2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
b'MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1810
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2LJUA 2JYAA
chains in the Genus database with same CATH superfamily
2JYAA 1NCSA 2EJ4A 2EPMX 3MHSC 3J80C 3VHTB 1WJPA 5AE3A 4NHRA 2EM8A 3T1YE 2EOXA 1YUJA 3OMLA 5ADZA 1HNZE 2VF1A 2LUPB 4GKKE 2EMBA 2EM0A 2DGCA 2EOJA 3HTXA 4F9AB 4OX9E 3HPZA 1EH7A 1L4SA 4BC9A 2YTPA 2EN8A 5KL2A 4GEQB 2LT7A 2YTJA 5BR8E 4JI5E 1X6EA 1TN9A 3BBGA 4LU9A 1SR9A 2I13A 2K7IA 4JYAE 4NZVA 4WSGA 2DSYA 2EN3A 2EM3A 2CSHA 4MLQA 1UBDC 4KWYA 4ZYEA 5FLXC 2EMCA 4R03A 4N4RB 1YYKA 2WCC3 1EH6A 4DR7E 2V85A 4DKKA 1FJGE 2EM9A 5KL4A 2EMHA 3QG5C 1P47A 2UUAE 4K0KE 1YPNA 1STUA 3MSWA 1PJQA 4JI8E 2JPAA 2NUEA 3HQ1A 3UK3C 2EMZA 3C4BA 2UU9E 3RMPA 1PJTA 2YTQA 5TSEA 2JWOA 2LMZA 2E72A 2JR1A 2VQEE 2YTOA 2EOEA 4M9VC 3ADJA 4WXDA 5IWAE 5A6BA 2ELZA 3VYYA 4LFBE 4DR4E 2EPCA 5IT9C 2YRHA 4LF4E 4FK5C 1N36E 2YTEA 1IMUA 1EKZA 2UXCE 4JI1E 4NXME 3THOB 2EN4A 2GPIA 2YU8A 2M4IA 2L6MA 2DIXA 3OTOE 2EPRA 2D9HA 4WSPA 1UHZA 2ENCA 1FKAE 2UUCE 4R2SA 5KL6A 3T1HE 2EOYA 1SFEA 2LV2A 1RQ0A 2ENAA 2EL5A 1T4NA 1QNTA 4DV3E 1N34E 1A1HA 4YY3E 2L2KB 2CPNA 1LLMC 5KL3A 1ZAAC 4JI3E 2HHHE 5A6BD 3L00A 3KZYA 2YWQA 2JOXA 1A1IA 3ECRA 2RPCA 2E5LE 2KHXA 2GHFA 1ZU1A 3AV0A 3F6GA 1IQOA 2YRKA 1RC7A 4ZYDA 1HNWE 2VE7C 2B7VA 2CT1A 2EM6A 4BMJA 5AE2A 2F8BA 2LVHA 1BBGA 4DR5E 2EPUA 4DV4E 2BBGA 2F4VE 3DJWA 4DMIA 2FGGA 4LF9E 2A25A 3M99B 4WXCA 4JI2E 1MEYC 3KZZA 1O0WA 3J81C 4DV5E 2EN1A 1YUIA 1X6FA 3AUZA 2EOSA 2HJJA 3C6KA 4BHBA 4I8OA 1WHNA 2MDRA 2WBTA 2EORA 2L8TA 2ODRC 2EM2A 1I94E 2EPAA 3HPSA 1TF3A 2EMIA 4M2ZA 3IWBA 2EZ6A 4M0VA 2PRTA 2DRPA 1YYWA 4YHHE 4TUIA 2LTSA 4O4KA 2ADRA 4HTGA 2ELYA 2BB8A 5LL6R 3EPKA 1PJSA 2LJHA 4LFCE 5A6KA 1A1GA 1YYOA 2EMKA 2V87A 1GZ6A 2LO3A 3FIGA 2EWLA 5LMUE 2NUFA 4O24A 2DB2A 5AC4A 4BBYA 4LF6E 1ZR9A 3DF6A 2ZM6E 2EN6A 4O43A 3EPLA 2L92A 4LF7E 4DV2E 1XMQE 