2EOZA

Solution structure of the c2h2 type zinc finger (region 809-841) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQETLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 809-841) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eozA01
4GZNC 3M99B 2EMZA 3UK3C 1YUJA 2EOMA 5KL2A 2EORA 1A1GA 1YSAC 2EN3A 2YTJA 1MEYC 1G2DC 2A25A 2EM6A 2EMWA 2EE8A 2RPCA 2RSIA 1ZR9A 2WBUA 2GHFA 2YRMA 2EOQA 2EQ0A 4WSGA 4X9JA 5KL5A 1A1KA 2YTDA 1X6EA 2EL5A 1P47A 2CT1A 2EPRA 2EPCA 2EPPA 2YTPA 4M9VC 1AAYA 2YRKA 2EOOA 2D9HA 1NCSA 2LVHA 2EOYA 1UBDC 2EM7A 4R2RA 1TN9A 2WBSA 2I13A 4IJDA 2EMCA 2YTNA 2LT7A 2EL6A 4F6NA 1ZAAC 2LO3A 2EMHA 2YTOA 2LV2A 2EN6A 2DLKA 2CSHA 2E72A 4F2JC 2JPAA 2YTIA 2EQ3A 2EN8A 1TF3A 3EPLA 2DLQA 2YTQA 4R2CA 2YSPA 1ZU1A 4R2EA 1F2IG 2EMFA 2EOXA 2LCEA 2EOFA 1A1IA 2EJ4A 1G2FC 4R2PA 2YU8A 4FK5C 2EOSA 2DRPA 1DGCA 1UN6B 2JP9A 1WJPA 2PRTA 2ENHA 2M9AA 4R2QA 2EN1A 2EN2A 1BBOA 3EPJA 3EPHA 2MKNA 2WBTA 2EL4A 1X5WA 2EM8A 1RMDA 1A1HA 1TF6A 1A1LA 2EQ1A 2J7JA 2YTFA 1A1JA 1X6HA 3MHHC 2EM9A 2EOHA 2YSOA 2CTDA 2YU5A 5KL6A 2EM5A 1Z1BA 2ADRA 2R1FA 5KL4A 1YUIA 2EOZA 4R2DA 2EN7A 2ELZA 2NABA 5KL3A 4IS1C 3VHTB 1BB8A 1KJKA 2DMIA 2MKDA 4F6MA 2EM3A 1X3CA 2EMGA 1LLMC 2YRHA 2EM4A 2MDGA 2EMLA 1JK1A 2EMAA 2EPAA 2EM0A 2DGCA 2EPXA 1JK2A 1X6FA 2GLIA 2ENAA 2VRDA 2EOEA 2ENCA 2EPUA 4R2SA 2EMXA 1B69A 2EM2A 2EOIA 2YTGA 2BB8A 1A1FA 2EMKA 2EPZA 2EP3A 3MHSC 2ELYA 2EMBA 3EPKA 2EN4A 2HGHA 2EOJA 2EMIA 5KL7A 2EMYA 4R2AA 2WCC3 2YTEA
chains in the Genus database with same CATH superfamily
4GZNC 3M99B 2EMZA 2EOMA 2RTXA 2EORA 1A1GA 4LF4E 2B3TB 4DMIA 1G2DC 5F3WA 2RSIA 2WBUA 2GHFA 3LLHA 4X65E 4X9JA 4LU9A 4TUGA 4R03A 5KL5A 2I9IA 2YTDA 2CPNA 2GPIA 2LJUA 5LL6R 5AE3A 1N3GA 1X6EA 1IBLE 2UUAE 2YTPA 4L5NC 4BHCA 3HXLA 2LE2A 3F6HA 1NCSA 1UBDC 2B7TA 2YZTA 2I13A 4IJDA 5ADZA 2EMCA 2YTNA 4F6NA 1T39A 2V88A 3EQ1A 5FLXC 3THNA 1XNRE 2YTOA 2LV2A 4M30A 2E72A 4F2JC 4DR3E 2YTIA 2BBGA 1IBME 2EN8A 5A6BD 1BBGA 2UUBE 5A6JA 2NA2A 