2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1810
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2JYAA 2LJUA
chains in the Genus database with same CATH superfamily
2YTNA 1O0WA 3C6MA 3OTOE 3LLHA 1HNZE 2FV4B 1ZAAC 4DR2E 2JOBA 3J7Yp 2EPUA 2EZ6A 4DV1E 3EPKA 4IJDA 2EL6A 4MLQA 2HHHE 4R03A 2MDGA 5KL4A 2EOSA 1G2FC 4WPYA 2EOHA 2WZOA 3EQ1A 4M0VA 3MHSC 1WHQA 2V89A 1WHNA 2CSHA 5DNYA 4HTGA 5AC4A 1SFEA 2DLQA 3P1XA 2NUGA 2LO3A 1X49A 2RTXA 5A6AA 1L4SA 2YTFA 5AE3A 5LLQA 2EPCA 4JI5E 2CT1A 1EH6A 2DSYA 1MGTA 2ENAA 2YRMA 1GZ6A 5F3WA 2R76A 4NXNE 4L8NA 4BS9A 3HQ1A 2E1MA 3OMLA 4BHBA 1A1FA 2LE2A 3ADGA 1YPNA 2GHFA 4DR3E 2EPRA 1UN6B 1PDAA 4F54A 2DLKA 5IT9C 1X6HA 3HPZA 3HTXA 4F6MA 2ENCA 1NCSA 1EH8A 5BR8E 1KYQA 1IBKE 3ADLA 2EOYA 2H36X 1J26A 5AASA 1GQEA 2R1FA 4Q28A 4WX9A 1JK2A 4DV5E 3RMPA 4LU9A 4LF5E 2NA2A 5TSEA 2EPMX 4WFTA 2EQ0A 2LUPB 4R2EA 5KL5A 4M30A 1NEIA 2L2KB 3F6GA 1GTKA 2EPLX 2N8XA 3QG5C 1WJPA 2LTSA 3EPHA 1IBLE 2MC5A 2YSOA 2EMYA 2JY9A 1HNWE 1A1LA 1EKZA 1X3CA 1YUJA 1TN9A 2JR1A 5IV8B 2WCC3 3VYYA 3MHHC 2N3GA 1RMDA 2WBUA 2LV2A 2UUBE 4IS1C 2JWOA 4RHBB 2YTQA 2JOXA 3MSWA 4K0KE 1TF6A 3KZZA 2YT4A 2VQEE 4DUZE 2E5LE 2GLIA 1YUIA 2EMKA 3JU0A 1SR9A 3BF2A 4O43A 2EPXA 4YY3E 1DQ3A 4GEQB 1N33E 2EMZA 2NUEA 2EN3A 2HC5A 4X66E 4BC7A 4WSGA 2LUQA 5KL2A 1T4LB 5A6JA 2EM4A 2JPAA 5ADZA 2YZTA 1A1HA 4NZVA 2YRHA 2M4IA 2EM8A 2YU8A 3J80C 1HNXE 4DV7E 4TUGA 4M9VC 1BBOA 1N32E 3UK3C 1T4NA 3M99B 4R2DA 3C6KA 1XMQE 2EPOA 2RSIA 3K6QA 5LL6R 4WSPA 2F4VE 2PRTA 3JTZA 2L3CA 4JI2E 2EMAA 1A1KA 4DV0E 1N34E 1X6EA 2BB8A 4ZYGA 2EOIA 2EMBA 1YYKA 2M9AA 4KZSA 1FJGE 3VYXA 4JI1E 1RC7A 2N3HA 5IXMB 2L2NA 3HPSA 2ENHA 4LF8E 3ADIA 2EMHA 2UXBE 1A1JA 2EL5A 2VRDA 2EN7A 4B3SE 1T4OA 1ZBQA 1B69A 2EOMA 4X8WA 3FIGA 2LTRA 3KZYA 4HEIA 2WBSA 1ZBTA 1P47A 3IWCA 1X47A 2RS7A 3HXLA 2LVHA 4JYAE 2EOJA 4DR5E 2B7VA 2YWQA 1T38A 2EMWA 4DV4E 5A69A 2EPZA 2EM9A 4LF9E 3BGHA 1BB8A 2UUCE 4L5NC 2UU9E 