2L3JA

The solution structure of the adar2 dsrbm-rna complex reveals a sequence-specific read out of the minor groove
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
236
structure length
236
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 34
structure length 236
sequence length 236
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA01
1UILA 2DIXA 2B7VA 4JI3E 1T4NA 2RTXA 3OTOE 3ADGA 2MDRA 3P1XA 1T4LB 1X47A 1FJGE 4WYQB 2L3CA 2UXBE 4K0KE 4B3RE 4OX9E 2UXCE 5LMUE 4LFBE 1RC7A 4WFTA 2UUAE 4JI7E 1XMOE 1X48A 2E5LE 1WHNA 2NUGA 4DR1E 2NUFA 1HNWE 4DR6E 4JI1E 4X65E 2LTSA 2RS7A 3VYYA 3T1YE 2L2MA 4NXME 2L3JA 2IHR1 3ADLA 4GKJE 1J26A 1X49A 4DV6E 1I94E 4JI8E 1J5EE 2UUBE 4DUZE 1YZ9A 4GKKE 5CFFE 4LF4E 4DUYE 5IWAE 4LFAE 2RS6A 3VYXA 3T1HE 3ADIA 2N3GA 2L2KB 4DV4E 2JVAA 4OOGC 1T4OA 4B3ME 1YYOA 4YHHE 4DR5E 4DV2E 4JV5E 1STUA 2DMYA 4LF5E 1RQ0A 1WHQA 2DB2A 1XMQE 4B3TE 3C4BA 4X66E 4DR2E 1N34E 1DI2A 2LUPB 1HR0E 1UHZA 4DR3E 2LJHA 1HNXE 4NXNE 2ZM6E 4LF7E 4DR4E 4JYAE 2CPNA 2JY9A 2YT4A 4AQYE 4M2ZA 3C4TA 4X62E 4LF6E 2L2NA 1QU6A 2VQFE 2L33A 4X64E 2N3HA 4DV7E 2LTRA 2LRSA 2UUCE 4DV3E 2NUEA 3LLHA 4X8WA 2B3TB 2B7TA 4M30A 1IBKE 1FKAE 4DKKA 1N36E 4B3SE 1HNZE 2HHHE 4JI6E 1O0WA 1YYKA 4LF8E 2NA2A 2UXDE 3J7Yp 4JI0E 1IBLE 4DR7E 1YYWA 2F4VE 1EKZA 3ADJA 1XNRE 5BR8E 5LMNE 4DV0E 1ZBTA 4YY3E 4JI4E 4LF9E 4KHPE 1IBME 1PKPA 1N32E 2RSMA 2UU9E 3HTXA 2KHXA 4JI2E 4LFCE 2LBSB 1N33E 1XNQE 2EZ6A 4DV5E 2LUQA 1GQEA 2VQEE 4DV1E 4JI5E
chains in the Genus database with same CATH superfamily
1UILA 1AAYA 5A69A 3BF2A 2EN6A 4BHCA 1UN6B 2EMBA 2RTXA 4WXCA 2DSYA 5T6JA 1GTKA 1T4LB 2YWQA 2EOFA 4HEIA 4K0KE 4OX9E 5AASA 3J7AG 1RC7A 4WFTA 4ZYHA 4JI7E 2EM7A 5A6AA 1A1GA 4R2RA 2EMZA 1YUJA 3JAMC 4HTGA 1ZBQA 4DR6E 1A1JA 2EM0A 5A6BA 2YRMA 5KL3A 2EN8A 4LTYA 2EQ3A 1G2DC 5IXMB 1J26A 3FIGA 1X49A 4WX9A 2M4IA 2EPAA 3MHSC 2EPCA 1J5EE 2UUBE 2E72A 1YZ9A 2EMFA 5CFFE 3M99B 4DUYE 5AE2A 2JVAA 3HXLA 1T4OA 2DRPA 2EL6A 2EM3A 4B3ME 2EQ1A 3HPZA 4BMJA 1YYOA 2EOZA 4DV2E 4O5GA 2DB2A 3H09A 4R03A 1N34E 1DI2A 1UHZA 4F9BB 2LMZA 3C6KA 2LJHA 2YTPA 2WCC3 1A1LA 4L5NC 2YSPA 2EN4A 4RH8A 1EH8A 4AQYE 4LF6E 2ENCA 