2EPKX 1L4SA 2YTQA 2KONA 2L2MA 2L6MA 4R2EA 3ZOQB 2EMFA 2EOXA 3JAMC 1G2FC 2YU8A 2UUCE 4TUIA 3VYYA 5LMNE 1WJPA 4Q35B 2NUGA 4R2QA 3DJWA 5IXMB 1BBOA 2ODRD 3EPJA 2UXBE 2ZM6E 2MKNA 1X5WA 3HQ1A 5AASA 4X66E 1A1JA 2EOHA 5KL6A 1O0WA 2EM5A 1Z1BA 2ADRA 2R1FA 4P78A 5CFFE 4NHRA 4DV4E 5LMUE 1KJKA 4JV5E 1HNZE 4WYQB 4BBYA 4ZYDA 3T1YE 4X62E 4M2ZA 2MDGA 1UILA 1JK1A 2M4IA 3DF6A 2EPMX 3VK6A 3KZZA 2EPXA 2HC5A 4DV6E 2ENAA 2EOEA 2EPUA 4O43A 2EMXA 1J5EE 2EOIA 1J26A 1XMOE 1GQEA 1A1FA 2JR1A 4I8OA 4F9BB 2ELYA 2EMBA 2HGHA 3BIDA 5KL7A 2LUPB 4R2AA 2YTEA 3UK3C 1MGTA 3VYXA 1KYQA 2EN3A 2LUQA 5A6KA 4WXDA 2EMWA 2YT4A 1HNXE 4LF6E 2K7IA 4WSPA 4KZSA 5AE2A 3C4TA 2RS7A 2UXCE 4J8ZA 2KOUA 1IBKE 4HEIA 2EPRA 2EPCA 4ZYEA 2EPPA 1I94E 1XMQE 1AAYA 4B3ME 2D9HA 2LVHA 4JI1E 3TQMA 2WBSA 1WHNA 1YYWA 4L8NA 1X48A 1EKZA 2V83A 2LTSA 5A69A 1T4LB 5TSEA 4R8OA 2VF1A 2N3GA 4O24A 2EN6A 2CSHA 1YFHA 2JPAA 1STUA 1YPNA 2JOBA 3BF2A 3C6KA 2M1SA 2L3CA 2DLQA 5AC4A 4R2CA 4F9AB 1ZU1A 2WZOA 4DR2E 4NXME 1N36E 4LF5E 2EPOA 2FTXB 2EJ4A 3J81C 2V87A 4R2PA 5IWAE 2JY9A 4LFBE 4DV3E 3L00A 4X64E 4WX9A 4JI4E 2Q8UA 2UU9E 4DR1E 2M9AA 2LBSB 2EN2A 3J7AG 4RHBB 1T4OA 2EQ1A 2YTFA 1X6HA 4O5GA 4HTGA 4BS9A 1HR0E 2EM9A 1WHQA 2V85A 1PDAA 3BGHA 2YPNA 4R2DA 1UHZA 2MC5A 2ELZA 1QNTA 2VQEE 3VHTB 2V86A 2FV4B 4F6MA 4OX9E 2EMGA 3MSWA 1NEIA 5AC5A 1LLMC 2ODRC 2F4VE 4JI0E 1X47A 2EM4A 2EMLA 2LTRA 2JOXA 5IT9C 3KZYA 1JK2A 4JI3E 1X6FA 4F54A 2VRDA 4LF7E 2JVAA 4DV1E 4O4KA 2EMKA 4ZYHA 3F6GA 4BMJA 3MHSC 5BR8E 4DR7E 2EPLX 2B7VA 1YUJA 3K6QA 5KL2A 3OMLA 1YSAC 3QG5C 4BHBA 1MEYC 4GEQB 2RPCA 2EM6A 2EE8A 1ZR9A 1EH7A 4WPYA 2EOQA 2G7HA 3H09A 1T4NA 4LTYA 2L33A 5T6JA 4NXNE 1SFEA 2EL5A 2CT1A 4DR6E 2F8BA 1PKPA 2RS6A 1N34E 4DV7E 2EOOA 4RH8A 2EOYA 2EM7A 4R2RA 1QU6A 1TN9A 5A6AA 5IV8B 1HNWE 2L3JA 2VQFE 4BC7A 1ZAAC 2LO3A 4DUYE 2R76A 2DLKA 4NZVA 2EWLA 2L92A 3RMPA 4JI6E 4KWYA 3IWCA 3EPLA 2UXDE 2YSPA 1IQSA 1F2IG 2EOFA 1A1IA 2DRPA 1X49A 1DGCA 1UN6B 3C6MA 2JP9A 3HPSA 2L8TA 4LF8E 4BCAA 