4GZNC 2DLQA 2G7HA 2V8QB 1G2DC 1EH8A 4B3TE 2N3GA 5A6JA 3ZOQB 4LFAE 1F2IG 1X47A 4B3RE 3EPHA 2EOHA 4WFTA 2R1FA 2MC6A 2EE8A 5KL5A 1B69A 4F54A 1DGCA 1BB8A 2EP3A 1WRJA 2EPZA 2JXPA 2JP9A 2Q8UA 1ZBTA 4F6MA 1YFHA 2EOIA 4X8WA 3K6QA 4WPYA 2JY9A 3MHHC 4R2EA 4AQYE 2EMGA 2EQ1A 1N33E 1J26A 4WX9A 2LJUA 2B3TB 5LMNE 4RH8A 2YSOA 2EMYA 1BBOA 3JTZA 1YZ9A 3H09A 5LLQA 1TF6A 5DNYA 1IBKE 5AC5A 1Z1BA 3J7AG 3C4TA 2M9AA 4R2AA 2EMWA 4JI4E 1X5WA 1G2FC 2KOUA 3EPJA 4DR2E 4R2DA 1T38A 2H36X 4X66E 2ODRD 3BGHA 3J7Yp 4Q35B 4X64E 1IQSA 4DR6E 2EL4A 4KZSA 1IBLE 4B3ME 2EQ3A 4HEIA 2EQ0A 1A1KA 2R76A 2EL6A 2K4VA 4F2JC 4F6NA 2WBSA 1PKPA 1HNXE 4R2QA 2EM7A 1KYQA 2EM5A 1KJKA 2HC5A 2EOQA 1X49A 2EPLX 2LTRA 1RMDA 2LE2A 2YTNA 1X48A 2L2MA 3ADLA 1QU6A 5A69A 3BIDA 1GTKA 2EOFA 1NEIA 4DV6E 1XNRE 4F9CB 4BHCA 3THNA 1IBME 2JOBA 1N3GA 2WBUA 2M7QA 4BC7A 2MDGA 4J8ZA 2DLKA 4LF8E 3EQ1A 4OOGC 4IS1C 2I9IA 1DQ3A 2J7JA 2EMLA 4LF5E 2UXDE 2RSIA 4DV7E 2YTGA 4R2CA 2CTDA 2IHR1 2YTDA 1JK2A 3LLHA 3VK6A 4NXNE 1AAYA 2EN7A 4X9JA 1GQEA 2GLIA 5AE1A 2B9DA 2V89A 2UUBE 4MLVA 5A6AA 1YSAC 4P78A 3JU0A 4L8NA 2N8XA 4R8OA 5CFFE 2RS6A 1UILA 2EPOA 2B7TA 5AASA 4X62E 1WXRA 1T39A 2LBSB 2EN2A 4L5NC 1T4OA 3ADGA 4Q28A 4JI6E 2RSMA 2DMIA 1WHQA 2L33A 1JK1A 4ZYGA 2EM4A 4DUZE 2NUGA 2L3CA 2E1MA 4RHBB 2EOOA 2MKDA 4JV5E 4DV1E 2EOMA 3IWCA 4M30A 5IXMB 5A2QC 4DUYE 5F3WA 4F9BB 4O5GA 4BS9A 2HGHA 2V86A 3C6MA 5T6JA 2ENHA 2V83A 1DI2A 2NA2A 1A1JA 2L3JA 3KWRA 2LUQA 2EPKX 4KHPE 2NABA 1HR0E 4WYQB 2VQFE 2LCEA 3F6HA 4IJDA 1T4LB 2LRSA 2RTXA 4TUGA 3BF2A 2EPNA 4B3SE 1XNQE 3TQMA 2EPPA 4R2PA 1A1LA 4GKJE 4ZYHA 4P7DA 5IV8B 2EPXA 2EMFA 3HXLA 2EMAA 1UN6B 2YZTA 2M1SA 4BCAA 4JI7E 2YSPA 4DR1E 1ZBQA 2YU5A 2MKNA 4X65E 2UXBE 2VRDA 2RS7A 1PDAA 2YTIA 5KL7A 2YTFA 4DR3E 4JI0E 1N32E 3JAMC 2YT4A 1X3CA 3P1XA 2WZOA 2KONA 1MGTA 2MC5A 2RQLA 2YRMA 4LTYA 1AH5A 3LMLA 3VYXA 3IWDA 2V88A 2EOZA 2L2NA 2FV4B 2JVAA 2N3HA 1XMOE 2EMXA 4DV0E 4R2RA 2DMYA 2YPNA 1J5EE 1A1FA 1X6HA 2FTXB 3ADIA
