2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1810
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2JYAA 2LJUA
chains in the Genus database with same CATH superfamily
1MGTA 2A25A 5IT9C 5LMNE 1HNZE 1X49A 1ZAAC 1KJKA 2EMZA 2V86A 2VF1A 1QNTA 4X64E 2F8BA 1STUA 3C4TA 3J7AG 2EMXA 4JI7E 4GZNC 4WXCA 2EPRA 5AE2A 4JI1E 3JAMC 4LTYA 5A6KA 2UUCE 2YTEA 4F6MA 2EOEA 4F2JC 2RQLA 4DUZE 1A1FA 3ADIA 2FV4B 1BBGA 3HPSA 3OTOE 4R2DA 4O5GA 4OOGC 2RSMA 2LTSA 4L8NA 1RMDA 2J7JA 4LFAE 4TUIA 4JI8E 3VK6A 1F2IG 2GLIA 2YTGA 4NZVA 1YUJA 2LJHA 2L6MA 3BF2A 1BB8A 3HTXA 1N32E 2EPZA 2EL5A 5AE1A 1BBOA 5A6JA 2EPLX 1YYOA 1UBDC 2DSYA 2YTPA 3RMPA 5ADZA 2VQFE 2L8TA 3P1XA 5AC5A 2JOXA 3L00A 4IS1C 2JOBA 2EMFA 2EOQA 4L5NC 2Q8UA 2N8XA 2NUFA 3LMLA 4DR4E 3MHHC 2CTDA 4DV1E 2YSPA 2EMGA 1EH7A 2LCEA 1YYKA 1AH5A 3EPHA 1I94E 4ZYHA 2L2NA 1X6FA 2ENAA 3AV0A 2YTNA 1KYQA 3UK3C 4DV4E 2EOJA 4DUYE 1N3GA 3QG5C 2RS6A 2LV2A 5IWAE 2V8QB 4DR7E 3KWRA 4ZYEA 4AQYE 2JPAA 2V89A 4R2EA 4JI0E 3KZYA 2EM5A 4B3SE 2HJJA 2EMBA 4GKJE 1PJSA 2KOUA 2B9DA 2DLKA 2L92A 1X48A 4R03A 2DGCA 2JP9A 2N3HA 1SFEA 3EPLA 4DV0E 2L33A 2L2MA 5TSEA 1RQ0A 3MHSC 4R2QA 5AC4A 3VYYA 2E5LE 1IQOA 4JI5E 2EOSA 3AUZA 2EMKA 1YUIA 4JI3E 3IWDA 4KWYA 1XMQE 2LO3A 1EH6A 4WX9A 4RH8A 1TF3A 1ZBQA 3MSWA 2L2KB 2EM0A 3BIDA 2EN4A 2LT7A 2MDRA 2HC5A 4F9CB 3VHTB 2UXBE 1X5WA 2M9AA 2EQ1A 2EMYA 2ENHA 1YYWA 2EM2A 2EP3A 4DV6E 2EN1A 2CSHA 2EMAA 1QU6A 2UXCE 1GQEA 5A6AA 5F3WA 2WBTA 1ZR9A 1T39A 2EOIA 1WXRA 2K7IA 5DNYA 4NHRA 4R2CA 1UILA 1WJPA 2RPCA 2RTXA 2BBGA 2HHHE 2ODRC 2KONA 1MEYC 1IQSA 2EMWA 2L3CA 3ZOQB 4MLQA 2E72A 2LE2A 2EQ3A 1DGCA 4JYAE 4R2AA 3J7Yp 4LF6E 3ADJA 2JR1A 2V83A 2EM4A 2DMYA 3HPZA 2EJ4A 2D9HA 2MC5A 3EQ1A 2KHXA 5IV8B 4BMJA 2R76A 2PRTA 1PKPA 4LU9A 1AAYA 1DQ3A 2WZOA 1IBKE 1UHZA 2EPAA 2DB2A 2EL4A 5LL6R 5LMUE 5FLXC 4R2PA 2JVAA 4BS9A 3HQ1A 1N34E 2VE7C 4ZYGA 5LLQA 2YRHA 2WBUA 1RC7A 2G7HA 5BR8E 4HEIA 4HTGA 4MLVA 4Q35B 1FJGE 