2L3JA

The solution structure of the adar2 dsrbm-rna complex reveals a sequence-specific read out of the minor groove
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
236
structure length
236
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 34
structure length 236
sequence length 236
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3jA01
4JV5E 4B3RE 2IHR1 4LF8E 3VYXA 4DUZE 3LLHA 4LF9E 3OTOE 5LMNE 2HHHE 3T1YE 4B3TE 1UILA 2LJHA 4DR2E 1IBLE 3C4TA 1I94E 2UUCE 3T1HE 4KHPE 2UXCE 1YYWA 4B3SE 2YT4A 4X64E 4OX9E 1T4OA 2L2KB 2UU9E 2RS6A 4DR4E 2JVAA 3ADIA 2L2MA 4M30A 4JI7E 4LF7E 1X49A 1YYOA 2NUFA 1N32E 2L33A 2B7TA 4GKJE 2B3TB 4AQYE 4OOGC 2UXBE 2NA2A 1HNXE 1STUA 2LBSB 2L2NA 1O0WA 2DMYA 4DV1E 2ZM6E 2DB2A 4M2ZA 2N3HA 1GQEA 2F4VE 2N3GA 1UHZA 3C4BA 4DV0E 1PKPA 4WFTA 4DUYE 4DV2E 4K0KE 1IBKE 2UUBE 4NXNE 4DR7E 1WHNA 4DKKA 4JI3E 2UUAE 2LUPB 1XMOE 4DV5E 1T4LB 1N34E 4YHHE 1XNRE 1J5EE 1RQ0A 1HNZE 1J26A 4DR6E 1XMQE 4GKKE 2RS7A 1N33E 4LF6E 3ADJA 1N36E 2L3JA 4JI2E 4DR1E 2RSMA 2MDRA 2RTXA 3J7Yp 4DV3E 1YZ9A 4JI6E 1X47A 1HR0E 1IBME 4JI4E 1FKAE 2E5LE 4YY3E 2CPNA 4DV6E 1XNQE 1X48A 5BR8E 2EZ6A 3ADGA 4JYAE 1T4NA 4JI8E 4B3ME 2B7VA 3VYYA 2UXDE 2DIXA 3HTXA 2VQFE 4X66E 2LRSA 4LF4E 4WYQB 5LMUE 4X8WA 2NUGA 4X62E 1ZBTA 3P1XA 4DV7E 5IWAE 1QU6A 1EKZA 2LUQA 4X65E 1WHQA 4LFAE 2L3CA 5CFFE 3ADLA 2NUEA 1FJGE 2LTSA 4DR3E 4DV4E 2KHXA 4LF5E 4DR5E 2LTRA 1RC7A 4JI0E 1HNWE 4JI5E 2VQEE 1DI2A 4JI1E 4LFBE 1YYKA 4NXME 2JY9A 4LFCE
chains in the Genus database with same CATH superfamily
4JV5E 2M1SA 2RQLA 5KL3A 3VYXA 5AE2A 3OTOE 5AASA 5LMNE 2DSYA 4R2DA 2EM0A 2WCC3 3BF2A 1YYWA 1WRJA 4B3SE 4X64E 4OX9E 1G2FC 1T4OA 4P78A 2RS6A 4DR4E 3BBGA 5AE1A 3ADIA 1YPNA 2L2MA 4MLQA 1T39A 2EL6A 2BB8A 4GEQB 1X49A 1YYOA 5A6BD 2EOZA 2R76A 1JK2A 4WPYA 4GKJE 4KWYA 2CTDA 4OOGC 2EMYA 3EQ1A 1STUA 1LLMC 3H09A 2EE8A 3FIGA 4DV1E 2EOEA 3KZZA 4L5NC 2N3HA 1GQEA 4R2PA 2F4VE 5A6BA 4NZVA 3UK3C 2WBUA 2EJ4A 3ZOQB 2EOQA 2YTOA 2YTEA 2LMZA 4F9AB 3F6GA 4YHHE 2EOFA 4J8ZA 1J26A 5A6AA 1XMQE 4DR6E 2EM9A 1N33E 2DLQA 2L3JA 2MDRA 3J7Yp 1YZ9A 5KL4A 2GPIA 1X47A 1HR0E 1FKAE 1A1LA 1X48A 2EZ6A 1MGTA 1T4NA 2K7IA 