2L3JA

The solution structure of the adar2 dsrbm-rna complex reveals a sequence-specific read out of the minor groove
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
236
structure length
236
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
molecule keywords Double-stranded RNA-specific editase 1
total genus 34
structure length 236
sequence length 236
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA01
4DV2E 1J5EE 3OTOE 1WHNA 3HTXA 2NUEA 3LLHA 2UUBE 1WHQA 4KHPE 1I94E 1YYKA 4B3ME 4DV3E 2EZ6A 4M30A 1RC7A 2CPNA 3VYXA 2VQFE 2NUGA 2B3TB 4YY3E 4DV7E 1X49A 2NUFA 2YT4A 4WFTA 2KHXA 2LBSB 2LTSA 1YYWA 4DR3E 4JI3E 1XMOE 4X65E 4JI2E 2UU9E 1DI2A 4NXME 4DUYE 4DR2E 4DV6E 3T1YE 2N3GA 2L3JA 4JI1E 2B7VA 2B7TA 4DR4E 2UXBE 1PKPA 3C4BA 4OX9E 4JYAE 2JVAA 2NA2A 3T1HE 1T4LB 1YZ9A 1HNXE 4DV5E 4M2ZA 4JV5E 1HR0E 2LTRA 3J7Yp 1STUA 4DUZE 4LF9E 4LF7E 1HNWE 4JI6E 1O0WA 2E5LE 4B3RE 4YHHE 4NXNE 1UHZA 2ZM6E 1FKAE 3ADGA 4JI0E 4LF4E 4LF6E 1X47A 2DIXA 4DR7E 1N34E 1FJGE 4GKKE 1RQ0A 4AQYE 2RS7A 4DKKA 4JI4E 1XNQE 1XMQE 1UILA 2LRSA 4B3TE 2L3CA 4DR5E 1QU6A 2IHR1 4LFCE 4LF5E 3VYYA 2RTXA 1XNRE 4X62E 2DB2A 1N32E 2L2NA 3ADIA 1T4NA 2JY9A 1GQEA 2RS6A 5BR8E 1EKZA 4LFBE 2DMYA 2F4VE 4JI8E 2N3HA 4X66E 4X64E 4OOGC 1T4OA 2L33A 4JI7E 5IWAE 5LMUE 4LFAE 4WYQB 1N33E 1IBLE 2L2KB 5CFFE 2UXDE 2HHHE 4DR6E 3ADJA 4JI5E 4B3SE 3ADLA 2UUAE 4K0KE 4X8WA 2UUCE 5LMNE 1J26A 2LJHA 4GKJE 1IBME 2VQEE 2UXCE 1ZBTA 2L2MA 4DR1E 1X48A 4DV0E 1YYOA 3C4TA 2RSMA 1N36E 1IBKE 1HNZE 4LF8E 2LUQA 2LUPB 4DV4E 2MDRA 3P1XA 4DV1E
chains in the Genus database with same CATH superfamily
4HEIA 1LLMC 4N4RB 3KZYA 3OTOE 1WHNA 2PRTA 2WZOA 3LLHA 3IWCA 2EM9A 4KHPE 2EMCA 4B3ME 2EZ6A 1G2FC 3FIGA 4M30A 2VQFE 3THNA 4WSPA 3AV0A 1X49A 4R2DA 4WFTA 1YYWA 4DR3E 2LO3A 3JAMC 2UU9E 1DI2A 1KYQA 4JI1E 2EM4A 1SR9A 4R2QA 4DR4E 2EN1A 1X5WA 3C4BA 1EH7A 2EPCA 3T1HE 1YZ9A 1YFHA 2ENHA 4R2AA 4JV5E 2DLQA 1EH8A 2EOHA 2MC5A 4O43A 4DUZE 2EMHA 1YPNA 1UHZA 5KL7A 2ZM6E 4F6NA 3ADGA 4LF4E 4LF6E 2YRMA 3LMLA 2DIXA 3HQ1A 2YTQA 3OMLA 4DMIA 2JYAA 2YTEA 1T38A 4GKKE 2YWQA 3JTZA 1XMQE 2YSOA 4BCAA 2EOEA 1WXRA 1QU6A 1UN6B 2EMGA 4BC7A 4RH8A 2V87A 