2EOZA

Solution structure of the c2h2 type zinc finger (region 809-841) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQETLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 809-841) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 473
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eozA01
2EM3A 2EMXA 2LV2A 2A25A 2EMZA 4R2AA 2DLKA 2YSPA 2YTJA 3EPKA 2PRTA 1G2DC 2M9AA 2EN2A 3EPJA 2MKDA 2ENCA 2YRHA 2EJ4A 5KL7A 2LVHA 2YTEA 2DMIA 2EM6A 4R2RA 1TF3A 2EE8A 2VRDA 1NCSA 2EOJA 4R2CA 4IS1C 2EN6A 2EN1A 1A1KA 2EMFA 2E72A 1A1HA 3UK3C 4R2SA 2I13A 2RPCA 2YTOA 2ELYA 2WCC3 5KL6A 2EOXA 4FK5C 5KL3A 1BB8A 2EL4A 2EL5A 1RMDA 2ENHA 1YUJA 2EN8A 2GHFA 1TF6A 1KJKA 2EOZA 3M99B 2DRPA 2EM0A 2EQ0A 2EP3A 1B69A 2YTGA 1X6HA 2EMHA 2YTIA 2EOYA 3MHSC 2D9HA 2EQ1A 1A1GA 2EMCA 2JPAA 2EMGA 1Z1BA 2EPCA 4R2QA 1AAYA 1YUIA 2DGCA 2EL6A 2BB8A 1X3CA 3EPHA 2EOHA 3VHTB 2LO3A 1A1JA 4X9JA 1JK2A 2R1FA 4R2DA 2EOMA 2YRKA 1DGCA 2EN3A 1X6FA 2EM5A 2EOSA 2MDGA 4IJDA 2YU5A 2EMKA 4GZNC 1X5WA 1MEYC 1A1LA 2EM9A 2EPXA 2EPAA 2EOIA 4F6MA 2EQ3A 2WBUA 2YU8A 2CT1A 2YTDA 2J7JA 2EOQA 4R2PA 4F2JC 1ZAAC 2ENAA 2CSHA 2EMBA 2EMIA 2EMWA 2WBTA 2EMAA 2YTPA 4F6NA 2EM2A 2EM8A 2CTDA 2EMYA 1JK1A 1UBDC 1X6EA 2DLQA 2EN4A 2EN7A 2EPPA 2EOEA 1F2IG 2YTNA 1UN6B 2EMLA 2EPRA 2WBSA 1WJPA 2EORA 2YRMA 2EPZA 2LCEA 1G2FC 1ZR9A 2YSOA 2EPUA 4WSGA 2YTFA 1BBOA 1TN9A 2MKNA 1YSAC 1ZU1A 2GLIA 1P47A 2EM7A 1LLMC 2LT7A 3MHHC 2EOOA 5KL2A 2EOFA 2ADRA 4R2EA 2ELZA 2RSIA 2NABA 2EM4A 5KL5A 2HGHA 1A1IA 5KL4A 3EPLA 1A1FA 4M9VC 2JP9A 2YTQA
chains in the Genus database with same CATH superfamily
3ECRA 4HEIA 2PRTA 2K7IA 1G2DC 2M9AA 3EPJA 2JOBA 4DV2E 2EJ4A 2N3HA 4KHPE 2EM6A 4R2RA 1RQ0A 1TF3A 1NCSA 1A1KA 2EMFA 2I13A 1RC7A 2FGGA 5KL3A 2EL4A 5IT9C 1PKPA 3BF2A 4DV4E 4JI3E 3BIDA 2UXDE 3HQ1A 4LFAE 3T1HE 1WXRA 2L2MA 2NA2A 2UUAE 2Q8UA 4R2QA 4LF4E 2DGCA 4RHBB 4JV5E 4LFCE 5AASA 2V83A 2BB8A 1N33E 2L92A 2HC5A 4LF8E 1YPNA 5F3WA 4LF7E 1IBME 1BBGA 3EQ1A 4TUGA 1A1JA 4X9JA 