2RS7A

Solution structure of the second dsrbd from rna helicase a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase A
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs7A01
4DV3E 4DV2E 2LTRA 5IWAE 2KHXA 2UUAE 2LUQA 4M30A 3ADGA 2LTSA 4DUZE 1XMOE 4LF9E 2UXDE 4AQYE 2EZ6A 4JI4E 4B3RE 2B3TB 3T1HE 1ZBTA 2MDRA 4JV5E 1T4NA 4NXNE 2F4VE 1GQEA 1QU6A 4JI1E 4B3ME 1IBME 4X66E 4KHPE 4DR7E 2DB2A 2N3HA 1T4OA 4B3SE 3P1XA 4LFCE 4DR6E 4DV1E 1XMQE 4WYQB 4K0KE 1N36E 4DR1E 4LF7E 2RS6A 4DR5E 4LF6E 3OTOE 2LUPB 3ADLA 1YZ9A 4X64E 4DV0E 2RS7A 3J7Yp 1UILA 2ZM6E 2RSMA 4DV6E 3T1YE 4JI6E 2DMYA 4DV4E 1I94E 1J5EE 4DUYE 5LMUE 2VQEE 4LFAE 4GKKE 2HHHE 2B7VA 1IBKE 2L3CA 4JI2E 2NUGA 4NXME 3C4TA 2JVAA 2UUCE 2L2MA 4X8WA 1J26A 1HNXE 1FKAE 4LF8E 4M2ZA 2LBSB 4GKJE 2LRSA 2NUEA 1DI2A 2L2KB 2LJHA 1X49A 4X65E 2YT4A 3LLHA 4OX9E 1EKZA 1N32E 4LFBE 1HNWE 2NUFA 4WFTA 1RQ0A 4YY3E 3C4BA 4DR4E 2VQFE 1STUA 1XNRE 1RC7A 2UXBE 4DR3E 2B7TA 4X62E 4JI8E 1FJGE 1HR0E 2E5LE 1YYOA 2L2NA 3ADJA 2N3GA 1N34E 1HNZE 5CFFE 4B3TE 4JI0E 2DIXA 1IBLE 4LF4E 4JYAE 2CPNA 2L33A 2UUBE 4DV5E 3VYYA 1WHNA 1WHQA 2UU9E 2NA2A 5LMNE 2IHR1 4DV7E 4JI5E 1O0WA 4LF5E 3VYXA 2UXCE 1PKPA 2L3JA 4JI3E 4DKKA 1T4LB 4OOGC 1X48A 2JY9A 1YYKA 1YYWA 1N33E 5BR8E 1XNQE 3ADIA 4JI7E 2RTXA 1UHZA 4DR2E 3HTXA 4YHHE 1X47A
chains in the Genus database with same CATH superfamily
4TUGA 2JPAA 2ADRA 4LTYA 2YTFA 4DV2E 3BF2A 2LT7A 1YFHA 3K6QA 1YSAC 5A69A 2YTQA 4HEIA 4LF9E 2UXDE 2EN1A 3F6HA 4TUIA 1X5WA 3AUZA 2G7HA 4B3RE 2EM5A 4O4KA 3L00A 4NXNE 2YTIA 2N8XA 2F4VE 2EMLA 2JWOA 2KOUA 1IBME 1T38A 4L5NC 2DB2A 4B3SE 2EPRA 4WYQB 2LE2A 2EMXA 2J7JA 2R1FA 3M99B 4BS9A 3OTOE 1BB8A 4X64E 2YTJA 5LLQA 2RS7A 3J7Yp 4DV0E 4JI6E 2RSMA 4O24A 2DRPA 2MC5A 2EP3A 1AH5A 4WSGA 1J5EE 4DUYE 4LFAE 2VQEE 3C6MA 2HHHE 2V87A 2B7VA 5A6KA 2L3CA 1F2IG 2L2MA 2ELYA 2JYAA 2YTGA 4X8WA 2LJUA 1KYQA 2RPCA 2FTXB 1A1HA 5AE2A 1HNXE 4LF8E 2EM9A 2YU5A 1DI2A 2F8BA 3DJWA 2EQ0A 2YT4A 2ENHA 3LLHA 4OX9E 2V83A 2YTNA 1N32E 1HNWE 5AASA 1TF3A 3C4BA 2VQFE 4DMIA 1WJPA 3TQMA 1N3GA 2UXBE 2DSYA 4X62E 2EOIA 2JOXA 3MHSC 1YYOA 2L2NA 2EMIA 2EOZA 2ODRC 3ADJA 1N34E 2I9IA 