2L3JA

The solution structure of the adar2 dsrbm-rna complex reveals a sequence-specific read out of the minor groove
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
236
structure length
236
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 34
structure length 236
sequence length 236
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA01
1XNQE 2YT4A 4JI1E 5LMUE 5BR8E 2L33A 1X47A 4M30A 1T4OA 4DKKA 1ZBTA 4X65E 2E5LE 3C4TA 2DIXA 4DUYE 3ADLA 4LF6E 1IBLE 1XMQE 4DR4E 2VQEE 3T1HE 4OX9E 1X49A 4DUZE 1EKZA 2LUQA 1T4LB 4KHPE 3ADJA 2KHXA 4DV7E 4GKJE 1GQEA 2N3HA 2LTSA 4LF5E 2LJHA 1N33E 1UILA 2L2KB 4LFCE 4DR1E 1N32E 1FJGE 4DV2E 2L3JA 4DV3E 1X48A 4M2ZA 2B7VA 4LF9E 1J26A 3VYYA 1HNZE 4JI3E 1XNRE 1T4NA 2IHR1 2LBSB 1HNXE 1UHZA 5IWAE 2UU9E 4B3SE 4NXNE 3ADIA 2HHHE 2LTRA 2ZM6E 4JI0E 2UUBE 2JVAA 4K0KE 4DR7E 1HNWE 3LLHA 2B3TB 4DV4E 4JI2E 1YYOA 4DR6E 1WHNA 4DV0E 4X62E 2RSMA 1QU6A 5CFFE 4AQYE 2CPNA 1IBME 4LF8E 2NUEA 4LF7E 4GKKE 1N36E 1YYWA 1YZ9A 4JV5E 1RQ0A 2UUCE 4B3TE 2L2NA 4WFTA 3J7Yp 3C4BA 2DMYA 1YYKA 4X66E 2LRSA 1DI2A 2N3GA 1J5EE 1N34E 4JI6E 2L3CA 4JYAE 1IBKE 2UXDE 4WYQB 2DB2A 2UXCE 2UUAE 3HTXA 4LFBE 3P1XA 3VYXA 4LF4E 2NUFA 4OOGC 4X64E 1HR0E 2MDRA 2LUPB 2EZ6A 2UXBE 4LFAE 4JI7E 2RTXA 3OTOE 5LMNE 1FKAE 4DV1E 3ADGA 4X8WA 3T1YE 4DR3E 4JI5E 1WHQA 4JI8E 2L2MA 1RC7A 2JY9A 4YHHE 2B7TA 2NA2A 2RS6A 1XMOE 4YY3E 4DV5E 2VQFE 4DR2E 4NXME 2NUGA 2F4VE 1PKPA 1I94E 4B3RE 2RS7A 1STUA 1O0WA 4DV6E 4B3ME 4JI4E 4DR5E
chains in the Genus database with same CATH superfamily
1XNQE 2YPNA 5LMUE 4Q28A 3DJWA 2L92A 2FV4B 2E72A 4X65E 2HC5A 5F3WA 2DLQA 2EM4A 2ELYA 2JR1A 2EPZA 1X49A 1ZU1A 2YTFA 2LUQA 3TQMA 4TUGA 1NCSA 1BB8A 2LV2A 4MLVA 4NZVA 2EM2A 2VRDA 4DR1E 2YRHA 1X3CA 2K7IA 2N8XA 1X48A 4N4RB 1J26A 1TF6A 5KL7A 1HNZE 2D9HA 2EM9A 1XNRE 2IHR1 1HNXE 1NEIA 2LTRA 3RMPA 4JI0E 1YFHA 2G7HA 2JVAA 3K6QA 4F6NA 4R2QA 2EOYA 4ZYGA 4JI2E 2EOOA 3BBGA 2RPCA 1WHNA 4DV0E 4F6MA 2RSMA 4AQYE 1MEYC 4F9BB 4LF7E 4GKKE 2WBTA 4JV5E 1RQ0A 3THOB 3VK6A 2MKNA 2DMYA 5A6AA 3IWBA 1YYKA 5AC5A 4X66E 2EN3A 1A1IA 4R2PA 1B69A 4BMJA 2CTDA 1X6EA 2Q8UA 1J5EE 4JI6E 2JXPA 3HQ1A 2DB2A 1AAYA 3DF6A 