2B7TA 1DQ3A 4R2DA 1X48A 2R76A 2EM5A 1MEYC 4LU9A 2EPXA 2EOIA 2WBUA 1WHNA 2CT1A 1IQOA 4DUYE 2JR1A 2HJJA 2CSHA 5BR8E 2EMIA 2EMWA 5IV8B 2EZ6A 1HNWE 2EM8A 2KHXA 2DLQA 1SR9A 2EN7A 2EPPA 3T1YE 2M4IA 4GKKE 1O0WA 2EPRA 2EORA 2YRMA 3ADLA 2EPZA 4LFBE 2LUQA 2UXCE 1UHZA 1PDAA 3DF6A 1N3GA 4X64E 1T4LB 1XNRE 2VQEE 4DR4E 2YPNA 1NEIA 1A1IA 2F4VE 3VK6A 5KL4A 2M7QA 1PJSA 5LL6R 3IWDA 4JI7E 1MGTA 1WRJA 2DB2A 5A2QC 2YTJA 2YSPA 4JI5E 1IBLE 2MKDA 2YRHA 3THOB 4OOGC 4J8ZA 1PJTA 1X47A 2YTEA 2DMIA 4WXCA 5A6BA 4NXNE 1YYKA 4IS1C 4R2CA 2L6MA 2RSMA 5A6BD 2E72A 1T38A 1A1HA 4DV0E 2RPCA 2ELYA 5KL6A 2V86A 3HTXA 2EL5A 1RMDA 2ENHA 2MDRA 3P1XA 2N8XA 4LF6E 2RS7A 3M99B 2EM0A 5AE3A 2EQ0A 3RMPA 1YYWA 4ZYDA 2RTXA 2YTGA 1X6HA 2YTIA 1B69A 1L4SA 2BBGA 3AV0A 4BCAA 4BC9A 1AAYA 1YUIA 3LMLA 3C6MA 2JWOA 2E5LE 4WYQB 1T39A 4F54A 4DMIA 2YRKA 2EN3A 4L8NA 1X6FA 2EOSA 1YYOA 2EMKA 3C4BA 1X5WA 2EPAA 2JOXA 3KZYA 2L33A 1N32E 2LTSA 1EH7A 2J7JA 3C6KA 4Q35B 3L00A 2JVAA 4WSPA 1ZAAC 3AUZA 2E1MA 4O5GA 4X65E 2VQFE 2EMAA 4F6NA 4X62E 3KZZA 5IWAE 4YHHE 3DJWA 2V87A 2EWLA 1JK1A 2LJUA 2UXBE 1IMUA 2K4VA 1F2IG 3J80C 2VF1A 2EMLA 2WBSA 1WJPA 1G2FC 2B7VA 2EPUA 3F6GA 1BBOA 3ADJA 1FKAE 4WX9A 2EPMX 1YSAC 1ZU1A 4M2ZA 4L5NC 2RQLA 2EM7A 1LLMC 2EPKX 4JI8E 2LT7A 4O24A 2ADRA 4R2EA 2ZM6E 1J5EE 2HGHA 4P7DA 5AE2A 2UU9E 2YTQA 2EMXA 2RS6A 2V88A 4BHCA 2A25A 2MC5A 2FTXB 5AC4A 4ZYHA 1I94E 4DKKA 1X49A 2EN2A 3J7AG 2ENCA 5FLXC 2IHR1 4BMJA 4NHRA 2EPLX 2M1SA 1HNZE 2EOJA 4B3RE 5TSEA 2MC6A 2LMZA 2DIXA 2EOXA 3BBGA 3J7Yp 3K6QA 4MLVA 4R03A 2DSYA 2VE7C 4NXME 3VYYA 1YUJA 2L3JA 4B3ME 2GHFA 1KJKA 5CFFE 5A69A 2EOZA 2DRPA 1GZ6A 4WPYA 4F9AB 4GKJE 2KONA 2EOYA 3MHSC 2EQ1A 2JPAA 2EMGA 1IQSA 4F9CB 5A6KA 1Z1BA 4WXDA 2V85A 3ADGA 4JI4E 1KYQA 4NZVA 4DR5E 1N36E 1X3CA 3VHTB 2LO3A 2DMYA 3IWCA 2H36X 1JK2A 2R1FA 2EOMA 2B3TB 2YT4A 4IJDA 2GPIA 2L2KB 2EM9A 2B9DA 4F6MA 2HHHE 3HPZA 4M0VA 2YTDA 4R2PA 4F2JC 2LE2A 1ZBTA 2ENAA 3JTZA 2YZTA 1FJGE 4Q28A 2WBTA 4JI6E 2N3GA 2EM2A 2KOUA 4K0KE 2EMYA 