2RS7A

Solution structure of the second dsrbd from rna helicase a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase A
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 26
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs7A01
2B3TB 2L33A 4DKKA 1T4NA 4X65E 3OTOE 4DV0E 4NXNE 4X62E 4WFTA 2RTXA 2NUGA 2UXDE 2L3CA 2B7TA 4DUZE 1HR0E 4DR7E 3ADLA 3VYYA 4B3ME 4LF8E 1DI2A 2IHR1 1XMQE 2KHXA 4JI3E 2UXCE 2UUBE 4JI5E 4LF4E 3C4BA 4JI7E 4LFBE 1X48A 2HHHE 4X66E 3LLHA 5LMUE 1ZBTA 1O0WA 4DR2E 1XMOE 4B3SE 2F4VE 3ADIA 3P1XA 5IWAE 4DV4E 4OOGC 4WYQB 4YHHE 1N34E 3J7Yp 2EZ6A 1X49A 3ADGA 4OX9E 4DR4E 2UUAE 4DV1E 1QU6A 2UUCE 4GKKE 2NA2A 1UILA 2VQEE 4DR3E 1GQEA 2MDRA 4DV6E 1XNQE 2JY9A 2LTSA 4DV2E 3T1HE 1I94E 3T1YE 4K0KE 2RS6A 5CFFE 4DV7E 4LF5E 4X64E 3ADJA 1RC7A 4DR5E 1X47A 4KHPE 4DV5E 3HTXA 1T4OA 2N3GA 4M30A 2RS7A 4B3TE 1YZ9A 4LF6E 2DIXA 4NXME 2ZM6E 2UXBE 4X8WA 1PKPA 1FKAE 1UHZA 1YYKA 1HNWE 2LBSB 4YY3E 2NUFA 4JI0E 2LJHA 2B7VA 4LF7E 4JV5E 2UU9E 1HNZE 2L2KB 1FJGE 1T4LB 2JVAA 1J5EE 4GKJE 1IBKE 4LFCE 1IBME 1WHQA 2VQFE 4LFAE 5LMNE 2L2MA 2LRSA 4DV3E 2CPNA 4DR6E 1N33E 4JYAE 2L2NA 4JI1E 2E5LE 2LUPB 4AQYE 4B3RE 4JI8E 2LTRA 2L3JA 5BR8E 3C4TA 4DR1E 1YYOA 1IBLE 2LUQA 1HNXE 2RSMA 4JI6E 4JI4E 1WHNA 2DB2A 1XNRE 4M2ZA 1STUA 2DMYA 1N32E 1J26A 2YT4A 4DUYE 2NUEA 1YYWA 4LF9E 1RQ0A 1N36E 1EKZA 4JI2E 3VYXA 2N3HA
chains in the Genus database with same CATH superfamily
2VE7C 2L33A 1T4NA 2YZTA 4DV0E 4NXNE 1B69A 1ZBQA 4X62E 1X5WA 2RTXA 2NUGA 4I8OA 3BGHA 2B7TA 5IV8B 2J7JA 5A6BD 2IHR1 5DNYA 2KHXA 2EPNA 3J7AG 2UUBE 2EPCA 1WJPA 2V8QB 4WPYA 4LF4E 1KJKA 1X48A 4X9JA 2EPUA 4DR2E 4B3SE 2HC5A 2EOXA 2GHFA 3ADIA 1PJTA 1GZ6A 1TF3A 4R2SA 2YTIA 4WYQB 4R8OA 1EH7A 2YRMA 4LTYA 4DR4E 2UUAE 4DV1E 1QU6A 2VF1A 2I13A 2NA2A 2EMLA 4F6MA 2JR1A 2MDRA 4DV6E 1RMDA 2EN6A 4WSGA 2LTSA 3T1HE 2EPZA 1MGTA 2EQ3A 1YSAC 4KHPE 2YTNA 1T4OA 2N3GA 3EPKA 4F2JC 2RS7A 2E1MA 2DIXA 2M1SA 4R2QA 1PKPA 2E72A 2MC5A 2JWOA 2RQLA 1QNTA 1F2IG 2B7VA 2F8BA 1HNZE 4GEQB 4BHBA 2L2KB 3JTZA 4GKJE 2LJUA 4F54A 2PRTA 2V88A 2CPNA 2LE2A 2ELZA 2LMZA 2EM3A 2EM5A 2EN4A 2L92A 4N4RB 4JI8E 5BR8E 4DR1E 2VRDA 