2RS7A

Solution structure of the second dsrbd from rna helicase a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase A
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 26
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs7A01
2RS6A 3C4BA 1T4NA 4LF9E 4AQYE 4OX9E 4B3SE 2NUEA 2UUBE 4DR1E 4JYAE 4LF8E 2UUAE 2DMYA 1X48A 4LF7E 3ADLA 1EKZA 1IBLE 2MDRA 1J26A 1N36E 2VQEE 2LTRA 2RTXA 1FKAE 1YZ9A 5IWAE 4KHPE 4DV3E 4JI3E 4LFAE 4X62E 3VYYA 4LFBE 2UU9E 2UXDE 1I94E 4DV4E 4M30A 4X8WA 3ADJA 4DV6E 1IBKE 4JI8E 4LF4E 4X64E 4B3RE 4DV7E 2N3HA 2L33A 1RQ0A 1STUA 2RSMA 1T4OA 4DR7E 4OOGC 4B3ME 2CPNA 4JI0E 1HNXE 4WFTA 2NUGA 3ADIA 2VQFE 2KHXA 1N33E 4YHHE 2B7TA 1GQEA 4GKJE 2N3GA 1XNRE 2E5LE 4B3TE 1QU6A 3ADGA 2HHHE 1UILA 2LUPB 4DR6E 2NA2A 3VYXA 4DR4E 4DUZE 4DV0E 2LBSB 2EZ6A 2JVAA 4LF5E 5LMUE 1XMQE 1PKPA 1IBME 4X65E 4JI2E 2LJHA 2L2NA 2NUFA 3C4TA 2LRSA 1WHQA 4K0KE 2JY9A 2YT4A 4JI4E 1XNQE 4GKKE 2IHR1 2LTSA 4DR3E 4NXME 4JI1E 2UUCE 5LMNE 2DB2A 4DKKA 4DV5E 1WHNA 4DR2E 3HTXA 1YYWA 1J5EE 2UXCE 1ZBTA 3T1HE 2RS7A 4DR5E 1HR0E 2B3TB 3LLHA 2ZM6E 4NXNE 3P1XA 1RC7A 2L2MA 2L3CA 2DIXA 4DV2E 2B7VA 1DI2A 1UHZA 1FJGE 2UXBE 2L3JA 1YYOA 4X66E 4WYQB 4JI6E 1T4LB 4LF6E 3OTOE 1YYKA 2F4VE 1HNWE 2LUQA 4JI7E 4DV1E 1N32E 3T1YE 4JI5E 4M2ZA 1X47A 1O0WA 1X49A 4YY3E 3J7Yp 1N34E 5CFFE 1HNZE 5BR8E 4DUYE 4LFCE 4JV5E 2L2KB 1XMOE
chains in the Genus database with same CATH superfamily
5AE2A 4AQYE 2NUEA 3J80C 3TQMA 4IS1C 2BBGA 2UUAE 4LF7E 2MC5A 1B69A 4BHBA 2KOUA 4MLQA 2LTRA 1FKAE 4L8NA 2EPXA 4RH8A 2GHFA 2UXDE 1A1JA 4DV4E 4X8WA 3VHTB 4R03A 2EMKA 2EOOA 4X64E 2YRHA 4B3RE 5KL2A 2N3HA 2YTJA 2EMFA 3QG5C 2EOIA 2LMZA 2DRPA 1Z1BA 2V88A 2EE8A 1T39A 2WZOA 2YTGA 2EM4A 2EMIA 3LMLA 2EOQA 1PJQA 2FTXB 2EORA 1GQEA 4B3TE 2MKNA 2EN2A 5ADZA 1MGTA 4BMJA 3RMPA 4DR4E 4DV0E 2LBSB 5A6KA 4LF5E 3IWBA 3BIDA 5FLXC 2EPPA 2GPIA 2ENAA 3FIGA 1G2DC 3UK3C 2LTSA 2EQ0A 3KZZA 2EPKX 4I8OA 2N8XA 1YFHA 4Q35B 2LO3A 3HTXA 2V83A 4F54A 4R2CA 5DNYA 4R8OA 2JWOA 5A69A 2EOMA 3JU0A 3C6MA 2RS7A 2EMXA 2K4VA 2EM8A 2YRMA 3BGHA 2EMBA 2ZM6E 1G2FC 3P1XA 1TF6A 1IQOA 2L2MA 2L3CA 1A1KA 1UHZA 2JP9A 2EN3A 2L3JA 