2LRSA 3THNA 1UBDC 3ZOQB 4DV1E 3HPSA 1GQEA 1IBKE 2LBSB 2EOEA 4KZSA 2YTNA 4LF9E 4DV3E 4LTYA 3BGHA 1ZBQA 1PJQA 3LLHA 4DV6E 1J26A 4WSGA 2YTFA 1WHQA 4BBYA 2I9IA 2MKNA 5AC5A 4KWYA 5A6AA 3KWRA 4DV7E 2WZOA 4YY3E 2GLIA 4BC7A 3F6HA 2UUBE 2YWQA 2EOOA 3OMLA 1UILA 5KL2A 2UUCE 2ELZA 5IXMB 2NABA 2EM4A 5KL5A 2V8QB 4I8OA 1A1FA 4N4RB 4MLQA 2LJHA 2JP9A 4DR6E 2EM3A 1N34E 2L8TA 2LV2A 1SFEA 4RH8A 2EMZA 4ZYEA 4R2AA 4O4KA 2DLKA 3HXLA 3EPKA 5KL7A 2LVHA 3JAMC 4WFTA 1T4NA 1T4OA 4HTGA 2EE8A 2VRDA 3H09A 3JU0A 2JYAA 4O43A 2EN6A 2EN1A 1DI2A 3UK3C 4R2SA 2YTOA 4BS9A 3MSWA 2WCC3 1GTKA 4FK5C 2NUFA 1BB8A 4JI0E 1EH6A 2L2NA 1STUA 5T6JA 4BHBA 2EN8A 2ODRC 1TF6A 4X66E 5LMNE 4DUZE 3ADIA 5AE1A 1HNXE 3IWBA 2EP3A 1QNTA 4P78A 2EMHA 2D9HA 1A1GA 2EMCA 2FV4B 2EPCA 2CPNA 1QU6A 5LLQA 4ZYGA 2EL6A 4F9BB 5DNYA 4AQYE 1EKZA 3EPHA 2JXPA 2EOHA 4B3TE 4OX9E 4X8WA 4GEQB 1DGCA 5A6JA 3J81C 2MDGA 4TUIA 4LF5E 2YU5A 4GZNC 1A1LA 4DR1E 2EQ3A 2YU8A 3TQMA 2LUPB 2EPOA 4JYAE 2NUGA 2EOQA 3C4TA 3OTOE 2F8BA 2EMBA 4M30A 2YTPA 2CTDA 4DR2E 1HR0E 1YFHA 3QG5C 2L3CA 1X6EA 4DV5E 2EN4A 1XMOE 2EPNA 4R8OA 4DR7E 1UN6B 5LMUE 2LCEA 2G7HA 1ZR9A 2NUEA 1AH5A 2YSOA 1TN9A 2LTRA 3VYXA 5ADZA 1P47A 3MHHC 4JI2E 2EOFA 2RSIA 2V89A 2ODRD 1YZ9A 1XNQE 3FIGA 3EPLA 1EH8A 4JI1E 4M9VC 4B3SE 1XMQE 2JY9A 4DR3E
chains in the Genus database with same CATH topology
2EM3A 2EMXA 2LV2A 2A25A 2EMZA 4R2AA 2DLKA 2YSPA 2YTJA 3EPKA 2PRTA 1G2DC 2M9AA 2EN2A 3EPJA 2MKDA 2ENCA 2YRHA 2EJ4A 5KL7A 2LVHA 2YTEA 2DMIA 2EM6A 4R2RA 1TF3A 2EE8A 2VRDA 1NCSA 2EOJA 4R2CA 4IS1C 2EN6A 2EN1A 1A1KA 2EMFA 2E72A 1A1HA 3UK3C 4R2SA 2I13A 2RPCA 2YTOA 2ELYA 2WCC3 5KL6A 2EOXA 4FK5C 5KL3A 1BB8A 2EL4A 2EL5A 1RMDA 2ENHA 1YUJA 2EN8A 2GHFA 1TF6A 1KJKA 2EOZA 3M99B 2DRPA 2EM0A 2EQ0A 2EP3A 1B69A 2YTGA 1X6HA 2EMHA 2YTIA 2EOYA 3MHSC 2D9HA 2EQ1A 1A1GA 2EMCA 2JPAA 2EMGA 1Z1BA 2EPCA 4R2QA 1AAYA 1YUIA 2DGCA 2EL6A 2BB8A 1X3CA 3EPHA 2EOHA 3VHTB 2LO3A 1A1JA 4X9JA 1JK2A 2R1FA 4R2DA 2EOMA 2YRKA 1DGCA 2EN3A 1X6FA 2EM5A 