3BIDA 4KWYA 2M9AA 4MLVA 1X3CA 2RSMA 4JI6E 2EMFA 2BBGA 4M2ZA 1N32E 1J26A 2YT4A 5A6AA 5TSEA 1EKZA 2MC6A 1A1GA 4JI2E 2EN2A 4ZYHA 5AE2A 2N8XA 2L3CA 3DF6A 2EOQA 3ADLA 1XMQE 2EOOA 3KZYA 1SR9A 2UXCE 2K7IA 2R76A 3C6MA 1BB8A 4JI5E 3C4BA 2LT7A 1TF6A 2ODRD 2EMIA 2ENAA 2HHHE 4MLQA 5LMUE 2CT1A 2EE8A 1O0WA 1YPNA 3JAMC 1XMOE 4R2RA 2DRPA 4IS1C 2F4VE 2EPMX 3P1XA 2EOIA 5IWAE 4OOGC 5AC5A 3J7Yp 4WSPA 4TUIA 2YTJA 4NZVA 3ADGA 1WRJA 3C6KA 1YUIA 2K4VA 2M4IA 4BMJA 3IWCA 4BBYA 1BBGA 3M99B 1UILA 3F6HA 4ZYEA 4ZYDA 5KL3A 2EMYA 2HGHA 1XNQE 2V85A 4R2PA 2JY9A 1G2FC 4DV2E 2EM8A 4R2EA 5CFFE 3HXLA 5ADZA 4X64E 3ZOQB 1X6HA 2KONA 4Q35B 2JOXA 1UN6B 4DV5E 2WBUA 1SFEA 3BBGA 4M30A 5LL6R 1YZ9A 4LF6E 2LV2A 5AE3A 4X8WA 4O4KA 4BC9A 2EPPA 1UHZA 2JXPA 1YYKA 2LBSB 2NUFA 5AE1A 3VK6A 2FV4B 1X6FA 4JV5E 2EP3A 2YWQA 2JVAA 1IBME 1WHQA 1JK1A 3EPJA 2VQFE 4LFAE 1IQSA 2L2MA 1DQ3A 2LRSA 1G2DC 4R2AA 4JYAE 2L2NA 3ECRA 4RH8A 1Z1BA 2E5LE 2EMAA 2LUPB 4AQYE 2EWLA 2YTPA 2EMGA 2EMKA 1T38A 3C4TA 2EMBA 4F9CB 2YRKA 1HNXE 1TN9A 2DB2A 3BF2A 1ZAAC 5KL6A 3MHSC 2KOUA 2EM6A 2EMWA 5A69A 2EM7A 2N3HA 2B3TB 2EPKX 4KZSA 2LCEA 4DMIA 3DJWA 4IJDA 2UXDE 4P7DA 1HR0E 4LF8E 1DI2A 2LVHA 3UK3C 3KWRA 1ZU1A 2ODRC 2YU5A 4HTGA 4LFBE 3VHTB 3KZZA 3QG5C 4X66E 2I9IA 3OMLA 4M9VC 3MSWA 4DV4E 2YTQA 4YHHE 2EL6A 2V89A 1UBDC 2ADRA 1X49A 2ELYA 2L8TA 2A25A 2WZOA 1LLMC 2JP9A 2MKNA 1YUJA 4F6NA 2EN8A 3IWDA 2EORA 3L00A 5KL2A 2VQEE 4R2DA 2YRHA 2ENHA 3K6QA 3HPZA 4O24A 5A6JA 4K0KE 1I94E 2EOMA 3T1YE 5KL5A 4LF5E 3RMPA 2EMXA 2GLIA 2LO3A 3F6GA 1RC7A 2JPAA 4DR5E 2EQ0A 1X47A 2EN7A 2YTOA 2V87A 2GPIA 2EN3A 4M0VA 4B3TE 3AUZA 2RSIA 4NXME 2ZM6E 2UXBE 2YTDA 3J81C 1FKAE 1YFHA 4WX9A 3FIGA 4JI0E 1FJGE 1T4LB 1J5EE 1GTKA 5A6BA 5AASA 1N3GA 2L6MA 2EMCA 2EOYA 2DLQA 2HJJA 4DR6E 2EOSA 2EOFA 1L4SA 2DGCA 2EMZA 5F3WA 4B3RE 1NEIA 2YTFA 4LU9A 4BCAA 2DSYA 5IXMB 2EMHA 2EL4A 4WXCA 2MDGA 1A1JA 1XNRE 1T39A 3THNA 2M7QA 3H09A 2YSOA 4BC7A 2H36X 5AC4A 2DMIA 2NUEA 3EPLA 1NCSA 2EOZA 5FLXC 4O5GA 4LF9E 1N36E 1A1IA 4Q28A 3VYXA 4DKKA 1A1HA 1KYQA 1A1KA 4X65E 3OTOE 1PJQA 2ENCA 1EH6A 4WFTA 2EPOA 3AV0A 4DUZE 4DR7E 3JU0A 3VYYA 3LMLA 4B3ME 1P47A 2B9DA 2NABA 