4X8WA 1PJSA 2ENHA 2LJHA 2N3HA 4B3SE 2EZ6A 3EPHA 2HJJA 2WBTA 2EM8A 2VE7C 2J7JA 2YSOA 2YU5A 1AH5A 2DMYA 5KL4A 1YUIA 2NABA 4IS1C 1EH8A 1N33E 2DMIA 2EM3A 1X3CA 4JI7E 2YRHA 1RC7A 3ECRA 2V8QB 2EMAA 2EM0A 4GKJE 4GKKE 2DGCA 2K4VA 2JXPA 4DKKA 1SR9A 3J80C 4DV2E 1IQOA 3J7Yp 3ADLA 2EM2A 4LFCE 2EPZA 4DV5E 4K0KE 4Q28A 2EP3A 1DI2A 2N8XA 2RSMA 4B3TE 2EN4A 4DR5E 4YY3E 4LF9E 3IWBA 2EMYA 4ZYGA 3LMLA 2V89A 3KWRA 3IWDA 2YTJA 4DV0E 2NUEA 3AUZA 2A25A 1XNQE 2YRMA 3ADGA 4BC9A 1FKAE 3AV0A 2IHR1 2EQ0A 3JU0A 4WSGA 1EH6A 3THOB 1FJGE 1IMUA 1A1KA 1PJQA 1P47A 4MLQA 1YZ9A 2RQLA 4M9VC 2YRKA 2LMZA 2E1MA 2FGGA 2H36X 2M7QA 2LT7A 1ZBQA 2EL6A 2JWOA 3P1XA 1T38A 4WXCA 4B3RE 2EMHA 3OTOE 2B9DA 2DSYA 4YHHE 1RQ0A 2EQ3A 2LRSA 1YYOA 2L2KB 1TF3A 4AQYE 5LLQA 3T1HE 2DIXA 2E5LE 1WRJA 2LCEA 4LFAE 5AE1A 3FIGA 2JYAA 2L2NA 5A2QC 2NUFA 5DNYA 4FK5C 2EOSA 3ADJA 2PRTA 4JI5E 2MDRA 4MLVA 3ADIA 2EN1A 2DB2A 2YWQA 2MC6A 1YYKA 1A1HA 1PJTA 2EL4A 1RMDA 1TF6A 1A1LA 4JI8E 3MHHC 2HHHE 3JTZA 4M0VA 2CTDA 4JI2E 2EOZA 2EN7A 5KL3A 1BB8A 4DR4E 2MKDA 3HTXA 3BBGA 4N4RB 2KHXA 1DQ3A 5A6BA 4KHPE 3C4BA 2EPAA 3HPZA 1N32E 2GLIA 2ENCA 4WFTA 4OOGC 1ZBTA 1WXRA 4R2SA 4DUZE 1B69A 2YTGA 4JYAE 1GZ6A 2BB8A 2EPNA 3EPKA 4P7DA 4F9CB 2EOJA 2EMIA 1GTKA 2WCC3
chains in the Genus database with same CATH topology
4GZNC 3M99B 2EMZA 3UK3C 1YUJA 2EOMA 5KL2A 2EORA 1A1GA 1YSAC 2EN3A 2YTJA 1MEYC 1G2DC 2A25A 2EM6A 2EMWA 2EE8A 2RPCA 2RSIA 1ZR9A 2WBUA 2GHFA 2YRMA 2EOQA 2EQ0A 4WSGA 4X9JA 5KL5A 1A1KA 2YTDA 1X6EA 2EL5A 1P47A 2CT1A 2EPRA 2EPCA 2EPPA 2YTPA 4M9VC 1AAYA 2YRKA 2EOOA 2D9HA 1NCSA 2LVHA 2EOYA 1UBDC 2EM7A 4R2RA 1TN9A 2WBSA 2I13A 4IJDA 2EMCA 2YTNA 2LT7A 2EL6A 4F6NA 1ZAAC 2LO3A 2EMHA 2YTOA 2LV2A 2EN6A 2DLKA 2CSHA 2E72A 4F2JC 2JPAA 2YTIA 2EQ3A 2EN8A 1TF3A 3EPLA 2DLQA 2YTQA 4R2CA 2YSPA 1ZU1A 4R2EA 1F2IG 2EMFA 2EOXA 2LCEA 2EOFA 1A1IA 2EJ4A 1G2FC 4R2PA 2YU8A 4FK5C 2EOSA 2DRPA 1DGCA 1UN6B 2JP9A 1WJPA 2PRTA 2ENHA 2M9AA 4R2QA 2EN1A 2EN2A 1BBOA 3EPJA 3EPHA 2MKNA 