3HTXA 3VYXA 2BB8A 4ZYHA 4X64E 2FTXB 2UXBE 4P7DA 3EPLA 4TUIA 1FKAE 2ENCA 1N3GA 4X9JA 3ADGA 1UBDC 2YRKA 3T1YE 2EOQA 1LLMC 4JI8E 2L2MA 5LLQA 1AH5A 2EPXA 2EPMX 2EOJA 1A1LA 4O5GA 1F2IG 3F6GA 1XMOE 4Q35B 4DR2E 4J8ZA 4NXME 2B9DA 5KL2A 2EWLA 2EN2A 2YTOA 4R2DA 4B3RE 2EPKX 2RS7A 4DV6E 2EMFA 4DR5E 2WZOA 1A1GA 4JI1E 2JOXA 2LVHA 2V89A 2LJUA 2EMAA 2EN8A 1YUJA 1X47A 1JK2A 2PRTA 1GZ6A 3J81C 2WBUA 3MSWA 2E5LE 4BBYA 3C4TA 2DIXA 5AE3A 4LF6E 2YTIA 2JOBA 1XMQE 3AUZA 2VQEE 2NABA 1EKZA 1KYQA 4DUZE 4KHPE 2EQ0A 4GKJE 5IXMB 2I13A 1N33E 3THNA 4BC9A 2L2KB 2EE8A 1N32E 2ODRD 1FJGE 2RSIA 4DV3E 2EOSA 1T38A 1EH6A 4ZYEA 4IJDA 5KL3A 1IQOA 2ENAA 3OMLA 2YTQA 2EN7A 3VYYA 2JPAA 4JI3E 2LBSB 3HXLA 1A1HA 1P47A 2EPOA 2GLIA 2EPRA 1L4SA 1ZR9A 2JP9A 2YTNA 4WSGA 4K0KE 4DR7E 4O24A 2JWOA 3LLHA 4HEIA 4DV4E 1IMUA 3M99B 1YYOA 4DR6E 1MGTA 3H09A 3HPZA 4X62E 1QU6A 5TSEA 5CFFE 2CPNA 1IBME 4LF8E 1ZAAC 3VHTB 4O4KA 4I8OA 2UUCE 4F54A 2L2NA 3KWRA 3IWCA 2EL5A 5T6JA 4WSPA 3F6HA 4BC7A 2HJJA 2KOUA 2EOXA 2EMCA 2EM5A 2R76A 1A1JA 1N34E 2LCEA 2L3CA 2YU8A 4JYAE 4HTGA 2EMGA 1IBKE 2MDGA 4WYQB 2J7JA 4KWYA 4LFBE 2MDRA 2ADRA 2EP3A 2EPNA 2EORA 4JI7E 4LFAE 3J7AG 3OTOE 2DLKA 2EMZA 3BGHA 4DV1E 2DMIA 4BCAA 2KONA 2EOMA 4DR3E 2V8QB 1WRJA 2EPLX 2MC6A 2NA2A 4BHBA 2EJ4A 4NHRA 5KL5A 2EM0A 4IS1C 4WX9A 4L8NA 2NUGA 4ZYDA 3EQ1A 2L6MA 1O0WA 1GTKA 3J80C 2YU5A 2EOIA 2YT4A 1DQ3A 2FGGA 1X6FA 5A69A 2BBGA 5BR8E 2L33A 2DSYA 4M30A 2M9AA 4DKKA 2EMXA 2E1MA 4DR4E 2R1FA 2WCC3 5A6KA 2YSPA 3FIGA 5FLXC 2DRPA 2JYAA 4P78A 2EM3A 1UILA 2MKDA 2YTGA 5AE1A 2EMHA 3EPHA 4DV2E 4R8OA 2EL4A 4LU9A 3MHHC 2EMIA 1T4NA 1UHZA 5IWAE 2EPPA 1Z1BA 1YSAC 4R2EA 2ODRC 3LMLA 4M9VC 1HNWE 1T39A 2EOZA 4BHCA 4O43A 3MHSC 4GEQB 3JTZA 2CT1A 2GPIA 3BF2A 1PDAA 2EPAA 3KZZA 1YZ9A 2ENHA 1QNTA 2V83A 3ECRA 3J7Yp 5DNYA 2LRSA 5AC4A 2A25A 5LL6R 3HPSA 3C6KA 2L8TA 2UXDE 4BS9A 2M7QA 2UUAE 2LT7A 1WJPA 2EMLA 2EN6A 4OOGC 2LUPB 1TN9A 2EMWA 2YRMA 1EH7A 2EMYA 2RTXA 5LMNE 5AASA 3KZYA 4GZNC 2LMZA 2EQ3A 1SR9A 4X8WA 2GHFA 4JI5E 1WHQA 3UK3C 1RC7A 4YHHE 1UN6B 2B7TA 2V88A 2EM6A 1G2FC 2RS6A 2EN1A 4DV5E 1BBGA 2VQFE 2F4VE 1PKPA 2ELZA 1I94E 5KL4A 2EM8A 2YTJA 3EPJA 1A1FA 1STUA 