4F9AB 4JI3E 2V86A 4JI7E 3LLHA 2Q8UA 1ZBTA 2BB8A 2DLKA 2EM2A 1A1FA 2JYAA 1AH5A 2YU8A 3THOB 1N34E 3HQ1A 2EZ6A 2WBSA 2YTGA 3J80C 4OX9E 1ZR9A 2JOBA 5KL7A 4BHCA 4TUGA 2UUCE 4HEIA 2EPAA 4GKKE 2EOEA 2EOJA 4WXDA 5KL4A 4DR3E 1GQEA 2MKDA 2EJ4A 3MHHC 1IQOA 2YPNA 2EPLX 2EQ1A 2YTEA 5LLQA 1PDAA 2RS6A 4DV7E 3ADJA 4L5NC 1DGCA 4O43A 2WCC3 3EPHA 1BBOA 2FTXB 1A1LA 3HTXA 4FK5C 2R1FA 5A6KA 2FGGA 3EQ1A 5IT9C 5A2QC 4R2CA 2CTDA 1HNWE 4YY3E 2LJHA 4LF7E 4J8ZA 3TQMA 2UU9E 2D9HA 4ZYGA 2WBTA 1IBKE 2RPCA 4LFCE 2EM0A 2EOHA 2EPRA 2EPXA 4RHBB 5LMNE 5T6JA 2V83A 4DV3E 4L8NA 1JK2A 2EL5A 1N33E 1EH8A 1X6EA 4JI1E 2EN1A 4F9BB 2G7HA 2LTRA 2L3JA 3HPSA 1YYOA 4BS9A 1IBLE 2EM9A 2LUQA 4P78A 1WXRA 2YSPA 3IWBA 4NHRA 4JI4E 1WHNA 1IMUA 2EM4A 1STUA 2DMYA 1MEYC 4DUYE 2CSHA 4R03A 1YYWA 1RQ0A 1AAYA 4GZNC 1PJSA
chains in the Genus database with same CATH topology
2B3TB 2VE7C 2L33A 4DKKA 1T4NA 2YZTA 4X65E 4KZSA 3OTOE 4DV0E 5AE2A 4NXNE 4DMIA 1ZBQA 4X62E 4WFTA 3DJWA 2RTXA 2NUGA 3AV0A 4I8OA 2L3CA 3DF6A 2UXDE 2B7TA 4DUZE 4P7DA 3JU0A 1HR0E 3ADLA 4DR7E 3VYYA 3LMLA 4B3ME 4LF8E 1DI2A 2B9DA 2IHR1 4JV5E 5DNYA 4F9AB 1XMQE 2KHXA 3KWRA 1SR9A 4JI3E 3J7AG 2UXCE 2ODRC 2UUBE 1YZ9A 4JI5E 2V86A 3C4BA 2V8QB 4WPYA 4JI7E 4LF4E 4LFBE 1X48A 2ODRD 2HHHE 4X66E 3LLHA 5LMUE 1HNWE 3OMLA 1ZBTA 1O0WA 4DR2E 3JAMC 1XMOE 4B3SE 2F4VE 4LF7E 3ADIA 3P1XA 3MSWA 1GZ6A 5IWAE 4DV4E 4OOGC 2NUFA 4WYQB 4YHHE 1N34E 4R8OA 2V89A 4WSPA 3J7Yp 3HQ1A 4TUIA 2EZ6A 1X49A 3ADGA 2L8TA 4JI0E 2WZOA 4LTYA 3J80C 4OX9E 4DR4E 2UUAE 4DV1E 1QU6A 2JOBA 2K4VA 2M4IA 2VF1A 3IWCA 4BMJA 4BBYA 4TUGA 2UUCE 4GKKE 2NA2A 3IWDA 1UILA 3F6HA 2VQEE 4DR3E 2JR1A 1GQEA 2MDRA 4DV6E 1XNQE 3K6QA 2V85A 2JY9A 3HPZA 2LTSA 4DV2E 3T1HE 1I94E 3T1YE 4K0KE 2RS6A 5CFFE 3HXLA 5ADZA 4DV7E 3RMPA 4LF5E 3F6GA 3ADJA 3ZOQB 4X64E 4DR5E 1RC7A 2KONA 4L5NC 1X47A 2JOXA 4KHPE 4DV5E 2V87A 2FTXB 3HTXA 1T4OA 2N3GA 4M30A 5LL6R 2RS7A 4M0VA 2E1MA 4B3TE 2FGGA 2DIXA 2M1SA 3AUZA 5AE3A 2ZM6E 5IT9C 4LF6E 4NXME 2UXBE 4X8WA 1PKPA 2MC5A 4BC9A 2JWOA 5A2QC 3J81C 1FKAE 1UHZA 1YYKA 3FIGA 2LBSB 4YY3E 5AE1A 3VK6A 2LJHA 2B7VA 2F8BA 2FV4B 4J8ZA 1HNZE 4GEQB 2L2KB 1T4LB 2UU9E 2JVAA 