2WBTA 2EL4A 1X5WA 2EM8A 1RMDA 1A1HA 1TF6A 1A1LA 2EQ1A 2J7JA 2YTFA 1A1JA 1X6HA 3MHHC 2EM9A 2EOHA 2YSOA 2CTDA 2YU5A 5KL6A 2EM5A 1Z1BA 2ADRA 2R1FA 5KL4A 1YUIA 2EOZA 4R2DA 2EN7A 2ELZA 2NABA 5KL3A 4IS1C 3VHTB 1BB8A 1KJKA 2DMIA 2MKDA 4F6MA 2EM3A 1X3CA 2EMGA 1LLMC 2YRHA 2EM4A 2MDGA 2EMLA 1JK1A 2EMAA 2EPAA 2EM0A 2DGCA 2EPXA 1JK2A 1X6FA 2GLIA 2ENAA 2VRDA 2EOEA 2ENCA 2EPUA 4R2SA 2EMXA 1B69A 2EM2A 2EOIA 2YTGA 2BB8A 1A1FA 2EMKA 2EPZA 2EP3A 3MHSC 2ELYA 2EMBA 3EPKA 2EN4A 2HGHA 2EOJA 2EMIA 5KL7A 2EMYA 4R2AA 2WCC3 2YTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZN C;  3M99 B;  2EMZ A;  3UK3 C;  1YUJ A;  2EOM A;  5KL2 A;  2EOR A;  1A1G A;  1YSA C;  2EN3 A;  2YTJ A;  1MEY C;  1G2D C;  2A25 A;  2EM6 A;  2EMW A;  2EE8 A;  2RPC A;  2RSI A;  1ZR9 A;  2WBU A;  2GHF A;  2YRM A;  2EOQ A;  2EQ0 A;  4WSG A;  4X9J A;  5KL5 A;  1A1K A;  2YTD A;  1X6E A;  2EL5 A;  1P47 A;  2CT1 A;  2EPR A;  2EPC A;  2EPP A;  2YTP A;  4M9V C;  1AAY A;  2YRK A;  2EOO A;  2D9H A;  1NCS A;  2LVH A;  2EOY A;  1UBD C;  2EM7 A;  4R2R A;  1TN9 A;  2WBS A;  2I13 A;  4IJD A;  2EMC A;  2YTN A;  2LT7 A;  2EL6 A;  4F6N A;  1ZAA C;  2LO3 A;  2EMH A;  2YTO A;  2LV2 A;  2EN6 A;  2DLK A;  2CSH A;  2E72 A;  4F2J C;  2JPA A;  2YTI A;  2EQ3 A;  2EN8 A;  1TF3 A;  3EPL A;  2DLQ A;  2YTQ A;  4R2C A;  2YSP A;  1ZU1 A;  4R2E A;  1F2I G;  2EMF A;  2EOX A;  2LCE A;  2EOF A;  1A1I A;  2EJ4 A;  1G2F C;  4R2P A;  2YU8 A;  4FK5 C;  2EOS A;  2DRP A;  1DGC A;  1UN6 B;  2JP9 A;  1WJP A;  2PRT A;  2ENH A;  2M9A A;  4R2Q A;  2EN1 A;  2EN2 A;  1BBO A;  3EPJ A;  3EPH A;  2MKN A;  2WBT A;  2EL4 A;  1X5W A;  2EM8 A;  1RMD A;  1A1H A;  1TF6 A;  1A1L A;  2EQ1 A;  2J7J A;  2YTF A;  1A1J A;  1X6H A;  3MHH C;  2EM9 A;  2EOH A;  2YSO A;  2CTD A;  2YU5 A;  5KL6 A;  2EM5 A;  1Z1B A;  2ADR A;  2R1F A;  5KL4 A;  1YUI A;  2EOZ A;  4R2D A;  2EN7 A;  2ELZ A;  2NAB A;  5KL3 A;  4IS1 C;  3VHT B;  1BB8 A;  1KJK A;  2DMI A;  2MKD A;  4F6M A;  