5AE2A 4B3ME 3C6MA 4JI4E 3JU0A 2EPUA 1X5WA 5A6JA 1TF3A 1T4OA 2LE2A 4M0VA 1ZBTA 4R03A 3QG5C 2H36X 4DUYE 3ADLA 1IBLE 3T1HE 4OX9E 1T4LB 3ADJA 5A6BA 2KHXA 4DV7E 1GQEA 2N3HA 2EQ1A 2LTSA 4LF5E 2LJHA 1ZBQA 2EOEA 4LFCE 3AV0A 4RHBB 4R2RA 2YSOA 2WBSA 1A1KA 2HGHA 2M4IA 2EN4A 4WXCA 2L3JA 1PJTA 4M2ZA 2B7VA 1PJQA 4LF9E 4WPYA 2EL6A 5A2QC 2VF1A 2F8BA 3L00A 4F9AB 3JAMC 2UU9E 1X6HA 2RQLA 4B3SE 4NXNE 3ADIA 2HHHE 2ZM6E 2UUBE 5KL6A 3IWDA 2V86A 1G2DC 1KJKA 2B3TB 4FK5C 2DGCA 2NUEA 1N36E 1YYWA 2I9IA 1WXRA 4B3TE 4WFTA 1RMDA 2CSHA 3C4BA 2YZTA 2LO3A 2K4VA 1YPNA 2MC5A 4DMIA 1DI2A 2N3GA 2YTDA 4R2CA 2V85A 2EMBA 5A6BD 4F2JC 2V87A 4LTYA 4MLQA 2YWQA 2M1SA 1DGCA 4KZSA 2UXCE 1JK1A 5IV8B 3P1XA 2YTPA 4LF4E 2NUFA 3BIDA 1HR0E 2EZ6A 2EMKA 1IQSA 2EPCA 1PJSA 4L5NC 2EM7A 5ADZA 3EPKA 2JY9A 5IT9C 1EH8A 2EOFA 2YTEA 4RH8A 2EOHA 4R2AA 4R2SA 4YY3E 1SFEA 2VE7C 3ZOQB 4F9CB 1BBOA 1YUIA 4WXDA
chains in the Genus database with same CATH topology
1XNQE 2YT4A 4JI1E 1DQ3A 2FGGA 5LMUE 2JOXA 2V89A 3JU0A 4Q28A 5BR8E 2L33A 3DJWA 2DSYA 1X47A 1GZ6A 4M30A 1T4OA 2L92A 2FV4B 2LE2A 4M0VA 3J81C 4DKKA 1ZBTA 4X65E 3MSWA 4R03A 2E5LE 4BBYA 3C4TA 2DIXA 2H36X 5AE3A 4DUYE 5F3WA 2JOBA 4LF6E 2E1MA 1XMQE 1IBLE 3ADLA 2JR1A 3AUZA 2VQEE 3T1HE 4OX9E 4DR4E 1X49A 4DUZE 1EKZA 2LUQA 1T4LB 4KHPE 3ADJA 3FIGA 2KHXA 4DV7E 4GKJE 1GQEA 5FLXC 2N3HA 4TUGA 2LTSA 4LF5E 2LJHA 1ZBQA 1N33E 4P78A 1UILA 4BC9A 2L2KB 4LFCE 3AV0A 4DR1E 1N32E 5AE1A 2M4IA 2ODRD 4DV2E 4R8OA 2L3JA 4DV3E 1FJGE 1X48A 4M2ZA 2B7VA 4LF9E 4WPYA 1J26A 5A2QC 4LU9A 2VF1A 3OMLA 2F8BA 3VYYA 4F9AB 1HNZE 4JI3E 3JAMC 1XNRE 1T4NA 2IHR1 2LBSB 1HNXE 1UHZA 3HXLA 5IWAE 2UU9E 4B3SE 4NXNE 3ADIA 2HHHE 2LTRA 3RMPA 2ZM6E 4JI0E 2UUBE 2G7HA 2JVAA 3IWDA 2V86A 3K6QA 4K0KE 4DR7E 2ODRC 3LMLA 1HNWE 2JWOA 3LLHA 2B3TB 4DV4E 4JI2E 1YYOA 4DR6E 3H09A 1WHNA 4DV0E 3HPZA 2RSMA 1QU6A 5CFFE 4X62E 2CPNA 4AQYE 1IBME 4F9BB 4GEQB 4LF8E 4LF7E 2NUEA 4GKKE 3JTZA 1N36E 1YYWA 1YZ9A 1WXRA 4I8OA 4JV5E 2V83A 1RQ0A 2UUCE 4F54A 2L2NA 3KWRA 3IWCA 4WFTA 4B3TE 5T6JA 3C4BA 4WSPA 3VK6A 5DNYA 2YZTA 3F6HA 2DMYA 4BC7A 3J7Yp 3IWBA 1YYKA 2K4VA 2KOUA 4X66E 2LRSA 2MC5A 4BMJA 4DMIA 1DI2A 2N3GA 1J5EE 