2L3JA

The solution structure of the adar2 dsrbm-rna complex reveals a sequence-specific read out of the minor groove
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
236
structure length
236
Chain Sequence
b'PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 34
structure length 236
sequence length 236
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA01
1YYWA 4LF4E 3T1YE 1N33E 4LFBE 4DKKA 1QU6A 1XMQE 1N34E 4M2ZA 1PKPA 4DR2E 1I94E 4DR3E 2L33A 4LF5E 2LRSA 2L3CA 1YZ9A 4DUZE 1J5EE 1DI2A 4JI3E 1FJGE 4DV1E 4DR6E 4K0KE 1WHQA 2L2NA 2B3TB 4B3TE 2UUBE 5LMNE 1YYOA 3ADLA 2F4VE 2NUFA 2IHR1 3J7Yp 2NUEA 4DR4E 3ADIA 1STUA 4LFAE 5CFFE 4JI0E 4JI5E 4DR5E 5LMUE 1UHZA 4WFTA 4M30A 1IBME 1GQEA 4DV5E 4DV7E 3HTXA 2VQEE 1X47A 1T4NA 2HHHE 2UXBE 4DV6E 2NUGA 2RS6A 4NXME 4YHHE 4LF6E 3LLHA 4LF7E 2UXDE 1T4OA 1YYKA 2LUQA 4NXNE 4DR7E 2RS7A 1IBKE 2KHXA 2B7TA 2NA2A 1EKZA 3OTOE 4LFCE 2LTRA 4OOGC 1XNRE 4JV5E 4DV0E 2UU9E 4JI7E 1X49A 2B7VA 4DUYE 3ADJA 2UXCE 1FKAE 1HNXE 4DV4E 5IWAE 1RQ0A 2UUAE 1N36E 4JI2E 2DIXA 2LUPB 4AQYE 4JI6E 4JYAE 2YT4A 3VYYA 4OX9E 1N32E 3ADGA 2N3GA 2JY9A 2EZ6A 4JI1E 4GKJE 1RC7A 2LTSA 4B3ME 1X48A 2L2MA 2L2KB 3VYXA 4X64E 4DV2E 2LBSB 2ZM6E 4X66E 2VQFE 4X62E 4GKKE 2DMYA 4B3RE 2LJHA 4DV3E 1T4LB 2E5LE 3C4BA 2CPNA 4DR1E 1J26A 4KHPE 4JI4E 2N3HA 2RTXA 4WYQB 1UILA 4YY3E 1ZBTA 2DB2A 2RSMA 4JI8E 1WHNA 4LF8E 2MDRA 5BR8E 1HR0E 3T1HE 1HNZE 2JVAA 1XMOE 3C4TA 4X8WA 4LF9E 1O0WA 1HNWE 2UUCE 4B3SE 4X65E 1IBLE 1XNQE 2L3JA 3P1XA
chains in the Genus database with same CATH superfamily
4LF4E 3KZZA 3RMPA 1N33E 1G2DC 4R03A 4IJDA 1QU6A 1N34E 2ODRD 3KWRA 2K7IA 3F6HA 5AC5A 2BBGA 2DLKA 4DR6E 2MC6A 2CT1A 2EOXA 5A6BD 2K4VA 2M1SA 5LMNE 2F4VE 2IHR1 1IQSA 3J7Yp 3C6KA 1SR9A 4DR4E 1X6FA 1TF6A 5CFFE 4JI0E 4ZYDA 5AE1A 2EWLA 2EOMA 5KL7A 2Q8UA 4WFTA 2CTDA 4R2QA 1GQEA 4DV7E 5AE2A 1IQOA 2EMCA 1A1IA 2UXBE 2ENCA 4WSGA 2WBSA 4J8ZA 2NUGA 2YTDA 4NHRA 2UXDE 1T4OA 1TN9A 2D9HA 2EPCA 4DR7E 1ZU1A 4MLQA 2NA2A 4F6NA 1YFHA 4LTYA 4JI7E 4BCAA 3ADJA 5TSEA 4BS9A 5IWAE 2ELYA 2EL6A 1N36E 4JI2E 4AQYE 3IWBA 2YPNA 2HC5A 1WJPA 2FGGA 3BIDA 2L6MA 4R2EA 1N32E 2EZ6A 1X3CA 1RC7A 2EL4A 