1YYOA 5LL6R 4X66E 4BCAA 2F4VE 1PDAA 1HNWE 4JI7E 3M99B 3BF2A 3K6QA 3T1YE 2LVHA 1X49A 2F8BA 1HNZE 1DQ3A 3H09A 3JTZA 3HPSA 2YRKA 3ZOQB 4LF9E 4OX9E 3F6GA 2UUBE 1T38A 3J7AG 1A1HA 4JYAE 4BC7A 4LF8E 2BB8A 1L4SA 1X48A 3ADLA 2MDRA 2GLIA 1N36E 2RTXA 2E1MA 2EQ1A 3BBGA 1JK1A 2EWLA 5IWAE 4KHPE 2EOJA 4X62E 3VYYA 1SFEA 2V85A 3MSWA 4IJDA 4NZVA 2UU9E 3ADJA 4DV6E 1IBKE 4JI8E 4DV7E 2L92A 2D9HA 3DF6A 1YUJA 3VK6A 1X5WA 4DR7E 2YTOA 1EH6A 4MLVA 2EM7A 2EPRA 4BBYA 4OOGC 4B3ME 1LLMC 1HNXE 4R2DA 2ENHA 2VQFE 4R2RA 2KHXA 2EMHA 4YHHE 2B7TA 2EPLX 1QU6A 2LCEA 2HHHE 2VF1A 1UILA 2DGCA 4O43A 4KWYA 1X6HA 2EN1A 4X9JA 5KL7A 3EQ1A 4F2JC 2EL4A 2JVAA 2YU8A 1BBOA 4R2SA 1PKPA 2EMCA 2L2NA 1N3GA 2LRSA 5KL4A 1WHQA 4K0KE 2JY9A 2IHR1 3AUZA 2WBUA 2WCC3 4BC9A 4NHRA 5LMNE 2EM2A 3JAMC 4DV5E 2EM3A 4DR2E 2EOFA 1AH5A 1UN6B 2YZTA 1J5EE 2EM5A 1ZBTA 4KZSA 3T1HE 5AE1A 3IWCA 1NEIA 1HR0E 3LLHA 1MEYC 2EOHA 4NXNE 2B7VA 1EH8A 2H36X 3L00A 2EPUA 1PJSA 1YUIA 2I13A 1A1GA 1IQSA 5A6BD 4WYQB 3EPJA 1WJPA 2V86A 5KL3A 2EM6A 1YYKA 3KWRA 5KL6A 4O24A 2EOXA 2EMWA 2ENCA 5AC4A 2V87A 1X6EA 5A6AA 3J7Yp 2EM0A 5CFFE 2L2KB 2ODRD 2YWQA 2RS6A 4BS9A 4F6NA 1ZR9A 3EPLA 2CT1A 2EPOA 4P78A 2JXPA 5A6BA 4LTYA 2LV2A 4J8ZA 2DMYA 1YSAC 1IBLE 1J26A 1A1LA 2J7JA 4HTGA 2VQEE 2JR1A 4F9CB 2EM9A 1YZ9A 2RSIA 4M0VA 4LFAE 2EJ4A 4O4KA 1ZU1A 2EL5A 2EQ3A 3EPHA 1BBGA 1EH7A 1I94E 4M30A 1F2IG 5LLQA 5AC5A 3MHSC 4F9AB 1WRJA 3HPZA 3HXLA 4M9VC 2LJUA 4ZYGA 2L33A 3HQ1A 2RSMA 1T4OA 2EPAA 2ELYA 2EOEA 1IMUA 2EMYA 1SR9A 2CPNA 5T6JA 2HC5A 4JI0E 2VE7C 2M7QA 3ADIA 4GKJE 2N3GA 2YPNA 2E5LE 2CSHA 2MDGA 4GEQB 3ECRA 2EMGA 2JPAA 4DR6E 1RMDA 2WBSA 2EMAA 5A6JA 5A2QC 1TN9A 5LMUE 1X3CA 4JI2E 2NUFA 3C4TA 2VRDA 2HJJA 4JI1E 4WX9A 2DMIA 2E72A 2DB2A 4DKKA 1WHNA 1YYWA 2UXCE 5IXMB 2EOZA 2EPMX 3C6KA 1QNTA 4P7DA 2DIXA 4DV2E 2EOYA 1FJGE 3KZYA 2JYAA 2B9DA 2R1FA 2DSYA 2EPZA 2YTFA 2EN8A 1T4LB 4WSGA 4LF6E 4TUGA 2LUQA 2M4IA 4Q28A 2JOBA 2MC6A 5IV8B 4DV1E 3DJWA 5TSEA 2YU5A 2YSPA 4DUYE 4DMIA 2LE2A 4JV5E 3MHHC 2EMZA 3C4BA 3OMLA 1T4NA 4R2EA 2M9AA 4B3SE 1ZBQA 4DR1E 2A25A 2YTPA 1A1FA 1DGCA 2FGGA 3J81C 2FV4B 1EKZA 5KL5A 2EL6A 1YPNA 1GZ6A 4DV3E 4JI3E 