1N34E 4JI6E 2V85A 5LL6R 3HPSA 2L3CA 2V87A 4JYAE 3HQ1A 2L8TA 1IBKE 2UXDE 4LTYA 4BS9A 2M7QA 2M1SA 4WYQB 2DB2A 3DF6A 4KZSA 2UXCE 2UUAE 3HTXA 4LFBE 3P1XA 3VYXA 4LF4E 2NUFA 4OOGC 4X64E 2FTXB 1HR0E 2MDRA 2LUPB 2EZ6A 2UXBE 4P7DA 4LFAE 3J7AG 4JI7E 2RTXA 3OTOE 5LMNE 4TUIA 1FKAE 5AASA 4DV1E 4BCAA 2LMZA 2KONA 3ADGA 1SR9A 4X8WA 3T1YE 4DR3E 4JI5E 1WHQA 4L5NC 4JI8E 2L2MA 2V8QB 5ADZA 1RC7A 2JY9A 4YHHE 2MC6A 5IT9C 2B7TA 2V88A 2NA2A 3F6GA 2RS6A 1XMOE 4YY3E 4DV5E 2VQFE 4L8NA 4J8ZA 4DR2E 4NXME 2VE7C 2NUGA 1PKPA 2F4VE 2B9DA 1I94E 2EWLA 4B3RE 2L6MA 2RS7A 1STUA 1O0WA 3ZOQB 4F9CB 5AE2A 4DV6E 4B3ME 4JI4E 4DR5E 3J80C 2WZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ E;  2YT4 A;  4JI1 E;  5LMU E;  5BR8 E;  2L33 A;  1X47 A;  4M30 A;  1T4O A;  4DKK A;  1ZBT A;  4X65 E;  2E5L E;  3C4T A;  2DIX A;  4DUY E;  3ADL A;  4LF6 E;  1IBL E;  1XMQ E;  4DR4 E;  2VQE E;  3T1H E;  4OX9 E;  1X49 A;  4DUZ E;  1EKZ A;  2LUQ A;  1T4L B;  4KHP E;  3ADJ A;  2KHX A;  4DV7 E;  4GKJ E;  1GQE A;  2N3H A;  2LTS A;  4LF5 E;  2LJH A;  1N33 E;  1UIL A;  2L2K B;  4LFC E;  4DR1 E;  1N32 E;  1FJG E;  4DV2 E;  2L3J A;  4DV3 E;  1X48 A;  4M2Z A;  2B7V A;  4LF9 E;  1J26 A;  3VYY A;  1HNZ E;  4JI3 E;  1XNR E;  1T4N A;  2IHR 1;  2LBS B;  1HNX E;  1UHZ A;  5IWA E;  2UU9 E;  4B3S E;  4NXN E;  3ADI A;  2HHH E;  2LTR A;  2ZM6 E;  4JI0 E;  2UUB E;  2JVA A;  4K0K E;  4DR7 E;  1HNW E;  3LLH A;  2B3T B;  4DV4 E;  4JI2 E;  1YYO A;  4DR6 E;  1WHN A;  4DV0 E;  4X62 E;  2RSM A;  1QU6 A;  5CFF E;  4AQY E;  2CPN A;  1IBM E;  4LF8 E;  2NUE A;  4LF7 E;  4GKK E;  1N36 E;  1YYW A;  1YZ9 A;  4JV5 E;  1RQ0 A;  2UUC E;  4B3T E;  2L2N A;  4WFT A;  3J7Y p;  3C4B A;  2DMY A;  1YYK A;  4X66 E;  2LRS A;  1DI2 A;  2N3G A;  1J5E E;  1N34 E;  4JI6 E;  2L3C A;  4JYA E;  1IBK E;  2UXD E;  4WYQ B;  2DB2 A;  2UXC E;  2UUA E;  3HTX A;  4LFB E;  3P1X A;  3VYX A;  4LF4 E;  2NUF A;  4OOG C;  4X64 E;  1HR0 E;  2MDR A;  2LUP B;  2EZ6 A;  2UXB E;  4LFA E;  4JI7 E;  2RTX A;  3OTO E;  5LMN E;  1FKA E;  4DV1 E;  3ADG A;  4X8W A;  3T1Y E;  4DR3 E;  4JI5 E;  1WHQ A;  4JI8 E;  2L2M A;  1RC7 A;  2JY9 A;  4YHH E;  2B7T A;  2NA2 A;  2RS6 A;  1XMO E;  4YY3 E;  4DV5 E;  2VQF E;  4DR2 E;  4NXM E;  2NUG A;  2F4V E;  1PKP A;  1I94 E;  4B3R E;  2RS7 A;  1STU A;  1O0W A;  4DV6 E;  4B3M E;  4JI4 E;  4DR5 E; 