2YTQA 3F6HA 2MKNA 2V87A 4DV7E 4R2SA 1SFEA 1GZ6A 4TUIA 2YTFA 4DV3E 2NUEA 4WSGA 2EL5A 2B7TA 2EOXA 3VK6A 4F9AB 2YTEA 2EMLA 4MLQA 3J80C 2JWOA 1DQ3A 2WZOA 2YZTA 3LMLA 5KL6A 4JI0E 4Q35B 2EOQA 2EPNA 2LO3A 3EPKA 4GEQB 1EH7A 2EORA 2LCEA 4KHPE 2EMIA 5AC4A 2K7IA 2GHFA 2KHXA 5IV8B 2EOOA 2L6MA 3DJWA 4DV1E 1A1FA 2EOHA 1N3GA 2EOYA 2V83A 2HGHA 4DMIA 4M0VA 2KOUA 2YRKA 1TF6A 2DLKA 4MLVA 2EOSA 2EN1A 2RSIA 5ADZA 1KYQA 3EPLA 1TF3A 1X6FA 4WYQB 1PDAA 2EPXA 4F2JC 2V86A 2LVHA 2WBTA 2UXBE 4B3RE 2UXCE 2VF1A 2YTDA 4BBYA 1WHNA 1ZAAC 4ZYDA 2EPRA 4O4KA 4LU9A 3KZYA 2EPPA 5FLXC 2LE2A 2V89A 2BB8A 2E1MA 2RS7A 1ZR9A 3VYYA 2EJ4A 3F6GA 2L3JA 2IHR1 3ADLA 4GKJE 3BBGA 2EL4A 2JXPA 1X5WA 3VHTB 4DUZE 4GKKE 1ZU1A 1YSAC 4LF4E 5IWAE 4I8OA 1YPNA 4LFAE 2EP3A 3MSWA 3T1HE 5A2QC 2N3GA 2L2KB 4DV4E 3L00A 1A1HA 3VYXA 4OOGC 4YHHE 2D9HA 4DR5E 2ENAA 1MGTA 2DMYA 1RQ0A 4B3TE 4DR2E 1HR0E 4DR3E 4NXNE 2EQ0A 4R2QA 3AV0A 4LF7E 2K4VA 2CPNA 2YT4A 2F8BA 1X6EA 5KL5A 3MHHC 2L33A 4P78A 4X64E 2JPAA 1X6HA 2EWLA 3C6MA 2LRSA 2DLQA 4KWYA 4Q28A 2PRTA 4WPYA 2YRHA 2MC5A 2EMKA 1JK2A 1IQOA 2M7QA 2N8XA 1N36E 1HNZE 4JI6E 4R8OA 1O0WA 2NA2A 5DNYA 2M1SA 3J7Yp 1IBLE 5A6JA 2F4VE 1P47A 1WRJA 4WXDA 5LMNE 4DV0E 3TQMA 4YY3E 1IBME 2A25A 1PKPA 1WJPA 1B69A 4P7DA 3K6QA 4F6MA 1WXRA 4IS1C 4LFCE 2MKDA 2H36X 5IT9C 2LUQA 1GQEA 4ZYEA 1T39A 2CSHA 4JI5E 2JOXA 2M9AA 4RHBB 2EMGA 2JR1A 4JI3E 1T4NA 4NZVA 4R2AA 2EN3A 3OTOE 2MDRA 4ZYGA 3RMPA 1X47A 1FJGE 2L3CA 2EOIA 2EMYA 2JP9A 1BBGA 2ELYA 4F9CB 3EPHA 2UUAE 2FV4B 1XMOE 2EMAA 2NUGA 2EPKX 2ELZA 4TUGA 2NUFA 1HNWE 2G7HA 2HC5A 3KZZA 4BHBA 2YSOA 1TN9A 2LTSA 2YTJA 2L2MA 3ECRA 4R2DA 4NXME 3JTZA 4R2EA 2NABA 4BS9A 3EPJA 2BBGA 2YTGA 1A1KA 3IWCA 2V88A 2I9IA 2LT7A 1I94E 4FK5C 2L92A 1A1IA 2L8TA 1LLMC 2JYAA 1IMUA 2EM8A 3ADIA 5A6KA 2VE7C 2EOJA 3IWBA 2EOMA 1RMDA 1PJTA 3HPSA 4R2PA 5KL4A 4LF5E 1WHQA 2EMHA 1XMQE 3C4BA 4X66E 2LUPB 4BC9A 1HNXE 4JYAE 2J7JA 3C4TA 2DGCA 4X62E 4X9JA 2EMCA 2L2NA 5LLQA 2B9DA 1QU6A 5LL6R 2YTNA 2YTOA 2LTRA 2EPUA 4F54A 1NEIA 2I13A 2ENHA 4M30A 2ODRC 2EPMX 3HQ1A 1FKAE 2EM2A 1PJSA 4DKKA 4B3SE 4L8NA 4LF8E 1EH6A 2UXDE 1PJQA 2ADRA 4DR7E 2LV2A 1YYWA 3ADJA 2MC6A 1MEYC 2Q8UA 