1B69A 2GHFA 5TSEA 2EMBA 2EMXA 1T4NA 4LU9A 3THOB 2FV4B 1AH5A 2DMYA 3JU0A 4JI8E 4J8ZA 3TQMA 4NHRA 4OOGC 1T4OA 2L33A 2MKNA 4Q28A 2EJ4A 4BC9A 4LFAE 2EQ1A 4WYQB 2EPXA 2L8TA 2EM3A 4WPYA 2YSPA 4ZYEA 2EE8A 2UUAE 2EPUA 2V83A 2I9IA 4P7DA 2V85A 2LMZA 1IBME 5KL4A 1X6EA 1ZBTA 2WBTA 4DV0E 1YYOA 1N36E 2JPAA 2EMAA 2YPNA 5KL6A 2EN6A 2MDRA 4DV2E 2CT1A 4X9JA 2JR1A 3HTXA 1WHQA 2FGGA 1YYKA 4DV3E 2CPNA 2B3TB 1YUJA 1NEIA 1T39A 1QNTA 1IQOA 2KHXA 4JI3E 2EOOA 1X6FA 5AASA 2EMIA 2EOJA 2RQLA 4X65E 2EL5A 5A69A 2VF1A 4NXME 2EM6A 2YTNA 3T1YE 2N8XA 2YU8A 5ADZA 2EM0A 2B7TA 3H09A 4TUIA 2A25A 2I13A 3ECRA 3VK6A 2JVAA 2M1SA 2NA2A 2YTFA 1DGCA 1HNXE 4NZVA 2YU5A 2LTRA 3J7Yp 1STUA 1HNWE 1O0WA 2F8BA 1UBDC 5A6AA 2E5LE 4JI0E 1FKAE 2EQ0A 4DR7E 4F2JC 3IWDA 2LCEA 1FJGE 1L4SA 2EN7A 4AQYE 2RS7A 2HC5A 2RPCA 3MHHC 2EPPA 2LE2A 4B3TE 1A1HA 2ENAA 4BMJA 5IXMB 2WBSA 4DR5E 3M99B 4P78A 4MLVA 4R2CA 2EORA 3J80C 2RTXA 3MHSC 2LVHA 1A1JA 2E1MA 2L2NA 2RSIA 3VHTB 4ZYGA 1YUIA 1PJQA 1GQEA 3F6GA 1EKZA 2YTGA 1GTKA 3DJWA 5DNYA 4KZSA 4JI7E 4R2PA 4L5NC 5LMUE 5A6KA 1G2DC 1N33E 2L2KB 2Q8UA 2ELZA 1TF6A 2UXDE 3ADJA 4JI5E 4B3SE 2L92A 5AE1A 4RHBB 2UUCE 2DSYA 2EOIA 4WXDA 4R2SA 2EP3A 1X6HA 3C6MA 2M4IA 2VQEE 3QG5C 4GEQB 4DR1E 1IBKE 2HGHA 2D9HA 2EMFA 2RSMA 1HNZE 4LF8E 5LL6R 1EH6A 4R8OA 2LUPB 1N32E 4M0VA 2ENCA 4F9BB 2NUEA 4LTYA 2V89A 3DF6A 2YTOA 2UUBE 2VRDA 5A6BA 1I94E 2LT7A 2NABA 4IJDA 2ADRA 2NUFA 3HXLA 5KL3A 4TUGA 2LBSB 2YTDA 2LTSA 4BHBA 2WBUA 2CTDA 4R2EA 4JI2E 1AAYA 3C6KA 4DUYE 2K7IA 2EN4A 2V86A 2B7VA 2EPMX 3J81C 3J7AG 3EPJA 4GZNC 4F6MA 1PKPA 2EM2A 2LV2A 2ODRC 4WXCA 4BS9A 4F9AB 2V88A 4FK5C 1PJTA 2EQ3A 4DV5E 1BBGA 2EM8A 5AE3A 1HR0E 3BGHA 4LF9E 2EN3A 4LF7E 4JI6E 1PDAA 4YHHE 4NXNE 2JOXA 2H36X 4F9CB 1X47A 4ZYHA 2JP9A 1F2IG 5KL5A 3BIDA 2K4VA 4DKKA 4JI4E 1JK2A 2YTJA 2M7QA 1UILA 1WRJA 2EOFA 2J7JA 3AUZA 3VYYA 1NCSA 1ZR9A 2JXPA 4ZYDA 1XNRE 1TF3A 4X62E 2DB2A 2HJJA 3HPSA 3ADIA 2V8QB 1KJKA 2GPIA 3BF2A 3UK3C 3BBGA 2E72A 2KOUA 2EPKX 2RS6A 5BR8E 2YZTA 3EQ1A 2B9DA 2F4VE 3EPLA 2EPZA 5IV8B 4BHCA 4X66E 1WJPA 5IWAE 4WX9A 2EMLA 3HPZA 1A1GA 1IBLE 4R03A 2EOQA 5CFFE 5A6BD 3K6QA 2HHHE 4Q35B 2DRPA 2EN8A 4HTGA 5LMNE 2LJHA 2YTIA 