3KZYA 3THNA 2RPCA 2LJUA 3VYYA 2EOMA 2JOXA 2CSHA 1YUJA 1A1GA 4RH8A 4IJDA 3AUZA 3IWDA 3QG5C 4R2CA 4NHRA 5AC5A 1MEYC 1ZBTA 4P7DA 2EPOA 3VHTB 2EQ1A 2EWLA 3EPLA 2DLKA 1AH5A 4I8OA 2ENCA 4R2QA 2L3CA 5CFFE 1PJQA 2KONA 2YTDA 4DV4E 2KHXA 4TUIA 4DR5E 4R03A 4JI0E 2YTNA 2VQEE 4LFBE 3AV0A 4NXME 2EPXA 2EM6A 4IS1C 1B69A 2IHR1 4LF9E 2EMWA 2KOUA 5KL5A 5KL7A 2EM3A 4R2SA 2UUCE 2YTPA 3T1HE 2MDGA 4KHPE 1T38A 2WZOA 2EPCA 3JAMC 4ZYHA 2EM7A 2EN7A 1SR9A 3F6HA 4BS9A 5IT9C 3MHSC 2K4VA 2JXPA 2L33A 2FTXB 2ADRA 4BHCA 5KL2A 2DRPA 5KL6A 2L2NA 2EQ0A 2ZM6E 2EMZA 1X5WA 2R1FA 2VRDA 2N3GA 2EPMX 1UHZA 4WXDA 4ZYGA 5FLXC 2DMIA 2WBSA 1ZR9A 4WFTA 2ODRC 4K0KE 2YTIA 4X9JA 1N34E 2EPRA 2V85A 1HNZE 2EOIA 2EPLX 2J7JA 1SFEA 2RS7A 4Q35B 4LF6E 2M4IA 4DR1E 1YUIA 4BC7A 2EMCA 1QNTA 4R8OA 1IBME 1X6EA 2E5LE 2E72A 4TUGA 4DV6E 2F8BA 1XNQE 1BBOA 3J7AG 5IV8B 5LLQA 4B3ME 2EM4A 1TF6A 2L8TA 2DIXA 2EM2A 1PDAA 4F54A 4X8WA 5LMUE 2NUGA 2EPZA 5TSEA 4X62E 2FV4B 3P1XA 5IXMB 1YFHA 5A2QC 3IWBA 3ECRA 2EN1A 2FGGA 2EMFA 4O5GA 1UBDC 2EL5A 2NUEA 4O24A 2V8QB 2M9AA 2H36X 2LTRA 2L92A 2EN2A 2MC6A 5A6KA 4JI1E 2EM5A 2JYAA 2Q8UA 5T6JA 2E1MA 2DGCA 2ENHA 3KWRA 4BC9A 1WXRA 4BHBA 4LF8E 4DUZE 3LLHA 2LCEA 1IMUA 2LJHA 4DR2E 3C4TA 1I94E 2MKNA 1X3CA 2UXCE 3OMLA 4MLVA 2YT4A 2YWQA 2L2KB 1A1KA 1ZAAC 4F9CB 4DMIA 4WSGA 3THOB 4JI7E 4M0VA 4ZYDA 2EPAA 2EPUA 4LF7E 1NCSA 2JWOA 1N32E 4WXCA 1TN9A 1X6HA 3IWCA 1KJKA 2B7TA 4R2RA 2LVHA 3JTZA 4AQYE 4M9VC 4BCAA 2EOXA 2UXBE 2EOSA 3K6QA 2EPKX 3DJWA 2LBSB 2N8XA 2EMXA 2YTGA 1BB8A 3DF6A 1A1JA 2DB2A 2EOOA 4M2ZA 2L6MA 2HC5A 2ENAA 1P47A 3C4BA 1PKPA 2I9IA 4DUYE 4DV2E 1IBKE 2UUBE 4NXNE 2BBGA 4HEIA 1BBGA 4DR7E 3HXLA 3MHHC 4JI3E 2UUAE 2VE7C 2JOBA 2LE2A 4BBYA 2EPPA 2YU5A 2VF1A 2EM8A 1T4LB 1J5EE 1RQ0A 3TQMA 4WSPA 2EMKA 1JK1A 3HQ1A 4GKKE 3ADJA 1N36E 1F2IG 5F3WA 3EPKA 2EP3A 2M7QA 2EMIA 2RTXA 4RHBB 1EH6A 3VK6A 2RSIA 1G2DC 1ZBQA 3JU0A 5AE3A 4JYAE 4JI8E 2YPNA 1GTKA 1IQOA 2B7VA 1Z1BA 3J81C 2UXDE 3HTXA 2VQFE 4X66E 2G7HA 2LRSA 4HTGA 4WYQB 4R2EA 2EN8A 1N3GA 4DV7E 2LT7A 2EOYA 2EN4A 1ZU1A 5IWAE 2WBTA 1QU6A 1EKZA 1WHQA 4LFAE 3L00A 2YTQA 5AC4A 3ADLA 2EMHA 2I13A 4O43A 4LF5E 2YTJA 2EOHA 2EL4A 1RC7A 