2LTSA 2YU5A 3JTZA 4DV2E 2LBSB 4X62E 3BF2A 4GKKE 2BB8A 4TUGA 1F2IG 4DV3E 2WCC3 1T4LB 4DR1E 2CPNA 2KOUA 3HXLA 4KHPE 4JI4E 2EN1A 4WYQB 5KL3A 2JPAA 2EORA 2V88A 1HNZE 3C4TA 1HNWE 3C6MA 1O0WA 2EPOA 4B3SE 4HTGA 2L3JA 2J7JA 3EPHA 4F9CB 4LU9A 4LFBE 1PJQA 2EPXA 2V86A 5A6BA 1XMQE 2DLQA 1A1GA 2YU8A 1BBGA 3HQ1A 4DR2E 1G2FC 2RSIA 3MSWA 2B9DA 4L8NA 1Z1BA 2DGCA 2EOJA 2L3CA 2EMBA 2YZTA 2LV2A 1DI2A 1FJGE 2EN2A 4DMIA 5A2QC 1LLMC 1IMUA 1WRJA 2B3TB 4B3TE 2UUBE 1YYOA 2NUFA 2YSPA 2NUEA 1YUJA 1DGCA 2EOHA 3J80C 3ADIA 1A1FA 3EPLA 2E72A 2V87A 4LFAE 2GPIA 4M9VC 4NZVA 5A6JA 2V89A 2YTIA 1GZ6A 2EPPA 1UHZA 2EOEA 3J7AG 3IWCA 1IBME 4DV5E 2EN4A 5KL4A 3EQ1A 4RHBB 4BC9A 1T39A 2EE8A 2EN7A 2MDGA 2FTXB 4LF6E 3THOB 4NXME 4MLVA 4F9BB 2EMZA 2DSYA 1A1LA 1P47A 2LUQA 1IBKE 2H36X 4O4KA 2EM2A 3THNA 1T38A 4L5NC 4JV5E 2EMGA 1X6EA 2VE7C 2R1FA 3EPKA 2YWQA 5KL6A 1FKAE 4BBYA 3HPZA 2EMLA 1A1HA 2EM8A 2PRTA 2L8TA 2JP9A 2ENAA 3BBGA 3AUZA 3IWDA 5KL2A 2L2KB 4ZYHA 3MHSC 2ZM6E 2LJUA 4X66E 2VQFE 5AASA 1SFEA 2L92A 2WZOA 4F6MA 1ZAAC 4B3RE 2RQLA 1TF3A 3C4BA 2YTOA 5LLQA 1J26A 2N8XA 2N3HA 2RTXA 3DF6A 4YY3E 2EOQA 2EPZA 3JU0A 2MDRA 1XMOE 3F6GA 2EPRA 4X65E 1IBLE 4GKJE 5T6JA 1YYWA 2V85A 2EMAA 2EOIA 3AV0A 4M2ZA 1PKPA 4Q28A 2EPUA 4RH8A 2YSOA 4TUIA 1PDAA 2YTJA 4DR3E 2EPLX 2EQ3A 2EOFA 2LRSA 4F9AB 3M99B 5A6KA 1YZ9A 4DUZE 2JYAA 3HPSA 2L2NA 1NEIA 1N3GA 3MHHC 3TQMA 4R2RA 4BHCA 2LMZA 2M4IA 2HGHA 2HJJA 2EM4A 3KZYA 2EL5A 3J81C 4FK5C 5A6AA 2JXPA 2EM9A 4DR5E 2ODRC 3UK3C 1X6HA 4M30A 2R76A 5IV8B 1MGTA 2CSHA 4HEIA 3HTXA 1AH5A 1X47A 1T4NA 2EM3A 1PJTA 2HHHE 1EH8A 3DJWA 2YTNA 2RS6A 2EOSA 3LLHA 2MKDA 4LF7E 1RMDA 5DNYA 3FIGA 3K6QA 4NXNE 5ADZA 4P78A 2WBTA 2KHXA 2F8BA 1EKZA 4OOGC 4R2AA 4DV0E 1NCSA 1X49A 2YRKA 2EP3A 2V83A 2EM6A 2UXCE 4DV4E 2EM0A 2UUAE 1GTKA 2V8QB 4M0VA 2LUPB 1AAYA 4O24A 4JYAE 2EQ1A 2YT4A 2EMFA 3VYYA 4OX9E 2JY9A 2EMIA 4BC7A 2LO3A 1KYQA 4B3ME 2MC5A 2YRHA 2L2MA 2EMXA 2LCEA 5LL6R 4X64E 4ZYGA 2YTPA 5AE3A 3L00A 3H09A 4WXCA 4IS1C 5A69A 2E5LE 4R8OA 2I9IA 2JR1A 2DB2A 4JI8E 2EPKX 5FLXC 1HR0E 4R2DA 2WBUA 2FV4B 2YTQA 4Q35B 4BHBA 4X8WA 2UUCE 1EH7A 1XNQE 2LVHA 2LE2A 2EM5A 4ZYEA 3T1YE 1BBOA 4WSPA 4BMJA 2EOYA 