2UXCE 2JWOA 2L2MA 1MGTA 2EOMA 2R1FA 4DV1E 1A1FA 1J5EE 2EPNA 5KL2A 2KONA 2EMKA 1IMUA 1DQ3A 4DV4E 1A1KA 1Z1BA 1RMDA 1YSAC 1SFEA 2WCC3 2EOSA 1IQSA 1RC7A 3VYXA 2EOYA 2NUGA 4YY3E 4DV7E 5F3WA 2YT4A 3IWBA 2MDGA 5AE2A 2YRKA 4R2RA 4O24A 1XMOE 1GZ6A 1A1LA 4DR2E 4DV6E 2N3GA 2L3JA 2EL6A 1MEYC 3RMPA 2UXBE 5A2QC 4OX9E 1ZAAC 4JYAE 2EPLX 1T4LB 2CSHA 2EMWA 4M9VC 4M2ZA 1A1IA 3KWRA 3KZZA 1TN9A 4B3RE 2VE7C 5T6JA 1N34E 3EPHA 4I8OA 1ZU1A 4WSGA 2DMIA 2DGCA 2BBGA 1RQ0A 4IS1C 2R76A 1ZBQA 1XNQE 1BBOA 2L6MA 2EM7A 2LRSA 4O5GA 3EPKA 2YRHA 1P47A 2L3CA 1X3CA 4F54A 2IHR1 4LFCE 2MKDA 2LJUA 5A6JA 5FLXC 4LF5E 1PJSA 2EM5A 4KWYA 2EMZA 2EOXA 2GLIA 2ELYA 2EPRA 3F6HA 1JK1A 2YTPA 2JY9A 5LLQA 5AC5A 3L00A 4L8NA 4LFBE 1N3GA 2N3HA 2EWLA 2EPAA 4X64E 2DLKA 1BB8A 4BBYA 2EN2A 2G7HA 2EPOA 2ODRD 3MSWA 2FTXB 4DR6E 3ZOQB 3ADLA 2M9AA 4K0KE 4X8WA 4O4KA 5IT9C 2MC6A 4MLQA 1J26A 4GKJE 5AC4A 2JOBA 1X48A 3C4TA 2EMYA 2EL4A 2EOZA 2LUQA 2BB8A 3P1XA
chains in the Genus database with same CATH topology
4DV2E 4M0VA 1J5EE 2JR1A 2KONA 3OTOE 1DQ3A 1WHNA 3HTXA 4F9BB 2NUEA 4LTYA 2WZOA 2V89A 3LLHA 3DF6A 3IWCA 2UUBE 1WHQA 4KHPE 2FGGA 1I94E 4LF4E 1YYKA 4B3ME 4DV3E 4JI0E 2EZ6A 3FIGA 4M30A 1RC7A 2CPNA 3VYXA 2VQFE 2NUGA 4WSPA 2B3TB 4YY3E 4DV7E 3AV0A 1X49A 5F3WA 2NUFA 2YT4A 3HXLA 3IWBA 4WFTA 2KHXA 4TUGA 2LBSB 2LTSA 1YYWA 4DR3E 5AE2A 4JI3E 5AASA 1XMOE 1GZ6A 3JAMC 4X65E 4JI2E 2UU9E 1DI2A 2VF1A 4DUYE 4NXME 4DR2E 4DV6E 3T1YE 2N3GA 5ADZA 2L3JA 4JI1E 2V86A 1SR9A 2B7VA 2B7TA 3J81C 3J7AG 4DR4E 3H09A 4TUIA 3RMPA 2UXBE 5A2QC 1PKPA 3C4BA 4OX9E 4BS9A 2ODRC 4JYAE 4F9AB 2V88A 3VK6A 2JVAA 2M1SA 2NA2A 3T1HE 1T4LB 4LF6E 1YZ9A 1HNXE 4DV5E 5AE3A 4M2ZA 4JV5E 1HR0E 2LTRA 3J7Yp 1STUA 4DUZE 2MC5A 4LF9E 4LF7E 3KWRA 1HNWE 4JI6E 1O0WA 2F8BA 2E5LE 4B3RE 4YHHE 4NXNE 1UHZA 2VE7C 2JOXA 3ADGA 2ZM6E 1FKAE 2H36X 3LMLA 1X47A 2DIXA 3HQ1A 5T6JA 4F9CB 1N34E 4DR7E 4I8OA 3IWDA 3OMLA 4DMIA 1FJGE 4GKKE 1RQ0A 2K4VA 2RS7A 3JTZA 4DKKA 1ZBQA 4AQYE 4JI4E 1XNQE 2LE2A 2L6MA 2M7QA 1XMQE 1UILA 2LRSA 4BCAA 4B3TE 4LF8E 2L3CA 1WXRA 4BMJA 4DR5E 4F54A 1QU6A 2IHR1 4P78A 3AUZA 4LFCE 4BC7A 5FLXC 3J80C 3VYYA 4LF5E 2RTXA 2V87A 1XNRE 4X62E 2DB2A 2E1MA 