2DIXA 5T6JA 1TN9A 2EMKA 5KL6A 5KL4A 2WZOA 1WXRA 3VYYA 5KL7A 2D9HA 1IQOA 2EMWA 1SR9A 2B9DA 2EM3A 4RHBB 1O0WA 1BBGA 2YRHA 1UBDC 2YWQA 1YUIA 4FK5C 4O43A 3J81C 4DKKA 1T4LB 1PJTA 1X6HA 1XNQE 2VF1A 2I13A 4R2CA 5AE3A 1MGTA 2MC6A 3THNA 4DV3E 2EPXA 2LMZA 5IWAE 1ZBQA 5AE1A 2YSPA 4KWYA 4KZSA 4F2JC 2LTSA 1XMOE 2DGCA 4JI4E 3EPKA 2B3TB 2CSHA 3T1HE 5IXMB 1PJSA 1T4NA 1ZU1A 4F54A 5KL3A 5FLXC 2EM0A 1GQEA 2EM7A 4BHCA 1A1FA 2ENCA 4P7DA 4X66E 4DR7E 4R2EA 2N3HA 2K4VA 5A6JA 4LU9A 4DR6E 2EM8A 3BIDA 2EPMX 3THOB 4K0KE 2YU8A 1JK2A 4X9JA 1QNTA 2EPKX 1PDAA 2LUPB 1YZ9A 1PJQA 3T1YE 3ECRA 3MHHC 4R2QA 2EOSA 4R2AA 1EH6A 3JTZA 4J8ZA 4GKKE 2EOJA 2MKDA 2EQ3A 3EPJA 3MSWA 1IBKE 4R8OA 2L6MA 3ZOQB 2NUGA 3C4TA 5A6BA 2V86A 1J26A 1FKAE 2EOMA 3AV0A 2R76A 2EOQA 2L2KB 1X49A 2HJJA 2YRKA 5A6BD 1EKZA 1Z1BA 1GTKA 4LFBE 1IMUA 2CTDA 3UK3C 2EPOA 2NUFA 4F9BB 4YY3E 3OMLA 3HQ1A 2B7TA 4JI8E 1FJGE 1HR0E 2V88A 2DMIA 4R2PA 1IBLE 4R2DA 2EOXA 4HTGA 3JU0A 2FGGA 2HGHA 4P78A 2UUBE 2EN2A 2RSIA 2EPZA 2L92A 4DV5E 3LMLA 2UU9E 2ELZA 5LMNE 1YPNA 1SFEA 5KL5A 5IT9C 2BB8A 2EJ4A 3HXLA 2Q8UA 4M0VA 2E72A 1PKPA 2A25A 5IV8B 2EMCA 2JY9A 1YYWA 2WBTA 3KWRA 4BC7A 4JI7E 4DR2E 1X47A 5F3WA 2EPAA 2LTRA 2EN6A 2KHXA 2CT1A 3BGHA 2EL6A 4BBYA 1KJKA 2MKNA 4M30A 3ADGA 2LCEA 4DUZE 2EOEA 2EPNA 2EZ6A 2M4IA 2M7QA 4GZNC 4JV5E 3FIGA 4ZYHA 2ODRD 4BHBA 1ZAAC 1A1IA 1QU6A 2GPIA 4JI1E 2E1MA 1NCSA 2EWLA 4IJDA 1YUJA 4DV1E 2YTPA 4R2SA 2LVHA 4BMJA 1XMQE 1G2FC 1A1JA 2YTEA 3KZYA 3J80C 2EN3A 4I8OA 4IS1C 1B69A 2VRDA 4R2RA 1UILA 2DMYA 1EH8A 4DV4E 3IWCA 2WBUA 2EM4A 3IWDA 2BBGA 4Q35B 2EN8A 5LL6R 1BBOA 4JI2E 4NXME 1NEIA 2JVAA 2EOFA 2EPLX 4M2ZA 2LBSB 2LRSA 2GLIA 3EPLA 2NUEA 1AAYA 2K7IA 4BC9A 1L4SA 3EPHA 1RQ0A 2WCC3 4DR4E 3H09A 4DR3E 3F6GA 2WBSA 1X3CA 5AC5A 2YTDA 3RMPA 3QG5C 5CFFE 2V8QB 2EPPA 4B3TE 4JYAE 4LF4E 2CPNA 2L33A 1TF6A 4Q28A 3IWBA 2EMZA 1LLMC 2H36X 2EMBA 4M9VC 2EM6A 4LF5E 2EMAA 2EOOA 5AC4A 2LV2A 3VYXA 2YSOA 2UXCE 2L3JA 4JI3E 1A1LA 1X48A 1YYKA 1N33E 2EM2A 2RTXA 2EN4A 3BBGA 2L8TA 4YHHE 3HTXA 2M1SA 4F9AB 2EL5A 1ZR9A 3EQ1A 3J7AG 4BCAA 2UUAE 4N4RB 4F6NA 2YRMA 2LUQA 1IQSA 2YPNA 1RMDA 2RQLA 4MLVA 4O5GA 