4R2SA 4O43A 4DKKA 1UBDC 2EM7A 1B69A 2EN6A 2YRMA 2JWOA 3VHTB 4F2JC 2EMHA 1I94E 3ZOQB 5AC4A 2G7HA 2L33A 4LF5E 1A1JA 1DQ3A 1J5EE 1YSAC 3OMLA 1YUIA 4JI3E 3ECRA 4DV1E 2I13A 5IT9C 1WHQA 2EPNA 4K0KE 2YTGA 3ADLA 2EPMX 2ELZA 3JAMC 5KL5A 3QG5C 1STUA 5F3WA 2DMIA 4JI5E 3VK6A 4X9JA 5LMUE 2EOOA 4O5GA 1EH6A 2VQEE 2ADRA 4WXDA 4I8OA 4DV6E 4YHHE 2EN3A 1A1KA 2RPCA 4WX9A 2M7QA 1WXRA 2GHFA 2NABA 1ZBQA 1YPNA 1YYKA 2RS7A 2EPAA 2JOXA 2YTEA 2B7TA 2E1MA 4LFCE 3OTOE 1JK2A 2LTRA 1XNRE 1JK1A 2UU9E 4R2CA 1X5WA 2EQ0A 3BGHA 2B7VA 2VRDA 4DUYE 4GEQB 2M9AA 2EN8A 2VF1A 1L4SA 2DRPA 2EMKA 3LMLA 1HNXE 1RQ0A 2DIXA 2EOZA 2EMWA 4P7DA 4JI6E 2MKNA 1PJSA 2YTFA 4WPYA 3ADGA 2N3GA 1QNTA 4KWYA 4R2PA 4JI1E 2KONA 1X48A 1BB8A 4N4RB 3VYXA 4F54A 1ZR9A 2JOBA 2DMYA 1MEYC 2EJ4A 2LJHA 5IXMB 1UILA 3EPJA 1KJKA 1ZBTA 2RSMA 1WHNA 4LF8E 5BR8E 2GLIA 3T1HE 4GZNC 2LT7A 2JVAA 4LF9E 4KZSA 2EMYA 2ENHA 2A25A 1UN6B 3P1XA
chains in the Genus database with same CATH topology
1YYWA 2V85A 4F9CB 4LU9A 4LF4E 3RMPA 3T1YE 1N33E 4LFBE 4WSPA 4BMJA 2V86A 3AV0A 4R03A 1QU6A 4DKKA 1XMQE 1N34E 1PKPA 4Q28A 4M2ZA 3HQ1A 2JWOA 2ODRD 4DR2E 4TUIA 1I94E 3KWRA 3MSWA 3ZOQB 4DR3E 2B9DA 2G7HA 2L33A 4LF5E 3F6HA 2LRSA 4L8NA 1DQ3A 4F9AB 2L3CA 2YZTA 1YZ9A 4DUZE 1J5EE 3OMLA 1DI2A 4JI3E 1FJGE 4DV1E 4DMIA 5T6JA 5A2QC 3HPSA 1WHQA 2L2NA 2MC6A 5IT9C 4DR6E 4K0KE 2B3TB 4B3TE 2K4VA 2M1SA 5LMNE 1YYOA 2UUBE 3ADLA 3JAMC 2F4VE 2NUFA 2IHR1 2LMZA 3J7Yp 2M4IA 2NUEA 1SR9A 1HNWE 4DR4E 3J80C 3ADIA 1STUA 2V87A 5F3WA 3J81C 4LFAE 5CFFE 4JI0E 4JI5E 3VK6A 2EWLA 5AE1A 2V89A 4DR5E 2ODRC 1GZ6A 5LMUE 1UHZA 4WFTA 4M30A 3J7AG 3IWCA 1GQEA 2L3JA 4DV5E 1IBME 4DV7E 5AE2A 3HTXA 2VQEE 1X47A 1T4NA 4BC9A 2HHHE 2UXBE 3DJWA 4I8OA 4DV6E 4J8ZA 2NUGA 2RS6A 4NXME 4YHHE 2FTXB 3LLHA 4LF6E 2M7QA 4F9BB 1WXRA 4LF7E 2UXDE 1T4OA 2DSYA 5DNYA 3FIGA 1ZBQA 3K6QA 1YYKA 2LUQA 4NXNE 5ADZA 4P78A 4DR7E 2RS7A 1IBKE 2JOXA 2KHXA 2B7TA 2H36X 2E1MA 2F8BA 2NA2A 1EKZA 3OTOE 4L5NC 2LTRA 4OOGC 4LFCE 1XNRE 4JV5E 4DV0E 4LTYA 2UU9E 4JI7E 1X49A 2B7VA 2VE7C 2V83A 4BCAA 4DUYE 4GEQB 3ADJA 2UXCE 2VF1A 1FKAE 4BBYA 3HPZA 4BS9A 3LMLA 4DV4E 1HNXE 5IWAE 1RQ0A 2UUAE 1N36E 4JI2E 2DIXA 2V8QB 