2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1810
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2LJUA 2JYAA
chains in the Genus database with same CATH superfamily
1N32E 5T6JA 2EMWA 1KJKA 4M9VC 2LE2A 2V87A 1PJTA 5A6KA 4OX9E 3J7AG 2EJ4A 1EH8A 4JI2E 5AE1A 2EN4A 1WXRA 1LLMC 2EPAA 2UXBE 4LF6E 2DIXA 4DV4E 1YSAC 4Q28A 3LMLA 4DV3E 2D9HA 2FTXB 4IJDA 3C4TA 1J5EE 2BBGA 1XMOE 5IV8B 2EPZA 1XNQE 1AH5A 2ODRD 4NZVA 1UN6B 1HNZE 4LU9A 2VQEE 1A1HA 1FJGE 1KYQA 4LF4E 1Z1BA 4F54A 5CFFE 1AAYA 3AUZA 2R76A 3OMLA 3BIDA 4X8WA 4X9JA 4YHHE 5IT9C 1NEIA 1O0WA 2L8TA 3MHSC 1HR0E 4DR6E 4F2JC 3ECRA 2EOIA 2YSPA 4DR1E 2EM2A 3EQ1A 4R8OA 2E5LE 1IMUA 1EH7A 4DV0E 1YZ9A 2EZ6A 2L2KB 5LMNE 2EPCA 2MKDA 3ADGA 2EM8A 2RQLA 2YRKA 3IWDA 4R2QA 1T4OA 3MHHC 3FIGA 2EN8A 4WX9A 1EH6A 1X5WA 2EPKX 3IWBA 4KZSA 1YYOA 2YTEA 5A6BD 1T38A 2EPPA 2KONA 2L3CA 4BMJA 1YUIA 3BF2A 4P7DA 3T1YE 4DV6E 2LO3A 1T4NA 3EPJA 4ZYDA 4WSGA 3C6MA 2JXPA 1IBME 2UUAE 2EOXA 4M30A 1A1KA 2EMXA 2EPOA 1A1LA 2EPMX 3IWCA 3ADIA 1T4LB 5KL4A 2CSHA 2YTIA 2EMHA 5KL5A 2EE8A 2V83A 2DMIA 4DR2E 4LF8E 4R03A 2PRTA 2ELZA 2R1FA 2EOOA 2A25A 1PJQA 5KL2A 2WZOA 2I9IA 4DKKA 3BGHA 1RMDA 2G7HA 2YTPA 2H36X 2EOHA 1X6EA 1PDAA 2L33A 1X6FA 2JY9A 2L6MA 2DGCA 5IWAE 1N36E 2EWLA 2DLQA 4OOGC 2EMLA 4TUGA 2LUQA 2V8QB 4HEIA 4BS9A 3MSWA 2YPNA 2DB2A 3LLHA 2N8XA 3HPSA 1ZBQA 1IBLE 2WBSA 4X64E 1WRJA 2EM7A 2EMGA 1XMQE 5LMUE 2WCC3 1YYWA 2HJJA 2GHFA 4NXME 3VK6A 3ADLA 2RSIA 5A6BA 3KZZA 2LMZA 3EPKA 1ZAAC 4JI4E 1J26A 2YTFA 2EPLX 2M7QA 1UHZA 2RPCA 2E72A 4L8NA 2MKNA 4LFCE 2YTNA 4DR4E 4WFTA 1IBKE 4DV2E 2LTSA 2E1MA 1HNXE 4DV1E 4F9AB 2F4VE 1P47A 1JK2A 2MC6A 1IQSA 1DQ3A 1IQOA 2JPAA 2EMYA 2DSYA 5A6AA 1MEYC 2YU5A 4JI0E 2V86A 2L2NA 4K0KE 1A1JA 4R2RA 1WHQA 4M2ZA 3HTXA 1N3GA 3VYXA 2RS6A 2MC5A 2B9DA 1B69A 2J7JA 3EPLA 2EMAA 1PKPA 2EP3A 3VHTB 2DRPA 2KOUA 1HNWE 2KHXA 4F6NA 2CPNA 2UXCE 5AE3A 2LVHA 2EM6A 3T1HE 2JR1A 4YY3E 4R2SA 1I94E 5ADZA 