2EOHA 4AQYE 2MDGA 1ZBTA 2MDRA 4NZVA 2EPUA 4GEQB 4B3ME 5KL2A 4KHPE 5TSEA 4LFCE 1T4OA 3VHTB 3P1XA 2M9AA 4R03A 1N36E 4DR1E 4LF7E 2RS6A 4DR5E 4LF6E 2FV4B 2EORA 2ENAA 3ADLA 2ZM6E 4DV6E 1WRJA 2NABA 1DGCA 4ZYDA 4WX9A 2V89A 4WSPA 1I94E 2EQ1A 1X6EA 3HPSA 5LMUE 2EMFA 2KONA 4RH8A 2EMHA 4F6MA 2EL4A 4ZYGA 3VK6A 4L8NA 3KZZA 1UN6B 2UUCE 2EMYA 2EN7A 4ZYEA 1T39A 4GKJE 2HC5A 2LJHA 2V85A 4X65E 4MLQA 1GZ6A 3HPZA 4WFTA 3DF6A 1STUA 1XNRE 1JK1A 1RC7A 4NHRA 2VE7C 5A6AA 2DLQA 2JXPA 4WPYA 3C6KA 5DNYA 1X6FA 1P47A 2E5LE 4WXDA 2EOYA 2N3GA 5A2QC 1HNZE 2YTOA 4JI0E 2YZTA 1A1GA 1A1KA 2EPCA 1EH7A 2DLKA 2EE8A 1G2DC 1WHNA 1WHQA 2PRTA 4F9CB 2NA2A 1MEYC 4DV7E 2IHR1 4WXCA 2EMGA 2JP9A 4JI5E 2JOBA 4OOGC 5BR8E 3ADIA 1DQ3A 2GHFA 2JR1A 1UHZA 2LO3A 5ADZA 3JAMC
chains in the Genus database with same CATH topology
4F9AB 4TUGA 2MC6A 5F3WA 4DV3E 4LTYA 4DV2E 2LTRA 2LMZA 3J7AG 5IWAE 2KHXA 4BCAA 1ZBQA 2UUAE 3K6QA 5AE1A 4KZSA 4BBYA 2LUQA 4M30A 3ADGA 2LTSA 4DUZE 1XMOE 4LF9E 2UXDE 4AQYE 3F6HA 4TUIA 2EZ6A 2M4IA 3AUZA 2G7HA 4JI4E 4B3RE 2B3TB 2M7QA 1ZBTA 2MDRA 3T1HE 3FIGA 1T4NA 3HTXA 4JV5E 2ODRD 5FLXC 4F54A 4DR6E 4NXNE 2F4VE 1GQEA 1QU6A 4GEQB 4JI1E 2JWOA 2KOUA 4B3ME 4P7DA 1IBME 2E1MA 4X66E 4KHPE 4L5NC 4DR7E 2DB2A 2EWLA 1T4OA 2K4VA 2N3HA 3P1XA 4LU9A 4R03A 4B3SE 4LFCE 4DV1E 1XMQE 4BMJA 4WYQB 4K0KE 1N36E 4DR1E 4LF7E 2LE2A 2RS6A 4DR5E 4LF6E 2FV4B 4BS9A 3OTOE 3J80C 2LUPB 3ADLA 1YZ9A 4X64E 4I8OA 4DV0E 2RS7A 3J7Yp 1UILA 2ZM6E 2RSMA 4DV6E 3T1YE 4JI6E 2DMYA 2MC5A 4DV4E 2V89A 4WSPA 1I94E 3IWCA 3HPSA 3JTZA 4J8ZA 4DUYE 5LMUE 2VQEE 1J5EE 3IWDA 2KONA 4LFAE 2HHHE 3MSWA 4GKKE 2V87A 2B7VA 1IBKE 4R8OA 2L6MA 2L3CA 3ZOQB 5LL6R 4JI2E 2NUGA 4NXME 3C4TA 2JVAA 4L8NA 3VK6A 2UUCE 2L2MA 4X8WA 2V86A 1J26A 2FTXB 1HNXE 5AE2A 1FKAE 4LF8E 3AV0A 4M2ZA 2LBSB 4GKJE 2LRSA 2NUEA 2F8BA 3DJWA 1DI2A 2L2KB 2LJHA 2V85A 1X49A 4X65E 2YT4A 3LLHA 4OX9E 4BC9A 2V83A 1EKZA 1N32E 4LFBE 1HNWE 1GZ6A 5AASA 2NUFA 3HPZA 4WFTA 4F9BB 1RQ0A 5AE3A 4YY3E 3C4BA 3OMLA 3DF6A 1STUA 4DMIA 2VQFE 1RC7A 1XNRE 4DR4E 2UXBE 3H09A 4DR3E 3HQ1A 2DSYA 3F6GA 2VE7C 2B7TA 4X62E 4JI8E 2JOXA 1HR0E 1FJGE 2V88A 4WPYA 3RMPA 1N33E 