2EM3 A;  1X3C A;  2EMG A;  1LLM C;  2YRH A;  2EM4 A;  2MDG A;  2EML A;  1JK1 A;  2EMA A;  2EPA A;  2EM0 A;  2DGC A;  2EPX A;  1JK2 A;  1X6F A;  2GLI A;  2ENA A;  2VRD A;  2EOE A;  2ENC A;  2EPU A;  4R2S A;  2EMX A;  1B69 A;  2EM2 A;  2EOI A;  2YTG A;  2BB8 A;  1A1F A;  2EMK A;  2EPZ A;  2EP3 A;  3MHS C;  2ELY A;  2EMB A;  3EPK A;  2EN4 A;  2HGH A;  2EOJ A;  2EMI A;  5KL7 A;  2EMY A;  4R2A A;  2WCC 3;  2YTE A; 
#chains in the Genus database with same CATH topology
 4GZN C;  3M99 B;  2EMZ A;  2EOM A;  2RTX A;  2EOR A;  1A1G A;  4LF4 E;  2B3T B;  4DMI A;  1G2D C;  5F3W A;  2RSI A;  2WBU A;  2GHF A;  3LLH A;  4X65 E;  4X9J A;  4LU9 A;  4TUG A;  4R03 A;  5KL5 A;  2I9I A;  2YTD A;  2CPN A;  2GPI A;  2LJU A;  5LL6 R;  5AE3 A;  1N3G A;  1X6E A;  1IBL E;  2UUA E;  2YTP A;  4L5N C;  4BHC A;  3HXL A;  2LE2 A;  3F6H A;  1NCS A;  1UBD C;  2B7T A;  2YZT A;  2I13 A;  4IJD A;  5ADZ A;  2EMC A;  2YTN A;  4F6N A;  1T39 A;  2V88 A;  3EQ1 A;  5FLX C;  3THN A;  1XNR E;  2YTO A;  2LV2 A;  4M30 A;  2E72 A;  4F2J C;  4DR3 E;  2YTI A;  2BBG A;  1IBM E;  2EN8 A;  5A6B D;  1BBG A;  2UUB E;  5A6J A;  2NA2 A;  2EPK X;  1L4S A;  2YTQ A;  2KON A;  2L2M A;  2L6M A;  4R2E A;  3ZOQ B;  2EMF A;  2EOX A;  3JAM C;  1G2F C;  2YU8 A;  2UUC E;  4TUI A;  3VYY A;  5LMN E;  1WJP A;  4Q35 B;  2NUG A;  4R2Q A;  3DJW A;  5IXM B;  1BBO A;  2ODR D;  3EPJ A;  2UXB E;  2ZM6 E;  2MKN A;  1X5W A;  3HQ1 A;  5AAS A;  4X66 E;  1A1J A;  2EOH A;  5KL6 A;  1O0W A;  2EM5 A;  1Z1B A;  2ADR A;  2R1F A;  4P78 A;  5CFF E;  4NHR A;  4DV4 E;  5LMU E;  1KJK A;  4JV5 E;  1HNZ E;  4WYQ B;  4BBY A;  4ZYD A;  3T1Y E;  4X62 E;  4M2Z A;  2MDG A;  1UIL A;  1JK1 A;  2M4I A;  3DF6 A;  2EPM X;  3VK6 A;  3KZZ A;  2EPX A;  2HC5 A;  4DV6 E;  2ENA A;  2EOE A;  2EPU A;  4O43 A;  2EMX A;  1J5E E;  2EOI A;  1J26 A;  1XMO E;  1GQE A;  1A1F A;  2JR1 A;  4I8O A;  4F9B B;  2ELY A;  2EMB A;  2HGH A;  3BID A;  5KL7 A;  2LUP B;  4R2A A;  2YTE