2YTEA 4GZNC 1JK2A 1WXRA 2PRTA 2DLKA 2EPCA 4LFBE 2KONA 5IT9C 2ELZA 4ZYDA 3IWDA 2G7HA 4LF4E 2EN6A 1GTKA 4BHCA 2K7IA 3THOB 1PJTA 4FK5C 4TUIA 1ZAAC 1RQ0A 1STUA 1A1IA 4WFTA 2NUGA 4HEIA 1N33E 2RPCA 2R76A 3AV0A 1XNRE 4R2AA 2RQLA 2YTNA 3ADGA 4LU9A 4N4RB 2LUPB 1P47A 2Q8UA 2YTDA 4WSPA 1TF3A 2NA2A 3VYXA 1KYQA 4DUZE 2V89A 2YSOA 2EZ6A 4WXDA 1XMQE 2M1SA 1IBME 2EN4A 4X65E 2EN7A 2LJHA 4R2PA 1X6FA 2YT4A 4JI4E 2I9IA 2L6MA 1XNQE 5AE3A 4GKKE 4O5GA 2ADRA 3EPKA 4DR3E 1AAYA 4NXME 2UUCE 2V8QB 4ZYEA 1KJKA 2EP3A 4RHBB 3THNA 2CTDA 2L8TA 2ODRC 2YTQA 2YTIA 2MKDA 4DR5E 1UBDC 1NCSA 5F3WA 2NABA 2B3TB 1RC7A 2JOXA 4R2QA 1DI2A 2LT7A 2UXBE 2WBTA 4L5NC 4JI6E 5AASA 2EMLA 3F6HA 3OTOE 4WXCA 2HGHA 2EPNA 1N32E 4JI5E 4WPYA 4M2ZA 4F9BB 4F6MA 1BB8A 1O0WA 4YY3E 2DLQA 4ZYHA 1N34E 5BR8E 4LFCE 1X47A 1XMOE 2EOSA
chains in the Genus database with same CATH topology
3ZOQB 2RS6A 3C4BA 3OMLA 4BS9A 5AE2A 1T4NA 4LF9E 4AQYE 4OX9E 4B3SE 3F6GA 2NUEA 2UUBE 4P78A 3J80C 1ZBQA 4DR1E 3J7AG 4JYAE 4LTYA 4BC7A 2UUAE 4LF8E 4J8ZA 2FGGA 2DMYA 1X48A 2MC5A 3J81C 4LF7E 2FV4B 1IBLE 2MDRA 1EKZA 3ADLA 2KOUA 2VQEE 1N36E 2LTRA 2RTXA 1FKAE 2JR1A 2E1MA 4F9CB 4L8NA 1YZ9A 2EWLA 4M0VA 5IWAE 1GZ6A 4DV3E 4JI3E 4LFAE 4KHPE 4X62E 1N32E 3VYYA 1WXRA 2V85A 4LFBE 3MSWA 2UU9E 2UXDE 2KONA 5IT9C 1I94E 4DV4E 3IWDA 4M30A 4X8WA 3ADJA 2G7HA 4DV6E 1IBKE 4R03A 4JI8E 4LF4E 4F9AB 4X64E 4B3RE 3HPZA 3HXLA 2L92A 4DV7E 2N3HA 2L33A 3HQ1A 3DF6A 4TUIA 3VK6A 1RQ0A 1STUA 2RSMA 1T4OA 2LMZA 4DR7E 2V88A 2WZOA 4BBYA 4OOGC 4B3ME 1SR9A 2CPNA 5T6JA 4JI0E 3LMLA 1HNXE 2VE7C 4WFTA 2NUGA 2M7QA 3ADIA 2VQFE 2KHXA 2FTXB 4YHHE 1N33E 2B7TA 1GQEA 4GKJE 3AV0A 2N3GA 1XNRE 2E5LE 4B3TE 1QU6A 3ADGA 4LU9A 2HHHE 2VF1A 1UILA 2LUPB 1XMOE 4GEQB 5ADZA 4WSPA 4DR6E 2NA2A 3VYXA 4BMJA 3RMPA 4DR4E 4DUZE 5A2QC 4DV0E 2LBSB 2V89A 2EZ6A 2JVAA 4LF5E 5LMUE 1XMQE 3IWBA 1PKPA 2M1SA 1IBME 4X65E 4JI2E 2LJHA 2L2NA 2NUFA 3C4TA 2LRSA 5FLXC 1WHQA 4K0KE 2JY9A 2YT4A 4JI4E 2L6MA 1XNQE 5AE3A 3FIGA 4GKKE 2IHR1 2L2KB 2LTSA 3AUZA 4DMIA 4DR3E 4BC9A 4NXME 4I8OA 4JI1E 2UUCE 2V8QB 5LMNE 2DB2A 4DKKA 3JAMC 4DV5E 1WHNA 4DR2E 2V83A 4F54A 3HTXA 5DNYA 1YYWA 2ODRC 2L8TA 