1T4NA 2EPXA 1TF6A 2YTQA 5A6BD 2ELZA 4TUGA 2EPMX 2V87A 2UU9E 4LFCE 2YSOA 2EQ0A 2EPNA 2GPIA 4Q28A 1N33E 1A1JA 4DR5E 4P7DA 1N36E 4LF4E 3T1HE 2YTFA 2V88A 4O4KA 2EM9A 3BGHA 4B3ME 2EN6A 1SR9A 2NA2A 1NCSA 5T6JA 3OMLA 4R2SA 1HNXE 4FK5C 3M99B 2V85A 3FIGA 2UUAE 4JV5E 4OX9E 1PDAA 3J81C 4KHPE 4N4RB 3DJWA 2JYAA 2BB8A 4DV3E 4DR3E 1WHNA 1A1GA 2WBSA 2FTXB 2YTIA 2K4VA 2JWOA 1HNWE 3H09A 2L3JA 2UXDE 4BC7A 3F6GA 4DV7E 1JK2A 4LF8E 3ADLA 1FKAE 4X66E 4ZYDA 3C6KA 2FGGA 4J8ZA 2ELYA 4X8WA 1L4SA 1P47A 1DI2A 2EPUA 2M1SA 1X47A 2YTOA 4F54A 2EMIA 2EOZA 2LMZA 5A6BA 2LUQA 1B69A 1YZ9A 3K6QA 2EOXA 3KZZA 3IWCA 4X62E 2EOOA 1O0WA 2DIXA 1NEIA 4K0KE 4WSPA 4F9BB 4DV5E 2IHR1 2NUGA 2ENCA 4DV2E 5KL4A 1WHQA 1PJTA 2MDGA 2I9IA 4YY3E 4LF7E 3T1YE 2EE8A 1YPNA 4I8OA 2JY9A 4WFTA 1A1IA 1EKZA 4WYQB 5IXMB 4BCAA 2EN2A 2M4IA 1GZ6A 2DMIA 4JI2E 2EMCA 1A1LA 1G2FC 3VYXA 3IWBA 1GTKA 2N3GA 2YU5A 5KL5A 1JK1A 2EORA 2EOYA 2F4VE 4DMIA 2EMLA 2B7VA 3EPJA 2LBSB 4F6NA 2MKDA 5A69A 2LJUA 4O43A 4M0VA 2I13A 4LF5E 4IJDA 2EOMA 4JI6E 2RS7A 2EM6A 1A1KA 3JTZA 1IMUA 4DR1E 4LF9E 4WPYA 4BC9A 4NXME 2LTRA 2EM3A 4X9JA 1EH8A 4KZSA 2LVHA 5KL3A 1XMOE 4B3TE 5CFFE 4NXNE 2UUBE 1J5EE 3F6HA 2R1FA 4P78A 2E1MA 2EMHA 4GKKE 2YZTA 3THOB 3J80C 2M7QA 2HGHA 3LLHA 1G2DC 2YPNA 3ECRA 3TQMA 1ZU1A 3HXLA 1X3CA 4R2RA 2CT1A 4DR2E 1ZBTA 2ZM6E 4JI4E 1LLMC 2EWLA 2H36X 2NABA 3C6MA 5KL2A 2EN3A 2NUEA 4M2ZA 1T4LB 1XNRE 2DLQA 2EN8A 2MC6A 1Z1BA 4X65E 4R8OA 1WRJA 2EM8A 5AASA 2EOHA 2EL6A 1UN6B 1T4OA 2DRPA 4B3RE 4BHCA 2VQEE 4WXDA 5AE3A 4LFBE 2YWQA 3ADGA 4WSGA 2JXPA 1HR0E 2RSIA 1A1HA 2LRSA 1IBLE 1J26A 4YHHE 2EPPA 2EPCA 2GHFA 2YRKA 2YRMA 3DF6A 2EOFA 2YT4A 5A2QC 2EZ6A 4GEQB 3JU0A 5KL6A 2EPOA 4BHBA 4M9VC 4BBYA 2ODRD 3C4BA 2EN7A 2WCC3 2VRDA 1YSAC 4O24A 4DKKA 4DR6E 5KL7A 2EM7A 4RHBB 1X6HA 2B7TA 1T38A 3THNA 1X6EA 2YU8A 1YFHA 2ADRA 2YTDA 2B3TB 1PJQA 3BBGA 3EPKA 2MKNA 1TN9A 2EPKX 2YTJA 4F9AB 1IBME 2CPNA 2LUPB 1XNQE 4M30A