A;  3UK3 C;  1MGT A;  3VYX A;  1KYQ A;  2EN3 A;  2LUQ A;  5A6K A;  4WXD A;  2EMW A;  2YT4 A;  1HNX E;  4LF6 E;  2K7I A;  4WSP A;  4KZS A;  5AE2 A;  3C4T A;  2RS7 A;  2UXC E;  4J8Z A;  2KOU A;  1IBK E;  4HEI A;  2EPR A;  2EPC A;  4ZYE A;  2EPP A;  1I94 E;  1XMQ E;  1AAY A;  4B3M E;  2D9H A;  2LVH A;  4JI1 E;  3TQM A;  2WBS A;  1WHN A;  1YYW A;  4L8N A;  1X48 A;  1EKZ A;  2V83 A;  2LTS A;  5A69 A;  1T4L B;  5TSE A;  4R8O A;  2VF1 A;  2N3G A;  4O24 A;  2EN6 A;  2CSH A;  1YFH A;  2JPA A;  1STU A;  1YPN A;  2JOB A;  3BF2 A;  3C6K A;  2M1S A;  2L3C A;  2DLQ A;  5AC4 A;  4R2C A;  4F9A B;  1ZU1 A;  2WZO A;  4DR2 E;  4NXM E;  1N36 E;  4LF5 E;  2EPO A;  2FTX B;  2EJ4 A;  3J81 C;  2V87 A;  4R2P A;  5IWA E;  2JY9 A;  4LFB E;  4DV3 E;  3L00 A;  4X64 E;  4WX9 A;  4JI4 E;  2Q8U A;  2UU9 E;  4DR1 E;  2M9A A;  2LBS B;  2EN2 A;  3J7A G;  4RHB B;  1T4O A;  2EQ1 A;  2YTF A;  1X6H A;  4O5G A;  4HTG A;  4BS9 A;  1HR0 E;  2EM9 A;  1WHQ A;  2V85 A;  1PDA A;  3BGH A;  2YPN A;  4R2D A;  1UHZ A;  2MC5 A;  2ELZ A;  1QNT A;  2VQE E;  3VHT B;  2V86 A;  2FV4 B;  4F6M A;  4OX9 E;  2EMG A;  3MSW A;  1NEI A;  5AC5 A;  1LLM C;  2ODR C;  2F4V E;  4JI0 E;  1X47 A;  2EM4 A;  2EML A;  2LTR A;  2JOX A;  5IT9 C;  3KZY A;  1JK2 A;  4JI3 E;  1X6F A;  4F54 A;  2VRD A;  4LF7 E;  2JVA A;  4DV1 E;  4O4K A;  2EMK A;  4ZYH A;  3F6G A;  4BMJ A;  3MHS C;  5BR8 E;  4DR7 E;  2EPL X;  2B7V A;  1YUJ A;  3K6Q A;  5KL2 A;  3OML A;  1YSA C;  3QG5 C;  4BHB A;  1MEY C;  4GEQ B;  2RPC A;  2EM6 A;  2EE8 A;  1ZR9 A;  1EH7 A;  4WPY A;  2EOQ A;  2G7H A;  3H09 A;  1T4N A;  4LTY A;  2L33 A;  5T6J A;  4NXN E;  1SFE A;  2EL5 A;  2CT1 A;  4DR6 E;  2F8B A;  1PKP A;  2RS6 A;  1N34 E;  4DV7 E;  2EOO A;  4RH8 A;  2EOY A;  2EM7 A;  4R2R A;  1QU6 A;  1TN9 A;  5A6A A;  5IV8 B;  1HNW E;  2L3J A;  2VQF E;  4BC7 A;  1ZAA C;  2LO3 A;  4DUY E;  2R76 A;  2DLK A;  4NZV A;  2EWL A;  2L92 A;  3RMP A;  4JI6 E;  4KWY A;  3IWC A;  3EPL