2F8BA 4YHHE 1STUA 2LCEA 2VF1A 4LF4E 4DV3E 2LMZA 1TF3A 3IWDA 3ZOQB 2EM0A 2G7HA 5IWAE 4AQYE 4BBYA 5A2QC 4DV6E 4B3ME 3J7AG 2DMIA 3BIDA 4KWYA 2EQ1A 1LLMC 3AUZA 2L33A 3KWRA 2HJJA 4NXME 2ADRA 2D9HA 4R2RA 4N4RB 2V86A 2HGHA 4LF6E 2EJ4A 2EPNA 2EM2A 1WRJA 4X9JA 1ZR9A 2DIXA 5FLXC 4M2ZA 2EMLA 2IHR1 2L3JA 4GKJE 1IQSA 2EM6A 2KHXA 2EQ3A 2EWLA 2WBTA 1AAYA 2DMYA 4P7DA 4R2SA 2JYAA 4RH8A 4DR6E 2RQLA 2EPKX 2E72A 1YYWA 2EMXA 4WXDA 1KJKA 2DB2A 2LJUA 1EH7A 2MDRA 2UXCE 1PJSA 4LTYA 2EMFA 3THNA 2EOQA 1PKPA 4MLVA 2EPAA 1F2IG 4DMIA 2L2MA 2EN1A 3VK6A 2DRPA 2L92A 1YFHA 4TUIA 4B3TE 4LF7E 2V85A 2DGCA 3JAMC 1A1IA 1AH5A 1BBGA 2YPNA 3J81C 4JI3E 3F6HA 4LFAE 2UUAE 2EOXA 4WYQB 2YU5A 5KL3A 2EOEA 4DV2E 2EE8A 4DUYE 1N3GA 1UBDC 1G2DC 2I13A 4Q35B 1RQ0A 2ODRD 1ZU1A 3EPLA 1XMOE 2JVAA 1IMUA 3ECRA 4KHPE 2NABA 2LT7A 2EORA 1DGCA 2JP9A 2EOZA 4R2PA 3T1HE 4OOGC 1MEYC 2RSMA 4X65E 4JI0E 2M1SA 2ELYA 1IQOA 3AV0A 4JI7E 1PJQA 2L6MA 4BHCA 5A6BD 2EMCA 3LMLA 4F6NA 2EM3A 2RS6A 5LMNE 3DF6A 2ZM6E 1Z1BA 1YSAC 4GKKE 2EN8A 4LFBE 4R8OA 2EM7A 4R2CA 4ZYHA 1PJTA 3T1YE 4F9CB 2V87A 1N36E 1X6FA 4P78A 2YSPA 1IBME 4BMJA 3THOB 2EMIA 3EPJA 4FK5C 5LMUE 2NUFA 4X64E 2VE7C 2EM5A 3ADJA 4DR1E 2ODRC 1I94E 1X5WA 5AE2A 1QNTA 3DJWA 2J7JA 2CTDA 2EPPA 2CPNA 2MKDA 2EP3A 2KOUA 4JI6E 1XNRE 5KL7A 3VHTB 2K4VA 2V88A 1QU6A 4R2AA 4R2QA 2YTPA 4LFCE 3L00A 2B7TA 2EMGA 2YTGA 3BBGA 2V83A 1X48A 2KONA 2I9IA 3H09A 5A6BA 4OX9E 5T6JA 2K7IA 2EL4A 2UXDE 2YTIA 4BC9A 1FKAE 1J5EE 4BCAA 2LBSB 4I8OA 4J8ZA 4F2JC 2VQFE 2FTXB 2JXPA 1HR0E 2EOOA 2YTDA 4O24A 1JK1A 4F9AB 2EN4A 3TQMA 4JV5E 2YTEA 4F9BB 1WXRA 5AE1A 2GPIA 2B9DA 2YTJA 3C4TA 1DI2A 2MKNA 4O4KA 4ZYEA 1T39A 3C4BA 2M7QA 1A1GA 2ELZA 4B3RE 4WXCA 5AC5A 4GZNC 2YRKA 2Q8UA 5KL6A 4X62E 2FGGA 2L8TA 2EOFA 1UILA 4JI8E 2A25A 2B3TB 2RPCA 1YYOA 4DR4E 2EN2A 2MC6A 2V8QB 4DR7E 1UHZA 2LRSA 2BBGA 4NHRA 4DKKA 2YTOA 1XNQE 5CFFE 4JI4E 5A6KA 4ZYDA 2LJHA 3IWBA 4O5GA 1YZ9A 2EN6A