4P7DA 4M0VA 2LUPB 4AQYE 3IWBA 2L8TA 4JI6E 2FGGA 4JYAE 2YT4A 2L6MA 4WPYA 3VYYA 4OX9E 1N32E 3ADGA 2N3GA 2JY9A 2EZ6A 4BC7A 4JI1E 4GKJE 1RC7A 2LTSA 2KONA 3AUZA 3IWDA 1X48A 4B3ME 2MC5A 2L2MA 2L2KB 3VYXA 3JTZA 5LL6R 4X64E 4F54A 5AE3A 4DV2E 2ZM6E 2LBSB 4X66E 2VQFE 5AASA 2JOBA 4X62E 3H09A 2L92A 2DMYA 2WZOA 4GKKE 4TUGA 4B3RE 2LJHA 4DV3E 1T4LB 2E5LE 3C4BA 2CPNA 2KOUA 3HXLA 4DR1E 4R8OA 4KHPE 1J26A 4JI4E 2N3HA 2RTXA 3DF6A 4WYQB 1UILA 4YY3E 3JU0A 2JR1A 1ZBTA 2DB2A 2RSMA 4JI8E 1WHNA 4LF8E 5FLXC 2MDRA 5BR8E 2V88A 1HR0E 3T1HE 1HNZE 2FV4B 2JVAA 1XMOE 3C4TA 4X8WA 3F6GA 1O0WA 4KZSA 2UUCE 4LF9E 4B3SE 4X65E 1IBLE 1XNQE 2LE2A 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYW A;  4LF4 E;  3T1Y E;  1N33 E;  4LFB E;  4DKK A;  1QU6 A;  1XMQ E;  1N34 E;  4M2Z A;  1PKP A;  4DR2 E;  1I94 E;  4DR3 E;  2L33 A;  4LF5 E;  2LRS A;  2L3C A;  1YZ9 A;  4DUZ E;  1J5E E;  1DI2 A;  4JI3 E;  1FJG E;  4DV1 E;  4DR6 E;  4K0K E;  1WHQ A;  2L2N A;  2B3T B;  4B3T E;  2UUB E;  5LMN E;  1YYO A;  3ADL A;  2F4V E;  2NUF A;  2IHR 1;  3J7Y p;  2NUE A;  4DR4 E;  3ADI A;  1STU A;  4LFA E;  5CFF E;  4JI0 E;  4JI5 E;  4DR5 E;  5LMU E;  1UHZ A;  4WFT A;  4M30 A;  1IBM E;  1GQE A;  4DV5 E;  4DV7 E;  3HTX A;  2VQE E;  1X47 A;  1T4N A;  2HHH E;  2UXB E;  4DV6 E;  2NUG A;  2RS6 A;  4NXM E;  4YHH E;  4LF6 E;  3LLH A;  4LF7 E;  2UXD E;  1T4O A;  1YYK A;  2LUQ A;  4NXN E;  4DR7 E;  2RS7 A;  1IBK E;  2KHX A;  2B7T A;  2NA2 A;  1EKZ A;  3OTO E;  4LFC E;  2LTR A;  4OOG C;  1XNR E;  4JV5 E;  4DV0 E;  2UU9 E;  4JI7 E;  1X49 A;  2B7V A;  4DUY E;  3ADJ A;  2UXC E;  1FKA E;  1HNX E;  4DV4 E;  5IWA E;  1RQ0 A;  2UUA E;  1N36 E;  4JI2 E;  2DIX A;  2LUP B;  4AQY E;  4JI6 E;  4JYA E;  2YT4 A;  3VYY A;  4OX9 E;  1N32 E;  3ADG A;  2N3G A;  2JY9 A;  2EZ6 A;  4JI1 E;  4GKJ E;  1RC7 A;  2LTS A;  4B3M E;  1X48 A;  2L2M A;  2L2K B;  3VYX A;  4X64 E;  4DV2 E;  2LBS B;  2ZM6 E;  4X66 E;  2VQF E;  4X62 E;  4GKK E;  2DMY A;  4B3R E;  2LJH A;  4DV3 E;  1T4L B;  2E5L E;  3C4B A;  2CPN A;  4DR1 E;  1J26 A;  4KHP E;  4JI4 E;  2N3H A;  2RTX A;  4WYQ B;  1UIL A;  4YY3 E;  1ZBT A;  2DB2 A;  2RSM A;  4JI8 E;  1WHN A;  4LF8 E;  2MDR A;  5BR8 E;  1HR0 E;  3T1H E;  1HNZ E;  2JVA A;  1XMO E;  3C4T A;  4X8W A;  4LF9 E;  1O0W A;  1HNW E;  2UUC E;  4B3S E;  4X65 E;  1IBL E;  1XNQ E;  2L3J A;  3P1X A; 