5DNYA 2E5LE 1YYOA 2L2NA 2ODRC 3ADJA 2N3GA 1N34E 5A2QC 1HNZE 5CFFE 2V8QB 4B3TE 2DIXA 2YZTA 1IBLE 4JI0E 4LF4E 4JYAE 5T6JA 2CPNA 2L33A 3JU0A 2FGGA 4P78A 4Q28A 2WZOA 1WXRA 2UUBE 2L92A 3IWBA 4DV5E 3VYYA 3LMLA 1WHNA 1WHQA 2H36X 4F9CB 2NA2A 2UU9E 5LMNE 2IHR1 4DV7E 4JI5E 1SR9A 2B9DA 5IT9C 1O0WA 4LF5E 3HXLA 2JOBA 4M0VA 3VYXA 2UXCE 1PKPA 3J81C 2L3JA 4JI3E 4DKKA 1T4LB 4OOGC 1X48A 2JY9A 1YYKA 4BC7A 3KWRA 5BR8E 1XNQE 1YYWA 2VF1A 1DQ3A 2JR1A 2RTXA 1UHZA 4JI7E 3ADIA 4DR2E 2L8TA 4YHHE 5ADZA 1X47A 2M1SA 3JAMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  4DV2 E;  2LTR A;  5IWA E;  2KHX A;  2UUA E;  2LUQ A;  4M30 A;  3ADG A;  2LTS A;  4DUZ E;  1XMO E;  4LF9 E;  2UXD E;  4AQY E;  2EZ6 A;  4JI4 E;  4B3R E;  2B3T B;  3T1H E;  1ZBT A;  2MDR A;  4JV5 E;  1T4N A;  4NXN E;  2F4V E;  1GQE A;  1QU6 A;  4JI1 E;  4B3M E;  1IBM E;  4X66 E;  4KHP E;  4DR7 E;  2DB2 A;  2N3H A;  1T4O A;  4B3S E;  3P1X A;  4LFC E;  4DR6 E;  4DV1 E;  1XMQ E;  4WYQ B;  4K0K E;  1N36 E;  4DR1 E;  4LF7 E;  2RS6 A;  4DR5 E;  4LF6 E;  3OTO E;  2LUP B;  3ADL A;  1YZ9 A;  4X64 E;  4DV0 E;  2RS7 A;  3J7Y p;  1UIL A;  2ZM6 E;  2RSM A;  4DV6 E;  3T1Y E;  4JI6 E;  2DMY A;  4DV4 E;  1I94 E;  1J5E E;  4DUY E;  5LMU E;  2VQE E;  4LFA E;  4GKK E;  2HHH E;  2B7V A;  1IBK E;  2L3C A;  4JI2 E;  2NUG A;  4NXM E;  3C4T A;  2JVA A;  2UUC E;  2L2M A;  4X8W A;  1J26 A;  1HNX E;  1FKA E;  4LF8 E;  4M2Z A;  2LBS B;  4GKJ E;  2LRS A;  2NUE A;  1DI2 A;  2L2K B;  2LJH A;  1X49 A;  4X65 E;  2YT4 A;  3LLH A;  4OX9 E;  1EKZ A;  1N32 E;  4LFB E;  1HNW E;  2NUF A;  4WFT A;  1RQ0 A;  4YY3 E;  3C4B A;  4DR4 E;  2VQF E;  1STU A;  1XNR E;  1RC7 A;  2UXB E;  4DR3 E;  2B7T A;  4X62 E;  4JI8 E;  1FJG E;  1HR0 E;  2E5L E;  1YYO A;  2L2N A;  3ADJ A;  2N3G A;  1N34 E;  1HNZ E;  5CFF E;  4B3T E;  4JI0 E;  2DIX A;  1IBL E;  4LF4 E;  4JYA E;  2CPN A;  2L33 A;  2UUB E;  4DV5 E;  3VYY A;  1WHN A;  1WHQ A;  2UU9 E;  2NA2 A;  5LMN E;  2IHR 1;  4DV7 E;  4JI5 E;  1O0W A;  4LF5 E;  3VYX A;  2UXC E;  1PKP A;  2L3J A;  4JI3 E;  4DKK A;  1T4L B;  4OOG C;  1X48 A;  2JY9 A;  1YYK A;  1YYW A;  1N33 E;  5BR8 E;  1XNQ E;  3ADI A;  4JI7 E;  2RTX A;  1UHZ A;  4DR2 E;  3HTX A;  4YHH E;  1X47 A; 