2L2NA 3HPSA 1N32E 3F6HA 3ADIA 2V8QB 1T4NA 2JY9A 4LU9A 2FV4B 2KOUA 1GQEA 2RS6A 2YZTA 3F6GA 4L8NA 2DMYA 2B9DA 5BR8E 3JU0A 1EKZA 2F4VE 4LFBE 4JI8E 2N3HA 4J8ZA 2EWLA 4X64E 4X66E 3DJWA 1T4OA 2L33A 4OOGC 4KZSA 4Q28A 4JI7E 4BBYA 4L5NC 4BC9A 5IWAE 5DNYA 3HPZA 2L8TA 2G7HA 4WYQB 5LMUE 4LFAE 1N33E 1IBLE 2L2KB 2ODRD 4R03A 4WPYA 5CFFE 3MSWA 2FTXB 2UXDE 3K6QA 2HHHE 4DR6E 3ADJA 3ZOQB 4JI5E 4B3SE 3ADLA 2L92A 5AE1A 2UUAE 4K0KE 2V83A 4X8WA 2UUCE 4P7DA 2DSYA 5LMNE 2V85A 5IT9C 2MC6A 1J26A 2LJHA 2LMZA 4GKJE 2M4IA 2VQEE 1IBME 2UXCE 2JOBA 2JWOA 1ZBTA 2L2MA 4GEQB 1X48A 4DV0E 4DR1E 3C4TA 2RSMA 1YYOA 1N36E 5LL6R 1IBKE 4R8OA 1HNZE 2LUQA 2LUPB 4DV4E 2MDRA 3P1XA 4DV1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 E;  1J5E E;  3OTO E;  1WHN A;  3HTX A;  2NUE A;  3LLH A;  2UUB E;  1WHQ A;  4KHP E;  1I94 E;  1YYK A;  4B3M E;  4DV3 E;  2EZ6 A;  4M30 A;  1RC7 A;  2CPN A;  3VYX A;  2VQF E;  2NUG A;  2B3T B;  4YY3 E;  4DV7 E;  1X49 A;  2NUF A;  2YT4 A;  4WFT A;  2KHX A;  2LBS B;  2LTS A;  1YYW A;  4DR3 E;  4JI3 E;  1XMO E;  4X65 E;  4JI2 E;  2UU9 E;  1DI2 A;  4NXM E;  4DUY E;  4DR2 E;  4DV6 E;  3T1Y E;  2N3G A;  2L3J A;  4JI1 E;  2B7V A;  2B7T A;  4DR4 E;  2UXB E;  1PKP A;  3C4B A;  4OX9 E;  4JYA E;  2JVA A;  2NA2 A;  3T1H E;  1T4L B;  1YZ9 A;  1HNX E;  4DV5 E;  4M2Z A;  4JV5 E;  1HR0 E;  2LTR A;  3J7Y p;  1STU A;  4DUZ E;  4LF9 E;  4LF7 E;  1HNW E;  4JI6 E;  1O0W A;  2E5L E;  4B3R E;  4YHH E;  4NXN E;  1UHZ A;  2ZM6 E;  1FKA E;  3ADG A;  4JI0 E;  4LF4 E;  4LF6 E;  1X47 A;  2DIX A;  4DR7 E;  1N34 E;  1FJG E;  4GKK E;  1RQ0 A;  4AQY E;  2RS7 A;  4DKK A;  4JI4 E;  1XNQ E;  1XMQ E;  1UIL A;  2LRS A;  4B3T E;  2L3C A;  4DR5 E;  1QU6 A;  2IHR 1;  4LFC E;  4LF5 E;  3VYY A;  2RTX A;  1XNR E;  4X62 E;  2DB2 A;  1N32 E;  2L2N A;  3ADI A;  1T4N A;  2JY9 A;  1GQE A;  2RS6 A;  5BR8 E;  1EKZ A;  4LFB E;  2DMY A;  2F4V E;  4JI8 E;  2N3H A;  4X66 E;  4X64 E;  4OOG C;  1T4O A;  2L33 A;  4JI7 E;  5IWA E;  5LMU E;  4LFA E;  4WYQ B;  1N33 E;  1IBL E;  2L2K B;  5CFF E;  2UXD E;  2HHH E;  4DR6 E;  3ADJ A;  4JI5 E;  4B3S E;  3ADL A;  2UUA E;  4K0K E;  4X8W A;  2UUC E;  5LMN E;  1J26 A;  2LJH A;  4GKJ E;  1IBM E;  2VQE E;  2UXC E;  1ZBT A;  2L2M A;  4DR1 E;  1X48 A;  4DV0 E;  1YYO A;  3C4T A;  2RSM A;  1N36 E;  1IBK E;  1HNZ E;  4LF8 E;  2LUQ A;  2LUP B;  4DV4 E;  2MDR A;  3P1X A;  4DV1 E; 