3JTZA 1J5EE 1IBKE 1FJGE 4LFCE 4GKJE 5AASA 1IBME 1WHQA 2L6MA 4F54A 2VQFE 4LFAE 5LMNE 2L2MA 1DQ3A 2LRSA 5T6JA 2V83A 2V88A 4DV3E 4L8NA 2CPNA 4DR6E 2LE2A 2LMZA 1N33E 4JYAE 2L2NA 4JI1E 2E5LE 2L92A 4F9BB 2G7HA 4JI8E 2LUPB 4AQYE 2LTRA 5F3WA 4B3RE 2EWLA 4LU9A 2L3JA 5BR8E 4BCAA 3C4TA 3HPSA 4DR1E 2DSYA 1YYOA 4BS9A 1IBLE 2LUQA 4P78A 1WXRA 4F9CB 3IWBA 1HNXE 2RSMA 4JI6E 4JI4E 1WHNA 2DB2A 1XNRE 4M2ZA 1STUA 2DMYA 2M7QA 1N32E 1J26A 3H09A 2YT4A 4BC7A 2H36X 4DUYE 2KOUA 4R03A 2NUEA 5FLXC 1YYWA 4LF9E 1RQ0A 1N36E 1EKZA 2MC6A 4JI2E 4Q28A 3VYXA 2N3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3T B;  2L33 A;  4DKK A;  1T4N A;  4X65 E;  3OTO E;  4DV0 E;  4NXN E;  4X62 E;  4WFT A;  2RTX A;  2NUG A;  2UXD E;  2L3C A;  2B7T A;  4DUZ E;  1HR0 E;  4DR7 E;  3ADL A;  3VYY A;  4B3M E;  4LF8 E;  1DI2 A;  2IHR 1;  1XMQ E;  2KHX A;  4JI3 E;  2UXC E;  2UUB E;  4JI5 E;  4LF4 E;  3C4B A;  4JI7 E;  4LFB E;  1X48 A;  2HHH E;  4X66 E;  3LLH A;  5LMU E;  1ZBT A;  1O0W A;  4DR2 E;  1XMO E;  4B3S E;  2F4V E;  3ADI A;  3P1X A;  5IWA E;  4DV4 E;  4OOG C;  4WYQ B;  4YHH E;  1N34 E;  3J7Y p;  2EZ6 A;  1X49 A;  3ADG A;  4OX9 E;  4DR4 E;  2UUA E;  4DV1 E;  1QU6 A;  2UUC E;  4GKK E;  2NA2 A;  1UIL A;  2VQE E;  4DR3 E;  1GQE A;  2MDR A;  4DV6 E;  1XNQ E;  2JY9 A;  2LTS A;  4DV2 E;  3T1H E;  1I94 E;  3T1Y E;  4K0K E;  2RS6 A;  5CFF E;  4DV7 E;  4LF5 E;  4X64 E;  3ADJ A;  1RC7 A;  4DR5 E;  1X47 A;  4KHP E;  4DV5 E;  3HTX A;  1T4O A;  2N3G A;  4M30 A;  2RS7 A;  4B3T E;  1YZ9 A;  4LF6 E;  2DIX A;  4NXM E;  2ZM6 E;  2UXB E;  4X8W A;  1PKP A;  1FKA E;  1UHZ A;  1YYK A;  1HNW E;  2LBS B;  4YY3 E;  2NUF A;  4JI0 E;  2LJH A;  2B7V A;  4LF7 E;  4JV5 E;  2UU9 E;  1HNZ E;  2L2K B;  1FJG E;  1T4L B;  2JVA A;  1J5E E;  4GKJ E;  1IBK E;  4LFC E;  1IBM E;  1WHQ A;  2VQF E;  4LFA E;  5LMN E;  2L2M A;  2LRS A;  4DV3 E;  2CPN A;  4DR6 E;  1N33 E;  4JYA E;  2L2N A;  4JI1 E;  2E5L E;  2LUP B;  4AQY E;  4B3R E;  4JI8 E;  2LTR A;  2L3J A;  5BR8 E;  3C4T A;  4DR1 E;  1YYO A;  1IBL E;  2LUQ A;  1HNX E;  2RSM A;  4JI6 E;  4JI4 E;  1WHN A;  2DB2 A;  1XNR E;  4M2Z A;  1STU A;  2DMY A;  1N32 E;  1J26 A;  2YT4 A;  4DUY E;  2NUE A;  1YYW A;  4LF9 E;  1RQ0 A;  1N36 E;  1EKZ A;  4JI2 E;  3VYX A;  2N3H A; 