#chains in the Genus database with same CATH topology
 1XNQ E;  2YPN A;  5LMU E;  4Q28 A;  3DJW A;  2L92 A;  2FV4 B;  2E72 A;  4X65 E;  2HC5 A;  5F3W A;  2DLQ A;  2EM4 A;  2ELY A;  2JR1 A;  2EPZ A;  1X49 A;  1ZU1 A;  2YTF A;  2LUQ A;  3TQM A;  4TUG A;  1NCS A;  1BB8 A;  2LV2 A;  4MLV A;  4NZV A;  2EM2 A;  2VRD A;  4DR1 E;  2YRH A;  1X3C A;  2K7I A;  2N8X A;  1X48 A;  4N4R B;  1J26 A;  1TF6 A;  5KL7 A;  1HNZ E;  2D9H A;  2EM9 A;  1XNR E;  2IHR 1;  1HNX E;  1NEI A;  2LTR A;  3RMP A;  4JI0 E;  1YFH A;  2G7H A;  2JVA A;  3K6Q A;  4F6N A;  4R2Q A;  2EOY A;  4ZYG A;  4JI2 E;  2EOO A;  3BBG A;  2RPC A;  1WHN A;  4DV0 E;  4F6M A;  2RSM A;  4AQY E;  1MEY C;  4F9B B;  4LF7 E;  4GKK E;  2WBT A;  4JV5 E;  1RQ0 A;  3THO B;  3VK6 A;  2MKN A;  2DMY A;  5A6A A;  3IWB A;  1YYK A;  5AC5 A;  4X66 E;  2EN3 A;  1A1I A;  4R2P A;  1B69 A;  4BMJ A;  2CTD A;  1X6E A;  2Q8U A;  1J5E E;  4JI6 E;  2JXP A;  3HQ1 A;  2DB2 A;  1AAY A;  3DF6 A;  3HTX A;  3VYX A;  2BB8 A;  4ZYH A;  4X64 E;  2FTX B;  2UXB E;  4P7D A;  3EPL A;  4TUI A;  1FKA E;  2ENC A;  1N3G A;  4X9J A;  3ADG A;  1UBD C;  2YRK A;  3T1Y E;  2EOQ A;  1LLM C;  4JI8 E;  2L2M A;  5LLQ A;  1AH5 A;  2EPX A;  2EPM X;  2EOJ A;  1A1L A;  4O5G A;  1F2I G;  3F6G A;  1XMO E;  4Q35 B;  4DR2 E;  4J8Z A;  4NXM E;  2B9D A;  5KL2 A;  2EWL A;  2EN2 A;  2YTO A;  4R2D A;  4B3R E;  2EPK X;  2RS7 A;  4DV6 E;  2EMF A;  4DR5 E;  2WZO A;  1A1G A;  4JI1 E;  2JOX A;  2LVH A;  2V89 A;  2LJU A;  2EMA A;  2EN8 A;  1YUJ A;  1X47 A;  1JK2 A;  2PRT A;  1GZ6 A;  3J81 C;  2WBU A;  3MSW A;  2E5L E;  4BBY A;  3C4T A;  2DIX A;  5AE3 A;  4LF6 E;  2YTI A;  2JOB A;  1XMQ E;  3AUZ A;  2VQE E;  2NAB A;  1EKZ A;  1KYQ A;  4DUZ E;  4KHP E;  2EQ0 A;  4GKJ E;  5IXM B;  2I13 A;  1N33 E;  3THN A;  4BC9 A;  2L2K B;  2EE8 A;  1N32 E;  2ODR D;  1FJG E;  2RSI A;  4DV3 E;  2EOS A;  1T38 A;  1EH6 A;  4ZYE A;  4IJD A;  5KL3 A;  1IQO A;  2ENA A;  3OML