2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1810
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2JYAA 2LJUA
chains in the Genus database with same CATH superfamily
4R2SA 3F6GA 2EM3A 2YT4A 4HTGA 4BBYA 1EH6A 3ADGA 2V86A 1EH8A 5LMNE 1TF6A 2N3HA 5AC5A 2YTNA 4ZYGA 3KZZA 1EH7A 2EMIA 2YTPA 3VK6A 3C4BA 5KL5A 3IWDA 2M7QA 4DV1E 1NEIA 2JY9A 3C6KA 4DV5E 4DMIA 2JOBA 2LJUA 2ODRD 1PKPA 5KL3A 1YYWA 1X6FA 1UILA 4GEQB 4DUYE 3HQ1A 5LLQA 2JVAA 2LRSA 3TQMA 4M2ZA 2EN7A 2LE2A 4GKJE 2EOFA 1A1LA 3OTOE 2N8XA 4BMJA 4DV6E 2H36X 2EE8A 2KOUA 5KL6A 5AASA 1FKAE 5A2QC 3JTZA 2M9AA 2GHFA 4J8ZA 2EMGA 4LFCE 1KJKA 2EMWA 5A69A 2WBUA 2N3GA 1ZAAC 4X9JA 4IJDA 2L6MA 3J7Yp 1IQOA 4F9AB 4JI1E 4R2EA 3LMLA 4NZVA 1YUIA 2ENCA 2EOEA 5A6AA 1WHQA 2WCC3 3DJWA 2YTEA 1O0WA 1XMQE 2LCEA 2EQ1A 3P1XA 4BC7A 2YSOA 5IXMB 2RQLA 5IT9C 3HTXA 2L2NA 2L33A 2EOIA 4GZNC 4BS9A 4MLQA 4DV7E 1YUJA 4F54A 4DR3E 2EM7A 2YTDA 4JYAE 4WSGA 3T1HE 3J7AG 2V85A 2RS7A 4K0KE 1UHZA 4I8OA 1Z1BA 4LF4E 2EMKA 4GKKE 1J26A 1ZBQA 1RMDA 2DGCA 1GQEA 4WX9A 2UXDE 1UBDC 2FGGA 2ENHA 1X47A 3AV0A 2YTFA 2UXCE 2VRDA 4WFTA 2R1FA 1IMUA 3MSWA 1X48A 1QU6A 3VHTB 5AE2A 2YZTA 4O43A 4P7DA 3OMLA 4R2QA 2EWLA 4Q28A 3BBGA 2EMBA 1RC7A 4NHRA 4X64E 5KL7A 1PJSA 5IWAE 1X6EA 2CT1A 4LTYA 5AE1A 1IBKE 1N32E 2B3TB 3H09A 2L2KB 1JK2A 2EOHA 1BBGA 2ADRA 2NUFA 5LMUE 4BHBA 3AUZA 2MDRA 2YRMA 1F2IG 4JI5E 2EOYA 3J80C 4TUIA 2DMYA 4YHHE 2WZOA 2V8QB 4JI4E 1A1HA 2GPIA 1L4SA 4NXME 2EPOA 5F3WA 1RQ0A 4MLVA 2UXBE 3LLHA 2KHXA 2ELYA 2GLIA 3DF6A 1YYKA 3ADIA 3C4TA 2EN6A 2EOMA 2EOXA 3MHSC 3THOB 3UK3C 2RPCA 5BR8E 4NXNE 4DV0E 4HEIA 1B69A 2V83A 2E5LE 4DUZE 2Q8UA 1MEYC 2VQEE 4DR7E 1TF3A 2I9IA 2VQFE 3T1YE 4BHCA 1XMOE 2V88A 1I94E 3KWRA 1SFEA 1AAYA 2YRHA 2EPXA 1IBME 1WHNA 3THNA 4KWYA 3VYYA 3JU0A 5AC4A 1A1KA 3EPJA 2V89A 4F6MA 2F4VE 4WSPA 1HNZE 4KHPE 2DLKA 3IWCA 4JI0E 2DRPA 2EPRA 3EPKA 2V87A 4F9CB 2VE7C 2JOXA 1XNQE 2EMYA 4JI6E 4DR6E 2JPAA 2YTQA 2L3JA 3JAMC 1T39A 1DI2A 3C6MA 2KONA 1ZR9A 1T4OA 2L92A 2HGHA 1DGCA 1QNTA 2EQ0A 3KZYA 5FLXC 3HPSA 2MC5A 3IWBA 5A6JA 4DV4E 4DR5E 2EPLX 2EQ3A 2M1SA 2ZM6E 3ZOQB 2CSHA 4BCAA 1GZ6A 1STUA 2DB2A 2CTDA 3BF2A 1N34E 2HJJA 2NABA 1WJPA 2EM6A 2I13A 2LUPB 2EM5A 2VF1A 2RTXA 5ADZA 2YRKA 2F8BA 3EPLA 4X8WA 3FIGA 2D9HA 4JV5E 1PJTA 5A6BD 4JI3E 2YTGA 2MC6A 2WBTA 3HXLA 2EN2A 2RSMA 1N33E 4OOGC 2DMIA 2WBSA 1T38A 2EPPA 2LMZA 2UUBE 2UUAE 4ZYDA 2EN4A 4L8NA 4LFBE 1YPNA 1BBOA 2LJHA 2EOOA 4DKKA 4R03A 