#chains in the Genus database with same CATH topology
 4LF4 E;  3KZZ A;  3RMP A;  1N33 E;  1G2D C;  4R03 A;  4IJD A;  1QU6 A;  1N34 E;  2ODR D;  3KWR A;  2K7I A;  3F6H A;  5AC5 A;  2BBG A;  2DLK A;  4DR6 E;  2MC6 A;  2CT1 A;  2EOX A;  5A6B D;  2K4V A;  2M1S A;  5LMN E;  2F4V E;  2IHR 1;  1IQS A;  3J7Y p;  3C6K A;  1SR9 A;  4DR4 E;  1X6F A;  1TF6 A;  5CFF E;  4JI0 E;  4ZYD A;  5AE1 A;  2EWL A;  2EOM A;  5KL7 A;  2Q8U A;  4WFT A;  2CTD A;  4R2Q A;  1GQE A;  4DV7 E;  5AE2 A;  1IQO A;  2EMC A;  1A1I A;  2UXB E;  2ENC A;  4WSG A;  2WBS A;  4J8Z A;  2NUG A;  2YTD A;  4NHR A;  2UXD E;  1T4O A;  1TN9 A;  2D9H A;  2EPC A;  4DR7 E;  1ZU1 A;  4MLQ A;  2NA2 A;  4F6N A;  1YFH A;  4LTY A;  4JI7 E;  4BCA A;  3ADJ A;  5TSE A;  4BS9 A;  5IWA E;  2ELY A;  2EL6 A;  1N36 E;  4JI2 E;  4AQY E;  3IWB A;  2YPN A;  2HC5 A;  1WJP A;  2FGG A;  3BID A;  2L6M A;  4R2E A;  1N32 E;  2EZ6 A;  1X3C A;  1RC7 A;  2EL4 A;  2LTS A;  2YU5 A;  3JTZ A;  4DV2 E;  2LBS B;  4X62 E;  3BF2 A;  4GKK E;  2BB8 A;  4TUG A;  1F2I G;  4DV3 E;  2WCC 3;  1T4L B;  4DR1 E;  2CPN A;  2KOU A;  3HXL A;  4KHP E;  4JI4 E;  2EN1 A;  4WYQ B;  5KL3 A;  2JPA A;  2EOR A;  2V88 A;  1HNZ E;  3C4T A;  1HNW E;  3C6M A;  1O0W A;  2EPO A;  4B3S E;  4HTG A;  2L3J A;  2J7J A;  3EPH A;  4F9C B;  4LU9 A;  4LFB E;  1PJQ A;  2EPX A;  2V86 A;  5A6B A;  1XMQ E;  2DLQ A;  1A1G A;  2YU8 A;  1BBG A;  3HQ1 A;  4DR2 E;  1G2F C;  2RSI A;  3MSW A;  2B9D A;  4L8N A;  1Z1B A;  2DGC A;  2EOJ A;  2L3C A;  2EMB A;  2YZT A;  2LV2 A;  1DI2 A;  1FJG E;  2EN2 A;  4DMI A;  5A2Q C;  1LLM C;  1IMU A;  1WRJ A;  2B3T B;  4B3T E;  2UUB E;  1YYO A;  2NUF A;  2YSP A;  2NUE A;  1YUJ A;  1DGC A;  2EOH A;  3J80 C;  3ADI A;  1A1F A;  3EPL A;  2E72 A;  2V87 A;  4LFA E;  2GPI A;  4M9V C;  4NZV A;  5A6J A;  2V89 A;  2YTI A;  1GZ6 A;  2EPP A;  1UHZ A;  2EOE A;  3J7A G;  3IWC A;  1IBM E;  4DV5 E;  2EN4 A;  5KL4 A;  3EQ1 A;  4RHB