A;  2YTQ A;  2EN7 A;  3VYY A;  2JPA A;  4JI3 E;  2LBS B;  3HXL A;  1A1H A;  1P47 A;  2EPO A;  2GLI A;  2EPR A;  1L4S A;  1ZR9 A;  2JP9 A;  2YTN A;  4WSG A;  4K0K E;  4DR7 E;  4O24 A;  2JWO A;  3LLH A;  4HEI A;  4DV4 E;  1IMU A;  3M99 B;  1YYO A;  4DR6 E;  1MGT A;  3H09 A;  3HPZ A;  4X62 E;  1QU6 A;  5TSE A;  5CFF E;  2CPN A;  1IBM E;  4LF8 E;  1ZAA C;  3VHT B;  4O4K A;  4I8O A;  2UUC E;  4F54 A;  2L2N A;  3KWR A;  3IWC A;  2EL5 A;  5T6J A;  4WSP A;  3F6H A;  4BC7 A;  2HJJ A;  2KOU A;  2EOX A;  2EMC A;  2EM5 A;  2R76 A;  1A1J A;  1N34 E;  2LCE A;  2L3C A;  2YU8 A;  4JYA E;  4HTG A;  2EMG A;  1IBK E;  2MDG A;  4WYQ B;  2J7J A;  4KWY A;  4LFB E;  2MDR A;  2ADR A;  2EP3 A;  2EPN A;  2EOR A;  4JI7 E;  4LFA E;  3J7A G;  3OTO E;  2DLK A;  2EMZ A;  3BGH A;  4DV1 E;  2DMI A;  4BCA A;  2KON A;  2EOM A;  4DR3 E;  2V8Q B;  1WRJ A;  2EPL X;  2MC6 A;  2NA2 A;  4BHB A;  2EJ4 A;  4NHR A;  5KL5 A;  2EM0 A;  4IS1 C;  4WX9 A;  4L8N A;  2NUG A;  4ZYD A;  3EQ1 A;  2L6M A;  1O0W A;  1GTK A;  3J80 C;  2YU5 A;  2EOI A;  2YT4 A;  1DQ3 A;  2FGG A;  1X6F A;  5A69 A;  2BBG A;  5BR8 E;  2L33 A;  2DSY A;  4M30 A;  2M9A A;  4DKK A;  2EMX A;  2E1M A;  4DR4 E;  2R1F A;  2WCC 3;  5A6K A;  2YSP A;  3FIG A;  5FLX C;  2DRP A;  2JYA A;  4P78 A;  2EM3 A;  1UIL A;  2MKD A;  2YTG A;  5AE1 A;  2EMH A;  3EPH A;  4DV2 E;  4R8O A;  2EL4 A;  4LU9 A;  3MHH C;  2EMI A;  1T4N A;  1UHZ A;  5IWA E;  2EPP A;  1Z1B A;  1YSA C;  4R2E A;  2ODR C;  3LML A;  4M9V C;  1HNW E;  1T39 A;  2EOZ A;  4BHC A;  4O43 A;  3MHS C;  4GEQ B;  3JTZ A;  2CT1 A;  2GPI A;  3BF2 A;  1PDA A;  2EPA A;  3KZZ A;  1YZ9 A;  2ENH A;  1QNT A;  2V83 A;  3ECR A;  3J7Y p;  5DNY A;  2LRS A;  5AC4 A;  2A25 A;  5LL6 R;  3HPS A;  3C6K A;  2L8T A;  2UXD E;  4BS9 A;  2M7Q A;  2UUA E;  2LT7 A;  1WJP A;  2EML A;  2EN6 A;  4OOG C;  2LUP B;  1TN9 A;  2EMW A;  2YRM A;  1EH7 A;  2EMY A;  2RTX A;  5LMN E;  5AAS A;  3KZY A;  4GZN C;  2LMZ A;  2EQ3 A;  1SR9 A;  4X8W A;  2GHF A;  4JI5 E;  1WHQ A;  3UK3 C;  1RC7 A;  4YHH E;  1UN6 B;  2B7T A;  2V88 A;  2EM6 A;  1G2F C;  2RS6 A;  2EN1 A;  4DV5 E;  1BBG A;  2VQF E;  