3EQ1A 2EM5A 2RQLA 2RPCA 1JK1A 1YUIA 1N32E 1IQSA 1YFHA 3THNA 1L4SA 1XNQE 2EN2A 2VRDA 3JU0A 4DV5E 5AC5A 5AE1A 2KONA 2EPZA 2R76A 2DIXA 2B7VA 2FTXB 2YPNA 1F2IG 3ADGA 3P1XA 4J8ZA 2HJJA 3IWDA 2EM9A 1T38A 2DMIA 5LMUE 4R2CA 4LFBE 2EOEA 2E5LE 1X48A 2WBSA 4DR1E 4WSPA 2CT1A 1KJKA 4JI1E 4BC7A 2ODRD 2EM6A 4X65E 3T1YE 1G2FC 2GPIA 2EMXA 3J81C 4DV6E 2LJUA 4JI8E 4IJDA 1NCSA 2EM4A 1QNTA 1DGCA 2RS6A 2YU5A 1X3CA 5F3WA 5KL7A 4JV5E 1STUA 1BBOA 4KZSA 2EE8A 2WBUA 2ZM6E 4DR4E 4M9VC 2FGGA 2JY9A 3OMLA 4M2ZA 4GZNC 2EPOA 2V85A 1BB8A 3ZOQB 1UBDC 2YU8A 2VQFE 3AUZA 1Z1BA 2R1FA 2N3HA 4O24A 3BIDA 5KL2A 3THOB 4O43A 5TSEA 5AE3A 3KWRA 2UUCE 3LLHA 4X8WA 2B3TB 4N4RB 1IBKE 2V8QB 4NHRA 4BCAA 2EN7A 2HHHE 2CTDA 3UK3C 1YYKA 3QG5C 1SR9A 1EKZA 2MDGA 1XNRE 5BR8E 4F6NA 1AH5A 2EMWA 3BGHA 1ZBTA 4JI4E 4LF9E 2RSMA 2UU9E 2EPLX 3HTXA 4JI2E 5A6BD 2GLIA 2JOBA 2LBSB 1N33E 2EZ6A 3DF6A 2VQEE 2YTIA
chains in the Genus database with same CATH topology
2V83A 1UILA 2DIXA 4DMIA 4M0VA 2JR1A 2KOUA 2B7VA 2FTXB 4JI3E 1T4NA 2RTXA 3OTOE 5ADZA 2DSYA 3ADGA 2MDRA 5T6JA 3P1XA 4J8ZA 1X47A 3RMPA 4WYQB 2L3CA 1T4LB 1FJGE 2V86A 3IWDA 2UXBE 4K0KE 4B3RE 4OX9E 2UXCE 5LMUE 5AASA 3J7AG 4LFBE 1RC7A 2VF1A 4F9CB 4WFTA 2UUAE 2FV4B 4JI7E 1X48A 4BBYA 1WHNA 1XMOE 2E5LE 2NUGA 4DR1E 4TUGA 3JAMC 2NUFA 2G7HA 4LU9A 4B3SE 1ZBQA 4WSPA 4DR6E 1HNWE 5FLXC 4JI1E 2LE2A 4BC7A 2ODRD 2E1MA 2V89A 2LTSA 2RS7A 4X65E 3VYYA 3T1YE 2L2MA 4B3TE 3F6GA 4NXME 3JTZA 2L3JA 2IHR1 4LTYA 4BS9A 3ADLA 4GKJE 1J26A 3FIGA 1X49A 3J81C 4DV6E 3IWCA 2M4IA 2V88A 1I94E 4JI8E 2L92A 1J5EE 2UUBE 4DUZE 1YZ9A 4GKKE 2L8TA 5CFFE 4LF4E 4DUYE 5IWAE 4I8OA 2RS6A 4LFAE 3MSWA 3T1HE 3ADIA 5A2QC 2N3GA 2L2KB 5AE2A 2JVAA 2VE7C 3HXLA 4DV4E 4OOGC 1T4OA 3IWBA 4B3ME 1YYOA 3HPZA 4BMJA 4YHHE 4DR5E 5F3WA 4DV2E 3HPSA 4JI5E 4JV5E 1STUA 2DMYA 4LF5E 1RQ0A 1WHQA 2DB2A 3H09A 4R03A 1XMQE 3C4BA 4KZSA 4X66E 4DR2E 1N34E 2LUPB 4BC9A 1UHZA 4F9BB 2LMZA 1HR0E 4DR3E 2LJHA 1HNXE 4NXNE 3AV0A 2ZM6E 4LF7E 2K4VA 4L5NC 4DR4E 4JYAE 2CPNA 2FGGA 2JY9A 2YT4A 3OMLA 2F8BA 4AQYE 3C4TA 4M2ZA 4X62E 2V85A 4LF6E 3ZOQB 2L2NA 2B9DA 1QU6A 3F6HA 5LL6R 2VQFE 2L33A 2V87A 3AUZA 4P78A 2N3HA 4X64E 4DV7E 