2EOSA 2MDGA 4IJDA 2YU5A 2EMKA 4GZNC 1X5WA 1MEYC 1A1LA 2EM9A 2EPXA 2EPAA 2EOIA 4F6MA 2EQ3A 2WBUA 2YU8A 2CT1A 2YTDA 2J7JA 2EOQA 4R2PA 4F2JC 1ZAAC 2ENAA 2CSHA 2EMBA 2EMIA 2EMWA 2WBTA 2EMAA 2YTPA 4F6NA 2EM2A 2EM8A 2CTDA 2EMYA 1JK1A 1UBDC 1X6EA 2DLQA 2EN4A 2EN7A 2EPPA 2EOEA 1F2IG 2YTNA 1UN6B 2EMLA 2EPRA 2WBSA 1WJPA 2EORA 2YRMA 2EPZA 2LCEA 1G2FC 1ZR9A 2YSOA 2EPUA 4WSGA 2YTFA 1BBOA 1TN9A 2MKNA 1YSAC 1ZU1A 2GLIA 1P47A 2EM7A 1LLMC 2LT7A 3MHHC 2EOOA 5KL2A 2EOFA 2ADRA 4R2EA 2ELZA 2RSIA 2NABA 2EM4A 5KL5A 2HGHA 1A1IA 5KL4A 3EPLA 1A1FA 4M9VC 2JP9A 2YTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM3 A;  2EMX A;  2LV2 A;  2A25 A;  2EMZ A;  4R2A A;  2DLK A;  2YSP A;  2YTJ A;  3EPK A;  2PRT A;  1G2D C;  2M9A A;  2EN2 A;  3EPJ A;  2MKD A;  2ENC A;  2YRH A;  2EJ4 A;  5KL7 A;  2LVH A;  2YTE A;  2DMI A;  2EM6 A;  4R2R A;  1TF3 A;  2EE8 A;  2VRD A;  1NCS A;  2EOJ A;  4R2C A;  4IS1 C;  2EN6 A;  2EN1 A;  1A1K A;  2EMF A;  2E72 A;  1A1H A;  3UK3 C;  4R2S A;  2I13 A;  2RPC A;  2YTO A;  2ELY A;  2WCC 3;  5KL6 A;  2EOX A;  4FK5 C;  5KL3 A;  1BB8 A;  2EL4 A;  2EL5 A;  1RMD A;  2ENH A;  1YUJ A;  2EN8 A;  2GHF A;  1TF6 A;  1KJK A;  2EOZ A;  3M99 B;  2DRP A;  2EM0 A;  2EQ0 A;  2EP3 A;  1B69 A;  2YTG A;  1X6H A;  2EMH A;  2YTI A;  2EOY A;  3MHS C;  2D9H A;  2EQ1 A;  1A1G A;  2EMC A;  2JPA A;  2EMG A;  1Z1B A;  2EPC A;  4R2Q A;  1AAY A;  1YUI A;  2DGC A;  2EL6 A;  2BB8 A;  1X3C A;  3EPH A;  2EOH A;  3VHT B;  2LO3 A;  1A1J A;  4X9J A;  1JK2 A;  2R1F A;  4R2D A;  2EOM A;  2YRK A;  1DGC A;  2EN3 A;  1X6F A;  2EM5 A;  2EOS A;  2MDG A;  4IJD A;  2YU5 A;  2EMK A;  4GZN C;  1X5W A;  1MEY C;  1A1L A;  2EM9 A;  2EPX A;  2EPA A;  2EOI A;  4F6M A;  2EQ3 A;  2WBU A;  2YU8 A;  2CT1 A;  2YTD A;  2J7J A;  2EOQ A;  4R2P A;  4F2J C;  1ZAA C;  2ENA A;  2CSH A;  2EMB A;  2EMI A;  2EMW A;  2WBT A;  2EMA A;  2YTP A;  4F6N A;  2EM2 A;  2EM8 A;  2CTD A;  2EMY A;  1JK1 A;  1UBD C;  1X6E A;  2DLQ A;  2EN4 A;  