#chains in the Genus database with same CATH topology
 4TUG A;  2JPA A;  2ADR A;  4LTY A;  2YTF A;  4DV2 E;  3BF2 A;  2LT7 A;  1YFH A;  3K6Q A;  1YSA C;  5A69 A;  2YTQ A;  4HEI A;  4LF9 E;  2UXD E;  2EN1 A;  3F6H A;  4TUI A;  1X5W A;  3AUZ A;  2G7H A;  4B3R E;  2EM5 A;  4O4K A;  3L00 A;  4NXN E;  2YTI A;  2N8X A;  2F4V E;  2EML A;  2JWO A;  2KOU A;  1IBM E;  1T38 A;  4L5N C;  2DB2 A;  4B3S E;  2EPR A;  4WYQ B;  2LE2 A;  2EMX A;  2J7J A;  2R1F A;  3M99 B;  4BS9 A;  3OTO E;  1BB8 A;  4X64 E;  2YTJ A;  5LLQ A;  2RS7 A;  3J7Y p;  4DV0 E;  4JI6 E;  2RSM A;  4O24 A;  2DRP A;  2MC5 A;  2EP3 A;  1AH5 A;  4WSG A;  1J5E E;  4DUY E;  4LFA E;  2VQE E;  3C6M A;  2HHH E;  2V87 A;  2B7V A;  5A6K A;  2L3C A;  1F2I G;  2L2M A;  2ELY A;  2JYA A;  2YTG A;  4X8W A;  2LJU A;  1KYQ A;  2RPC A;  2FTX B;  1A1H A;  5AE2 A;  1HNX E;  4LF8 E;  2EM9 A;  2YU5 A;  1DI2 A;  2F8B A;  3DJW A;  2EQ0 A;  2YT4 A;  2ENH A;  3LLH A;  4OX9 E;  2V83 A;  2YTN A;  1N32 E;  1HNW E;  5AAS A;  1TF3 A;  3C4B A;  2VQF E;  4DMI A;  1WJP A;  3TQM A;  1N3G A;  2UXB E;  2DSY A;  4X62 E;  2EOI A;  2JOX A;  3MHS C;  1YYO A;  2L2N A;  2EMI A;  2EOZ A;  2ODR C;  3ADJ A;  1N34 E;  2I9I A;  2DIX A;  5T6J A;  1TN9 A;  2EMK A;  5KL6 A;  5KL4 A;  2WZO A;  1WXR A;  3VYY A;  5KL7 A;  2D9H A;  1IQO A;  2EMW A;  1SR9 A;  2B9D A;  2EM3 A;  4RHB B;  1O0W A;  1BBG A;  2YRH A;  1UBD C;  2YWQ A;  1YUI A;  4FK5 C;  4O43 A;  3J81 C;  4DKK A;  1T4L B;  1PJT A;  1X6H A;  1XNQ E;  2VF1 A;  2I13 A;  4R2C A;  5AE3 A;  1MGT A;  2MC6 A;  3THN A;  4DV3 E;  2EPX A;  2LMZ A;  5IWA E;  1ZBQ A;  5AE1 A;  2YSP A;  4KWY A;  4KZS A;  4F2J C;  2LTS A;  1XMO E;  2DGC A;  4JI4 E;  3EPK A;  2B3T B;  2CSH A;  3T1H E;  5IXM B;  1PJS A;  1T4N A;  1ZU1 A;  4F54 A;  5KL3 A;  5FLX C;  2EM0 A;  1GQE A;  2EM7 A;  4BHC A;  1A1F A;  2ENC A;  4P7D A;  4X66 E;  4DR7 E;  4R2E A;  2N3H A;  2K4V A;  5A6J A;  4LU9 A;  4DR6 E;  2EM8 A;  3BID A;  2EPM X;  3THO B;  4K0K E;  2YU8 A;  1JK2 A;  4X9J