chains in the Genus database with same CATH topology
2LJUA 2JYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJU A;  2JYA A; 
#chains in the Genus database with same CATH topology
 2JYA A;  1NCS A;  2EJ4 A;  2EPM X;  3MHS C;  3J80 C;  3VHT B;  1WJP A;  5AE3 A;  4NHR A;  2EM8 A;  3T1Y E;  2EOX A;  1YUJ A;  3OML A;  5ADZ A;  1HNZ E;  2VF1 A;  2LUP B;  4GKK E;  2EMB A;  2EM0 A;  2DGC A;  2EOJ A;  3HTX A;  4F9A B;  4OX9 E;  3HPZ A;  1EH7 A;  1L4S A;  4BC9 A;  2YTP A;  2EN8 A;  5KL2 A;  4GEQ B;  2LT7 A;  2YTJ A;  5BR8 E;  4JI5 E;  1X6E A;  1TN9 A;  3BBG A;  4LU9 A;  1SR9 A;  2I13 A;  2K7I A;  4JYA E;  4NZV A;  4WSG A;  2DSY A;  2EN3 A;  2EM3 A;  2CSH A;  4MLQ A;  1UBD C;  4KWY A;  4ZYE A;  5FLX C;  2EMC A;  4R03 A;  4N4R B;  1YYK A;  2WCC 3;  1EH6 A;  4DR7 E;  2V85 A;  4DKK A;  1FJG E;  2EM9 A;  5KL4 A;  2EMH A;  3QG5 C;  1P47 A;  2UUA E;  4K0K E;  1YPN A;  1STU A;  3MSW A;  1PJQ A;  4JI8 E;  2JPA A;  2NUE A;  3HQ1 A;  3UK3 C;  2EMZ A;  3C4B A;  2UU9 E;  3RMP A;  1PJT A;  2YTQ A;  5TSE A;  2JWO A;  2LMZ A;  2E72 A;  2JR1 A;  2VQE E;  2YTO A;  2EOE A;  4M9V C;  3ADJ A;  4WXD A;  5IWA E;  5A6B A;  2ELZ A;  3VYY A;  4LFB E;  4DR4 E;  2EPC A;  5IT9 C;  2YRH A;  4LF4 E;  4FK5 C;  1N36 E;  2YTE A;  1IMU A;  1EKZ A;  2UXC E;  4JI1 E;  4NXM E;  3THO B;  2EN4 A;  2GPI A;  2YU8 A;  2M4I A;  2L6M A;  2DIX A;  3OTO E;  2EPR A;  2D9H A;  4WSP A;  1UHZ A;  2ENC A;  1FKA E;  2UUC E;  4R2S A;  5KL6 A;  3T1H E;  2EOY A;  1SFE A;  2LV2 A;  1RQ0 A;  2ENA A;  2EL5 A;  1T4N A;  1QNT A;  4DV3 E;  1N34 E;  1A1H A;  4YY3 E;  2L2K B;  2CPN A;  1LLM C;  5KL3 A;  1ZAA C;  4JI3 E;  2HHH E;  5A6B D;  3L00 A;  3KZY A;  2YWQ A;  2JOX A;  1A1I A;  3ECR A;  2RPC A;  2E5L E;  2KHX A;  2GHF A;  1ZU1 A;  3AV0 A;  3F6G A;  1IQO A;  2YRK A;  1RC7 A;  4ZYD A;  1HNW E;  2VE7 C;  2B7V A;  2CT1 A;  2EM6 A;  4BMJ A;  5AE2 A;  2F8B A;  2LVH