#chains in the Genus database with same CATH topology
 4HEI A;  1LLM C;  4N4R B;  3KZY A;  3OTO E;  1WHN A;  2PRT A;  2WZO A;  3LLH A;  3IWC A;  2EM9 A;  4KHP E;  2EMC A;  4B3M E;  2EZ6 A;  1G2F C;  3FIG A;  4M30 A;  2VQF E;  3THN A;  4WSP A;  3AV0 A;  1X49 A;  4R2D A;  4WFT A;  1YYW A;  4DR3 E;  2LO3 A;  3JAM C;  2UU9 E;  1DI2 A;  1KYQ A;  4JI1 E;  2EM4 A;  1SR9 A;  4R2Q A;  4DR4 E;  2EN1 A;  1X5W A;  3C4B A;  1EH7 A;  2EPC A;  3T1H E;  1YZ9 A;  1YFH A;  2ENH A;  4R2A A;  4JV5 E;  2DLQ A;  1EH8 A;  2EOH A;  2MC5 A;  4O43 A;  4DUZ E;  2EMH A;  1YPN A;  1UHZ A;  5KL7 A;  2ZM6 E;  4F6N A;  3ADG A;  4LF4 E;  4LF6 E;  2YRM A;  3LML A;  2DIX A;  3HQ1 A;  2YTQ A;  3OML A;  4DMI A;  2JYA A;  2YTE A;  1T38 A;  4GKK E;  2YWQ A;  3JTZ A;  1XMQ E;  2YSO A;  4BCA A;  2EOE A;  1WXR A;  1QU6 A;  1UN6 B;  2EMG A;  4BC7 A;  4RH8 A;  2V87 A;  1B69 A;  2GHF A;  5TSE A;  2EMB A;  2EMX A;  1T4N A;  4LU9 A;  3THO B;  2FV4 B;  1AH5 A;  2DMY A;  3JU0 A;  4JI8 E;  4J8Z A;  3TQM A;  4NHR A;  4OOG C;  1T4O A;  2L33 A;  2MKN A;  4Q28 A;  2EJ4 A;  4BC9 A;  4LFA E;  2EQ1 A;  4WYQ B;  2EPX A;  2L8T A;  2EM3 A;  4WPY A;  2YSP A;  4ZYE A;  2EE8 A;  2UUA E;  2EPU A;  2V83 A;  2I9I A;  4P7D A;  2V85 A;  2LMZ A;  1IBM E;  5KL4 A;  1X6E A;  1ZBT A;  2WBT A;  4DV0 E;  1YYO A;  1N36 E;  2JPA A;  2EMA A;  2YPN A;  5KL6 A;  2EN6 A;  2MDR A;  4DV2 E;  2CT1 A;  4X9J A;  2JR1 A;  3HTX A;  1WHQ A;  2FGG A;  1YYK A;  4DV3 E;  2CPN A;  2B3T B;  1YUJ A;  1NEI A;  1T39 A;  1QNT A;  1IQO A;  2KHX A;  4JI3 E;  2EOO A;  1X6F A;  5AAS A;  2EMI A;  2EOJ A;  2RQL A;  4X65 E;  2EL5 A;  5A69 A;  2VF1 A;  4NXM E;  2EM6 A;  2YTN A;  3T1Y E;  2N8X A;  2YU8 A;  5ADZ A;  2EM0 A;  2B7T A;  3H09 A;  4TUI A;  2A25 A;  2I13 A;  3ECR A;  3VK6 A;  2JVA A;  2M1S A;  2NA2 A;  2YTF A;  1DGC A;  1HNX E;  4NZV A;  2YU5 A;  2LTR A;  3J7Y p;  1STU A;  1HNW E;  1O0W A;  2F8B