2EN7 A;  2EPP A;  2EOE A;  1F2I G;  2YTN A;  1UN6 B;  2EML A;  2EPR A;  2WBS A;  1WJP A;  2EOR A;  2YRM A;  2EPZ A;  2LCE A;  1G2F C;  1ZR9 A;  2YSO A;  2EPU A;  4WSG A;  2YTF A;  1BBO A;  1TN9 A;  2MKN A;  1YSA C;  1ZU1 A;  2GLI A;  1P47 A;  2EM7 A;  1LLM C;  2LT7 A;  3MHH C;  2EOO A;  5KL2 A;  2EOF A;  2ADR A;  4R2E A;  2ELZ A;  2RSI A;  2NAB A;  2EM4 A;  5KL5 A;  2HGH A;  1A1I A;  5KL4 A;  3EPL A;  1A1F A;  4M9V C;  2JP9 A;  2YTQ A; 
#chains in the Genus database with same CATH topology
 3ECR A;  4HEI A;  2PRT A;  2K7I A;  1G2D C;  2M9A A;  3EPJ A;  2JOB A;  4DV2 E;  2EJ4 A;  2N3H A;  4KHP E;  2EM6 A;  4R2R A;  1RQ0 A;  1TF3 A;  1NCS A;  1A1K A;  2EMF A;  2I13 A;  1RC7 A;  2FGG A;  5KL3 A;  2EL4 A;  5IT9 C;  1PKP A;  3BF2 A;  4DV4 E;  4JI3 E;  3BID A;  2UXD E;  3HQ1 A;  4LFA E;  3T1H E;  1WXR A;  2L2M A;  2NA2 A;  2UUA E;  2Q8U A;  4R2Q A;  4LF4 E;  2DGC A;  4RHB B;  4JV5 E;  4LFC E;  5AAS A;  2V83 A;  2BB8 A;  1N33 E;  2L92 A;  2HC5 A;  4LF8 E;  1YPN A;  5F3W A;  4LF7 E;  1IBM E;  1BBG A;  3EQ1 A;  4TUG A;  1A1J A;  4X9J A;  2B7T A;  1DQ3 A;  4R2D A;  1X48 A;  2R76 A;  2EM5 A;  1MEY C;  4LU9 A;  2EPX A;  2EOI A;  2WBU A;  1WHN A;  2CT1 A;  1IQO A;  4DUY E;  2JR1 A;  2HJJ A;  2CSH A;  5BR8 E;  2EMI A;  2EMW A;  5IV8 B;  2EZ6 A;  1HNW E;  2EM8 A;  2KHX A;  2DLQ A;  1SR9 A;  2EN7 A;  2EPP A;  3T1Y E;  2M4I A;  4GKK E;  1O0W A;  2EPR A;  2EOR A;  2YRM A;  3ADL A;  2EPZ A;  4LFB E;  2LUQ A;  2UXC E;  1UHZ A;  1PDA A;  3DF6 A;  1N3G A;  4X64 E;  1T4L B;  1XNR E;  2VQE E;  4DR4 E;  2YPN A;  1NEI A;  1A1I A;  2F4V E;  3VK6 A;  5KL4 A;  2M7Q A;  1PJS A;  5LL6 R;  3IWD A;  4JI7 E;  1MGT A;  1WRJ A;  2DB2 A;  5A2Q C;  2YTJ A;  2YSP A;  4JI5 E;  1IBL E;  2MKD A;  2YRH A;  3THO B;  4OOG C;  4J8Z A;  1PJT A;  1X47 A;  2YTE A;  2DMI A;  4WXC A;  5A6B A;  4NXN E;  1YYK A;  4IS1 C;  4R2C A;  2L6M A;  2RSM A;  5A6B D;  2E72 A;  1T38 A;  1A1H A;  4DV0 E;  2RPC A;  2ELY A;  