#chains in the Genus database with same CATH topology
 2VE7 C;  2L33 A;  1T4N A;  2YZT A;  4DV0 E;  4NXN E;  1B69 A;  1ZBQ A;  4X62 E;  1X5W A;  2RTX A;  2NUG A;  4I8O A;  3BGH A;  2B7T A;  5IV8 B;  2J7J A;  5A6B D;  2IHR 1;  5DNY A;  2KHX A;  2EPN A;  3J7A G;  2UUB E;  2EPC A;  1WJP A;  2V8Q B;  4WPY A;  4LF4 E;  1KJK A;  1X48 A;  4X9J A;  2EPU A;  4DR2 E;  4B3S E;  2HC5 A;  2EOX A;  2GHF A;  3ADI A;  1PJT A;  1GZ6 A;  1TF3 A;  4R2S A;  2YTI A;  4WYQ B;  4R8O A;  1EH7 A;  2YRM A;  4LTY A;  4DR4 E;  2UUA E;  4DV1 E;  1QU6 A;  2VF1 A;  2I13 A;  2NA2 A;  2EML A;  4F6M A;  2JR1 A;  2MDR A;  4DV6 E;  1RMD A;  2EN6 A;  4WSG A;  2LTS A;  3T1H E;  2EPZ A;  1MGT A;  2EQ3 A;  1YSA C;  4KHP E;  2YTN A;  1T4O A;  2N3G A;  3EPK A;  4F2J C;  2RS7 A;  2E1M A;  2DIX A;  2M1S A;  4R2Q A;  1PKP A;  2E72 A;  2MC5 A;  2JWO A;  2RQL A;  1QNT A;  1F2I G;  2B7V A;  2F8B A;  1HNZ E;  4GEQ B;  4BHB A;  2L2K B;  3JTZ A;  4GKJ E;  2LJU A;  4F54 A;  2PRT A;  2V88 A;  2CPN A;  2LE2 A;  2ELZ A;  2LMZ A;  2EM3 A;  2EM5 A;  2EN4 A;  2L92 A;  4N4R B;  4JI8 E;  5BR8 E;  4DR1 E;  2VRD A;  3BID A;  4KWY A;  2M9A A;  4MLV A;  1X3C A;  2RSM A;  4JI6 E;  2EMF A;  2BBG A;  4M2Z A;  1N32 E;  1J26 A;  2YT4 A;  5A6A A;  5TSE A;  1EKZ A;  2MC6 A;  1A1G A;  4JI2 E;  2EN2 A;  4ZYH A;  5AE2 A;  2N8X A;  2L3C A;  3DF6 A;  2EOQ A;  3ADL A;  1XMQ E;  2EOO A;  3KZY A;  1SR9 A;  2UXC E;  2K7I A;  2R76 A;  3C6M A;  1BB8 A;  4JI5 E;  3C4B A;  2LT7 A;  1TF6 A;  2ODR D;  2EMI A;  2ENA A;  2HHH E;  4MLQ A;  5LMU E;  2CT1 A;  2EE8 A;  1O0W A;  1YPN A;  3JAM C;  1XMO E;  4R2R A;  2DRP A;  4IS1 C;  2F4V E;  2EPM X;  3P1X A;  2EOI A;  5IWA E;  4OOG C;  5AC5 A;  3J7Y p;  4WSP A;  4TUI A;  2YTJ A;  4NZV A;  3ADG A;  1WRJ A;  3C6K A;  1YUI A;  2K4V A;  2M4I A;  4BMJ A;  3IWC A;  4BBY A;  1BBG A;  3M99 B;  1UIL A;  3F6H A;  4ZYE A;  4ZYD A;  5KL3 A;  2EMY A;  2HGH A;  1XNQ E;  2V85 A;  4R2P A;  2JY9 A;  1G2F C;  4DV2 E;  2EM8 A;  