2YZTA 1J5EE 2UXCE 4R8OA 2JWOA 1ZBTA 3JU0A 4KZSA 3T1HE 5AE1A 2RS7A 4DR5E 2K4VA 3IWCA 5F3WA 1HR0E 2B3TB 3LLHA 2ZM6E 4P7DA 4NXNE 3P1XA 1RC7A 2JOXA 1J26A 2L2MA 2L3CA 2DIXA 4DV2E 2B7VA 1DI2A 1UHZA 2H36X 1FJGE 2UXBE 2L3JA 1YYOA 2B9DA 5LL6R 4X66E 2DSYA 4L5NC 4WYQB 4BCAA 4JI6E 5AASA 2V86A 3F6HA 1T4LB 4LF6E 3OTOE 1YYKA 3KWRA 4TUGA 2F4VE 1HNWE 2LUQA 2M4IA 4Q28A 2JOBA 2MC6A 3K6QA 4JI7E 4DV1E 4WPYA 3T1YE 4F9BB 4JI5E 3DJWA 1O0WA 2V87A 4M2ZA 1X49A 4YY3E 2F8BA 3J7Yp 1N34E 5CFFE 1HNZE 1DQ3A 3H09A 3JTZA 3HPSA 2LE2A 1X47A 5BR8E 4DUYE 4LFCE 2ODRD 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS6 A;  3C4B A;  1T4N A;  4LF9 E;  4AQY E;  4OX9 E;  4B3S E;  2NUE A;  2UUB E;  4DR1 E;  4JYA E;  4LF8 E;  2UUA E;  2DMY A;  1X48 A;  4LF7 E;  3ADL A;  1EKZ A;  1IBL E;  2MDR A;  1J26 A;  1N36 E;  2VQE E;  2LTR A;  2RTX A;  1FKA E;  1YZ9 A;  5IWA E;  4KHP E;  4DV3 E;  4JI3 E;  4LFA E;  4X62 E;  3VYY A;  4LFB E;  2UU9 E;  2UXD E;  1I94 E;  4DV4 E;  4M30 A;  4X8W A;  3ADJ A;  4DV6 E;  1IBK E;  4JI8 E;  4LF4 E;  4X64 E;  4B3R E;  4DV7 E;  2N3H A;  2L33 A;  1RQ0 A;  1STU A;  2RSM A;  1T4O A;  4DR7 E;  4OOG C;  4B3M E;  2CPN A;  4JI0 E;  1HNX E;  4WFT A;  2NUG A;  3ADI A;  2VQF E;  2KHX A;  1N33 E;  4YHH E;  2B7T A;  1GQE A;  4GKJ E;  2N3G A;  1XNR E;  2E5L E;  4B3T E;  1QU6 A;  3ADG A;  2HHH E;  1UIL A;  2LUP B;  4DR6 E;  2NA2 A;  3VYX A;  4DR4 E;  4DUZ E;  4DV0 E;  2LBS B;  2EZ6 A;  2JVA A;  4LF5 E;  5LMU E;  1XMQ E;  1PKP A;  1IBM E;  4X65 E;  4JI2 E;  2LJH A;  2L2N A;  2NUF A;  3C4T A;  2LRS A;  1WHQ A;  4K0K E;  2JY9 A;  2YT4 A;  4JI4 E;  1XNQ E;  4GKK E;  2IHR 1;  2LTS A;  4DR3 E;  4NXM E;  4JI1 E;  2UUC E;  5LMN E;  2DB2 A;  4DKK A;  4DV5 E;  1WHN A;  4DR2 E;  3HTX A;  1YYW A;  1J5E E;  2UXC E;  1ZBT A;  3T1H E;  2RS7 A;  4DR5 E;  1HR0 E;  2B3T B;  3LLH A;  2ZM6 E;  4NXN E;  3P1X A;  1RC7 A;  2L2M A;  2L3C A;  2DIX A;  4DV2 E;  2B7V A;  1DI2 A;  1UHZ A;  1FJG E;  2UXB E;  2L3J A;  1YYO A;  4X66 E;  4WYQ B;  4JI6 E;  1T4L B;  4LF6 E;  3OTO E;  1YYK A;  2F4V E;  1HNW E;  2LUQ A;  4JI7 E;  4DV1 E;  1N32 E;  3T1Y E;  4JI5 E;  4M2Z A;  1X47 A;  1O0W A;  1X49 A;  4YY3 E;  3J7Y p;  1N34 E;  5CFF E;  1HNZ E;  5BR8 E;  4DUY E;  4LFC E;  4JV5 E;  2L2K B;  1XMO E; 