A;  1UBD C;  5A6A A;  2E5L E;  4JI0 E;  1FKA E;  2EQ0 A;  4DR7 E;  4F2J C;  3IWD A;  2LCE A;  1FJG E;  1L4S A;  2EN7 A;  4AQY E;  2RS7 A;  2HC5 A;  2RPC A;  3MHH C;  2EPP A;  2LE2 A;  4B3T E;  1A1H A;  2ENA A;  4BMJ A;  5IXM B;  2WBS A;  4DR5 E;  3M99 B;  4P78 A;  4MLV A;  4R2C A;  2EOR A;  3J80 C;  2RTX A;  3MHS C;  2LVH A;  1A1J A;  2E1M A;  2L2N A;  2RSI A;  3VHT B;  4ZYG A;  1YUI A;  1PJQ A;  1GQE A;  3F6G A;  1EKZ A;  2YTG A;  1GTK A;  3DJW A;  5DNY A;  4KZS A;  4JI7 E;  4R2P A;  4L5N C;  5LMU E;  5A6K A;  1G2D C;  1N33 E;  2L2K B;  2Q8U A;  2ELZ A;  1TF6 A;  2UXD E;  3ADJ A;  4JI5 E;  4B3S E;  2L92 A;  5AE1 A;  4RHB B;  2UUC E;  2DSY A;  2EOI A;  4WXD A;  4R2S A;  2EP3 A;  1X6H A;  3C6M A;  2M4I A;  2VQE E;  3QG5 C;  4GEQ B;  4DR1 E;  1IBK E;  2HGH A;  2D9H A;  2EMF A;  2RSM A;  1HNZ E;  4LF8 E;  5LL6 R;  1EH6 A;  4R8O A;  2LUP B;  1N32 E;  4M0V A;  2ENC A;  4F9B B;  2NUE A;  4LTY A;  2V89 A;  3DF6 A;  2YTO A;  2UUB E;  2VRD A;  5A6B A;  1I94 E;  2LT7 A;  2NAB A;  4IJD A;  2ADR A;  2NUF A;  3HXL A;  5KL3 A;  4TUG A;  2LBS B;  2YTD A;  2LTS A;  4BHB A;  2WBU A;  2CTD A;  4R2E A;  4JI2 E;  1AAY A;  3C6K A;  4DUY E;  2K7I A;  2EN4 A;  2V86 A;  2B7V A;  2EPM X;  3J81 C;  3J7A G;  3EPJ A;  4GZN C;  4F6M A;  1PKP A;  2EM2 A;  2LV2 A;  2ODR C;  4WXC A;  4BS9 A;  4F9A B;  2V88 A;  4FK5 C;  1PJT A;  2EQ3 A;  4DV5 E;  1BBG A;  2EM8 A;  5AE3 A;  1HR0 E;  3BGH A;  4LF9 E;  2EN3 A;  4LF7 E;  4JI6 E;  1PDA A;  4YHH E;  4NXN E;  2JOX A;  2H36 X;  4F9C B;  1X47 A;  4ZYH A;  2JP9 A;  1F2I G;  5KL5 A;  3BID A;  2K4V A;  4DKK A;  4JI4 E;  1JK2 A;  2YTJ A;  2M7Q A;  1UIL A;  1WRJ A;  2EOF A;  2J7J A;  3AUZ A;  3VYY A;  1NCS A;  1ZR9 A;  2JXP A;  4ZYD A;  1XNR E;  1TF3 A;  4X62 E;  2DB2 A;  2HJJ A;  3HPS A;  3ADI A;  2V8Q B;  1KJK A;  2GPI A;  3BF2 A;  3UK3 C;  3BBG A;  2E72 A;  2KOU A;  2EPK X;  2RS6 A;  5BR8 E;  2YZT A;  3EQ1 A;  2B9D A;  2F4V E;  3EPL A;  2EPZ A;  5IV8 B;  4BHC A;  4X66 E;  1WJP A;  5IWA E;  4WX9 A;  2EML A;  3HPZ A;  1A1G A;  1IBL E;  4R03 A;  2EOQ A;  5CFF E;  5A6B D;  3K6Q A;  2HHH E;  4Q35 B;  2DRP A;  2EN8 A;  