A;  1QNT A;  2EPK X;  1PDA A;  2LUP B;  1YZ9 A;  1PJQ A;  3T1Y E;  3ECR A;  3MHH C;  4R2Q A;  2EOS A;  4R2A A;  1EH6 A;  3JTZ A;  4J8Z A;  4GKK E;  2EOJ A;  2MKD A;  2EQ3 A;  3EPJ A;  3MSW A;  1IBK E;  4R8O A;  2L6M A;  3ZOQ B;  2NUG A;  3C4T A;  5A6B A;  2V86 A;  1J26 A;  1FKA E;  2EOM A;  3AV0 A;  2R76 A;  2EOQ A;  2L2K B;  1X49 A;  2HJJ A;  2YRK A;  5A6B D;  1EKZ A;  1Z1B A;  1GTK A;  4LFB E;  1IMU A;  2CTD A;  3UK3 C;  2EPO A;  2NUF A;  4F9B B;  4YY3 E;  3OML A;  3HQ1 A;  2B7T A;  4JI8 E;  1FJG E;  1HR0 E;  2V88 A;  2DMI A;  4R2P A;  1IBL E;  4R2D A;  2EOX A;  4HTG A;  3JU0 A;  2FGG A;  2HGH A;  4P78 A;  2UUB E;  2EN2 A;  2RSI A;  2EPZ A;  2L92 A;  4DV5 E;  3LML A;  2UU9 E;  2ELZ A;  5LMN E;  1YPN A;  1SFE A;  5KL5 A;  5IT9 C;  2BB8 A;  2EJ4 A;  3HXL A;  2Q8U A;  4M0V A;  2E72 A;  1PKP A;  2A25 A;  5IV8 B;  2EMC A;  2JY9 A;  1YYW A;  2WBT A;  3KWR A;  4BC7 A;  4JI7 E;  4DR2 E;  1X47 A;  5F3W A;  2EPA A;  2LTR A;  2EN6 A;  2KHX A;  2CT1 A;  3BGH A;  2EL6 A;  4BBY A;  1KJK A;  2MKN A;  4M30 A;  3ADG A;  2LCE A;  4DUZ E;  2EOE A;  2EPN A;  2EZ6 A;  2M4I A;  2M7Q A;  4GZN C;  4JV5 E;  3FIG A;  4ZYH A;  2ODR D;  4BHB A;  1ZAA C;  1A1I A;  1QU6 A;  2GPI A;  4JI1 E;  2E1M A;  1NCS A;  2EWL A;  4IJD A;  1YUJ A;  4DV1 E;  2YTP A;  4R2S A;  2LVH A;  4BMJ A;  1XMQ E;  1G2F C;  1A1J A;  2YTE A;  3KZY A;  3J80 C;  2EN3 A;  4I8O A;  4IS1 C;  1B69 A;  2VRD A;  4R2R A;  1UIL A;  2DMY A;  1EH8 A;  4DV4 E;  3IWC A;  2WBU A;  2EM4 A;  3IWD A;  2BBG A;  4Q35 B;  2EN8 A;  5LL6 R;  1BBO A;  4JI2 E;  4NXM E;  1NEI A;  2JVA A;  2EOF A;  2EPL X;  4M2Z A;  2LBS B;  2LRS A;  2GLI A;  3EPL A;  2NUE A;  1AAY A;  2K7I A;  4BC9 A;  1L4S A;  3EPH A;  1RQ0 A;  2WCC 3;  4DR4 E;  3H09 A;  4DR3 E;  3F6G A;  2WBS A;  1X3C A;  5AC5 A;  2YTD A;  3RMP A;  3QG5 C;  5CFF E;  2V8Q B;  2EPP A;  4B3T E;  4JYA E;  4LF4 E;  2CPN A;  2L33 A;  1TF6 A;  4Q28 A;  3IWB A;  2EMZ A;  1LLM C;  2H36 X;  2EMB A;  4M9V C;  2EM6 A;  4LF5 E;  2EMA A;  2EOO A;  5AC4 A;  2LV2 A;  3VYX A;  2YSO A;  2UXC E;  2L3J A;  4JI3 E;  1A1L A;  1X48 A;  1YYK