2EN6A 3DJWA 5IXMB 3KWRA 3EPHA 4X66E 2EORA 3QG5C 2YTGA 4ZYGA 4LF9E 2GLIA 1DI2A 2EQ0A 4JI3E 4JYAE 4DMIA 2BB8A 3THOB 3HPZA 2EPUA 3J80C 1GQEA 4N4RB 1EKZA 4X62E 4ZYEA 2GPIA 3AV0A 2ODRC 4DR3E 2EOMA 2L2MA 1BBGA 5F3WA 1FKAE 2WBUA 3P1XA 4BHBA 5BR8E 1DGCA 4DR7E 3UK3C 2MDRA 2HGHA 4WPYA 3KZYA 4M0VA 4P78A 4BBYA 4R2DA 2NUFA 2EM5A 4R2AA 2YTQA 1A1GA 2DLKA 2EQ1A 2FGGA 4JI1E 2EL6A 1F2IG 2RTXA 3H09A 4L5NC 4BHCA 5FLXC 4TUIA 5AASA 3RMPA 2EM9A 2F8BA 4LFBE 2JVAA 2YU8A 4GZNC 4JI5E 4DR5E 4BC7A 5A6JA 2EM3A 4WXDA 2B7TA 2VQFE 4B3TE 2YTOA 2LBSB 2L92A 2ADRA 2EM4A 2VE7C 2EMIA 2YTJA 4F9BB 2K7IA 2EN1A 4JI6E 4KHPE 4J8ZA 4DUYE 2M1SA 1T39A 3M99B 4AQYE 2YRHA 1TF3A 3F6HA 1A1FA 2ELYA 1BB8A 2EPNA 2JOXA 2UUBE 1X3CA 4F9CB 5AC4A 4B3ME 4X65E 1TF6A 2EPRA 1STUA 4WSPA 2UXDE 2VRDA 4MLVA 2EOEA 1RC7A 2K4VA 2YSOA 4R2EA 3JTZA 2CT1A 2LRSA 1SFEA 2I13A 3TQMA 2LT7A 2EOQA 3J7Yp 2EMCA 2EL5A 4I8OA 2YWQA 2EPXA 2EN3A 3K6QA 3ZOQB 4KWYA 2EOZA 4GKJE 4MLQA 4IS1C 1G2FC 2LJUA 3L00A 2EQ3A 5TSEA 1ZR9A 1QNTA 1UILA 2NUEA 2JOBA 2JYAA 2V89A 5LLQA 1SR9A 2EMBA 1YPNA 1A1IA 2NABA 2ENCA 2EL4A 1G2DC 3THNA 5AE2A 2M4IA 2Q8UA 2EMKA 4BCAA 5DNYA 4B3SE 1X49A 4BC9A 2N3HA 2LTRA 3JU0A 2JWOA 2ZM6E 2YTDA 2EN2A 5KL6A 1WJPA 2LV2A 4WYQB 1YYKA 4JV5E 2EOJA 4Q35B 4LFAE 4LF5E 2CTDA 2EOYA 2N3GA 2RSMA 2ENAA 2HC5A 1X6HA 2V85A 1NCSA 1JK1A 2ENHA 4GKKE 5KL3A 2B7VA 4O4KA 2V88A 5AC5A 1PJSA 4O43A 2YT4A 1XNRE 2UU9E 3J81C 4WXCA 4O5GA 2B3TB 2L3JA 2EOSA 2FV4B 4FK5C 2LUPB 1RQ0A 2EM0A 5A2QC 3C6KA 5KL7A 3JAMC 2EMFA 1WHNA 1BBOA 2EMZA 1L4SA 4NXNE 1N34E 2NA2A 5LL6R 3VYYA 1ZU1A 3OTOE 1GTKA 2WBTA 4RHBB 1YFHA 1N33E 2LCEA 4DV7E 3ADJA 2YRMA 2LJHA 4JI7E 4F6MA 2NUGA 4NHRA 2DMYA 3F6GA 3DF6A 1YUJA 2EN7A 3C4BA 2JP9A 4LF7E 4R2PA 3BBGA 3HXLA 2VF1A 5A69A 2YZTA 4O24A 2EOFA 4RH8A 4DUZE 3HQ1A 1QU6A 4ZYHA 1TN9A 4GEQB 4DV5E 2HHHE 1X47A 1ZBTA 2MDGA 1UBDC 2RS7A 1GZ6A 4HTGA 4B3RE 1MGTA 2IHR1 4JI8E 2UUCE 1X48A 2M9AA 4R2CA 4LTYA