1DI2A 2D9HA 4WX9A 4O4KA 4DV0E 4B3RE 4F6MA 1X6FA 2EMBA 2EMAA 2HHHE 1NEIA 2JP9A 3T1YE 4B3TE 4LU9A 1UILA 1IBLE 3C6MA 1WJPA 3EPJA 4KZSA 2LO3A 2YSOA 2A25A 4Q28A 1TF3A 2PRTA 2UU9E 1A1FA 2V83A 2JVAA 3HPZA 2EN3A 4F6NA 3J80C 2V88A 2LV2A 4M30A 3RMPA 4R2AA 3BIDA 2GLIA 2NUFA 2YZTA 2B3TB 2NABA 2NA2A 1HNXE 5DNYA 3EPHA 1O0WA 2CT1A 2DMYA 2JR1A 2YSPA 2HGHA 1PJTA 5LL6R 2ELZA 1GZ6A 4FK5C 3HPSA 2EPNA 4BMJA 2ODRD 1A1IA 5A69A 2HJJA 1YSAC 2YTFA 1WHNA 4DKKA 2V86A 2B9DA 3MSWA 5ADZA 2LUPB 1XMOE 4DV5E 1XNRE 2EQ3A 2YRMA 1DQ3A 4JI2E 3LMLA 2GHFA 2RSMA 4F2JC 3BGHA 1EH8A 4DV3E 2ELYA 3C6KA 4JI6E 4JI4E 5A6JA 4YY3E 4N4RB 2CPNA 2MC5A 2EMGA 5BR8E 2EORA 3ADGA 1IQSA 2JPAA 1EH7A 4LTYA 3M99B 2YRKA 4LF4E 4L8NA 2V89A 2MKDA 1UN6B 4GZNC 2YRHA 4ZYEA 1RMDA 2LUQA 4X65E 1KYQA 2EOJA 1PJSA 1L4SA 2V87A 1FJGE 2LTSA 4DR3E 2EMLA 4F9BB 1DGCA 1HNWE 4JI5E 1A1HA 2EN6A 1YYKA 1AAYA 2JY9A 2YU8A 4LFCE
chains in the Genus database with same CATH topology
4JV5E 4B3RE 2M1SA 3KWRA 5T6JA 4BC9A 1WXRA 2IHR1 4LF8E 3VYXA 4DUZE 3LLHA 4LF9E 5AE2A 3OTOE 5AASA 5LMNE 2HHHE 2KOUA 3T1YE 2DSYA 4B3TE 4LU9A 1UILA 2LJHA 4DR2E 1IBLE 3C4TA 1I94E 2UUCE 3T1HE 4KHPE 2UXCE 1YYWA 4KZSA 3OMLA 2WZOA 4B3SE 2YT4A 4Q28A 3JAMC 4X64E 4OX9E 1T4OA 4P78A 2L2KB 2UU9E 2RS6A 4DR4E 1SR9A 4F9CB 2V83A 2JVAA 3HPZA 5AE1A 3ADIA 3F6HA 2L2MA 4BS9A 4DMIA 3J80C 4GEQB 2V88A 4M30A 3RMPA 4JI7E 5IT9C 4M0VA 4LF7E 1X49A 1YYOA 2JWOA 2NUFA 1N32E 2K4VA 3IWCA 2L33A 2B7TA 2FTXB 2B3TB 2YZTA 3JTZA 4WPYA 4AQYE 4GKJE 4OOGC 4BCAA 2UXBE 2NA2A 3K6QA 3DJWA 1HNXE 5DNYA 1STUA 2LBSB 2L2NA 3H09A 3FIGA 1O0WA 2DMYA 4DV1E 2JR1A 2ZM6E 3DF6A 5LL6R 2DB2A 4L5NC 4M2ZA 2N3HA 1GQEA 1GZ6A 2L6MA 2F4VE 2N3GA 1UHZA 3HPSA 3C4BA 5FLXC 4DV0E 4BMJA 2ODRD 1PKPA 4WFTA 2ODRC 4DUYE 4DV2E 1IBKE 4K0KE 2UUBE 4NXNE 3ZOQB 4DR7E 1WHNA 4DKKA 3HXLA 2V86A 2B9DA 3MSWA 4JI3E 2UUAE 2VE7C 2JOBA 2LE2A 5ADZA 2LUPB 1XMOE 4BBYA 4DV5E 2LMZA 2VF1A 4F9AB 3F6GA 1T4LB 4YHHE 1N34E 1XNRE 2V85A 1RQ0A 4J8ZA 1J5EE 4WSPA 1HNZE 1J26A 3HQ1A 1XMQE 4DR6E 4GKKE 2RS7A 1N33E 1DQ3A 4LF6E 3ADJA 1N36E 2L3JA 4JI2E 3LMLA 2M4IA 5F3WA 4DR1E 2RSMA 2M7QA 2MDRA 4BC7A 2RTXA 3J7Yp 4DV3E 1YZ9A 4JI6E 3VK6A 1X47A 