#chains in the Genus database with same CATH topology
 5AE2 A;  4AQY E;  2NUE A;  3J80 C;  3TQM A;  4IS1 C;  2BBG A;  2UUA E;  4LF7 E;  2MC5 A;  1B69 A;  4BHB A;  2KOU A;  4MLQ A;  2LTR A;  1FKA E;  4L8N A;  2EPX A;  4RH8 A;  2GHF A;  2UXD E;  1A1J A;  4DV4 E;  4X8W A;  3VHT B;  4R03 A;  2EMK A;  2EOO A;  4X64 E;  2YRH A;  4B3R E;  5KL2 A;  2N3H A;  2YTJ A;  2EMF A;  3QG5 C;  2EOI A;  2LMZ A;  2DRP A;  1Z1B A;  2V88 A;  2EE8 A;  1T39 A;  2WZO A;  2YTG A;  2EM4 A;  2EMI A;  3LML A;  2EOQ A;  1PJQ A;  2FTX B;  2EOR A;  1GQE A;  4B3T E;  2MKN A;  2EN2 A;  5ADZ A;  1MGT A;  4BMJ A;  3RMP A;  4DR4 E;  4DV0 E;  2LBS B;  5A6K A;  4LF5 E;  3IWB A;  3BID A;  5FLX C;  2EPP A;  2GPI A;  2ENA A;  3FIG A;  1G2D C;  3UK3 C;  2LTS A;  2EQ0 A;  3KZZ A;  2EPK X;  4I8O A;  2N8X A;  1YFH A;  4Q35 B;  2LO3 A;  3HTX A;  2V83 A;  4F54 A;  4R2C A;  5DNY A;  4R8O A;  2JWO A;  5A69 A;  2EOM A;  3JU0 A;  3C6M A;  2RS7 A;  2EMX A;  2K4V A;  2EM8 A;  2YRM A;  3BGH A;  2EMB A;  2ZM6 E;  1G2F C;  3P1X A;  1TF6 A;  1IQO A;  2L2M A;  2L3C A;  1A1K A;  1UHZ A;  2JP9 A;  2EN3 A;  2L3J A;  1YYO A;  5LL6 R;  4X66 E;  4BCA A;  2F4V E;  1PDA A;  1HNW E;  4JI7 E;  3M99 B;  3BF2 A;  3K6Q A;  3T1Y E;  2LVH A;  1X49 A;  2F8B A;  1HNZ E;  1DQ3 A;  3H09 A;  3JTZ A;  3HPS A;  2YRK A;  3ZOQ B;  4LF9 E;  4OX9 E;  3F6G A;  2UUB E;  1T38 A;  3J7A G;  1A1H A;  4JYA E;  4BC7 A;  4LF8 E;  2BB8 A;  1L4S A;  1X48 A;  3ADL A;  2MDR A;  2GLI A;  1N36 E;  2RTX A;  2E1M A;  2EQ1 A;  3BBG A;  1JK1 A;  2EWL A;  5IWA E;  4KHP E;  2EOJ A;  4X62 E;  3VYY A;  1SFE A;  2V85 A;  3MSW A;  4IJD A;  4NZV A;  2UU9 E;  3ADJ A;  4DV6 E;  1IBK E;  4JI8 E;  4DV7 E;  2L92 A;  2D9H A;  3DF6 A;  1YUJ A;  3VK6 A;  1X5W A;  4DR7 E;  2YTO A;  1EH6 A;  4MLV A;  2EM7 A;  2EPR A;  4BBY A;  4OOG C;  4B3M E;  1LLM C;  1HNX E;  4R2D A;  2ENH A;  2VQF E;  4R2R A;  2KHX A;  2EMH A;  4YHH E;  2B7T A;  2EPL X;  1QU6 A;  2LCE A;  2HHH E;  2VF1 A;  