chains in the Genus database with same CATH topology
2LJUA 2JYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJU A;  2JYA A; 
#chains in the Genus database with same CATH topology
 1N32 E;  5T6J A;  2EMW A;  1KJK A;  4M9V C;  2LE2 A;  2V87 A;  1PJT A;  5A6K A;  4OX9 E;  3J7A G;  2EJ4 A;  1EH8 A;  4JI2 E;  5AE1 A;  2EN4 A;  1WXR A;  1LLM C;  2EPA A;  2UXB E;  4LF6 E;  2DIX A;  4DV4 E;  1YSA C;  4Q28 A;  3LML A;  4DV3 E;  2D9H A;  2FTX B;  4IJD A;  3C4T A;  1J5E E;  2BBG A;  1XMO E;  5IV8 B;  2EPZ A;  1XNQ E;  1AH5 A;  2ODR D;  4NZV A;  1UN6 B;  1HNZ E;  4LU9 A;  2VQE E;  1A1H A;  1FJG E;  1KYQ A;  4LF4 E;  1Z1B A;  4F54 A;  5CFF E;  1AAY A;  3AUZ A;  2R76 A;  3OML A;  3BID A;  4X8W A;  4X9J A;  4YHH E;  5IT9 C;  1NEI A;  1O0W A;  2L8T A;  3MHS C;  1HR0 E;  4DR6 E;  4F2J C;  3ECR A;  2EOI A;  2YSP A;  4DR1 E;  2EM2 A;  3EQ1 A;  4R8O A;  2E5L E;  1IMU A;  1EH7 A;  4DV0 E;  1YZ9 A;  2EZ6 A;  2L2K B;  5LMN E;  2EPC A;  2MKD A;  3ADG A;  2EM8 A;  2RQL A;  2YRK A;  3IWD A;  4R2Q A;  1T4O A;  3MHH C;  3FIG A;  2EN8 A;  4WX9 A;  1EH6 A;  1X5W A;  2EPK X;  3IWB A;  4KZS A;  1YYO A;  2YTE A;  5A6B D;  1T38 A;  2EPP A;  2KON A;  2L3C A;  4BMJ A;  1YUI A;  3BF2 A;  4P7D A;  3T1Y E;  4DV6 E;  2LO3 A;  1T4N A;  3EPJ A;  4ZYD A;  4WSG A;  3C6M A;  2JXP A;  1IBM E;  2UUA E;  2EOX A;  4M30 A;  1A1K A;  2EMX A;  2EPO A;  1A1L A;  2EPM X;  3IWC A;  3ADI A;  1T4L B;  5KL4 A;  2CSH A;  2YTI A;  2EMH A;  5KL5 A;  2EE8 A;  2V83 A;  2DMI A;  4DR2 E;  4LF8 E;  4R03 A;  2PRT A;  2ELZ A;  2R1F A;  2EOO A;  2A25 A;  1PJQ A;  5KL2 A;  2WZO A;  2I9I A;  4DKK A;  3BGH A;  1RMD A;  2G7H A;  2YTP A;  2H36 X;  2EOH A;  1X6E A;  1PDA A;  2L33 A;  1X6F A;  2JY9 A;  2L6M A;  2DGC A;  5IWA E;  1N36 E;  2EWL A;  2DLQ A;  4OOG C;  2EML A;  4TUG A;  2LUQ A;  2V8Q B;  4HEI A;  4BS9 A;  3MSW A;  2YPN A;  2DB2 A;  3LLH A;  2N8X A;  3HPS A;  1ZBQ A;  1IBL E;  