4R8OA 1HR0E 1IBME 4JI4E 1FKAE 2E5LE 4YY3E 4TUGA 2CPNA 4DV6E 2F8BA 1XNQE 2MC5A 1X48A 1ZBQA 3JU0A 3ADGA 5BR8E 5AE3A 2EZ6A 3J7AG 1T4NA 4JI8E 4B3ME 4JYAE 2B7VA 3VYYA 2JOXA 4LTYA 3J81C 2UXDE 2L8TA 2DIXA 3HTXA 2VQFE 4X66E 2G7HA 2LRSA 3AUZA 4LF4E 3IWDA 4WYQB 4L8NA 4F54A 2V89A 4X8WA 5LMUE 2NUGA 4X62E 1ZBTA 2FV4B 3P1XA 4P7DA 4DV7E 5IWAE 5A2QC 3IWBA 2EWLA 1QU6A 1EKZA 4I8OA 2FGGA 2LUQA 4X65E 1WHQA 4LFAE 2L3CA 5CFFE 3ADLA 2NUEA 2V87A 1FJGE 2LTSA 2KONA 2V8QB 4DR3E 2H36X 4DV4E 2KHXA 4LF5E 4TUIA 4DR5E 4R03A 2LTRA 4F9BB 1RC7A 4JI0E 1HNWE 2L92A 4JI5E 2MC6A 2VQEE 4JI1E 4LFBE 1YYKA 1DI2A 3AV0A 4NXME 2JY9A 4LFCE 2E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  4B3R E;  2IHR 1;  4LF8 E;  3VYX A;  4DUZ E;  3LLH A;  4LF9 E;  3OTO E;  5LMN E;  2HHH E;  3T1Y E;  4B3T E;  1UIL A;  2LJH A;  4DR2 E;  1IBL E;  3C4T A;  1I94 E;  2UUC E;  3T1H E;  4KHP E;  2UXC E;  1YYW A;  4B3S E;  2YT4 A;  4X64 E;  4OX9 E;  1T4O A;  2L2K B;  2UU9 E;  2RS6 A;  4DR4 E;  2JVA A;  3ADI A;  2L2M A;  4M30 A;  4JI7 E;  4LF7 E;  1X49 A;  1YYO A;  2NUF A;  1N32 E;  2L33 A;  2B7T A;  4GKJ E;  2B3T B;  4AQY E;  4OOG C;  2UXB E;  2NA2 A;  1HNX E;  1STU A;  2LBS B;  2L2N A;  1O0W A;  2DMY A;  4DV1 E;  2ZM6 E;  2DB2 A;  4M2Z A;  2N3H A;  1GQE A;  2F4V E;  2N3G A;  1UHZ A;  3C4B A;  4DV0 E;  1PKP A;  4WFT A;  4DUY E;  4DV2 E;  4K0K E;  1IBK E;  2UUB E;  4NXN E;  4DR7 E;  1WHN A;  4DKK A;  4JI3 E;  2UUA E;  2LUP B;  1XMO E;  4DV5 E;  1T4L B;  1N34 E;  4YHH E;  1XNR E;  1J5E E;  1RQ0 A;  1HNZ E;  1J26 A;  4DR6 E;  1XMQ E;  4GKK E;  2RS7 A;  1N33 E;  4LF6 E;  3ADJ A;  1N36 E;  2L3J A;  4JI2 E;  4DR1 E;  2RSM A;  2MDR A;  2RTX A;  3J7Y p;  4DV3 E;  1YZ9 A;  4JI6 E;  1X47 A;  1HR0 E;  1IBM E;  4JI4 E;  1FKA E;  2E5L E;  4YY3 E;  2CPN A;  4DV6 E;  1XNQ E;  1X48 A;  5BR8 E;  2EZ6 A;  3ADG A;  4JYA E;  1T4N A;  4JI8 E;  4B3M E;  2B7V A;  3VYY A;  2UXD E;  2DIX A;  3HTX A;  2VQF E;  4X66 E;  2LRS A;  4LF4 E;  4WYQ B;  5LMU E;  4X8W A;  2NUG A;  4X62 E;  1ZBT A;  3P1X A;  4DV7 E;  5IWA E;  1QU6 A;  1EKZ A;  2LUQ A;  4X65 E;  1WHQ A;  4LFA E;  2L3C A;  5CFF E;  3ADL A;  2NUE A;  1FJG E;  2LTS A;  4DR3 E;  4DV4 E;  2KHX A;  4LF5 E;  4DR5 E;  2LTR A;  1RC7 A;  4JI0 E;  1HNW E;  4JI5 E;  2VQE E;  1DI2 A;  4JI1 E;  4LFB E;  1YYK A;  4NXM E;  2JY9 A;  4LFC E; 