chains in the Genus database with same CATH topology
2JYAA 2LJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYA A;  2LJU A; 
#chains in the Genus database with same CATH topology
 1MGT A;  2A25 A;  5IT9 C;  5LMN E;  1HNZ E;  1X49 A;  1ZAA C;  1KJK A;  2EMZ A;  2V86 A;  2VF1 A;  1QNT A;  4X64 E;  2F8B A;  1STU A;  3C4T A;  3J7A G;  2EMX A;  4JI7 E;  4GZN C;  4WXC A;  2EPR A;  5AE2 A;  4JI1 E;  3JAM C;  4LTY A;  5A6K A;  2UUC E;  2YTE A;  4F6M A;  2EOE A;  4F2J C;  2RQL A;  4DUZ E;  1A1F A;  3ADI A;  2FV4 B;  1BBG A;  3HPS A;  3OTO E;  4R2D A;  4O5G A;  4OOG C;  2RSM A;  2LTS A;  4L8N A;  1RMD A;  2J7J A;  4LFA E;  4TUI A;  4JI8 E;  3VK6 A;  1F2I G;  2GLI A;  2YTG A;  4NZV A;  1YUJ A;  2LJH A;  2L6M A;  3BF2 A;  1BB8 A;  3HTX A;  1N32 E;  2EPZ A;  2EL5 A;  5AE1 A;  1BBO A;  5A6J A;  2EPL X;  1YYO A;  1UBD C;  2DSY A;  2YTP A;  3RMP A;  5ADZ A;  2VQF E;  2L8T A;  3P1X A;  5AC5 A;  2JOX A;  3L00 A;  4IS1 C;  2JOB A;  2EMF A;  2EOQ A;  4L5N C;  2Q8U A;  2N8X A;  2NUF A;  3LML A;  4DR4 E;  3MHH C;  2CTD A;  4DV1 E;  2YSP A;  2EMG A;  1EH7 A;  2LCE A;  1YYK A;  1AH5 A;  3EPH A;  1I94 E;  4ZYH A;  2L2N A;  1X6F A;  2ENA A;  3AV0 A;  2YTN A;  1KYQ A;  3UK3 C;  4DV4 E;  2EOJ A;  4DUY E;  1N3G A;  3QG5 C;  2RS6 A;  2LV2 A;  5IWA E;  2V8Q B;  4DR7 E;  3KWR A;  4ZYE A;  4AQY E;  2JPA A;  2V89 A;  4R2E A;  4JI0 E;  3KZY A;  2EM5 A;  4B3S E;  2HJJ A;  2EMB A;  4GKJ E;  1PJS A;  2KOU A;  2B9D A;  2DLK A;  2L92 A;  1X48 A;  4R03 A;  2DGC A;  2JP9 A;  2N3H A;  1SFE A;  3EPL A;  4DV0 E;  2L33 A;  2L2M A;  5TSE A;  1RQ0 A;  3MHS C;  4R2Q A;  5AC4 A;  3VYY A;  2E5L E;  1IQO A;  4JI5 E;  2EOS A;  3AUZ A;  2EMK A;  1YUI A;  4JI3 E;  3IWD A;  4KWY A;  1XMQ E;  2LO3 A;  1EH6 A;  4WX9 A;  4RH8 A;  1TF3 A;  1ZBQ A;  3MSW A;  2L2K B;  2EM0 A;  3BID A;  2EN4 A;  2LT7 A;  2MDR A;  2HC5 A;  4F9C B;  3VHT B;  2UXB E;  1X5W A;  2M9A A;  2EQ1 A;  