1UIL A;  2DGC A;  4O43 A;  4KWY A;  1X6H A;  2EN1 A;  4X9J A;  5KL7 A;  3EQ1 A;  4F2J C;  2EL4 A;  2JVA A;  2YU8 A;  1BBO A;  4R2S A;  1PKP A;  2EMC A;  2L2N A;  1N3G A;  2LRS A;  5KL4 A;  1WHQ A;  4K0K E;  2JY9 A;  2IHR 1;  3AUZ A;  2WBU A;  2WCC 3;  4BC9 A;  4NHR A;  5LMN E;  2EM2 A;  3JAM C;  4DV5 E;  2EM3 A;  4DR2 E;  2EOF A;  1AH5 A;  1UN6 B;  2YZT A;  1J5E E;  2EM5 A;  1ZBT A;  4KZS A;  3T1H E;  5AE1 A;  3IWC A;  1NEI A;  1HR0 E;  3LLH A;  1MEY C;  2EOH A;  4NXN E;  2B7V A;  1EH8 A;  2H36 X;  3L00 A;  2EPU A;  1PJS A;  1YUI A;  2I13 A;  1A1G A;  1IQS A;  5A6B D;  4WYQ B;  3EPJ A;  1WJP A;  2V86 A;  5KL3 A;  2EM6 A;  1YYK A;  3KWR A;  5KL6 A;  4O24 A;  2EOX A;  2EMW A;  2ENC A;  5AC4 A;  2V87 A;  1X6E A;  5A6A A;  3J7Y p;  2EM0 A;  5CFF E;  2L2K B;  2ODR D;  2YWQ A;  2RS6 A;  4BS9 A;  4F6N A;  1ZR9 A;  3EPL A;  2CT1 A;  2EPO A;  4P78 A;  2JXP A;  5A6B A;  4LTY A;  2LV2 A;  4J8Z A;  2DMY A;  1YSA C;  1IBL E;  1J26 A;  1A1L A;  2J7J A;  4HTG A;  2VQE E;  2JR1 A;  4F9C B;  2EM9 A;  1YZ9 A;  2RSI A;  4M0V A;  4LFA E;  2EJ4 A;  4O4K A;  1ZU1 A;  2EL5 A;  2EQ3 A;  3EPH A;  1BBG A;  1EH7 A;  1I94 E;  4M30 A;  1F2I G;  5LLQ A;  5AC5 A;  3MHS C;  4F9A B;  1WRJ A;  3HPZ A;  3HXL A;  4M9V C;  2LJU A;  4ZYG A;  2L33 A;  3HQ1 A;  2RSM A;  1T4O A;  2EPA A;  2ELY A;  2EOE A;  1IMU A;  2EMY A;  1SR9 A;  2CPN A;  5T6J A;  2HC5 A;  4JI0 E;  2VE7 C;  2M7Q A;  3ADI A;  4GKJ E;  2N3G A;  2YPN A;  2E5L E;  2CSH A;  2MDG A;  4GEQ B;  3ECR A;  2EMG A;  2JPA A;  4DR6 E;  1RMD A;  2WBS A;  2EMA A;  5A6J A;  5A2Q C;  1TN9 A;  5LMU E;  1X3C A;  4JI2 E;  2NUF A;  3C4T A;  2VRD A;  2HJJ A;  4JI1 E;  4WX9 A;  2DMI A;  2E72 A;  2DB2 A;  4DKK A;  1WHN A;  1YYW A;  2UXC E;  5IXM B;  2EOZ A;  2EPM X;  3C6K A;  1QNT A;  4P7D A;  2DIX A;  4DV2 E;  2EOY A;  1FJG E;  3KZY A;  2JYA A;  2B9D A;  2R1F A;  2DSY A;  2EPZ A;  2YTF A;  2EN8 A;  1T4L B;  4WSG A;  4LF6 E;  4TUG A;  2LUQ A;  2M4I A;  4Q28 A;  2JOB A;  2MC6 A;  5IV8 B;  4DV1 E;  3DJW A;  5TSE A;  2YU5 A;  2YSP A;  4DUY E;  4DMI A;  2LE2 A;  4JV5 E;  3MHH C;  2EMZ A;  3C4B