#chains in the Genus database with same CATH topology
 4JV5 E;  2M1S A;  2RQL A;  5KL3 A;  3VYX A;  5AE2 A;  3OTO E;  5AAS A;  5LMN E;  2DSY A;  4R2D A;  2EM0 A;  2WCC 3;  3BF2 A;  1YYW A;  1WRJ A;  4B3S E;  4X64 E;  4OX9 E;  1G2F C;  1T4O A;  4P78 A;  2RS6 A;  4DR4 E;  3BBG A;  5AE1 A;  3ADI A;  1YPN A;  2L2M A;  4MLQ A;  1T39 A;  2EL6 A;  2BB8 A;  4GEQ B;  1X49 A;  1YYO A;  5A6B D;  2EOZ A;  2R76 A;  1JK2 A;  4WPY A;  4GKJ E;  4KWY A;  2CTD A;  4OOG C;  2EMY A;  3EQ1 A;  1STU A;  1LLM C;  3H09 A;  2EE8 A;  3FIG A;  4DV1 E;  2EOE A;  3KZZ A;  4L5N C;  2N3H A;  1GQE A;  4R2P A;  2F4V E;  5A6B A;  4NZV A;  3UK3 C;  2WBU A;  2EJ4 A;  3ZOQ B;  2EOQ A;  2YTO A;  2YTE A;  2LMZ A;  4F9A B;  3F6G A;  4YHH E;  2EOF A;  4J8Z A;  1J26 A;  5A6A A;  1XMQ E;  4DR6 E;  2EM9 A;  1N33 E;  2DLQ A;  2L3J A;  2MDR A;  3J7Y p;  1YZ9 A;  5KL4 A;  2GPI A;  1X47 A;  1HR0 E;  1FKA E;  1A1L A;  1X48 A;  2EZ6 A;  1MGT A;  1T4N A;  2K7I A;  3KZY A;  3THN A;  2RPC A;  2LJU A;  3VYY A;  2EOM A;  2JOX A;  2CSH A;  1YUJ A;  1A1G A;  4RH8 A;  4IJD A;  3AUZ A;  3IWD A;  3QG5 C;  4R2C A;  4NHR A;  5AC5 A;  1MEY C;  1ZBT A;  4P7D A;  2EPO A;  3VHT B;  2EQ1 A;  2EWL A;  3EPL A;  2DLK A;  1AH5 A;  4I8O A;  2ENC A;  4R2Q A;  2L3C A;  5CFF E;  1PJQ A;  2KON A;  2YTD A;  4DV4 E;  2KHX A;  4TUI A;  4DR5 E;  4R03 A;  4JI0 E;  2YTN A;  2VQE E;  4LFB E;  3AV0 A;  4NXM E;  2EPX A;  2EM6 A;  4IS1 C;  1B69 A;  2IHR 1;  4LF9 E;  2EMW A;  2KOU A;  5KL5 A;  5KL7 A;  2EM3 A;  4R2S A;  2UUC E;  2YTP A;  3T1H E;  2MDG A;  4KHP E;  1T38 A;  2WZO A;  2EPC A;  3JAM C;  4ZYH A;  2EM7 A;  2EN7 A;  1SR9 A;  3F6H A;  4BS9 A;  5IT9 C;  3MHS C;  2K4V A;  2JXP A;  2L33 A;  2FTX B;  2ADR A;  4BHC A;  5KL2 A;  2DRP A;  5KL6 A;  2L2N A;  2EQ0 A;  2ZM6 E;  2EMZ A;  1X5W A;  2R1F A;  2VRD A;  2N3G A;  2EPM X;  1UHZ A;  4WXD A;  4ZYG A;  5FLX C;  2DMI A;  2WBS A;  1ZR9 A;  4WFT A;  2ODR C;  4K0K