2EWLA 2LTRA 1GZ6A 2LRSA 5AE3A 4TUIA 3KWRA 4DV3E 4F54A 2UUCE 3LLHA 4Q28A 2NUEA 4X8WA 2B3TB 2B7TA 2ODRC 4M30A 4WPYA 3VK6A 4F9AB 3HQ1A 1IBKE 2MC5A 2V8QB 1FKAE 3VYXA 2M7QA 4DKKA 3J80C 2JWOA 1N36E 4BCAA 1DQ3A 2WZOA 5IT9C 4L8NA 2YZTA 1O0WA 3LMLA 4R8OA 1HNZE 2HHHE 4JI6E 2NA2A 5DNYA 4LF8E 1YYKA 2M1SA 2UXDE 3J7Yp 4JI0E 1IBLE 4DR7E 1SR9A 1YYWA 2F4VE 1EKZA 3ADJA 1XNRE 5BR8E 5LMNE 2MC6A 4DV0E 4GEQB 1ZBTA 4YY3E 4JI4E 4LF9E 4KHPE 1IBME 1PKPA 1N32E 2RSMA 4P7DA 1DI2A 2UU9E 3K6QA 3HTXA 1WXRA 2KHXA 4JI2E 4LFCE 2JOBA 2LBSB 1XNQE 2EZ6A 1N33E 2H36X 3JU0A 2LUQA 1GQEA 4DV5E 3DF6A 2VQEE 2L6MA 3DJWA 5AE1A 4DV1E 2KONA 2JOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  2DIX A;  2B7V A;  4JI3 E;  1T4N A;  2RTX A;  3OTO E;  3ADG A;  2MDR A;  3P1X A;  1T4L B;  1X47 A;  1FJG E;  4WYQ B;  2L3C A;  2UXB E;  4K0K E;  4B3R E;  4OX9 E;  2UXC E;  5LMU E;  4LFB E;  1RC7 A;  4WFT A;  2UUA E;  4JI7 E;  1XMO E;  1X48 A;  2E5L E;  1WHN A;  2NUG A;  4DR1 E;  2NUF A;  1HNW E;  4DR6 E;  4JI1 E;  4X65 E;  2LTS A;  2RS7 A;  3VYY A;  3T1Y E;  2L2M A;  4NXM E;  2L3J A;  2IHR 1;  3ADL A;  4GKJ E;  1J26 A;  1X49 A;  4DV6 E;  1I94 E;  4JI8 E;  1J5E E;  2UUB E;  4DUZ E;  1YZ9 A;  4GKK E;  5CFF E;  4LF4 E;  4DUY E;  5IWA E;  4LFA E;  2RS6 A;  3VYX A;  3T1H E;  3ADI A;  2N3G A;  2L2K B;  4DV4 E;  2JVA A;  4OOG C;  1T4O A;  4B3M E;  1YYO A;  4YHH E;  4DR5 E;  4DV2 E;  4JV5 E;  1STU A;  2DMY A;  4LF5 E;  1RQ0 A;  1WHQ A;  2DB2 A;  1XMQ E;  4B3T E;  3C4B A;  4X66 E;  4DR2 E;  1N34 E;  1DI2 A;  2LUP B;  1HR0 E;  1UHZ A;  4DR3 E;  2LJH A;  1HNX E;  4NXN E;  2ZM6 E;  4LF7 E;  4DR4 E;  4JYA E;  2CPN A;  2JY9 A;  2YT4 A;  4AQY E;  4M2Z A;  3C4T A;  4X62 E;  4LF6 E;  2L2N A;  1QU6 A;  2VQF E;  2L33 A;  4X64 E;  2N3H A;  4DV7 E;  2LTR A;  2LRS A;  2UUC E;  4DV3 E;  2NUE A;  3LLH A;  4X8W A;  2B3T B;  2B7T A;  4M30 A;  1IBK E;  1FKA E;  4DKK A;  1N36 E;  4B3S E;  1HNZ E;  2HHH E;  4JI6 E;  1O0W A;  1YYK A;  4LF8 E;  2NA2 A;  2UXD E;  3J7Y p;  4JI0 E;  1IBL E;  4DR7 E;  1YYW A;  2F4V E;  1EKZ A;  3ADJ A;  1XNR E;  5BR8 E;  5LMN E;  4DV0 E;  1ZBT A;  4YY3 E;  4JI4 E;  4LF9 E;  4KHP E;  1IBM E;  1PKP A;  1N32 E;  2RSM A;  2UU9 E;  3HTX A;  2KHX A;  4JI2 E;  4LFC E;  2LBS B;  1N33 E;  1XNQ E;  2EZ6 A;  4DV5 E;  2LUQ A;  1GQE A;  2VQE E;  4DV1 E;  4JI5 E; 