2F4V E;  1PKP A;  2ELZ A;  1I94 E;  5KL4 A;  2EM8 A;  2YTJ A;  3EPJ A;  1A1F A;  1STU A;  5AE2 A;  4B3M E;  3C6M A;  4JI4 E;  3JU0 A;  2EPU A;  1X5W A;  5A6J A;  1TF3 A;  1T4O A;  2LE2 A;  4M0V A;  1ZBT A;  4R03 A;  3QG5 C;  2H36 X;  4DUY E;  3ADL A;  1IBL E;  3T1H E;  4OX9 E;  1T4L B;  3ADJ A;  5A6B A;  2KHX A;  4DV7 E;  1GQE A;  2N3H A;  2EQ1 A;  2LTS A;  4LF5 E;  2LJH A;  1ZBQ A;  2EOE A;  4LFC E;  3AV0 A;  4RHB B;  4R2R A;  2YSO A;  2WBS A;  1A1K A;  2HGH A;  2M4I A;  2EN4 A;  4WXC A;  2L3J A;  1PJT A;  4M2Z A;  2B7V A;  1PJQ A;  4LF9 E;  4WPY A;  2EL6 A;  5A2Q C;  2VF1 A;  2F8B A;  3L00 A;  4F9A B;  3JAM C;  2UU9 E;  1X6H A;  2RQL A;  4B3S E;  4NXN E;  3ADI A;  2HHH E;  2ZM6 E;  2UUB E;  5KL6 A;  3IWD A;  2V86 A;  1G2D C;  1KJK A;  2B3T B;  4FK5 C;  2DGC A;  2NUE A;  1N36 E;  1YYW A;  2I9I A;  1WXR A;  4B3T E;  4WFT A;  1RMD A;  2CSH A;  3C4B A;  2YZT A;  2LO3 A;  2K4V A;  1YPN A;  2MC5 A;  4DMI A;  1DI2 A;  2N3G A;  2YTD A;  4R2C A;  2V85 A;  2EMB A;  5A6B D;  4F2J C;  2V87 A;  4LTY A;  4MLQ A;  2YWQ A;  2M1S A;  1DGC A;  4KZS A;  2UXC E;  1JK1 A;  5IV8 B;  3P1X A;  2YTP A;  4LF4 E;  2NUF A;  3BID A;  1HR0 E;  2EZ6 A;  2EMK A;  1IQS A;  2EPC A;  1PJS A;  4L5N C;  2EM7 A;  5ADZ A;  3EPK A;  2JY9 A;  5IT9 C;  1EH8 A;  2EOF A;  2YTE A;  4RH8 A;  2EOH A;  4R2A A;  4R2S A;  4YY3 E;  1SFE A;  2VE7 C;  3ZOQ B;  4F9C B;  1BBO A;  1YUI A;  4WXD A; 
#chains in the Genus database with same CATH homology
 1XNQ E;  2YT4 A;  4JI1 E;  1DQ3 A;  2FGG A;  5LMU E;  2JOX A;  2V89 A;  3JU0 A;  4Q28 A;  5BR8 E;  2L33 A;  3DJW A;  2DSY A;  1X47 A;  1GZ6 A;  4M30 A;  1T4O A;  2L92 A;  2FV4 B;  2LE2 A;  4M0V A;  3J81 C;  4DKK A;  1ZBT A;  4X65 E;  3MSW A;  4R03 A;  2E5L E;  4BBY A;  3C4T A;  2DIX A;  2H36 X;  5AE3 A;  4DUY E;  5F3W A;  2JOB A;  4LF6 E;  2E1M A;  1XMQ E;  1IBL E;  3ADL A;  2JR1 A;  3AUZ A;  2VQE E;  3T1H E;  4OX9 E;  4DR4 E;  1X49 A;  4DUZ E;  1EKZ A;  2LUQ A;  1T4L B;  4KHP E;  3ADJ A;  3FIG A;  2KHX A;  4DV7 E;  4GKJ E;  1GQE A;  5FLX C;  2N3H A;  4TUG A;  2LTS A;  4LF5 E;  2LJH A;  1ZBQ A;  1N33 E;  4P78 A;  