E;  2YTI A;  4X9J A;  1N34 E;  2EPR A;  2V85 A;  1HNZ E;  2EOI A;  2EPL X;  2J7J A;  1SFE A;  2RS7 A;  4Q35 B;  4LF6 E;  2M4I A;  4DR1 E;  1YUI A;  4BC7 A;  2EMC A;  1QNT A;  4R8O A;  1IBM E;  1X6E A;  2E5L E;  2E72 A;  4TUG A;  4DV6 E;  2F8B A;  1XNQ E;  1BBO A;  3J7A G;  5IV8 B;  5LLQ A;  4B3M E;  2EM4 A;  1TF6 A;  2L8T A;  2DIX A;  2EM2 A;  1PDA A;  4F54 A;  4X8W A;  5LMU E;  2NUG A;  2EPZ A;  5TSE A;  4X62 E;  2FV4 B;  3P1X A;  5IXM B;  1YFH A;  5A2Q C;  3IWB A;  3ECR A;  2EN1 A;  2FGG A;  2EMF A;  4O5G A;  1UBD C;  2EL5 A;  2NUE A;  4O24 A;  2V8Q B;  2M9A A;  2H36 X;  2LTR A;  2L92 A;  2EN2 A;  2MC6 A;  5A6K A;  4JI1 E;  2EM5 A;  2JYA A;  2Q8U A;  5T6J A;  2E1M A;  2DGC A;  2ENH A;  3KWR A;  4BC9 A;  1WXR A;  4BHB A;  4LF8 E;  4DUZ E;  3LLH A;  2LCE A;  1IMU A;  2LJH A;  4DR2 E;  3C4T A;  1I94 E;  2MKN A;  1X3C A;  2UXC E;  3OML A;  4MLV A;  2YT4 A;  2YWQ A;  2L2K B;  1A1K A;  1ZAA C;  4F9C B;  4DMI A;  4WSG A;  3THO B;  4JI7 E;  4M0V A;  4ZYD A;  2EPA A;  2EPU A;  4LF7 E;  1NCS A;  2JWO A;  1N32 E;  4WXC A;  1TN9 A;  1X6H A;  3IWC A;  1KJK A;  2B7T A;  4R2R A;  2LVH A;  3JTZ A;  4AQY E;  4M9V C;  4BCA A;  2EOX A;  2UXB E;  2EOS A;  3K6Q A;  2EPK X;  3DJW A;  2LBS B;  2N8X A;  2EMX A;  2YTG A;  1BB8 A;  3DF6 A;  1A1J A;  2DB2 A;  2EOO A;  4M2Z A;  2L6M A;  2HC5 A;  2ENA A;  1P47 A;  3C4B A;  1PKP A;  2I9I A;  4DUY E;  4DV2 E;  1IBK E;  2UUB E;  4NXN E;  2BBG A;  4HEI A;  1BBG A;  4DR7 E;  3HXL A;  3MHH C;  4JI3 E;  2UUA E;  2VE7 C;  2JOB A;  2LE2 A;  4BBY A;  2EPP A;  2YU5 A;  2VF1 A;  2EM8 A;  1T4L B;  1J5E E;  1RQ0 A;  3TQM A;  4WSP A;  2EMK A;  1JK1 A;  3HQ1 A;  4GKK E;  3ADJ A;  1N36 E;  1F2I G;  5F3W A;  3EPK A;  2EP3 A;  2M7Q A;  2EMI A;  2RTX A;  4RHB B;  1EH6 A;  3VK6 A;  2RSI A;  1G2D C;  1ZBQ A;  3JU0 A;  5AE3 A;  4JYA E;  4JI8 E;  2YPN A;  1GTK A;  1IQO A;  2B7V A;  1Z1B A;  3J81 C;  2UXD E;  3HTX A;  2VQF E;  4X66 E;  2G7H A;  2LRS A;  4HTG A;  4WYQ B;  4R2E A;  2EN8 A;  1N3G A;  4DV7 E;  2LT7 A;  2EOY A;  2EN4 A;  1ZU1 A;  5IWA E;  2WBT A;  1QU6 A;  1EKZ A;  1WHQ A;  4LFA E;  3L00 A;  2YTQ A;  