chains in the Genus database with same CATH topology
2JYAA 2LJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYA A;  2LJU A; 
#chains in the Genus database with same CATH topology
 2YTN A;  1O0W A;  3C6M A;  3OTO E;  3LLH A;  1HNZ E;  2FV4 B;  1ZAA C;  4DR2 E;  2JOB A;  3J7Y p;  2EPU A;  2EZ6 A;  4DV1 E;  3EPK A;  4IJD A;  2EL6 A;  4MLQ A;  2HHH E;  4R03 A;  2MDG A;  5KL4 A;  2EOS A;  1G2F C;  4WPY A;  2EOH A;  2WZO A;  3EQ1 A;  4M0V A;  3MHS C;  1WHQ A;  2V89 A;  1WHN A;  2CSH A;  5DNY A;  4HTG A;  5AC4 A;  1SFE A;  2DLQ A;  3P1X A;  2NUG A;  2LO3 A;  1X49 A;  2RTX A;  5A6A A;  1L4S A;  2YTF A;  5AE3 A;  5LLQ A;  2EPC A;  4JI5 E;  2CT1 A;  1EH6 A;  2DSY A;  1MGT A;  2ENA A;  2YRM A;  1GZ6 A;  5F3W A;  2R76 A;  4NXN E;  4L8N A;  4BS9 A;  3HQ1 A;  2E1M A;  3OML A;  4BHB A;  1A1F A;  2LE2 A;  3ADG A;  1YPN A;  2GHF A;  4DR3 E;  2EPR A;  1UN6 B;  1PDA A;  4F54 A;  2DLK A;  5IT9 C;  1X6H A;  3HPZ A;  3HTX A;  4F6M A;  2ENC A;  1NCS A;  1EH8 A;  5BR8 E;  1KYQ A;  1IBK E;  3ADL A;  2EOY A;  2H36 X;  1J26 A;  5AAS A;  1GQE A;  2R1F A;  4Q28 A;  4WX9 A;  1JK2 A;  4DV5 E;  3RMP A;  4LU9 A;  4LF5 E;  2NA2 A;  5TSE A;  2EPM X;  4WFT A;  2EQ0 A;  2LUP B;  4R2E A;  5KL5 A;  4M30 A;  1NEI A;  2L2K B;  3F6G A;  1GTK A;  2EPL X;  2N8X A;  3QG5 C;  1WJP A;  2LTS A;  3EPH A;  1IBL E;  2MC5 A;  2YSO A;  2EMY A;  2JY9 A;  1HNW E;  1A1L A;  1EKZ A;  1X3C A;  1YUJ A;  1TN9 A;  2JR1 A;  5IV8 B;  2WCC 3;  3VYY A;  3MHH C;  2N3G A;  1RMD A;  2WBU A;  2LV2 A;  2UUB E;  4IS1 C;  2JWO A;  4RHB B;  2YTQ A;  2JOX A;  3MSW A;  4K0K E;  1TF6 A;  3KZZ A;  2YT4 A;  2VQE E;  4DUZ E;  2E5L E;  2GLI A;  1YUI A;  2EMK A;  3JU0 A;  1SR9 A;  3BF2 A;  4O43 A;  2EPX A;  4YY3 E;  1DQ3 A;  4GEQ B;  1N33 E;  2EMZ A;  2NUE A;  2EN3 A;  2HC5 A;  4X66 E;  4BC7 A;  4WSG A;  2LUQ A;  5KL2 A;  1T4L B;  5A6J A;  2EM4 A;  2JPA A;  5ADZ A;  2YZT A;  1A1H A;  4NZV A;  