4R2E A;  5CFF E;  3HXL A;  5ADZ A;  4X64 E;  3ZOQ B;  1X6H A;  2KON A;  4Q35 B;  2JOX A;  1UN6 B;  4DV5 E;  2WBU A;  1SFE A;  3BBG A;  4M30 A;  5LL6 R;  1YZ9 A;  4LF6 E;  2LV2 A;  5AE3 A;  4X8W A;  4O4K A;  4BC9 A;  2EPP A;  1UHZ A;  2JXP A;  1YYK A;  2LBS B;  2NUF A;  5AE1 A;  3VK6 A;  2FV4 B;  1X6F A;  4JV5 E;  2EP3 A;  2YWQ A;  2JVA A;  1IBM E;  1WHQ A;  1JK1 A;  3EPJ A;  2VQF E;  4LFA E;  1IQS A;  2L2M A;  1DQ3 A;  2LRS A;  1G2D C;  4R2A A;  4JYA E;  2L2N A;  3ECR A;  4RH8 A;  1Z1B A;  2E5L E;  2EMA A;  2LUP B;  4AQY E;  2EWL A;  2YTP A;  2EMG A;  2EMK A;  1T38 A;  3C4T A;  2EMB A;  4F9C B;  2YRK A;  1HNX E;  1TN9 A;  2DB2 A;  3BF2 A;  1ZAA C;  5KL6 A;  3MHS C;  2KOU A;  2EM6 A;  2EMW A;  5A69 A;  2EM7 A;  2N3H A;  2B3T B;  2EPK X;  4KZS A;  2LCE A;  4DMI A;  3DJW A;  4IJD A;  2UXD E;  4P7D A;  1HR0 E;  4LF8 E;  1DI2 A;  2LVH A;  3UK3 C;  3KWR A;  1ZU1 A;  2ODR C;  2YU5 A;  4HTG A;  4LFB E;  3VHT B;  3KZZ A;  3QG5 C;  4X66 E;  2I9I A;  3OML A;  4M9V C;  3MSW A;  4DV4 E;  2YTQ A;  4YHH E;  2EL6 A;  2V89 A;  1UBD C;  2ADR A;  1X49 A;  2ELY A;  2L8T A;  2A25 A;  2WZO A;  1LLM C;  2JP9 A;  2MKN A;  1YUJ A;  4F6N A;  2EN8 A;  3IWD A;  2EOR A;  3L00 A;  5KL2 A;  2VQE E;  4R2D A;  2YRH A;  2ENH A;  3K6Q A;  3HPZ A;  4O24 A;  5A6J A;  4K0K E;  1I94 E;  2EOM A;  3T1Y E;  5KL5 A;  4LF5 E;  3RMP A;  2EMX A;  2GLI A;  2LO3 A;  3F6G A;  1RC7 A;  2JPA A;  4DR5 E;  2EQ0 A;  1X47 A;  2EN7 A;  2YTO A;  2V87 A;  2GPI A;  2EN3 A;  4M0V A;  4B3T E;  3AUZ A;  2RSI A;  4NXM E;  2ZM6 E;  2UXB E;  2YTD A;  3J81 C;  1FKA E;  1YFH A;  4WX9 A;  3FIG A;  4JI0 E;  1FJG E;  1T4L B;  1J5E E;  1GTK A;  5A6B A;  5AAS A;  1N3G A;  2L6M A;  2EMC A;  2EOY A;  2DLQ A;  2HJJ A;  4DR6 E;  2EOS A;  2EOF A;  1L4S A;  2DGC A;  2EMZ A;  5F3W A;  4B3R E;  1NEI A;  2YTF A;  4LU9 A;  4BCA A;  2DSY A;  5IXM B;  2EMH A;  2EL4 A;  4WXC A;  2MDG A;  1A1J A;  1XNR E;  1T39 A;  3THN A;  2M7Q A;  3H09 A;  2YSO A;  4BC7 A;  2H36 X;  5AC4 A;  2DMI A;  2NUE A;  3EPL A;  1NCS A;  2EOZ A;  5FLX C;  4O5G A;  4LF9 E;  1N36 E;  1A1I A;  4Q28 A;  3VYX A;  