A;  1N33 E;  2EM2 A;  2RTX A;  2EN4 A;  3BBG A;  2L8T A;  4YHH E;  3HTX A;  2M1S A;  4F9A B;  2EL5 A;  1ZR9 A;  3EQ1 A;  3J7A G;  4BCA A;  2UUA E;  4N4R B;  4F6N A;  2YRM A;  2LUQ A;  1IQS A;  2YPN A;  1RMD A;  2RQL A;  4MLV A;  4O5G A;  2EOH A;  4AQY E;  2MDG A;  1ZBT A;  2MDR A;  4NZV A;  2EPU A;  4GEQ B;  4B3M E;  5KL2 A;  4KHP E;  5TSE A;  4LFC E;  1T4O A;  3VHT B;  3P1X A;  2M9A A;  4R03 A;  1N36 E;  4DR1 E;  4LF7 E;  2RS6 A;  4DR5 E;  4LF6 E;  2FV4 B;  2EOR A;  2ENA A;  3ADL A;  2ZM6 E;  4DV6 E;  1WRJ A;  2NAB A;  1DGC A;  4ZYD A;  4WX9 A;  2V89 A;  4WSP A;  1I94 E;  2EQ1 A;  1X6E A;  3HPS A;  5LMU E;  2EMF A;  2KON A;  4RH8 A;  2EMH A;  4F6M A;  2EL4 A;  4ZYG A;  3VK6 A;  4L8N A;  3KZZ A;  1UN6 B;  2UUC E;  2EMY A;  2EN7 A;  4ZYE A;  1T39 A;  4GKJ E;  2HC5 A;  2LJH A;  2V85 A;  4X65 E;  4MLQ A;  1GZ6 A;  3HPZ A;  4WFT A;  3DF6 A;  1STU A;  1XNR E;  1JK1 A;  1RC7 A;  4NHR A;  2VE7 C;  5A6A A;  2DLQ A;  2JXP A;  4WPY A;  3C6K A;  5DNY A;  1X6F A;  1P47 A;  2E5L E;  4WXD A;  2EOY A;  2N3G A;  5A2Q C;  1HNZ E;  2YTO A;  4JI0 E;  2YZT A;  1A1G A;  1A1K A;  2EPC A;  1EH7 A;  2DLK A;  2EE8 A;  1G2D C;  1WHN A;  1WHQ A;  2PRT A;  4F9C B;  2NA2 A;  1MEY C;  4DV7 E;  2IHR 1;  4WXC A;  2EMG A;  2JP9 A;  4JI5 E;  2JOB A;  4OOG C;  5BR8 E;  3ADI A;  1DQ3 A;  2GHF A;  2JR1 A;  1UHZ A;  2LO3 A;  5ADZ A;  3JAM C; 
#chains in the Genus database with same CATH homology
 4F9A B;  4TUG A;  2MC6 A;  5F3W A;  4DV3 E;  4LTY A;  4DV2 E;  2LTR A;  2LMZ A;  3J7A G;  5IWA E;  2KHX A;  4BCA A;  1ZBQ A;  2UUA E;  3K6Q A;  5AE1 A;  4KZS A;  4BBY A;  2LUQ A;  4M30 A;  3ADG A;  2LTS A;  4DUZ E;  1XMO E;  4LF9 E;  2UXD E;  4AQY E;  3F6H A;  4TUI A;  2EZ6 A;  2M4I A;  3AUZ A;  2G7H A;  4JI4 E;  4B3R E;  2B3T B;  2M7Q A;  1ZBT A;  2MDR A;  3T1H E;  3FIG A;  1T4N A;  3HTX A;  4JV5 E;  2ODR D;  5FLX C;  4F54 A;  4DR6 E;  4NXN E;  2F4V E;  1GQE A;  1QU6 A;  4GEQ B;  4JI1 E;  2JWO A;  2KOU A;  4B3M E;  4P7D A;  1IBM E;  2E1M A;  4X66 E;  4KHP E;  4L5N C;  4DR7 E;  2DB2 A;  2EWL A;  1T4O A;  2K4V A;  2N3H A;  3P1X A;  4LU9 