A;  1BBG A;  4DR5 E;  2EPU A;  4DV4 E;  2BBG A;  2F4V E;  3DJW A;  4DMI A;  2FGG A;  4LF9 E;  2A25 A;  3M99 B;  4WXC A;  4JI2 E;  1MEY C;  3KZZ A;  1O0W A;  3J81 C;  4DV5 E;  2EN1 A;  1YUI A;  1X6F A;  3AUZ A;  2EOS A;  2HJJ A;  3C6K A;  4BHB A;  4I8O A;  1WHN A;  2MDR A;  2WBT A;  2EOR A;  2L8T A;  2ODR C;  2EM2 A;  1I94 E;  2EPA A;  3HPS A;  1TF3 A;  2EMI A;  4M2Z A;  3IWB A;  2EZ6 A;  4M0V A;  2PRT A;  2DRP A;  1YYW A;  4YHH E;  4TUI A;  2LTS A;  4O4K A;  2ADR A;  4HTG A;  2ELY A;  2BB8 A;  5LL6 R;  3EPK A;  1PJS A;  2LJH A;  4LFC E;  5A6K A;  1A1G A;  1YYO A;  2EMK A;  2V87 A;  1GZ6 A;  2LO3 A;  3FIG A;  2EWL A;  5LMU E;  2NUF A;  4O24 A;  2DB2 A;  5AC4 A;  4BBY A;  4LF6 E;  1ZR9 A;  3DF6 A;  2ZM6 E;  2EN6 A;  4O43 A;  3EPL A;  2L92 A;  4LF7 E;  4DV2 E;  1XMQ E;  4GZN C;  2DLQ A;  2G7H A;  2V8Q B;  1G2D C;  1EH8 A;  4B3T E;  2N3G A;  5A6J A;  3ZOQ B;  4LFA E;  1F2I G;  1X47 A;  4B3R E;  3EPH A;  2EOH A;  4WFT A;  2R1F A;  2MC6 A;  2EE8 A;  5KL5 A;  1B69 A;  4F54 A;  1DGC A;  1BB8 A;  2EP3 A;  1WRJ A;  2EPZ A;  2JXP A;  2JP9 A;  2Q8U A;  1ZBT A;  4F6M A;  1YFH A;  2EOI A;  4X8W A;  3K6Q A;  4WPY A;  2JY9 A;  3MHH C;  4R2E A;  4AQY E;  2EMG A;  2EQ1 A;  1N33 E;  1J26 A;  4WX9 A;  2LJU A;  2B3T B;  5LMN E;  4RH8 A;  2YSO A;  2EMY A;  1BBO A;  3JTZ A;  1YZ9 A;  3H09 A;  5LLQ A;  1TF6 A;  5DNY A;  1IBK E;  5AC5 A;  1Z1B A;  3J7A G;  3C4T A;  2M9A A;  4R2A A;  2EMW A;  4JI4 E;  1X5W A;  1G2F C;  2KOU A;  3EPJ A;  4DR2 E;  4R2D A;  1T38 A;  2H36 X;  4X66 E;  2ODR D;  3BGH A;  3J7Y p;  4Q35 B;  4X64 E;  1IQS A;  4DR6 E;  2EL4 A;  4KZS A;  1IBL E;  4B3M E;  2EQ3 A;  4HEI A;  2EQ0 A;  1A1K A;  2R76 A;  2EL6 A;  2K4V A;  4F2J C;  4F6N A;  2WBS A;  1PKP A;  1HNX E;  4R2Q A;  2EM7 A;  1KYQ A;  2EM5 A;  1KJK A;  2HC5 A;  2EOQ A;  1X49 A;  2EPL X;  2LTR A;  1RMD A;  2LE2 A;  2YTN A;  1X48 A;  2L2M A;  3ADL A;  1QU6 A;  5A69 A;  