#chains in the Genus database with same CATH topology
 1UIL A;  1AAY A;  5A69 A;  3BF2 A;  2EN6 A;  4BHC A;  1UN6 B;  2EMB A;  2RTX A;  4WXC A;  2DSY A;  5T6J A;  1GTK A;  1T4L B;  2YWQ A;  2EOF A;  4HEI A;  4K0K E;  4OX9 E;  5AAS A;  3J7A G;  1RC7 A;  4WFT A;  4ZYH A;  4JI7 E;  2EM7 A;  5A6A A;  1A1G A;  4R2R A;  2EMZ A;  1YUJ A;  3JAM C;  4HTG A;  1ZBQ A;  4DR6 E;  1A1J A;  2EM0 A;  5A6B A;  2YRM A;  5KL3 A;  2EN8 A;  4LTY A;  2EQ3 A;  1G2D C;  5IXM B;  1J26 A;  3FIG A;  1X49 A;  4WX9 A;  2M4I A;  2EPA A;  3MHS C;  2EPC A;  1J5E E;  2UUB E;  2E72 A;  1YZ9 A;  2EMF A;  5CFF E;  3M99 B;  4DUY E;  5AE2 A;  2JVA A;  3HXL A;  1T4O A;  2DRP A;  2EL6 A;  2EM3 A;  4B3M E;  2EQ1 A;  3HPZ A;  4BMJ A;  1YYO A;  2EOZ A;  4DV2 E;  4O5G A;  2DB2 A;  3H09 A;  4R03 A;  1N34 E;  1DI2 A;  1UHZ A;  4F9B B;  2LMZ A;  3C6K A;  2LJH A;  2YTP A;  2WCC 3;  1A1L A;  4L5N C;  2YSP A;  2EN4 A;  4RH8 A;  1EH8 A;  4AQY E;  4LF6 E;  2ENC A;  2YTQ A;  3F6H A;  2MKN A;  2V87 A;  4DV7 E;  4R2S A;  1SFE A;  1GZ6 A;  4TUI A;  2YTF A;  4DV3 E;  2NUE A;  4WSG A;  2EL5 A;  2B7T A;  2EOX A;  3VK6 A;  4F9A B;  2YTE A;  2EML A;  4MLQ A;  3J80 C;  2JWO A;  1DQ3 A;  2WZO A;  2YZT A;  3LML A;  5KL6 A;  4JI0 E;  4Q35 B;  2EOQ A;  2EPN A;  2LO3 A;  3EPK A;  4GEQ B;  1EH7 A;  2EOR A;  2LCE A;  4KHP E;  2EMI A;  5AC4 A;  2K7I A;  2GHF A;  2KHX A;  5IV8 B;  2EOO A;  2L6M A;  3DJW A;  4DV1 E;  1A1F A;  2EOH A;  1N3G A;  2EOY A;  2V83 A;  2HGH A;  4DMI A;  4M0V A;  2KOU A;  2YRK A;  1TF6 A;  2DLK A;  4MLV A;  2EOS A;  2EN1 A;  2RSI A;  5ADZ A;  1KYQ A;  3EPL A;  1TF3 A;  1X6F A;  4WYQ B;  1PDA A;  2EPX A;  4F2J C;  2V86 A;  2LVH A;  2WBT A;  2UXB E;  4B3R E;  2UXC E;  2VF1 A;  2YTD A;  4BBY A;  1WHN A;  1ZAA C;  4ZYD A;  2EPR A;  4O4K A;  4LU9 A;  3KZY A;  2EPP A;  5FLX C;  2LE2 A;  2V89 A;  2BB8 A;  2E1M A;  2RS7 A;  1ZR9 A;  3VYY A;  2EJ4 A;  3F6G A;  2L3J A;  2IHR 1;  3ADL