2YRH A;  2M4I A;  2EM8 A;  2YU8 A;  3J80 C;  1HNX E;  4DV7 E;  4TUG A;  4M9V C;  1BBO A;  1N32 E;  3UK3 C;  1T4N A;  3M99 B;  4R2D A;  3C6K A;  1XMQ E;  2EPO A;  2RSI A;  3K6Q A;  5LL6 R;  4WSP A;  2F4V E;  2PRT A;  3JTZ A;  2L3C A;  4JI2 E;  2EMA A;  1A1K A;  4DV0 E;  1N34 E;  1X6E A;  2BB8 A;  4ZYG A;  2EOI A;  2EMB A;  1YYK A;  2M9A A;  4KZS A;  1FJG E;  3VYX A;  4JI1 E;  1RC7 A;  2N3H A;  5IXM B;  2L2N A;  3HPS A;  2ENH A;  4LF8 E;  3ADI A;  2EMH A;  2UXB E;  1A1J A;  2EL5 A;  2VRD A;  2EN7 A;  4B3S E;  1T4O A;  1ZBQ A;  1B69 A;  2EOM A;  4X8W A;  3FIG A;  2LTR A;  3KZY A;  4HEI A;  2WBS A;  1ZBT A;  1P47 A;  3IWC A;  1X47 A;  2RS7 A;  3HXL A;  2LVH A;  4JYA E;  2EOJ A;  4DR5 E;  2B7V A;  2YWQ A;  1T38 A;  2EMW A;  4DV4 E;  5A69 A;  2EPZ A;  2EM9 A;  4LF9 E;  3BGH A;  1BB8 A;  2UUC E;  4L5N C;  2UU9 E;  2F8B A;  4YHH E;  1STU A;  2LCE A;  2VF1 A;  4LF4 E;  4DV3 E;  2LMZ A;  1TF3 A;  3IWD A;  3ZOQ B;  2EM0 A;  2G7H A;  5IWA E;  4AQY E;  4BBY A;  5A2Q C;  4DV6 E;  4B3M E;  3J7A G;  2DMI A;  3BID A;  4KWY A;  2EQ1 A;  1LLM C;  3AUZ A;  2L33 A;  3KWR A;  2HJJ A;  4NXM E;  2ADR A;  2D9H A;  4R2R A;  4N4R B;  2V86 A;  2HGH A;  4LF6 E;  2EJ4 A;  2EPN A;  2EM2 A;  1WRJ A;  4X9J A;  1ZR9 A;  2DIX A;  5FLX C;  4M2Z A;  2EML A;  2IHR 1;  2L3J A;  4GKJ E;  1IQS A;  2EM6 A;  2KHX A;  2EQ3 A;  2EWL A;  2WBT A;  1AAY A;  2DMY A;  4P7D A;  4R2S A;  2JYA A;  4RH8 A;  4DR6 E;  2RQL A;  2EPK X;  2E72 A;  1YYW A;  2EMX A;  4WXD A;  1KJK A;  2DB2 A;  2LJU A;  1EH7 A;  2MDR A;  2UXC E;  1PJS A;  4LTY A;  2EMF A;  3THN A;  2EOQ A;  1PKP A;  4MLV A;  2EPA A;  1F2I G;  4DMI A;  2L2M A;  2EN1 A;  3VK6 A;  2DRP A;  2L92 A;  1YFH A;  4TUI A;  4B3T E;  4LF7 E;  2V85 A;  2DGC A;  3JAM C;  1A1I A;  1AH5 A;  1BBG A;  2YPN A;  3J81 C;  4JI3 E;  3F6H A;  4LFA E;  2UUA E;  2EOX A;  4WYQ B;  2YU5 A;  5KL3 A;  2EOE A;  4DV2 E;  2EE8 A;  4DUY