B;  4BC9 A;  1T39 A;  2EE8 A;  2EN7 A;  2MDG A;  2FTX B;  4LF6 E;  3THO B;  4NXM E;  4MLV A;  4F9B B;  2EMZ A;  2DSY A;  1A1L A;  1P47 A;  2LUQ A;  1IBK E;  2H36 X;  4O4K A;  2EM2 A;  3THN A;  1T38 A;  4L5N C;  4JV5 E;  2EMG A;  1X6E A;  2VE7 C;  2R1F A;  3EPK A;  2YWQ A;  5KL6 A;  1FKA E;  4BBY A;  3HPZ A;  2EML A;  1A1H A;  2EM8 A;  2PRT A;  2L8T A;  2JP9 A;  2ENA A;  3BBG A;  3AUZ A;  3IWD A;  5KL2 A;  2L2K B;  4ZYH A;  3MHS C;  2ZM6 E;  2LJU A;  4X66 E;  2VQF E;  5AAS A;  1SFE A;  2L92 A;  2WZO A;  4F6M A;  1ZAA C;  4B3R E;  2RQL A;  1TF3 A;  3C4B A;  2YTO A;  5LLQ A;  1J26 A;  2N8X A;  2N3H A;  2RTX A;  3DF6 A;  4YY3 E;  2EOQ A;  2EPZ A;  3JU0 A;  2MDR A;  1XMO E;  3F6G A;  2EPR A;  4X65 E;  1IBL E;  4GKJ E;  5T6J A;  1YYW A;  2V85 A;  2EMA A;  2EOI A;  3AV0 A;  4M2Z A;  1PKP A;  4Q28 A;  2EPU A;  4RH8 A;  2YSO A;  4TUI A;  1PDA A;  2YTJ A;  4DR3 E;  2EPL X;  2EQ3 A;  2EOF A;  2LRS A;  4F9A B;  3M99 B;  5A6K A;  1YZ9 A;  4DUZ E;  2JYA A;  3HPS A;  2L2N A;  1NEI A;  1N3G A;  3MHH C;  3TQM A;  4R2R A;  4BHC A;  2LMZ A;  2M4I A;  2HGH A;  2HJJ A;  2EM4 A;  3KZY A;  2EL5 A;  3J81 C;  4FK5 C;  5A6A A;  2JXP A;  2EM9 A;  4DR5 E;  2ODR C;  3UK3 C;  1X6H A;  4M30 A;  2R76 A;  5IV8 B;  1MGT A;  2CSH A;  4HEI A;  3HTX A;  1AH5 A;  1X47 A;  1T4N A;  2EM3 A;  1PJT A;  2HHH E;  1EH8 A;  3DJW A;  2YTN A;  2RS6 A;  2EOS A;  3LLH A;  2MKD A;  4LF7 E;  1RMD A;  5DNY A;  3FIG A;  3K6Q A;  4NXN E;  5ADZ A;  4P78 A;  2WBT A;  2KHX A;  2F8B A;  1EKZ A;  4OOG C;  4R2A A;  4DV0 E;  1NCS A;  1X49 A;  2YRK A;  2EP3 A;  2V83 A;  2EM6 A;  2UXC E;  4DV4 E;  2EM0 A;  2UUA E;  1GTK A;  2V8Q B;  4M0V A;  2LUP B;  1AAY A;  4O24 A;  4JYA E;  2EQ1 A;  2YT4 A;  2EMF A;  3VYY A;  4OX9 E;  2JY9 A;  2EMI A;  4BC7 A;  2LO3 A;  1KYQ A;  4B3M E;  2MC5 A;  2YRH A;  2L2M A;  2EMX A;  2LCE A;  5LL6 R;  4X64 E;  4ZYG A;  2YTP A;  5AE3 A;  3L00 A;  3H09 A;  4WXC A;  4IS1 C;  5A69 A;  2E5L E;  4R8O A;  2I9I A;  2JR1 A;  2DB2 A;  4JI8 E;  2EPK X;  5FLX C;  1HR0 E;  4R2D A;  2WBU A;  2FV4 B;  2YTQ A;  4Q35 B;  4BHB A;  4X8W A;  2UUC E;  1EH7 A;  1XNQ E;  