4DKK A;  1A1H A;  1KYQ A;  1A1K A;  4X65 E;  3OTO E;  1PJQ A;  2ENC A;  1EH6 A;  4WFT A;  2EPO A;  3AV0 A;  4DUZ E;  4DR7 E;  3JU0 A;  3VYY A;  3LML A;  4B3M E;  1P47 A;  2B9D A;  2NAB A;  4F9A B;  4JI3 E;  2V86 A;  4JI7 E;  3LLH A;  2Q8U A;  1ZBT A;  2BB8 A;  2DLK A;  2EM2 A;  1A1F A;  2JYA A;  1AH5 A;  2YU8 A;  3THO B;  1N34 E;  3HQ1 A;  2EZ6 A;  2WBS A;  2YTG A;  3J80 C;  4OX9 E;  1ZR9 A;  2JOB A;  5KL7 A;  4BHC A;  4TUG A;  2UUC E;  4HEI A;  2EPA A;  4GKK E;  2EOE A;  2EOJ A;  4WXD A;  5KL4 A;  4DR3 E;  1GQE A;  2MKD A;  2EJ4 A;  3MHH C;  1IQO A;  2YPN A;  2EPL X;  2EQ1 A;  2YTE A;  5LLQ A;  1PDA A;  2RS6 A;  4DV7 E;  3ADJ A;  4L5N C;  1DGC A;  4O43 A;  2WCC 3;  3EPH A;  1BBO A;  2FTX B;  1A1L A;  3HTX A;  4FK5 C;  2R1F A;  5A6K A;  2FGG A;  3EQ1 A;  5IT9 C;  5A2Q C;  4R2C A;  2CTD A;  1HNW E;  4YY3 E;  2LJH A;  4LF7 E;  4J8Z A;  3TQM A;  2UU9 E;  2D9H A;  4ZYG A;  2WBT A;  1IBK E;  2RPC A;  4LFC E;  2EM0 A;  2EOH A;  2EPR A;  2EPX A;  4RHB B;  5LMN E;  5T6J A;  2V83 A;  4DV3 E;  4L8N A;  1JK2 A;  2EL5 A;  1N33 E;  1EH8 A;  1X6E A;  4JI1 E;  2EN1 A;  4F9B B;  2G7H A;  2LTR A;  2L3J A;  3HPS A;  1YYO A;  4BS9 A;  1IBL E;  2EM9 A;  2LUQ A;  4P78 A;  1WXR A;  2YSP A;  3IWB A;  4NHR A;  4JI4 E;  1WHN A;  1IMU A;  2EM4 A;  1STU A;  2DMY A;  1MEY C;  4DUY E;  2CSH A;  4R03 A;  1YYW A;  1RQ0 A;  1AAY A;  4GZN C;  1PJS A; 
#chains in the Genus database with same CATH homology
 2B3T B;  2VE7 C;  2L33 A;  4DKK A;  1T4N A;  2YZT A;  4X65 E;  4KZS A;  3OTO E;  4DV0 E;  5AE2 A;  4NXN E;  4DMI A;  1ZBQ A;  4X62 E;  4WFT A;  3DJW A;  2RTX A;  2NUG A;  3AV0 A;  4I8O A;  2L3C A;  3DF6 A;  2UXD E;  2B7T A;  4DUZ E;  4P7D A;  3JU0 A;  1HR0 E;  3ADL A;  4DR7 E;  3VYY A;  3LML A;  4B3M E;  4LF8 E;  1DI2 A;  2B9D A;  2IHR 1;  4JV5 E;  5DNY A;  4F9A B;  1XMQ E;  2KHX A;  3KWR A;  1SR9 A;  4JI3 E;  3J7A G;  2UXC E;  2ODR C;  2UUB E;  1YZ9 A;  4JI5 E;  2V86 A;  3C4B A;  2V8Q B;  4WPY A;  4JI7 E;  4LF4 E;  4LFB E;  1X48 A;  2ODR D;  2HHH E;  4X66 E;  3LLH A;  5LMU E;  1HNW E;  3OML A;  1ZBT A;  1O0W A;  4DR2 E;  3JAM