5KL6 A;  2V86 A;  3HTX A;  2EL5 A;  1RMD A;  2ENH A;  2MDR A;  3P1X A;  2N8X A;  4LF6 E;  2RS7 A;  3M99 B;  2EM0 A;  5AE3 A;  2EQ0 A;  3RMP A;  1YYW A;  4ZYD A;  2RTX A;  2YTG A;  1X6H A;  2YTI A;  1B69 A;  1L4S A;  2BBG A;  3AV0 A;  4BCA A;  4BC9 A;  1AAY A;  1YUI A;  3LML A;  3C6M A;  2JWO A;  2E5L E;  4WYQ B;  1T39 A;  4F54 A;  4DMI A;  2YRK A;  2EN3 A;  4L8N A;  1X6F A;  2EOS A;  1YYO A;  2EMK A;  3C4B A;  1X5W A;  2EPA A;  2JOX A;  3KZY A;  2L33 A;  1N32 E;  2LTS A;  1EH7 A;  2J7J A;  3C6K A;  4Q35 B;  3L00 A;  2JVA A;  4WSP A;  1ZAA C;  3AUZ A;  2E1M A;  4O5G A;  4X65 E;  2VQF E;  2EMA A;  4F6N A;  4X62 E;  3KZZ A;  5IWA E;  4YHH E;  3DJW A;  2V87 A;  2EWL A;  1JK1 A;  2LJU A;  2UXB E;  1IMU A;  2K4V A;  1F2I G;  3J80 C;  2VF1 A;  2EML A;  2WBS A;  1WJP A;  1G2F C;  2B7V A;  2EPU A;  3F6G A;  1BBO A;  3ADJ A;  1FKA E;  4WX9 A;  2EPM X;  1YSA C;  1ZU1 A;  4M2Z A;  4L5N C;  2RQL A;  2EM7 A;  1LLM C;  2EPK X;  4JI8 E;  2LT7 A;  4O24 A;  2ADR A;  4R2E A;  2ZM6 E;  1J5E E;  2HGH A;  4P7D A;  5AE2 A;  2UU9 E;  2YTQ A;  2EMX A;  2RS6 A;  2V88 A;  4BHC A;  2A25 A;  2MC5 A;  2FTX B;  5AC4 A;  4ZYH A;  1I94 E;  4DKK A;  1X49 A;  2EN2 A;  3J7A G;  2ENC A;  5FLX C;  2IHR 1;  4BMJ A;  4NHR A;  2EPL X;  2M1S A;  1HNZ E;  2EOJ A;  4B3R E;  5TSE A;  2MC6 A;  2LMZ A;  2DIX A;  2EOX A;  3BBG A;  3J7Y p;  3K6Q A;  4MLV A;  4R03 A;  2DSY A;  2VE7 C;  4NXM E;  3VYY A;  1YUJ A;  2L3J A;  4B3M E;  2GHF A;  1KJK A;  5CFF E;  5A69 A;  2EOZ A;  2DRP A;  1GZ6 A;  4WPY A;  4F9A B;  4GKJ E;  2KON A;  2EOY A;  3MHS C;  2EQ1 A;  2JPA A;  2EMG A;  1IQS A;  4F9C B;  5A6K A;  1Z1B A;  4WXD A;  2V85 A;  3ADG A;  4JI4 E;  1KYQ A;  4NZV A;  4DR5 E;  1N36 E;  1X3C A;  3VHT B;  2LO3 A;  2DMY A;  3IWC A;  2H36 X;  1JK2 A;  2R1F A;  2EOM A;  2B3T B;  2YT4 A;  4IJD A;  2GPI A;  2L2K B;  2EM9 A;  2B9D A;  4F6M A;  2HHH E;  3HPZ A;  4M0V A;  2YTD A;  4R2P A;  4F2J C;  2LE2 A;  1ZBT A;  2ENA A;  