A;  4R03 A;  4B3S E;  4LFC E;  4DV1 E;  1XMQ E;  4BMJ A;  4WYQ B;  4K0K E;  1N36 E;  4DR1 E;  4LF7 E;  2LE2 A;  2RS6 A;  4DR5 E;  4LF6 E;  2FV4 B;  4BS9 A;  3OTO E;  3J80 C;  2LUP B;  3ADL A;  1YZ9 A;  4X64 E;  4I8O A;  4DV0 E;  2RS7 A;  3J7Y p;  1UIL A;  2ZM6 E;  2RSM A;  4DV6 E;  3T1Y E;  4JI6 E;  2DMY A;  2MC5 A;  4DV4 E;  2V89 A;  4WSP A;  1I94 E;  3IWC A;  3HPS A;  3JTZ A;  4J8Z A;  4DUY E;  5LMU E;  2VQE E;  1J5E E;  3IWD A;  2KON A;  4LFA E;  2HHH E;  3MSW A;  4GKK E;  2V87 A;  2B7V A;  1IBK E;  4R8O A;  2L6M A;  2L3C A;  3ZOQ B;  5LL6 R;  4JI2 E;  2NUG A;  4NXM E;  3C4T A;  2JVA A;  4L8N A;  3VK6 A;  2UUC E;  2L2M A;  4X8W A;  2V86 A;  1J26 A;  2FTX B;  1HNX E;  5AE2 A;  1FKA E;  4LF8 E;  3AV0 A;  4M2Z A;  2LBS B;  4GKJ E;  2LRS A;  2NUE A;  2F8B A;  3DJW A;  1DI2 A;  2L2K B;  2LJH A;  2V85 A;  1X49 A;  4X65 E;  2YT4 A;  3LLH A;  4OX9 E;  4BC9 A;  2V83 A;  1EKZ A;  1N32 E;  4LFB E;  1HNW E;  1GZ6 A;  5AAS A;  2NUF A;  3HPZ A;  4WFT A;  4F9B B;  1RQ0 A;  5AE3 A;  4YY3 E;  3C4B A;  3OML A;  3DF6 A;  1STU A;  4DMI A;  2VQF E;  1RC7 A;  1XNR E;  4DR4 E;  2UXB E;  3H09 A;  4DR3 E;  3HQ1 A;  2DSY A;  3F6G A;  2VE7 C;  2B7T A;  4X62 E;  4JI8 E;  2JOX A;  1HR0 E;  1FJG E;  2V88 A;  4WPY A;  3RMP A;  1N33 E;  5DNY A;  2E5L E;  1YYO A;  2L2N A;  2ODR C;  3ADJ A;  2N3G A;  1N34 E;  5A2Q C;  1HNZ E;  5CFF E;  2V8Q B;  4B3T E;  2DIX A;  2YZT A;  1IBL E;  4JI0 E;  4LF4 E;  4JYA E;  5T6J A;  2CPN A;  2L33 A;  3JU0 A;  2FGG A;  4P78 A;  4Q28 A;  2WZO A;  1WXR A;  2UUB E;  2L92 A;  3IWB A;  4DV5 E;  3VYY A;  3LML A;  1WHN A;  1WHQ A;  2H36 X;  4F9C B;  2NA2 A;  2UU9 E;  5LMN E;  2IHR 1;  4DV7 E;  4JI5 E;  1SR9 A;  2B9D A;  5IT9 C;  1O0W A;  4LF5 E;  3HXL A;  2JOB A;  4M0V A;  3VYX A;  2UXC E;  1PKP A;  3J81 C;  2L3J A;  4JI3 E;  4DKK A;  1T4L B;  4OOG C;  1X48 A;  2JY9 A;  1YYK A;  4BC7 A;  3KWR A;  5BR8 E;  1XNQ E;  1YYW A;  2VF1 A;  1DQ3 A;  2JR1 A;  2RTX A;  1UHZ A;  4JI7 E;  3ADI A;  4DR2 E;  2L8T A;  4YHH E;  5ADZ A;  1X47 A;  2M1S A;  3JAM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...