2EMY A;  2ENH A;  1YYW A;  2EM2 A;  2EP3 A;  4DV6 E;  2EN1 A;  2CSH A;  2EMA A;  1QU6 A;  2UXC E;  1GQE A;  5A6A A;  5F3W A;  2WBT A;  1ZR9 A;  1T39 A;  2EOI A;  1WXR A;  2K7I A;  5DNY A;  4NHR A;  4R2C A;  1UIL A;  1WJP A;  2RPC A;  2RTX A;  2BBG A;  2HHH E;  2ODR C;  2KON A;  1MEY C;  1IQS A;  2EMW A;  2L3C A;  3ZOQ B;  4MLQ A;  2E72 A;  2LE2 A;  2EQ3 A;  1DGC A;  4JYA E;  4R2A A;  3J7Y p;  4LF6 E;  3ADJ A;  2JR1 A;  2V83 A;  2EM4 A;  2DMY A;  3HPZ A;  2EJ4 A;  2D9H A;  2MC5 A;  3EQ1 A;  2KHX A;  5IV8 B;  4BMJ A;  2R76 A;  2PRT A;  1PKP A;  4LU9 A;  1AAY A;  1DQ3 A;  2WZO A;  1IBK E;  1UHZ A;  2EPA A;  2DB2 A;  2EL4 A;  5LL6 R;  5LMU E;  5FLX C;  4R2P A;  2JVA A;  4BS9 A;  3HQ1 A;  1N34 E;  2VE7 C;  4ZYG A;  5LLQ A;  2YRH A;  2WBU A;  1RC7 A;  2G7H A;  5BR8 E;  4HEI A;  4HTG A;  4MLV A;  4Q35 B;  1FJG E;  1T4N A;  2EPX A;  1TF6 A;  2YTQ A;  5A6B D;  2ELZ A;  4TUG A;  2EPM X;  2V87 A;  2UU9 E;  4LFC E;  2YSO A;  2EQ0 A;  2EPN A;  2GPI A;  4Q28 A;  1N33 E;  1A1J A;  4DR5 E;  4P7D A;  1N36 E;  4LF4 E;  3T1H E;  2YTF A;  2V88 A;  4O4K A;  2EM9 A;  3BGH A;  4B3M E;  2EN6 A;  1SR9 A;  2NA2 A;  1NCS A;  5T6J A;  3OML A;  4R2S A;  1HNX E;  4FK5 C;  3M99 B;  2V85 A;  3FIG A;  2UUA E;  4JV5 E;  4OX9 E;  1PDA A;  3J81 C;  4KHP E;  4N4R B;  3DJW A;  2JYA A;  2BB8 A;  4DV3 E;  4DR3 E;  1WHN A;  1A1G A;  2WBS A;  2FTX B;  2YTI A;  2K4V A;  2JWO A;  1HNW E;  3H09 A;  2L3J A;  2UXD E;  4BC7 A;  3F6G A;  4DV7 E;  1JK2 A;  4LF8 E;  3ADL A;  1FKA E;  4X66 E;  4ZYD A;  3C6K A;  2FGG A;  4J8Z A;  2ELY A;  4X8W A;  1L4S A;  1P47 A;  1DI2 A;  2EPU A;  2M1S A;  1X47 A;  2YTO A;  4F54 A;  2EMI A;  2EOZ A;  2LMZ A;  5A6B A;  2LUQ A;  1B69 A;  1YZ9 A;  3K6Q A;  2EOX A;  3KZZ A;  3IWC A;  4X62 E;  2EOO A;  1O0W A;  2DIX A;  1NEI A;  4K0K E;  4WSP A;  4F9B B;  4DV5 E;  2IHR 1;  2NUG A;  2ENC A;  4DV2 E;  5KL4 A;  1WHQ A;  1PJT A;  2MDG