1MGTA 2NUGA 4R2PA 1X6HA 2EOQA 4Q35B 4OX9E 1KYQA 2EPCA 1JK1A 1HNXE 1EKZA 2BB8A 4ZYEA 2EPAA 2DLQA 2M4IA 1N36E 2B9DA 4R2AA 3ADJA 4JI7E 4R2RA 4F6NA 4R8OA 4AQYE 2DIXA 1A1IA 2L2MA 4WYQB 3EPHA 1ZU1A 4O24A 4B3ME 2EN1A 4YY3E 4FK5C 4DR4E 1IQSA 4X65E 2YTIA 4ZYHA 2EMHA 1G2DC 1X49A 3MHHC 3F6HA 2UU9E 2JP9A 4LF6E 4X62E 1LLMC 4DV2E 2EOSA 1DQ3A 2CPNA 1XNRE 4BC9A 4WXCA 1IBLE 2A25A 4LU9A 1HNWE 2EOJA 4DR2E 2FV4B 1TN9A 5CFFE 4P78A 5T6JA 2LBSB 2RS6A 1X5WA 2YTOA 2JR1A 2LUQA 4F2JC 2K7IA 3M99B 2EZ6A 2EPZA 4LF5E 4LFAE 1HR0E 4DR1E 3BGHA 5KL4A 2EMCA 2R76A 2ELZA 1YZ9A 4WPYA 1UN6B 2E1MA 2JWOA 2J7JA 2LTSA 2YU8A 2L3CA 5IV8B 2RSIA 2JXPA 4JI2E 2LO3A 3QG5C 1A1GA 4M9VC 2YU5A 4RHBB 4B3SE 4X66E 2E72A 1YYOA 2EM8A 1GTKA 2EMAA 4IS1C 2K4VA 1A1JA 4LF9E 2EOZA 3J81C 2EL4A 5KL2A 5A6BA 2LV2A 3VYXA 3ADLA 5TSEA 2B7VA 1NCSA 3ECRA 4M0VA 2LTRA 4O4KA 4RH8A 4LF8E 2NA2A 2EL5A 2YTJA 2EL6A 2EMLA 1J5EE 4LF7E 1PDAA 5A6KA 1ZBTA 1BB8A 2ODRC 2JYAA 2G7HA 1WXRA 2EN3A 3EQ1A 4R2DA 2EJ4A 1G2FC 1YFHA 2FTXB 1P47A 1A1FA 4TUGA 2HC5A 2MKDA 3K6QA 2EMFA 2B7TA 2YPNA 2UUCE 2EORA 1T4NA 1N3GA 4M30A 2EPNA 2MDGA 1X3CA 3BIDA 2BBGA 2EM4A 2EMXA 4O5GA 5DNYA 1FJGE 4F9BB 1YSAC 2EM9A 4N4RB 3L00A 4WXDA 3RMPA 2EN8A 2NUEA 4JI8E 5LL6R 2LVHA 2LT7A 5AE3A 1PJQA 2PRTA 4B3TE 2ENAA 2YWQA 3HPZA 2EP3A 4DV3E 1WRJA 4R2CA 2EM2A 2EPMX 2EPUA 4B3RE 2DSYA 1T4LB 2YSPA 4KZSA 2MKNA 1AH5A 4L5NC 2EM0A 2L8TA 2EPKX 1SR9A 2HHHE 2IHR1 2EMZA
chains in the Genus database with same CATH topology
2JYAA 2LJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYA A;  2LJU A; 
#chains in the Genus database with same CATH topology
 4R2S A;  3F6G A;  2EM3 A;  2YT4 A;  4HTG A;  4BBY A;  1EH6 A;  3ADG A;  2V86 A;  1EH8 A;  5LMN E;  1TF6 A;  2N3H A;  5AC5 A;  2YTN A;  4ZYG A;  3KZZ A;  1EH7 A;  2EMI A;  2YTP A;  3VK6 A;  3C4B A;  5KL5 A;  3IWD A;  2M7Q A;  4DV1 E;  1NEI A;  2JY9 A;  3C6K A;  4DV5 E;  4DMI A;  2JOB A;  2LJU A;  2ODR D;  1PKP A;  5KL3 A;  1YYW A;  1X6F A;  1UIL A;  4GEQ B;  4DUY E;  3HQ1 A;  5LLQ A;  2JVA A;  2LRS A;  3TQM A;  4M2Z A;  2EN7 A;  2LE2 A;  4GKJ E;  2EOF A;  1A1L A;  3OTO E;  2N8X A;  4BMJ A;  4DV6 E;  2H36 X;  2EE8 A;  2KOU A;  5KL6 A;  5AAS A;  1FKA E;  5A2Q C;  3JTZ A;  2M9A A;  2GHF A;  4J8Z A;  2EMG A;  4LFC E;  1KJK A;  2EMW A;  5A69 A;  2WBU A;  2N3G A;  1ZAA C;  4X9J A;  4IJD A;  2L6M A;  3J7Y p;  1IQO A;  4F9A B;  4JI1 E;  4R2E A;  3LML A;  4NZV A;  1YUI