A;  4GKJ E;  3BBG A;  2EL4 A;  2JXP A;  1X5W A;  3VHT B;  4DUZ E;  4GKK E;  1ZU1 A;  1YSA C;  4LF4 E;  5IWA E;  4I8O A;  1YPN A;  4LFA E;  2EP3 A;  3MSW A;  3T1H E;  5A2Q C;  2N3G A;  2L2K B;  4DV4 E;  3L00 A;  1A1H A;  3VYX A;  4OOG C;  4YHH E;  2D9H A;  4DR5 E;  2ENA A;  1MGT A;  2DMY A;  1RQ0 A;  4B3T E;  4DR2 E;  1HR0 E;  4DR3 E;  4NXN E;  2EQ0 A;  4R2Q A;  3AV0 A;  4LF7 E;  2K4V A;  2CPN A;  2YT4 A;  2F8B A;  1X6E A;  5KL5 A;  3MHH C;  2L33 A;  4P78 A;  4X64 E;  2JPA A;  1X6H A;  2EWL A;  3C6M A;  2LRS A;  2DLQ A;  4KWY A;  4Q28 A;  2PRT A;  4WPY A;  2YRH A;  2MC5 A;  2EMK A;  1JK2 A;  1IQO A;  2M7Q A;  2N8X A;  1N36 E;  1HNZ E;  4JI6 E;  4R8O A;  1O0W A;  2NA2 A;  5DNY A;  2M1S A;  3J7Y p;  1IBL E;  5A6J A;  2F4V E;  1P47 A;  1WRJ A;  4WXD A;  5LMN E;  4DV0 E;  3TQM A;  4YY3 E;  1IBM E;  2A25 A;  1PKP A;  1WJP A;  1B69 A;  4P7D A;  3K6Q A;  4F6M A;  1WXR A;  4IS1 C;  4LFC E;  2MKD A;  2H36 X;  5IT9 C;  2LUQ A;  1GQE A;  4ZYE A;  1T39 A;  2CSH A;  4JI5 E;  2JOX A;  2M9A A;  4RHB B;  2EMG A;  2JR1 A;  4JI3 E;  1T4N A;  4NZV A;  4R2A A;  2EN3 A;  3OTO E;  2MDR A;  4ZYG A;  3RMP A;  1X47 A;  1FJG E;  2L3C A;  2EOI A;  2EMY A;  2JP9 A;  1BBG A;  2ELY A;  4F9C B;  3EPH A;  2UUA E;  2FV4 B;  1XMO E;  2EMA A;  2NUG A;  2EPK X;  2ELZ A;  4TUG A;  2NUF A;  1HNW E;  2G7H A;  2HC5 A;  3KZZ A;  4BHB A;  2YSO A;  1TN9 A;  2LTS A;  2YTJ A;  2L2M A;  3ECR A;  4R2D A;  4NXM E;  3JTZ A;  4R2E A;  2NAB A;  4BS9 A;  3EPJ A;  2BBG A;  2YTG A;  1A1K A;  3IWC A;  2V88 A;  2I9I A;  2LT7 A;  1I94 E;  4FK5 C;  2L92 A;  1A1I A;  2L8T A;  1LLM C;  2JYA A;  1IMU A;  2EM8 A;  3ADI A;  5A6K A;  2VE7 C;  2EOJ A;  3IWB A;  2EOM A;  1RMD A;  1PJT A;  3HPS A;  4R2P A;  5KL4 A;  4LF5 E;  1WHQ A;  2EMH A;  1XMQ E;  3C4B A;  4X66 E;  2LUP B;  4BC9 A;  1HNX E;  4JYA E;  2J7J A;  3C4T A;  2DGC A;  4X62 E;  4X9J A;  2EMC A;  2L2N A;  5LLQ A;  2B9D A;  1QU6 A;  5LL6 R;  2YTN A;  2YTO A;  2LTR A;  2EPU A;  4F54 A;  1NEI A;  2I13 A;  2ENH A;  4M30 A;  2ODR C;  2EPM X;  3HQ1 A;  1FKA E;  2EM2 A;  1PJS A;  4DKK A;  4B3S E;  4L8N A;  4LF8 E;  1EH6 A;  