A;  2UXD E;  2YSP A;  1IQS A;  1F2I G;  2EOF A;  1A1I A;  2DRP A;  1X49 A;  1DGC A;  1UN6 B;  3C6M A;  2JP9 A;  3HPS A;  2L8T A;  4LF8 E;  4BCA A;  4X8W A;  1PJS A;  2ENH A;  2LJH A;  2N3H A;  4B3S E;  2EZ6 A;  3EPH A;  2HJJ A;  2WBT A;  2EM8 A;  2VE7 C;  2J7J A;  2YSO A;  2YU5 A;  1AH5 A;  2DMY A;  5KL4 A;  1YUI A;  2NAB A;  4IS1 C;  1EH8 A;  1N33 E;  2DMI A;  2EM3 A;  1X3C A;  4JI7 E;  2YRH A;  1RC7 A;  3ECR A;  2V8Q B;  2EMA A;  2EM0 A;  4GKJ E;  4GKK E;  2DGC A;  2K4V A;  2JXP A;  4DKK A;  1SR9 A;  3J80 C;  4DV2 E;  1IQO A;  3J7Y p;  3ADL A;  2EM2 A;  4LFC E;  2EPZ A;  4DV5 E;  4K0K E;  4Q28 A;  2EP3 A;  1DI2 A;  2N8X A;  2RSM A;  4B3T E;  2EN4 A;  4DR5 E;  4YY3 E;  4LF9 E;  3IWB A;  2EMY A;  4ZYG A;  3LML A;  2V89 A;  3KWR A;  3IWD A;  2YTJ A;  4DV0 E;  2NUE A;  3AUZ A;  2A25 A;  1XNQ E;  2YRM A;  3ADG A;  4BC9 A;  1FKA E;  3AV0 A;  2IHR 1;  2EQ0 A;  3JU0 A;  4WSG A;  1EH6 A;  3THO B;  1FJG E;  1IMU A;  1A1K A;  1PJQ A;  1P47 A;  4MLQ A;  1YZ9 A;  2RQL A;  4M9V C;  2YRK A;  2LMZ A;  2E1M A;  2FGG A;  2H36 X;  2M7Q A;  2LT7 A;  1ZBQ A;  2EL6 A;  2JWO A;  3P1X A;  1T38 A;  4WXC A;  4B3R E;  2EMH A;  3OTO E;  2B9D A;  2DSY A;  4YHH E;  1RQ0 A;  2EQ3 A;  2LRS A;  1YYO A;  2L2K B;  1TF3 A;  4AQY E;  5LLQ A;  3T1H E;  2DIX A;  2E5L E;  1WRJ A;  2LCE A;  4LFA E;  5AE1 A;  3FIG A;  2JYA A;  2L2N A;  5A2Q C;  2NUF A;  5DNY A;  4FK5 C;  2EOS A;  3ADJ A;  2PRT A;  4JI5 E;  2MDR A;  4MLV A;  3ADI A;  2EN1 A;  2DB2 A;  2YWQ A;  2MC6 A;  1YYK A;  1A1H A;  1PJT A;  2EL4 A;  1RMD A;  1TF6 A;  1A1L A;  4JI8 E;  3MHH C;  2HHH E;  3JTZ A;  4M0V A;  2CTD A;  4JI2 E;  2EOZ A;  2EN7 A;  5KL3 A;  1BB8 A;  4DR4 E;  2MKD A;  3HTX A;  3BBG A;  4N4R B;  2KHX A;  1DQ3 A;  5A6B A;  4KHP E;  3C4B A;  2EPA A;  3HPZ A;  1N32 E;  2GLI A;  2ENC A;  4WFT A;  4OOG C;  1ZBT A;  1WXR A;  4R2S A;  4DUZ E;  1B69 A;  2YTG A;  4JYA E;  1GZ6 A;  2BB8 A;  2EPN A;  3EPK A;  4P7D A;  4F9C B;  2EOJ A;  2EMI A;  1GTK A;  2WCC 3; 