1UIL A;  4BC9 A;  2L2K B;  4LFC E;  3AV0 A;  4DR1 E;  1N32 E;  5AE1 A;  2M4I A;  2ODR D;  4DV2 E;  4R8O A;  2L3J A;  4DV3 E;  1FJG E;  1X48 A;  4M2Z A;  2B7V A;  4LF9 E;  4WPY A;  1J26 A;  5A2Q C;  4LU9 A;  2VF1 A;  3OML A;  2F8B A;  3VYY A;  4F9A B;  1HNZ E;  4JI3 E;  3JAM C;  1XNR E;  1T4N A;  2IHR 1;  2LBS B;  1HNX E;  1UHZ A;  3HXL A;  5IWA E;  2UU9 E;  4B3S E;  4NXN E;  3ADI A;  2HHH E;  2LTR A;  3RMP A;  2ZM6 E;  4JI0 E;  2UUB E;  2G7H A;  2JVA A;  3IWD A;  2V86 A;  3K6Q A;  4K0K E;  4DR7 E;  2ODR C;  3LML A;  1HNW E;  2JWO A;  3LLH A;  2B3T B;  4DV4 E;  4JI2 E;  1YYO A;  4DR6 E;  3H09 A;  1WHN A;  4DV0 E;  3HPZ A;  2RSM A;  1QU6 A;  5CFF E;  4X62 E;  2CPN A;  4AQY E;  1IBM E;  4F9B B;  4GEQ B;  4LF8 E;  4LF7 E;  2NUE A;  4GKK E;  3JTZ A;  1N36 E;  1YYW A;  1YZ9 A;  1WXR A;  4I8O A;  4JV5 E;  2V83 A;  1RQ0 A;  2UUC E;  4F54 A;  2L2N A;  3KWR A;  3IWC A;  4WFT A;  4B3T E;  5T6J A;  3C4B A;  4WSP A;  3VK6 A;  5DNY A;  2YZT A;  3F6H A;  2DMY A;  4BC7 A;  3J7Y p;  3IWB A;  1YYK A;  2K4V A;  2KOU A;  4X66 E;  2LRS A;  2MC5 A;  4BMJ A;  4DMI A;  1DI2 A;  2N3G A;  1J5E E;  1N34 E;  4JI6 E;  2V85 A;  5LL6 R;  3HPS A;  2L3C A;  2V87 A;  4JYA E;  3HQ1 A;  2L8T A;  1IBK E;  2UXD E;  4LTY A;  4BS9 A;  2M7Q A;  2M1S A;  4WYQ B;  2DB2 A;  3DF6 A;  4KZS A;  2UXC E;  2UUA E;  3HTX A;  4LFB E;  3P1X A;  3VYX A;  4LF4 E;  2NUF A;  4OOG C;  4X64 E;  2FTX B;  1HR0 E;  2MDR A;  2LUP B;  2EZ6 A;  2UXB E;  4P7D A;  4LFA E;  3J7A G;  4JI7 E;  2RTX A;  3OTO E;  5LMN E;  4TUI A;  1FKA E;  5AAS A;  4DV1 E;  4BCA A;  2LMZ A;  2KON A;  3ADG A;  1SR9 A;  4X8W A;  3T1Y E;  4DR3 E;  4JI5 E;  1WHQ A;  4L5N C;  4JI8 E;  2L2M A;  2V8Q B;  5ADZ A;  1RC7 A;  2JY9 A;  4YHH E;  2MC6 A;  5IT9 C;  2B7T A;  2V88 A;  2NA2 A;  3F6G A;  2RS6 A;  1XMO E;  4YY3 E;  4DV5 E;  2VQF E;  4L8N A;  4J8Z A;  4DR2 E;  4NXM E;  2VE7 C;  2NUG A;  1PKP A;  2F4V E;  2B9D A;  1I94 E;  2EWL A;  4B3R E;  2L6M A;  2RS7 A;  1STU A;  1O0W A;  3ZOQ B;  4F9C B;  5AE2 A;  4DV6 E;  4B3M E;  4JI4 E;  4DR5 E;  3J80 C;  2WZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...