3JTZ A;  2YZT A;  1FJG E;  4Q28 A;  2WBT A;  4JI6 E;  2N3G A;  2EM2 A;  2KOU A;  4K0K E;  2EMY A;  2LRS A;  3THN A;  1UBD C;  3ZOQ B;  4DV1 E;  3HPS A;  1GQE A;  1IBK E;  2LBS B;  2EOE A;  4KZS A;  2YTN A;  4LF9 E;  4DV3 E;  4LTY A;  3BGH A;  1ZBQ A;  1PJQ A;  3LLH A;  4DV6 E;  1J26 A;  4WSG A;  2YTF A;  1WHQ A;  4BBY A;  2I9I A;  2MKN A;  5AC5 A;  4KWY A;  5A6A A;  3KWR A;  4DV7 E;  2WZO A;  4YY3 E;  2GLI A;  4BC7 A;  3F6H A;  2UUB E;  2YWQ A;  2EOO A;  3OML A;  1UIL A;  5KL2 A;  2UUC E;  2ELZ A;  5IXM B;  2NAB A;  2EM4 A;  5KL5 A;  2V8Q B;  4I8O A;  1A1F A;  4N4R B;  4MLQ A;  2LJH A;  2JP9 A;  4DR6 E;  2EM3 A;  1N34 E;  2L8T A;  2LV2 A;  1SFE A;  4RH8 A;  2EMZ A;  4ZYE A;  4R2A A;  4O4K A;  2DLK A;  3HXL A;  3EPK A;  5KL7 A;  2LVH A;  3JAM C;  4WFT A;  1T4N A;  1T4O A;  4HTG A;  2EE8 A;  2VRD A;  3H09 A;  3JU0 A;  2JYA A;  4O43 A;  2EN6 A;  2EN1 A;  1DI2 A;  3UK3 C;  4R2S A;  2YTO A;  4BS9 A;  3MSW A;  2WCC 3;  1GTK A;  4FK5 C;  2NUF A;  1BB8 A;  4JI0 E;  1EH6 A;  2L2N A;  1STU A;  5T6J A;  4BHB A;  2EN8 A;  2ODR C;  1TF6 A;  4X66 E;  5LMN E;  4DUZ E;  3ADI A;  5AE1 A;  1HNX E;  3IWB A;  2EP3 A;  1QNT A;  4P78 A;  2EMH A;  2D9H A;  1A1G A;  2EMC A;  2FV4 B;  2EPC A;  2CPN A;  1QU6 A;  5LLQ A;  4ZYG A;  2EL6 A;  4F9B B;  5DNY A;  4AQY E;  1EKZ A;  3EPH A;  2JXP A;  2EOH A;  4B3T E;  4OX9 E;  4X8W A;  4GEQ B;  1DGC A;  5A6J A;  3J81 C;  2MDG A;  4TUI A;  4LF5 E;  2YU5 A;  4GZN C;  1A1L A;  4DR1 E;  2EQ3 A;  2YU8 A;  3TQM A;  2LUP B;  2EPO A;  4JYA E;  2NUG A;  2EOQ A;  3C4T A;  3OTO E;  2F8B A;  2EMB A;  4M30 A;  2YTP A;  2CTD A;  4DR2 E;  1HR0 E;  1YFH A;  3QG5 C;  2L3C A;  1X6E A;  4DV5 E;  2EN4 A;  1XMO E;  2EPN A;  4R8O A;  4DR7 E;  1UN6 B;  5LMU E;  2LCE A;  2G7H A;  1ZR9 A;  2NUE A;  1AH5 A;  2YSO A;  1TN9 A;  2LTR A;  3VYX A;  5ADZ A;  1P47 A;  3MHH C;  4JI2 E;  2EOF A;  2RSI A;  2V89 A;  2ODR D;  1YZ9 A;  1XNQ E;  3FIG A;  3EPL A;  1EH8 A;  4JI1 E;  4M9V C;  4B3S E;  1XMQ E;  2JY9 A;  4DR3 E; 