A;  3OML A;  1T4N A;  4R2E A;  2M9A A;  4B3S E;  1ZBQ A;  4DR1 E;  2A25 A;  2YTP A;  1A1F A;  1DGC A;  2FGG A;  3J81 C;  2FV4 B;  1EKZ A;  5KL5 A;  2EL6 A;  1YPN A;  1GZ6 A;  4DV3 E;  4JI3 E;  2YTE A;  4GZN C;  1JK2 A;  1WXR A;  2PRT A;  2DLK A;  2EPC A;  4LFB E;  2KON A;  5IT9 C;  2ELZ A;  4ZYD A;  3IWD A;  2G7H A;  4LF4 E;  2EN6 A;  1GTK A;  4BHC A;  2K7I A;  3THO B;  1PJT A;  4FK5 C;  4TUI A;  1ZAA C;  1RQ0 A;  1STU A;  1A1I A;  4WFT A;  2NUG A;  4HEI A;  1N33 E;  2RPC A;  2R76 A;  3AV0 A;  1XNR E;  4R2A A;  2RQL A;  2YTN A;  3ADG A;  4LU9 A;  4N4R B;  2LUP B;  1P47 A;  2Q8U A;  2YTD A;  4WSP A;  1TF3 A;  2NA2 A;  3VYX A;  1KYQ A;  4DUZ E;  2V89 A;  2YSO A;  2EZ6 A;  4WXD A;  1XMQ E;  2M1S A;  1IBM E;  2EN4 A;  4X65 E;  2EN7 A;  2LJH A;  4R2P A;  1X6F A;  2YT4 A;  4JI4 E;  2I9I A;  2L6M A;  1XNQ E;  5AE3 A;  4GKK E;  4O5G A;  2ADR A;  3EPK A;  4DR3 E;  1AAY A;  4NXM E;  2UUC E;  2V8Q B;  4ZYE A;  1KJK A;  2EP3 A;  4RHB B;  3THN A;  2CTD A;  2L8T A;  2ODR C;  2YTQ A;  2YTI A;  2MKD A;  4DR5 E;  1UBD C;  1NCS A;  5F3W A;  2NAB A;  2B3T B;  1RC7 A;  2JOX A;  4R2Q A;  1DI2 A;  2LT7 A;  2UXB E;  2WBT A;  4L5N C;  4JI6 E;  5AAS A;  2EML A;  3F6H A;  3OTO E;  4WXC A;  2HGH A;  2EPN A;  1N32 E;  4JI5 E;  4WPY A;  4M2Z A;  4F9B B;  4F6M A;  1BB8 A;  1O0W A;  4YY3 E;  2DLQ A;  4ZYH A;  1N34 E;  5BR8 E;  4LFC E;  1X47 A;  1XMO E;  2EOS A; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  2RS6 A;  3C4B A;  3OML A;  4BS9 A;  5AE2 A;  1T4N A;  4LF9 E;  4AQY E;  4OX9 E;  4B3S E;  3F6G A;  2NUE A;  2UUB E;  4P78 A;  3J80 C;  1ZBQ A;  4DR1 E;  3J7A G;  4JYA E;  4LTY A;  4BC7 A;  2UUA E;  4LF8 E;  4J8Z A;  2FGG A;  2DMY A;  1X48 A;  2MC5 A;  3J81 C;  4LF7 E;  2FV4 B;  1IBL E;  2MDR A;  1EKZ A;  3ADL A;  2KOU A;  2VQE E;  1N36 E;  2LTR A;  2RTX A;  1FKA E;  2JR1 A;  2E1M A;  4F9C B;  4L8N A;  1YZ9 A;  2EWL A;  4M0V A;  5IWA E;  1GZ6 A;  4DV3 E;  4JI3 E;  4LFA E;  4KHP E;  4X62 E;  1N32 E;  3VYY A;  1WXR A;  2V85 A;  4LFB E;  3MSW A;  2UU9 E;  2UXD E;  2KON A;  5IT9 C;  1I94 E;  4DV4 E;  3IWD A;  4M30 A;  4X8W