2LVH A;  2LE2 A;  2EM5 A;  4ZYE A;  3T1Y E;  1BBO A;  4WSP A;  4BMJ A;  2EOY A;  4R2S A;  4O43 A;  4DKK A;  1UBD C;  2EM7 A;  1B69 A;  2EN6 A;  2YRM A;  2JWO A;  3VHT B;  4F2J C;  2EMH A;  1I94 E;  3ZOQ B;  5AC4 A;  2G7H A;  2L33 A;  4LF5 E;  1A1J A;  1DQ3 A;  1J5E E;  1YSA C;  3OML A;  1YUI A;  4JI3 E;  3ECR A;  4DV1 E;  2I13 A;  5IT9 C;  1WHQ A;  2EPN A;  4K0K E;  2YTG A;  3ADL A;  2EPM X;  2ELZ A;  3JAM C;  5KL5 A;  3QG5 C;  1STU A;  5F3W A;  2DMI A;  4JI5 E;  3VK6 A;  4X9J A;  5LMU E;  2EOO A;  4O5G A;  1EH6 A;  2VQE E;  2ADR A;  4WXD A;  4I8O A;  4DV6 E;  4YHH E;  2EN3 A;  1A1K A;  2RPC A;  4WX9 A;  2M7Q A;  1WXR A;  2GHF A;  2NAB A;  1ZBQ A;  1YPN A;  1YYK A;  2RS7 A;  2EPA A;  2JOX A;  2YTE A;  2B7T A;  2E1M A;  4LFC E;  3OTO E;  1JK2 A;  2LTR A;  1XNR E;  1JK1 A;  2UU9 E;  4R2C A;  1X5W A;  2EQ0 A;  3BGH A;  2B7V A;  2VRD A;  4DUY E;  4GEQ B;  2M9A A;  2EN8 A;  2VF1 A;  1L4S A;  2DRP A;  2EMK A;  3LML A;  1HNX E;  1RQ0 A;  2DIX A;  2EOZ A;  2EMW A;  4P7D A;  4JI6 E;  2MKN A;  1PJS A;  2YTF A;  4WPY A;  3ADG A;  2N3G A;  1QNT A;  4KWY A;  4R2P A;  4JI1 E;  2KON A;  1X48 A;  1BB8 A;  4N4R B;  3VYX A;  4F54 A;  1ZR9 A;  2JOB A;  2DMY A;  1MEY C;  2EJ4 A;  2LJH A;  5IXM B;  1UIL A;  3EPJ A;  1KJK A;  1ZBT A;  2RSM A;  1WHN A;  4LF8 E;  5BR8 E;  2GLI A;  3T1H E;  4GZN C;  2LT7 A;  2JVA A;  4LF9 E;  4KZS A;  2EMY A;  2ENH A;  2A25 A;  1UN6 B;  3P1X A; 
#chains in the Genus database with same CATH homology
 1YYW A;  2V85 A;  4F9C B;  4LU9 A;  4LF4 E;  3RMP A;  3T1Y E;  1N33 E;  4LFB E;  4WSP A;  4BMJ A;  2V86 A;  3AV0 A;  4R03 A;  1QU6 A;  4DKK A;  1XMQ E;  1N34 E;  1PKP A;  4Q28 A;  4M2Z A;  3HQ1 A;  2JWO A;  2ODR D;  4DR2 E;  4TUI A;  1I94 E;  3KWR A;  3MSW A;  3ZOQ B;  4DR3 E;  2B9D A;  2G7H A;  2L33 A;  4LF5 E;  3F6H A;  2LRS A;  4L8N A;  1DQ3 A;  4F9A B;  2L3C A;  2YZT A;  1YZ9 A;  4DUZ E;  1J5E E;  3OML A;  1DI2 A;  4JI3 E;  1FJG E;  4DV1 E;  4DMI A;  5T6J A;  5A2Q C;  3HPS A;  1WHQ A;  2L2N A;  2MC6 A;  5IT9 C;  4DR6 E;  4K0K E;  2B3T B;  4B3T E;  2K4V A;  2M1S A;  5LMN E;  1YYO A;  2UUB E;  3ADL A;  3JAM