C;  1XMO E;  4B3S E;  2F4V E;  4LF7 E;  3ADI A;  3P1X A;  3MSW A;  1GZ6 A;  5IWA E;  4DV4 E;  4OOG C;  2NUF A;  4WYQ B;  4YHH E;  1N34 E;  4R8O A;  2V89 A;  4WSP A;  3J7Y p;  3HQ1 A;  4TUI A;  2EZ6 A;  1X49 A;  3ADG A;  2L8T A;  4JI0 E;  2WZO A;  4LTY A;  3J80 C;  4OX9 E;  4DR4 E;  2UUA E;  4DV1 E;  1QU6 A;  2JOB A;  2K4V A;  2M4I A;  2VF1 A;  3IWC A;  4BMJ A;  4BBY A;  4TUG A;  2UUC E;  4GKK E;  2NA2 A;  3IWD A;  1UIL A;  3F6H A;  2VQE E;  4DR3 E;  2JR1 A;  1GQE A;  2MDR A;  4DV6 E;  1XNQ E;  3K6Q A;  2V85 A;  2JY9 A;  3HPZ A;  2LTS A;  4DV2 E;  3T1H E;  1I94 E;  3T1Y E;  4K0K E;  2RS6 A;  5CFF E;  3HXL A;  5ADZ A;  4DV7 E;  3RMP A;  4LF5 E;  3F6G A;  3ADJ A;  3ZOQ B;  4X64 E;  4DR5 E;  1RC7 A;  2KON A;  4L5N C;  1X47 A;  2JOX A;  4KHP E;  4DV5 E;  2V87 A;  2FTX B;  3HTX A;  1T4O A;  2N3G A;  4M30 A;  5LL6 R;  2RS7 A;  4M0V A;  2E1M A;  4B3T E;  2FGG A;  2DIX A;  2M1S A;  3AUZ A;  5AE3 A;  2ZM6 E;  5IT9 C;  4LF6 E;  4NXM E;  2UXB E;  4X8W A;  1PKP A;  2MC5 A;  4BC9 A;  2JWO A;  5A2Q C;  3J81 C;  1FKA E;  1UHZ A;  1YYK A;  3FIG A;  2LBS B;  4YY3 E;  5AE1 A;  3VK6 A;  2LJH A;  2B7V A;  2F8B A;  2FV4 B;  4J8Z A;  1HNZ E;  4GEQ B;  2L2K B;  1T4L B;  2UU9 E;  2JVA A;  3JTZ A;  1J5E E;  1IBK E;  1FJG E;  4LFC E;  4GKJ E;  5AAS A;  1IBM E;  1WHQ A;  2L6M A;  4F54 A;  2VQF E;  4LFA E;  5LMN E;  2L2M A;  1DQ3 A;  2LRS A;  5T6J A;  2V83 A;  2V88 A;  4DV3 E;  4L8N A;  2CPN A;  4DR6 E;  2LE2 A;  2LMZ A;  1N33 E;  4JYA E;  2L2N A;  4JI1 E;  2E5L E;  2L92 A;  4F9B B;  2G7H A;  4JI8 E;  2LUP B;  4AQY E;  2LTR A;  5F3W A;  4B3R E;  2EWL A;  4LU9 A;  2L3J A;  5BR8 E;  4BCA A;  3C4T A;  3HPS A;  4DR1 E;  2DSY A;  1YYO A;  4BS9 A;  1IBL E;  2LUQ A;  4P78 A;  1WXR A;  4F9C B;  3IWB A;  1HNX E;  2RSM A;  4JI6 E;  4JI4 E;  1WHN A;  2DB2 A;  1XNR E;  4M2Z A;  1STU A;  2DMY A;  2M7Q A;  1N32 E;  1J26 A;  3H09 A;  2YT4 A;  4BC7 A;  2H36 X;  4DUY E;  2KOU A;  4R03 A;  2NUE A;  5FLX C;  1YYW A;  4LF9 E;  1RQ0 A;  1N36 E;  1EKZ A;  2MC6 A;  4JI2 E;  4Q28 A;  3VYX A;  2N3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...