A;  3ADJ A;  2G7H A;  4DV6 E;  1IBK E;  4R03 A;  4JI8 E;  4LF4 E;  4F9A B;  4X64 E;  4B3R E;  3HPZ A;  3HXL A;  2L92 A;  4DV7 E;  2N3H A;  2L33 A;  3HQ1 A;  3DF6 A;  4TUI A;  3VK6 A;  1RQ0 A;  1STU A;  2RSM A;  1T4O A;  2LMZ A;  4DR7 E;  2V88 A;  2WZO A;  4BBY A;  4OOG C;  4B3M E;  1SR9 A;  2CPN A;  5T6J A;  4JI0 E;  3LML A;  1HNX E;  2VE7 C;  4WFT A;  2NUG A;  2M7Q A;  3ADI A;  2VQF E;  2KHX A;  2FTX B;  4YHH E;  1N33 E;  2B7T A;  1GQE A;  4GKJ E;  3AV0 A;  2N3G A;  1XNR E;  2E5L E;  4B3T E;  1QU6 A;  3ADG A;  4LU9 A;  2HHH E;  2VF1 A;  1UIL A;  2LUP B;  1XMO E;  4GEQ B;  5ADZ A;  4WSP A;  4DR6 E;  2NA2 A;  3VYX A;  4BMJ A;  3RMP A;  4DR4 E;  4DUZ E;  5A2Q C;  4DV0 E;  2LBS B;  2V89 A;  2EZ6 A;  2JVA A;  4LF5 E;  5LMU E;  1XMQ E;  3IWB A;  1PKP A;  2M1S A;  1IBM E;  4X65 E;  4JI2 E;  2LJH A;  2L2N A;  2NUF A;  3C4T A;  2LRS A;  5FLX C;  1WHQ A;  4K0K E;  2JY9 A;  2YT4 A;  4JI4 E;  2L6M A;  1XNQ E;  5AE3 A;  3FIG A;  4GKK E;  2IHR 1;  2L2K B;  2LTS A;  3AUZ A;  4DMI A;  4DR3 E;  4BC9 A;  4NXM E;  4I8O A;  4JI1 E;  2UUC E;  2V8Q B;  5LMN E;  2DB2 A;  4DKK A;  3JAM C;  4DV5 E;  1WHN A;  4DR2 E;  2V83 A;  4F54 A;  3HTX A;  5DNY A;  1YYW A;  2ODR C;  2L8T A;  2YZT A;  1J5E E;  2UXC E;  4R8O A;  2JWO A;  1ZBT A;  3JU0 A;  4KZS A;  3T1H E;  5AE1 A;  2RS7 A;  4DR5 E;  2K4V A;  3IWC A;  5F3W A;  1HR0 E;  2B3T B;  3LLH A;  2ZM6 E;  4P7D A;  4NXN E;  3P1X A;  1RC7 A;  2JOX A;  1J26 A;  2L2M A;  2L3C A;  2DIX A;  4DV2 E;  2B7V A;  1DI2 A;  1UHZ A;  2H36 X;  1FJG E;  2UXB E;  2L3J A;  1YYO A;  2B9D A;  5LL6 R;  4X66 E;  2DSY A;  4L5N C;  4WYQ B;  4BCA A;  4JI6 E;  5AAS A;  2V86 A;  3F6H A;  1T4L B;  4LF6 E;  3OTO E;  1YYK A;  3KWR A;  4TUG A;  2F4V E;  1HNW E;  2LUQ A;  2M4I A;  4Q28 A;  2JOB A;  2MC6 A;  3K6Q A;  4JI7 E;  4DV1 E;  4WPY A;  3T1Y E;  4F9B B;  4JI5 E;  3DJW A;  1O0W A;  2V87 A;  4M2Z A;  1X49 A;  4YY3 E;  2F8B A;  3J7Y p;  1N34 E;  5CFF E;  1HNZ E;  1DQ3 A;  3H09 A;  3JTZ A;  3HPS A;  2LE2 A;  1X47 A;  5BR8 E;  4DUY E;  4LFC E;  2ODR D;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...