4HTG A;  5LMN E;  2LJH A;  2YTI A;  2UXC E;  2JWO A;  2L2M A;  1MGT A;  2EOM A;  2R1F A;  4DV1 E;  1A1F A;  1J5E E;  2EPN A;  5KL2 A;  2KON A;  2EMK A;  1IMU A;  1DQ3 A;  4DV4 E;  1A1K A;  1Z1B A;  1RMD A;  1YSA C;  1SFE A;  2WCC 3;  2EOS A;  1IQS A;  1RC7 A;  3VYX A;  2EOY A;  2NUG A;  4YY3 E;  4DV7 E;  5F3W A;  2YT4 A;  3IWB A;  2MDG A;  5AE2 A;  2YRK A;  4R2R A;  4O24 A;  1XMO E;  1GZ6 A;  1A1L A;  4DR2 E;  4DV6 E;  2N3G A;  2L3J A;  2EL6 A;  1MEY C;  3RMP A;  2UXB E;  5A2Q C;  4OX9 E;  1ZAA C;  4JYA E;  2EPL X;  1T4L B;  2CSH A;  2EMW A;  4M9V C;  4M2Z A;  1A1I A;  3KWR A;  3KZZ A;  1TN9 A;  4B3R E;  2VE7 C;  5T6J A;  1N34 E;  3EPH A;  4I8O A;  1ZU1 A;  4WSG A;  2DMI A;  2DGC A;  2BBG A;  1RQ0 A;  4IS1 C;  2R76 A;  1ZBQ A;  1XNQ E;  1BBO A;  2L6M A;  2EM7 A;  2LRS A;  4O5G A;  3EPK A;  2YRH A;  1P47 A;  2L3C A;  1X3C A;  4F54 A;  2IHR 1;  4LFC E;  2MKD A;  2LJU A;  5A6J A;  5FLX C;  4LF5 E;  1PJS A;  2EM5 A;  4KWY A;  2EMZ A;  2EOX A;  2GLI A;  2ELY A;  2EPR A;  3F6H A;  1JK1 A;  2YTP A;  2JY9 A;  5LLQ A;  5AC5 A;  3L00 A;  4L8N A;  4LFB E;  1N3G A;  2N3H A;  2EWL A;  2EPA A;  4X64 E;  2DLK A;  1BB8 A;  4BBY A;  2EN2 A;  2G7H A;  2EPO A;  2ODR D;  3MSW A;  2FTX B;  4DR6 E;  3ZOQ B;  3ADL A;  2M9A A;  4K0K E;  4X8W A;  4O4K A;  5IT9 C;  2MC6 A;  4MLQ A;  1J26 A;  4GKJ E;  5AC4 A;  2JOB A;  1X48 A;  3C4T A;  2EMY A;  2EL4 A;  2EOZ A;  2LUQ A;  2BB8 A;  3P1X A; 
#chains in the Genus database with same CATH homology
 4DV2 E;  4M0V A;  1J5E E;  2JR1 A;  2KON A;  3OTO E;  1DQ3 A;  1WHN A;  3HTX A;  4F9B B;  2NUE A;  4LTY A;  2WZO A;  2V89 A;  3LLH A;  3DF6 A;  3IWC A;  2UUB E;  1WHQ A;  4KHP E;  2FGG A;  1I94 E;  4LF4 E;  1YYK A;  4B3M E;  4DV3 E;  4JI0 E;  2EZ6 A;  3FIG A;  4M30 A;  1RC7 A;  2CPN A;  3VYX A;  2VQF E;  2NUG A;  4WSP A;  2B3T B;  4YY3 E;  4DV7 E;  3AV0 A;  1X49 A;  5F3W A;  2NUF A;  2YT4 A;  3HXL A;  3IWB A;  4WFT A;  2KHX A;  4TUG A;  2LBS B;  2LTS A;  1YYW A;  4DR3 E;  5AE2 A;  4JI3 E;  5AAS A;  1XMO E;  1GZ6 A;  3JAM C;  4X65 E;  4JI2 E;  2UU9 E;  1DI2 A;  2VF1 A;  4DUY E;  4NXM E;  4DR2 E;  4DV6 E;  3T1Y