2WBS A;  4X64 E;  1WRJ A;  2EM7 A;  2EMG A;  1XMQ E;  5LMU E;  2WCC 3;  1YYW A;  2HJJ A;  2GHF A;  4NXM E;  3VK6 A;  3ADL A;  2RSI A;  5A6B A;  3KZZ A;  2LMZ A;  3EPK A;  1ZAA C;  4JI4 E;  1J26 A;  2YTF A;  2EPL X;  2M7Q A;  1UHZ A;  2RPC A;  2E72 A;  4L8N A;  2MKN A;  4LFC E;  2YTN A;  4DR4 E;  4WFT A;  1IBK E;  4DV2 E;  2LTS A;  2E1M A;  1HNX E;  4DV1 E;  4F9A B;  2F4V E;  1P47 A;  1JK2 A;  2MC6 A;  1IQS A;  1DQ3 A;  1IQO A;  2JPA A;  2EMY A;  2DSY A;  5A6A A;  1MEY C;  2YU5 A;  4JI0 E;  2V86 A;  2L2N A;  4K0K E;  1A1J A;  4R2R A;  1WHQ A;  4M2Z A;  3HTX A;  1N3G A;  3VYX A;  2RS6 A;  2MC5 A;  2B9D A;  1B69 A;  2J7J A;  3EPL A;  2EMA A;  1PKP A;  2EP3 A;  3VHT B;  2DRP A;  2KOU A;  1HNW E;  2KHX A;  4F6N A;  2CPN A;  2UXC E;  5AE3 A;  2LVH A;  2EM6 A;  3T1H E;  2JR1 A;  4YY3 E;  4R2S A;  1I94 E;  5ADZ A;  2EN6 A;  3DJW A;  5IXM B;  3KWR A;  3EPH A;  4X66 E;  2EOR A;  3QG5 C;  2YTG A;  4ZYG A;  4LF9 E;  2GLI A;  1DI2 A;  2EQ0 A;  4JI3 E;  4JYA E;  4DMI A;  2BB8 A;  3THO B;  3HPZ A;  2EPU A;  3J80 C;  1GQE A;  4N4R B;  1EKZ A;  4X62 E;  4ZYE A;  2GPI A;  3AV0 A;  2ODR C;  4DR3 E;  2EOM A;  2L2M A;  1BBG A;  5F3W A;  1FKA E;  2WBU A;  3P1X A;  4BHB A;  5BR8 E;  1DGC A;  4DR7 E;  3UK3 C;  2MDR A;  2HGH A;  4WPY A;  3KZY A;  4M0V A;  4P78 A;  4BBY A;  4R2D A;  2NUF A;  2EM5 A;  4R2A A;  2YTQ A;  1A1G A;  2DLK A;  2EQ1 A;  2FGG A;  4JI1 E;  2EL6 A;  1F2I G;  2RTX A;  3H09 A;  4L5N C;  4BHC A;  5FLX C;  4TUI A;  5AAS A;  3RMP A;  2EM9 A;  2F8B A;  4LFB E;  2JVA A;  2YU8 A;  4GZN C;  4JI5 E;  4DR5 E;  4BC7 A;  5A6J A;  2EM3 A;  4WXD A;  2B7T A;  2VQF E;  4B3T E;  2YTO A;  2LBS B;  2L92 A;  2ADR A;  2EM4 A;  2VE7 C;  2EMI A;  2YTJ A;  4F9B B;  2K7I A;  2EN1 A;  4JI6 E;  4KHP E;  4J8Z A;  4DUY E;  2M1S A;  1T39 A;  3M99 B;  4AQY E;  2YRH A;  1TF3 A;  3F6H A;  1A1F A;  2ELY A;  1BB8 A;  2EPN A;  2JOX A;  2UUB E;  1X3C