3BID A;  1GTK A;  2EOF A;  1NEI A;  4DV6 E;  1XNR E;  4F9C B;  4BHC A;  3THN A;  1IBM E;  2JOB A;  1N3G A;  2WBU A;  2M7Q A;  4BC7 A;  2MDG A;  4J8Z A;  2DLK A;  4LF8 E;  3EQ1 A;  4OOG C;  4IS1 C;  2I9I A;  1DQ3 A;  2J7J A;  2EML A;  4LF5 E;  2UXD E;  2RSI A;  4DV7 E;  2YTG A;  4R2C A;  2CTD A;  2IHR 1;  2YTD A;  1JK2 A;  3LLH A;  3VK6 A;  4NXN E;  1AAY A;  2EN7 A;  4X9J A;  1GQE A;  2GLI A;  5AE1 A;  2B9D A;  2V89 A;  2UUB E;  4MLV A;  5A6A A;  1YSA C;  4P78 A;  3JU0 A;  4L8N A;  2N8X A;  4R8O A;  5CFF E;  2RS6 A;  1UIL A;  2EPO A;  2B7T A;  5AAS A;  4X62 E;  1WXR A;  1T39 A;  2LBS B;  2EN2 A;  4L5N C;  1T4O A;  3ADG A;  4Q28 A;  4JI6 E;  2RSM A;  2DMI A;  1WHQ A;  2L33 A;  1JK1 A;  4ZYG A;  2EM4 A;  4DUZ E;  2NUG A;  2L3C A;  2E1M A;  4RHB B;  2EOO A;  2MKD A;  4JV5 E;  4DV1 E;  2EOM A;  3IWC A;  4M30 A;  5IXM B;  5A2Q C;  4DUY E;  5F3W A;  4F9B B;  4O5G A;  4BS9 A;  2HGH A;  2V86 A;  3C6M A;  5T6J A;  2ENH A;  2V83 A;  1DI2 A;  2NA2 A;  1A1J A;  2L3J A;  3KWR A;  2LUQ A;  2EPK X;  4KHP E;  2NAB A;  1HR0 E;  4WYQ B;  2VQF E;  2LCE A;  3F6H A;  4IJD A;  1T4L B;  2LRS A;  2RTX A;  4TUG A;  3BF2 A;  2EPN A;  4B3S E;  1XNQ E;  3TQM A;  2EPP A;  4R2P A;  1A1L A;  4GKJ E;  4ZYH A;  4P7D A;  5IV8 B;  2EPX A;  2EMF A;  3HXL A;  2EMA A;  1UN6 B;  2YZT A;  2M1S A;  4BCA A;  4JI7 E;  2YSP A;  4DR1 E;  1ZBQ A;  2YU5 A;  2MKN A;  4X65 E;  2UXB E;  2VRD A;  2RS7 A;  1PDA A;  2YTI A;  5KL7 A;  2YTF A;  4DR3 E;  4JI0 E;  1N32 E;  3JAM C;  2YT4 A;  1X3C A;  3P1X A;  2WZO A;  2KON A;  1MGT A;  2MC5 A;  2RQL A;  2YRM A;  4LTY A;  1AH5 A;  3LML A;  3VYX A;  3IWD A;  2V88 A;  2EOZ A;  2L2N A;  2FV4 B;  2JVA A;  2N3H A;  1XMO E;  2EMX A;  4DV0 E;  4R2R A;  2DMY A;  2YPN A;  1J5E E;  1A1F A;  1X6H A;  2FTX B;  3ADI A; 
#chains in the Genus database with same CATH homology
 2LJU A;  2JYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...