2UXD E;  1PJQ A;  2ADR A;  4DR7 E;  2LV2 A;  1YYW A;  3ADJ A;  2MC6 A;  1MEY C;  2Q8U A;  3EQ1 A;  2EM5 A;  2RQL A;  2RPC A;  1JK1 A;  1YUI A;  1N32 E;  1IQS A;  1YFH A;  3THN A;  1L4S A;  1XNQ E;  2EN2 A;  2VRD A;  3JU0 A;  4DV5 E;  5AC5 A;  5AE1 A;  2KON A;  2EPZ A;  2R76 A;  2DIX A;  2B7V A;  2FTX B;  2YPN A;  1F2I G;  3ADG A;  3P1X A;  4J8Z A;  2HJJ A;  3IWD A;  2EM9 A;  1T38 A;  2DMI A;  5LMU E;  4R2C A;  4LFB E;  2EOE A;  2E5L E;  1X48 A;  2WBS A;  4DR1 E;  4WSP A;  2CT1 A;  1KJK A;  4JI1 E;  4BC7 A;  2ODR D;  2EM6 A;  4X65 E;  3T1Y E;  1G2F C;  2GPI A;  2EMX A;  3J81 C;  4DV6 E;  2LJU A;  4JI8 E;  4IJD A;  1NCS A;  2EM4 A;  1QNT A;  1DGC A;  2RS6 A;  2YU5 A;  1X3C A;  5F3W A;  5KL7 A;  4JV5 E;  1STU A;  1BBO A;  4KZS A;  2EE8 A;  2WBU A;  2ZM6 E;  4DR4 E;  4M9V C;  2FGG A;  2JY9 A;  3OML A;  4M2Z A;  4GZN C;  2EPO A;  2V85 A;  1BB8 A;  3ZOQ B;  1UBD C;  2YU8 A;  2VQF E;  3AUZ A;  1Z1B A;  2R1F A;  2N3H A;  4O24 A;  3BID A;  5KL2 A;  3THO B;  4O43 A;  5TSE A;  5AE3 A;  3KWR A;  2UUC E;  3LLH A;  4X8W A;  2B3T B;  4N4R B;  1IBK E;  2V8Q B;  4NHR A;  4BCA A;  2EN7 A;  2HHH E;  2CTD A;  3UK3 C;  1YYK A;  3QG5 C;  1SR9 A;  1EKZ A;  2MDG A;  1XNR E;  5BR8 E;  4F6N A;  1AH5 A;  2EMW A;  3BGH A;  1ZBT A;  4JI4 E;  4LF9 E;  2RSM A;  2UU9 E;  2EPL X;  3HTX A;  4JI2 E;  5A6B D;  2GLI A;  2JOB A;  2LBS B;  1N33 E;  2EZ6 A;  3DF6 A;  2VQE E;  2YTI A; 
#chains in the Genus database with same CATH homology
 2V83 A;  1UIL A;  2DIX A;  4DMI A;  4M0V A;  2JR1 A;  2KOU A;  2B7V A;  2FTX B;  4JI3 E;  1T4N A;  2RTX A;  3OTO E;  5ADZ A;  2DSY A;  3ADG A;  2MDR A;  5T6J A;  3P1X A;  4J8Z A;  1X47 A;  3RMP A;  4WYQ B;  2L3C A;  1T4L B;  1FJG E;  2V86 A;  3IWD A;  2UXB E;  4K0K E;  4B3R E;  4OX9 E;  2UXC E;  5LMU E;  5AAS A;  3J7A G;  4LFB E;  1RC7 A;  2VF1 A;  4F9C B;  4WFT A;  2UUA E;  2FV4 B;  4JI7 E;  1X48 A;  4BBY A;  1WHN A;  1XMO E;  2E5L E;  2NUG A;  4DR1 E;  4TUG A;  3JAM C;  2NUF A;  2G7H A;  4LU9 A;  4B3S E;  1ZBQ A;  4WSP A;  4DR6 E;  1HNW E;  5FLX C;  4JI1 E;  2LE2 A;  4BC7 A;  2ODR D;  2E1M A;  2V89 A;  2LTS A;  