E;  1N3G A;  1UBD C;  1G2D C;  2I13 A;  4Q35 B;  1RQ0 A;  2ODR D;  1ZU1 A;  3EPL A;  1XMO E;  2JVA A;  1IMU A;  3ECR A;  4KHP E;  2NAB A;  2LT7 A;  2EOR A;  1DGC A;  2JP9 A;  2EOZ A;  4R2P A;  3T1H E;  4OOG C;  1MEY C;  2RSM A;  4X65 E;  4JI0 E;  2M1S A;  2ELY A;  1IQO A;  3AV0 A;  4JI7 E;  1PJQ A;  2L6M A;  4BHC A;  5A6B D;  2EMC A;  3LML A;  4F6N A;  2EM3 A;  2RS6 A;  5LMN E;  3DF6 A;  2ZM6 E;  1Z1B A;  1YSA C;  4GKK E;  2EN8 A;  4LFB E;  4R8O A;  2EM7 A;  4R2C A;  4ZYH A;  1PJT A;  3T1Y E;  4F9C B;  2V87 A;  1N36 E;  1X6F A;  4P78 A;  2YSP A;  1IBM E;  4BMJ A;  3THO B;  2EMI A;  3EPJ A;  4FK5 C;  5LMU E;  2NUF A;  4X64 E;  2VE7 C;  2EM5 A;  3ADJ A;  4DR1 E;  2ODR C;  1I94 E;  1X5W A;  5AE2 A;  1QNT A;  3DJW A;  2J7J A;  2CTD A;  2EPP A;  2CPN A;  2MKD A;  2EP3 A;  2KOU A;  4JI6 E;  1XNR E;  5KL7 A;  3VHT B;  2K4V A;  2V88 A;  1QU6 A;  4R2A A;  4R2Q A;  2YTP A;  4LFC E;  3L00 A;  2B7T A;  2EMG A;  2YTG A;  3BBG A;  2V83 A;  1X48 A;  2KON A;  2I9I A;  3H09 A;  5A6B A;  4OX9 E;  5T6J A;  2K7I A;  2EL4 A;  2UXD E;  2YTI A;  4BC9 A;  1FKA E;  1J5E E;  4BCA A;  2LBS B;  4I8O A;  4J8Z A;  4F2J C;  2VQF E;  2FTX B;  2JXP A;  1HR0 E;  2EOO A;  2YTD A;  4O24 A;  1JK1 A;  4F9A B;  2EN4 A;  3TQM A;  4JV5 E;  2YTE A;  4F9B B;  1WXR A;  5AE1 A;  2GPI A;  2B9D A;  2YTJ A;  3C4T A;  1DI2 A;  2MKN A;  4O4K A;  4ZYE A;  1T39 A;  3C4B A;  2M7Q A;  1A1G A;  2ELZ A;  4B3R E;  4WXC A;  5AC5 A;  4GZN C;  2YRK A;  2Q8U A;  5KL6 A;  4X62 E;  2FGG A;  2L8T A;  2EOF A;  1UIL A;  4JI8 E;  2A25 A;  2B3T B;  2RPC A;  1YYO A;  4DR4 E;  2EN2 A;  2MC6 A;  2V8Q B;  4DR7 E;  1UHZ A;  2LRS A;  2BBG A;  4NHR A;  4DKK A;  2YTO A;  1XNQ E;  5CFF E;  4JI4 E;  5A6K A;  4ZYD A;  2LJH A;  3IWB A;  4O5G A;  1YZ9 A;  2EN6 A; 
#chains in the Genus database with same CATH homology
 2JYA A;  2LJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...