5AC4 A;  3ADL A;  2EMH A;  2I13 A;  4O43 A;  4LF5 E;  2YTJ A;  2EOH A;  2EL4 A;  1RC7 A;  1DI2 A;  2D9H A;  4WX9 A;  4O4K A;  4DV0 E;  4B3R E;  4F6M A;  1X6F A;  2EMB A;  2EMA A;  2HHH E;  1NEI A;  2JP9 A;  3T1Y E;  4B3T E;  4LU9 A;  1UIL A;  1IBL E;  3C6M A;  1WJP A;  3EPJ A;  4KZS A;  2LO3 A;  2YSO A;  2A25 A;  4Q28 A;  1TF3 A;  2PRT A;  2UU9 E;  1A1F A;  2V83 A;  2JVA A;  3HPZ A;  2EN3 A;  4F6N A;  3J80 C;  2V88 A;  2LV2 A;  4M30 A;  3RMP A;  4R2A A;  3BID A;  2GLI A;  2NUF A;  2YZT A;  2B3T B;  2NAB A;  2NA2 A;  1HNX E;  5DNY A;  3EPH A;  1O0W A;  2CT1 A;  2DMY A;  2JR1 A;  2YSP A;  2HGH A;  1PJT A;  5LL6 R;  2ELZ A;  1GZ6 A;  4FK5 C;  3HPS A;  2EPN A;  4BMJ A;  2ODR D;  1A1I A;  5A69 A;  2HJJ A;  1YSA C;  2YTF A;  1WHN A;  4DKK A;  2V86 A;  2B9D A;  3MSW A;  5ADZ A;  2LUP B;  1XMO E;  4DV5 E;  1XNR E;  2EQ3 A;  2YRM A;  1DQ3 A;  4JI2 E;  3LML A;  2GHF A;  2RSM A;  4F2J C;  3BGH A;  1EH8 A;  4DV3 E;  2ELY A;  3C6K A;  4JI6 E;  4JI4 E;  5A6J A;  4YY3 E;  4N4R B;  2CPN A;  2MC5 A;  2EMG A;  5BR8 E;  2EOR A;  3ADG A;  1IQS A;  2JPA A;  1EH7 A;  4LTY A;  3M99 B;  2YRK A;  4LF4 E;  4L8N A;  2V89 A;  2MKD A;  1UN6 B;  4GZN C;  2YRH A;  4ZYE A;  1RMD A;  2LUQ A;  4X65 E;  1KYQ A;  2EOJ A;  1PJS A;  1L4S A;  2V87 A;  1FJG E;  2LTS A;  4DR3 E;  2EML A;  4F9B B;  1DGC A;  1HNW E;  4JI5 E;  1A1H A;  2EN6 A;  1YYK A;  1AAY A;  2JY9 A;  2YU8 A;  4LFC E; 
#chains in the Genus database with same CATH homology
 4JV5 E;  4B3R E;  2M1S A;  3KWR A;  5T6J A;  4BC9 A;  1WXR A;  2IHR 1;  4LF8 E;  3VYX A;  4DUZ E;  3LLH A;  4LF9 E;  5AE2 A;  3OTO E;  5AAS A;  5LMN E;  2HHH E;  2KOU A;  3T1Y E;  2DSY A;  4B3T E;  4LU9 A;  1UIL A;  2LJH A;  4DR2 E;  1IBL E;  3C4T A;  1I94 E;  2UUC E;  3T1H E;  4KHP E;  2UXC E;  1YYW A;  4KZS A;  3OML A;  2WZO A;  4B3S E;  2YT4 A;  4Q28 A;  3JAM C;  4X64 E;  4OX9 E;  1T4O A;  4P78 A;  2L2K B;  2UU9 E;  2RS6 A;  4DR4 E;  1SR9 A;  4F9C B;  2V83 A;  2JVA A;  3HPZ A;  5AE1 A;  3ADI A;  3F6H A;  2L2M A;  4BS9 A;  4DMI A;  3J80 C;  4GEQ B;  2V88 A;  4M30 A;  3RMP A;  4JI7 E;  5IT9 C;  4M0V A;  4LF7 E;  