E;  2N3G A;  5ADZ A;  2L3J A;  4JI1 E;  2V86 A;  1SR9 A;  2B7V A;  2B7T A;  3J81 C;  3J7A G;  4DR4 E;  3H09 A;  4TUI A;  3RMP A;  2UXB E;  5A2Q C;  1PKP A;  3C4B A;  4OX9 E;  4BS9 A;  2ODR C;  4JYA E;  4F9A B;  2V88 A;  3VK6 A;  2JVA A;  2M1S A;  2NA2 A;  3T1H E;  1T4L B;  4LF6 E;  1YZ9 A;  1HNX E;  4DV5 E;  5AE3 A;  4M2Z A;  4JV5 E;  1HR0 E;  2LTR A;  3J7Y p;  1STU A;  4DUZ E;  2MC5 A;  4LF9 E;  4LF7 E;  3KWR A;  1HNW E;  4JI6 E;  1O0W A;  2F8B A;  2E5L E;  4B3R E;  4YHH E;  4NXN E;  1UHZ A;  2VE7 C;  2JOX A;  3ADG A;  2ZM6 E;  1FKA E;  2H36 X;  3LML A;  1X47 A;  2DIX A;  3HQ1 A;  5T6J A;  4F9C B;  1N34 E;  4DR7 E;  4I8O A;  3IWD A;  3OML A;  4DMI A;  1FJG E;  4GKK E;  1RQ0 A;  2K4V A;  2RS7 A;  3JTZ A;  4DKK A;  1ZBQ A;  4AQY E;  4JI4 E;  1XNQ E;  2LE2 A;  2L6M A;  2M7Q A;  1XMQ E;  1UIL A;  2LRS A;  4BCA A;  4B3T E;  4LF8 E;  2L3C A;  1WXR A;  4BMJ A;  4DR5 E;  4F54 A;  1QU6 A;  2IHR 1;  4P78 A;  3AUZ A;  4LFC E;  4BC7 A;  5FLX C;  3J80 C;  3VYY A;  4LF5 E;  2RTX A;  2V87 A;  1XNR E;  4X62 E;  2DB2 A;  2E1M A;  2L2N A;  3HPS A;  1N32 E;  3F6H A;  3ADI A;  2V8Q B;  1T4N A;  2JY9 A;  4LU9 A;  2FV4 B;  2KOU A;  1GQE A;  2RS6 A;  2YZT A;  3F6G A;  4L8N A;  2DMY A;  2B9D A;  5BR8 E;  3JU0 A;  1EKZ A;  2F4V E;  4LFB E;  4JI8 E;  2N3H A;  4J8Z A;  2EWL A;  4X64 E;  4X66 E;  3DJW A;  1T4O A;  2L33 A;  4OOG C;  4KZS A;  4Q28 A;  4JI7 E;  4BBY A;  4L5N C;  4BC9 A;  5IWA E;  5DNY A;  3HPZ A;  2L8T A;  2G7H A;  4WYQ B;  5LMU E;  4LFA E;  1N33 E;  1IBL E;  2L2K B;  2ODR D;  4R03 A;  4WPY A;  5CFF E;  3MSW A;  2FTX B;  2UXD E;  3K6Q A;  2HHH E;  4DR6 E;  3ADJ A;  3ZOQ B;  4JI5 E;  4B3S E;  3ADL A;  2L92 A;  5AE1 A;  2UUA E;  4K0K E;  2V83 A;  4X8W A;  2UUC E;  4P7D A;  2DSY A;  5LMN E;  2V85 A;  5IT9 C;  2MC6 A;  1J26 A;  2LJH A;  2LMZ A;  4GKJ E;  2M4I A;  2VQE E;  1IBM E;  2UXC E;  2JOB A;  2JWO A;  1ZBT A;  2L2M A;  4GEQ B;  1X48 A;  4DV0 E;  4DR1 E;  3C4T A;  2RSM A;  1YYO A;  1N36 E;  5LL6 R;  1IBK E;  4R8O A;  1HNZ E;  2LUQ A;  2LUP B;  4DV4 E;  2MDR A;  3P1X A;  4DV1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...