2RS7 A;  4X65 E;  3VYY A;  3T1Y E;  2L2M A;  4B3T E;  3F6G A;  4NXM E;  3JTZ A;  2L3J A;  2IHR 1;  4LTY A;  4BS9 A;  3ADL A;  4GKJ E;  1J26 A;  3FIG A;  1X49 A;  3J81 C;  4DV6 E;  3IWC A;  2M4I A;  2V88 A;  1I94 E;  4JI8 E;  2L92 A;  1J5E E;  2UUB E;  4DUZ E;  1YZ9 A;  4GKK E;  2L8T A;  5CFF E;  4LF4 E;  4DUY E;  5IWA E;  4I8O A;  2RS6 A;  4LFA E;  3MSW A;  3T1H E;  3ADI A;  5A2Q C;  2N3G A;  2L2K B;  5AE2 A;  2JVA A;  2VE7 C;  3HXL A;  4DV4 E;  4OOG C;  1T4O A;  3IWB A;  4B3M E;  1YYO A;  3HPZ A;  4BMJ A;  4YHH E;  4DR5 E;  5F3W A;  4DV2 E;  3HPS A;  4JI5 E;  4JV5 E;  1STU A;  2DMY A;  4LF5 E;  1RQ0 A;  1WHQ A;  2DB2 A;  3H09 A;  4R03 A;  1XMQ E;  3C4B A;  4KZS A;  4X66 E;  4DR2 E;  1N34 E;  2LUP B;  4BC9 A;  1UHZ A;  4F9B B;  2LMZ A;  1HR0 E;  4DR3 E;  2LJH A;  1HNX E;  4NXN E;  3AV0 A;  2ZM6 E;  4LF7 E;  2K4V A;  4L5N C;  4DR4 E;  4JYA E;  2CPN A;  2FGG A;  2JY9 A;  2YT4 A;  3OML A;  2F8B A;  4AQY E;  3C4T A;  4M2Z A;  4X62 E;  2V85 A;  4LF6 E;  3ZOQ B;  2L2N A;  2B9D A;  1QU6 A;  3F6H A;  5LL6 R;  2VQF E;  2L33 A;  2V87 A;  3AUZ A;  4P78 A;  2N3H A;  4X64 E;  4DV7 E;  2EWL A;  2LTR A;  1GZ6 A;  2LRS A;  5AE3 A;  4TUI A;  3KWR A;  4DV3 E;  4F54 A;  2UUC E;  3LLH A;  4Q28 A;  2NUE A;  4X8W A;  2B3T B;  2B7T A;  2ODR C;  4M30 A;  4WPY A;  3VK6 A;  4F9A B;  3HQ1 A;  1IBK E;  2MC5 A;  2V8Q B;  1FKA E;  3VYX A;  2M7Q A;  4DKK A;  3J80 C;  2JWO A;  1N36 E;  4BCA A;  1DQ3 A;  2WZO A;  5IT9 C;  4L8N A;  2YZT A;  1O0W A;  3LML A;  4R8O A;  1HNZ E;  2HHH E;  4JI6 E;  2NA2 A;  5DNY A;  4LF8 E;  1YYK A;  2M1S A;  2UXD E;  3J7Y p;  4JI0 E;  1IBL E;  4DR7 E;  1SR9 A;  1YYW A;  2F4V E;  1EKZ A;  3ADJ A;  1XNR E;  5BR8 E;  5LMN E;  2MC6 A;  4DV0 E;  4GEQ B;  1ZBT A;  4YY3 E;  4JI4 E;  4LF9 E;  4KHP E;  1IBM E;  1PKP A;  1N32 E;  2RSM A;  4P7D A;  1DI2 A;  2UU9 E;  3K6Q A;  3HTX A;  1WXR A;  2KHX A;  4JI2 E;  4LFC E;  2JOB A;  2LBS B;  1XNQ E;  2EZ6 A;  1N33 E;  2H36 X;  3JU0 A;  2LUQ A;  1GQE A;  4DV5 E;  3DF6 A;  2VQE E;  2L6M A;  3DJW A;  5AE1 A;  4DV1 E;  2KON A;  2JOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...