#chains in the Genus database with same CATH homology
 2EM3 A;  2EMX A;  2LV2 A;  2A25 A;  2EMZ A;  4R2A A;  2DLK A;  2YSP A;  2YTJ A;  3EPK A;  2PRT A;  1G2D C;  2M9A A;  2EN2 A;  3EPJ A;  2MKD A;  2ENC A;  2YRH A;  2EJ4 A;  5KL7 A;  2LVH A;  2YTE A;  2DMI A;  2EM6 A;  4R2R A;  1TF3 A;  2EE8 A;  2VRD A;  1NCS A;  2EOJ A;  4R2C A;  4IS1 C;  2EN6 A;  2EN1 A;  1A1K A;  2EMF A;  2E72 A;  1A1H A;  3UK3 C;  4R2S A;  2I13 A;  2RPC A;  2YTO A;  2ELY A;  2WCC 3;  5KL6 A;  2EOX A;  4FK5 C;  5KL3 A;  1BB8 A;  2EL4 A;  2EL5 A;  1RMD A;  2ENH A;  1YUJ A;  2EN8 A;  2GHF A;  1TF6 A;  1KJK A;  2EOZ A;  3M99 B;  2DRP A;  2EM0 A;  2EQ0 A;  2EP3 A;  1B69 A;  2YTG A;  1X6H A;  2EMH A;  2YTI A;  2EOY A;  3MHS C;  2D9H A;  2EQ1 A;  1A1G A;  2EMC A;  2JPA A;  2EMG A;  1Z1B A;  2EPC A;  4R2Q A;  1AAY A;  1YUI A;  2DGC A;  2EL6 A;  2BB8 A;  1X3C A;  3EPH A;  2EOH A;  3VHT B;  2LO3 A;  1A1J A;  4X9J A;  1JK2 A;  2R1F A;  4R2D A;  2EOM A;  2YRK A;  1DGC A;  2EN3 A;  1X6F A;  2EM5 A;  2EOS A;  2MDG A;  4IJD A;  2YU5 A;  2EMK A;  4GZN C;  1X5W A;  1MEY C;  1A1L A;  2EM9 A;  2EPX A;  2EPA A;  2EOI A;  4F6M A;  2EQ3 A;  2WBU A;  2YU8 A;  2CT1 A;  2YTD A;  2J7J A;  2EOQ A;  4R2P A;  4F2J C;  1ZAA C;  2ENA A;  2CSH A;  2EMB A;  2EMI A;  2EMW A;  2WBT A;  2EMA A;  2YTP A;  4F6N A;  2EM2 A;  2EM8 A;  2CTD A;  2EMY A;  1JK1 A;  1UBD C;  1X6E A;  2DLQ A;  2EN4 A;  2EN7 A;  2EPP A;  2EOE A;  1F2I G;  2YTN A;  1UN6 B;  2EML A;  2EPR A;  2WBS A;  1WJP A;  2EOR A;  2YRM A;  2EPZ A;  2LCE A;  1G2F C;  1ZR9 A;  2YSO A;  2EPU A;  4WSG A;  2YTF A;  1BBO A;  1TN9 A;  2MKN A;  1YSA C;  1ZU1 A;  2GLI A;  1P47 A;  2EM7 A;  1LLM C;  2LT7 A;  3MHH C;  2EOO A;  5KL2 A;  2EOF A;  2ADR A;  4R2E A;  2ELZ A;  2RSI A;  2NAB A;  2EM4 A;  5KL5 A;  2HGH A;  1A1I A;  5KL4 A;  3EPL A;  1A1F A;  4M9V C;  2JP9 A;  2YTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...