C;  2F4V E;  2NUF A;  2IHR 1;  2LMZ A;  3J7Y p;  2M4I A;  2NUE A;  1SR9 A;  1HNW E;  4DR4 E;  3J80 C;  3ADI A;  1STU A;  2V87 A;  5F3W A;  3J81 C;  4LFA E;  5CFF E;  4JI0 E;  4JI5 E;  3VK6 A;  2EWL A;  5AE1 A;  2V89 A;  4DR5 E;  2ODR C;  1GZ6 A;  5LMU E;  1UHZ A;  4WFT A;  4M30 A;  3J7A G;  3IWC A;  1GQE A;  2L3J A;  4DV5 E;  1IBM E;  4DV7 E;  5AE2 A;  3HTX A;  2VQE E;  1X47 A;  1T4N A;  4BC9 A;  2HHH E;  2UXB E;  3DJW A;  4I8O A;  4DV6 E;  4J8Z A;  2NUG A;  2RS6 A;  4NXM E;  4YHH E;  2FTX B;  3LLH A;  4LF6 E;  2M7Q A;  4F9B B;  1WXR A;  4LF7 E;  2UXD E;  1T4O A;  2DSY A;  5DNY A;  3FIG A;  1ZBQ A;  3K6Q A;  1YYK A;  2LUQ A;  4NXN E;  5ADZ A;  4P78 A;  4DR7 E;  2RS7 A;  1IBK E;  2JOX A;  2KHX A;  2B7T A;  2H36 X;  2E1M A;  2F8B A;  2NA2 A;  1EKZ A;  3OTO E;  4L5N C;  2LTR A;  4OOG C;  4LFC E;  1XNR E;  4JV5 E;  4DV0 E;  4LTY A;  2UU9 E;  4JI7 E;  1X49 A;  2B7V A;  2VE7 C;  2V83 A;  4BCA A;  4DUY E;  4GEQ B;  3ADJ A;  2UXC E;  2VF1 A;  1FKA E;  4BBY A;  3HPZ A;  4BS9 A;  3LML A;  4DV4 E;  1HNX E;  5IWA E;  1RQ0 A;  2UUA E;  1N36 E;  4JI2 E;  2DIX A;  2V8Q B;  4P7D A;  4M0V A;  2LUP B;  4AQY E;  3IWB A;  2L8T A;  4JI6 E;  2FGG A;  4JYA E;  2YT4 A;  2L6M A;  4WPY A;  3VYY A;  4OX9 E;  1N32 E;  3ADG A;  2N3G A;  2JY9 A;  2EZ6 A;  4BC7 A;  4JI1 E;  4GKJ E;  1RC7 A;  2LTS A;  2KON A;  3AUZ A;  3IWD A;  1X48 A;  4B3M E;  2MC5 A;  2L2M A;  2L2K B;  3VYX A;  3JTZ A;  5LL6 R;  4X64 E;  4F54 A;  5AE3 A;  4DV2 E;  2ZM6 E;  2LBS B;  4X66 E;  2VQF E;  5AAS A;  2JOB A;  4X62 E;  3H09 A;  2L92 A;  2DMY A;  2WZO A;  4GKK E;  4TUG A;  4B3R E;  2LJH A;  4DV3 E;  1T4L B;  2E5L E;  3C4B A;  2CPN A;  2KOU A;  3HXL A;  4DR1 E;  4R8O A;  4KHP E;  1J26 A;  4JI4 E;  2N3H A;  2RTX A;  3DF6 A;  4WYQ B;  1UIL A;  4YY3 E;  3JU0 A;  2JR1 A;  1ZBT A;  2DB2 A;  2RSM A;  4JI8 E;  1WHN A;  4LF8 E;  5FLX C;  2MDR A;  5BR8 E;  2V88 A;  1HR0 E;  3T1H E;  1HNZ E;  2FV4 B;  2JVA A;  1XMO E;  3C4T A;  4X8W A;  3F6G A;  1O0W A;  4KZS A;  2UUC E;  4LF9 E;  4B3S E;  4X65 E;  1IBL E;  1XNQ E;  2LE2 A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...