#chains in the Genus database with same CATH homology
 4GZN C;  3M99 B;  2EMZ A;  3UK3 C;  1YUJ A;  2EOM A;  5KL2 A;  2EOR A;  1A1G A;  1YSA C;  2EN3 A;  2YTJ A;  1MEY C;  1G2D C;  2A25 A;  2EM6 A;  2EMW A;  2EE8 A;  2RPC A;  2RSI A;  1ZR9 A;  2WBU A;  2GHF A;  2YRM A;  2EOQ A;  2EQ0 A;  4WSG A;  4X9J A;  5KL5 A;  1A1K A;  2YTD A;  1X6E A;  2EL5 A;  1P47 A;  2CT1 A;  2EPR A;  2EPC A;  2EPP A;  2YTP A;  4M9V C;  1AAY A;  2YRK A;  2EOO A;  2D9H A;  1NCS A;  2LVH A;  2EOY A;  1UBD C;  2EM7 A;  4R2R A;  1TN9 A;  2WBS A;  2I13 A;  4IJD A;  2EMC A;  2YTN A;  2LT7 A;  2EL6 A;  4F6N A;  1ZAA C;  2LO3 A;  2EMH A;  2YTO A;  2LV2 A;  2EN6 A;  2DLK A;  2CSH A;  2E72 A;  4F2J C;  2JPA A;  2YTI A;  2EQ3 A;  2EN8 A;  1TF3 A;  3EPL A;  2DLQ A;  2YTQ A;  4R2C A;  2YSP A;  1ZU1 A;  4R2E A;  1F2I G;  2EMF A;  2EOX A;  2LCE A;  2EOF A;  1A1I A;  2EJ4 A;  1G2F C;  4R2P A;  2YU8 A;  4FK5 C;  2EOS A;  2DRP A;  1DGC A;  1UN6 B;  2JP9 A;  1WJP A;  2PRT A;  2ENH A;  2M9A A;  4R2Q A;  2EN1 A;  2EN2 A;  1BBO A;  3EPJ A;  3EPH A;  2MKN A;  2WBT A;  2EL4 A;  1X5W A;  2EM8 A;  1RMD A;  1A1H A;  1TF6 A;  1A1L A;  2EQ1 A;  2J7J A;  2YTF A;  1A1J A;  1X6H A;  3MHH C;  2EM9 A;  2EOH A;  2YSO A;  2CTD A;  2YU5 A;  5KL6 A;  2EM5 A;  1Z1B A;  2ADR A;  2R1F A;  5KL4 A;  1YUI A;  2EOZ A;  4R2D A;  2EN7 A;  2ELZ A;  2NAB A;  5KL3 A;  4IS1 C;  3VHT B;  1BB8 A;  1KJK A;  2DMI A;  2MKD A;  4F6M A;  2EM3 A;  1X3C A;  2EMG A;  1LLM C;  2YRH A;  2EM4 A;  2MDG A;  2EML A;  1JK1 A;  2EMA A;  2EPA A;  2EM0 A;  2DGC A;  2EPX A;  1JK2 A;  1X6F A;  2GLI A;  2ENA A;  2VRD A;  2EOE A;  2ENC A;  2EPU A;  4R2S A;  2EMX A;  1B69 A;  2EM2 A;  2EOI A;  2YTG A;  2BB8 A;  1A1F A;  2EMK A;  2EPZ A;  2EP3 A;  3MHS C;  2ELY A;  2EMB A;  3EPK A;  2EN4 A;  2HGH A;  2EOJ A;  2EMI A;  5KL7 A;  2EMY A;  4R2A A;  2WCC 3;  2YTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...