A;  2I9I A;  4YY3 E;  4LF7 E;  3T1Y E;  2EE8 A;  1YPN A;  4I8O A;  2JY9 A;  4WFT A;  1A1I A;  1EKZ A;  4WYQ B;  5IXM B;  4BCA A;  2EN2 A;  2M4I A;  1GZ6 A;  2DMI A;  4JI2 E;  2EMC A;  1A1L A;  1G2F C;  3VYX A;  3IWB A;  1GTK A;  2N3G A;  2YU5 A;  5KL5 A;  1JK1 A;  2EOR A;  2EOY A;  2F4V E;  4DMI A;  2EML A;  2B7V A;  3EPJ A;  2LBS B;  4F6N A;  2MKD A;  5A69 A;  2LJU A;  4O43 A;  4M0V A;  2I13 A;  4LF5 E;  4IJD A;  2EOM A;  4JI6 E;  2RS7 A;  2EM6 A;  1A1K A;  3JTZ A;  1IMU A;  4DR1 E;  4LF9 E;  4WPY A;  4BC9 A;  4NXM E;  2LTR A;  2EM3 A;  4X9J A;  1EH8 A;  4KZS A;  2LVH A;  5KL3 A;  1XMO E;  4B3T E;  5CFF E;  4NXN E;  2UUB E;  1J5E E;  3F6H A;  2R1F A;  4P78 A;  2E1M A;  2EMH A;  4GKK E;  2YZT A;  3THO B;  3J80 C;  2M7Q A;  2HGH A;  3LLH A;  1G2D C;  2YPN A;  3ECR A;  3TQM A;  1ZU1 A;  3HXL A;  1X3C A;  4R2R A;  2CT1 A;  4DR2 E;  1ZBT A;  2ZM6 E;  4JI4 E;  1LLM C;  2EWL A;  2H36 X;  2NAB A;  3C6M A;  5KL2 A;  2EN3 A;  2NUE A;  4M2Z A;  1T4L B;  1XNR E;  2DLQ A;  2EN8 A;  2MC6 A;  1Z1B A;  4X65 E;  4R8O A;  1WRJ A;  2EM8 A;  5AAS A;  2EOH A;  2EL6 A;  1UN6 B;  1T4O A;  2DRP A;  4B3R E;  4BHC A;  2VQE E;  4WXD A;  5AE3 A;  4LFB E;  2YWQ A;  3ADG A;  4WSG A;  2JXP A;  1HR0 E;  2RSI A;  1A1H A;  2LRS A;  1IBL E;  1J26 A;  4YHH E;  2EPP A;  2EPC A;  2GHF A;  2YRK A;  2YRM A;  3DF6 A;  2EOF A;  2YT4 A;  5A2Q C;  2EZ6 A;  4GEQ B;  3JU0 A;  5KL6 A;  2EPO A;  4BHB A;  4M9V C;  4BBY A;  2ODR D;  3C4B A;  2EN7 A;  2WCC 3;  2VRD A;  1YSA C;  4O24 A;  4DKK A;  4DR6 E;  5KL7 A;  2EM7 A;  4RHB B;  1X6H A;  2B7T A;  1T38 A;  3THN A;  1X6E A;  2YU8 A;  1YFH A;  2ADR A;  2YTD A;  2B3T B;  1PJQ A;  3BBG A;  3EPK A;  2MKN A;  1TN9 A;  2EPK X;  2YTJ A;  4F9A B;  1IBM E;  2CPN A;  2LUP B;  1XNQ E;  4M30 A; 
#chains in the Genus database with same CATH homology
 2JYA A;  2LJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...