A;  4F9C B;  5AC4 A;  4B3M E;  4X65 E;  1TF6 A;  2EPR A;  1STU A;  4WSP A;  2UXD E;  2VRD A;  4MLV A;  2EOE A;  1RC7 A;  2K4V A;  2YSO A;  4R2E A;  3JTZ A;  2CT1 A;  2LRS A;  1SFE A;  2I13 A;  3TQM A;  2LT7 A;  2EOQ A;  3J7Y p;  2EMC A;  2EL5 A;  4I8O A;  2YWQ A;  2EPX A;  2EN3 A;  3K6Q A;  3ZOQ B;  4KWY A;  2EOZ A;  4GKJ E;  4MLQ A;  4IS1 C;  1G2F C;  2LJU A;  3L00 A;  2EQ3 A;  5TSE A;  1ZR9 A;  1QNT A;  1UIL A;  2NUE A;  2JOB A;  2JYA A;  2V89 A;  5LLQ A;  1SR9 A;  2EMB A;  1YPN A;  1A1I A;  2NAB A;  2ENC A;  2EL4 A;  1G2D C;  3THN A;  5AE2 A;  2M4I A;  2Q8U A;  2EMK A;  4BCA A;  5DNY A;  4B3S E;  1X49 A;  4BC9 A;  2N3H A;  2LTR A;  3JU0 A;  2JWO A;  2ZM6 E;  2YTD A;  2EN2 A;  5KL6 A;  1WJP A;  2LV2 A;  4WYQ B;  1YYK A;  4JV5 E;  2EOJ A;  4Q35 B;  4LFA E;  4LF5 E;  2CTD A;  2EOY A;  2N3G A;  2RSM A;  2ENA A;  2HC5 A;  1X6H A;  2V85 A;  1NCS A;  1JK1 A;  2ENH A;  4GKK E;  5KL3 A;  2B7V A;  4O4K A;  2V88 A;  5AC5 A;  1PJS A;  4O43 A;  2YT4 A;  1XNR E;  2UU9 E;  3J81 C;  4WXC A;  4O5G A;  2B3T B;  2L3J A;  2EOS A;  2FV4 B;  4FK5 C;  2LUP B;  1RQ0 A;  2EM0 A;  5A2Q C;  3C6K A;  5KL7 A;  3JAM C;  2EMF A;  1WHN A;  1BBO A;  2EMZ A;  1L4S A;  4NXN E;  1N34 E;  2NA2 A;  5LL6 R;  3VYY A;  1ZU1 A;  3OTO E;  1GTK A;  2WBT A;  4RHB B;  1YFH A;  1N33 E;  2LCE A;  4DV7 E;  3ADJ A;  2YRM A;  2LJH A;  4JI7 E;  4F6M A;  2NUG A;  4NHR A;  2DMY A;  3F6G A;  3DF6 A;  1YUJ A;  2EN7 A;  3C4B A;  2JP9 A;  4LF7 E;  4R2P A;  3BBG A;  3HXL A;  2VF1 A;  5A69 A;  2YZT A;  4O24 A;  2EOF A;  4RH8 A;  4DUZ E;  3HQ1 A;  1QU6 A;  4ZYH A;  1TN9 A;  4GEQ B;  4DV5 E;  2HHH E;  1X47 A;  1ZBT A;  2MDG A;  1UBD C;  2RS7 A;  1GZ6 A;  4HTG A;  4B3R E;  1MGT A;  2IHR 1;  4JI8 E;  2UUC E;  1X48 A;  2M9A A;  4R2C A;  4LTY A; 
#chains in the Genus database with same CATH homology
 2LJU A;  2JYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...