1X49 A;  1YYO A;  2JWO A;  2NUF A;  1N32 E;  2K4V A;  3IWC A;  2L33 A;  2B7T A;  2FTX B;  2B3T B;  2YZT A;  3JTZ A;  4WPY A;  4AQY E;  4GKJ E;  4OOG C;  4BCA A;  2UXB E;  2NA2 A;  3K6Q A;  3DJW A;  1HNX E;  5DNY A;  1STU A;  2LBS B;  2L2N A;  3H09 A;  3FIG A;  1O0W A;  2DMY A;  4DV1 E;  2JR1 A;  2ZM6 E;  3DF6 A;  5LL6 R;  2DB2 A;  4L5N C;  4M2Z A;  2N3H A;  1GQE A;  1GZ6 A;  2L6M A;  2F4V E;  2N3G A;  1UHZ A;  3HPS A;  3C4B A;  5FLX C;  4DV0 E;  4BMJ A;  2ODR D;  1PKP A;  4WFT A;  2ODR C;  4DUY E;  4DV2 E;  1IBK E;  4K0K E;  2UUB E;  4NXN E;  3ZOQ B;  4DR7 E;  1WHN A;  4DKK A;  3HXL A;  2V86 A;  2B9D A;  3MSW A;  4JI3 E;  2UUA E;  2VE7 C;  2JOB A;  2LE2 A;  5ADZ A;  2LUP B;  1XMO E;  4BBY A;  4DV5 E;  2LMZ A;  2VF1 A;  4F9A B;  3F6G A;  1T4L B;  4YHH E;  1N34 E;  1XNR E;  2V85 A;  1RQ0 A;  4J8Z A;  1J5E E;  4WSP A;  1HNZ E;  1J26 A;  3HQ1 A;  1XMQ E;  4DR6 E;  4GKK E;  2RS7 A;  1N33 E;  1DQ3 A;  4LF6 E;  3ADJ A;  1N36 E;  2L3J A;  4JI2 E;  3LML A;  2M4I A;  5F3W A;  4DR1 E;  2RSM A;  2M7Q A;  2MDR A;  4BC7 A;  2RTX A;  3J7Y p;  4DV3 E;  1YZ9 A;  4JI6 E;  3VK6 A;  1X47 A;  4R8O A;  1HR0 E;  1IBM E;  4JI4 E;  1FKA E;  2E5L E;  4YY3 E;  4TUG A;  2CPN A;  4DV6 E;  2F8B A;  1XNQ E;  2MC5 A;  1X48 A;  1ZBQ A;  3JU0 A;  3ADG A;  5BR8 E;  5AE3 A;  2EZ6 A;  3J7A G;  1T4N A;  4JI8 E;  4B3M E;  4JYA E;  2B7V A;  3VYY A;  2JOX A;  4LTY A;  3J81 C;  2UXD E;  2L8T A;  2DIX A;  3HTX A;  2VQF E;  4X66 E;  2G7H A;  2LRS A;  3AUZ A;  4LF4 E;  3IWD A;  4WYQ B;  4L8N A;  4F54 A;  2V89 A;  4X8W A;  5LMU E;  2NUG A;  4X62 E;  1ZBT A;  2FV4 B;  3P1X A;  4P7D A;  4DV7 E;  5IWA E;  5A2Q C;  3IWB A;  2EWL A;  1QU6 A;  1EKZ A;  4I8O A;  2FGG A;  2LUQ A;  4X65 E;  1WHQ A;  4LFA E;  2L3C A;  5CFF E;  3ADL A;  2NUE A;  2V87 A;  1FJG E;  2LTS A;  2KON A;  2V8Q B;  4DR3 E;  2H36 X;  4DV4 E;  2KHX A;  4LF5 E;  4TUI A;  4DR5 E;  4R03 A;  2LTR A;  4F9B B;  1RC7 A;  4JI0 E;  1HNW E;  2L92 A;  4JI5 E;  2MC6 A;  2VQE E;  4JI1 E;  4LFB E;  1YYK A;  1DI2 A;  3AV0 A;  4NXM E;  2JY9 A;  4LFC E;  2E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...