A;  2ENC A;  2EOE A;  5A6A A;  1WHQ A;  2WCC 3;  3DJW A;  2YTE A;  1O0W A;  1XMQ E;  2LCE A;  2EQ1 A;  3P1X A;  4BC7 A;  2YSO A;  5IXM B;  2RQL A;  5IT9 C;  3HTX A;  2L2N A;  2L33 A;  2EOI A;  4GZN C;  4BS9 A;  4MLQ A;  4DV7 E;  1YUJ A;  4F54 A;  4DR3 E;  2EM7 A;  2YTD A;  4JYA E;  4WSG A;  3T1H E;  3J7A G;  2V85 A;  2RS7 A;  4K0K E;  1UHZ A;  4I8O A;  1Z1B A;  4LF4 E;  2EMK A;  4GKK E;  1J26 A;  1ZBQ A;  1RMD A;  2DGC A;  1GQE A;  4WX9 A;  2UXD E;  1UBD C;  2FGG A;  2ENH A;  1X47 A;  3AV0 A;  2YTF A;  2UXC E;  2VRD A;  4WFT A;  2R1F A;  1IMU A;  3MSW A;  1X48 A;  1QU6 A;  3VHT B;  5AE2 A;  2YZT A;  4O43 A;  4P7D A;  3OML A;  4R2Q A;  2EWL A;  4Q28 A;  3BBG A;  2EMB A;  1RC7 A;  4NHR A;  4X64 E;  5KL7 A;  1PJS A;  5IWA E;  1X6E A;  2CT1 A;  4LTY A;  5AE1 A;  1IBK E;  1N32 E;  2B3T B;  3H09 A;  2L2K B;  1JK2 A;  2EOH A;  1BBG A;  2ADR A;  2NUF A;  5LMU E;  4BHB A;  3AUZ A;  2MDR A;  2YRM A;  1F2I G;  4JI5 E;  2EOY A;  3J80 C;  4TUI A;  2DMY A;  4YHH E;  2WZO A;  2V8Q B;  4JI4 E;  1A1H A;  2GPI A;  1L4S A;  4NXM E;  2EPO A;  5F3W A;  1RQ0 A;  4MLV A;  2UXB E;  3LLH A;  2KHX A;  2ELY A;  2GLI A;  3DF6 A;  1YYK A;  3ADI A;  3C4T A;  2EN6 A;  2EOM A;  2EOX A;  3MHS C;  3THO B;  3UK3 C;  2RPC A;  5BR8 E;  4NXN E;  4DV0 E;  4HEI A;  1B69 A;  2V83 A;  2E5L E;  4DUZ E;  2Q8U A;  1MEY C;  2VQE E;  4DR7 E;  1TF3 A;  2I9I A;  2VQF E;  3T1Y E;  4BHC A;  1XMO E;  2V88 A;  1I94 E;  3KWR A;  1SFE A;  1AAY A;  2YRH A;  2EPX A;  1IBM E;  1WHN A;  3THN A;  4KWY A;  3VYY A;  3JU0 A;  5AC4 A;  1A1K A;  3EPJ A;  2V89 A;  4F6M A;  2F4V E;  4WSP A;  1HNZ E;  4KHP E;  2DLK A;  3IWC A;  4JI0 E;  2DRP A;  2EPR A;  3EPK A;  2V87 A;  4F9C B;  2VE7 C;  2JOX A;  1XNQ E;  2EMY A;  4JI6 E;  4DR6 E;  2JPA A;  2YTQ A;  2L3J A;  3JAM C;  1T39 A;  1DI2 A;  3C6M A;  2KON A;  1ZR9 A;  1T4O A;  2L92 A;  2HGH A;  1DGC A;  1QNT A;  2EQ0 A;  3KZY A;  5FLX C;  3HPS A;  2MC5 A;  3IWB A;  5A6J A;  4DV4 E;  4DR5 E;  2EPL X;  2EQ3 A;  2M1S A;  2ZM6 E;  3ZOQ B;  2CSH A;  4BCA A;  1GZ6 A;  1STU A;  2DB2 A;  2CTD A;  3BF2 A;  1N34 E;  2HJJ A;  2NAB A;  1WJP A;  2EM6 A;  2I13 A;  2LUP B;  2EM5 A;  2VF1 A;  2RTX A;  5ADZ A;  2YRK A;  2F8B A;  3EPL A;  4X8W A;  3FIG A;  2D9H A;  4JV5 E;  1PJT A;  5A6B D;  4JI3 E;  2YTG A;  2MC6 A;  2WBT A;  3HXL A;  2EN2 A;  2RSM A;  1N33 E;  4OOG C;  2DMI A;  2WBS A;  1T38 A;  2EPP A;  2LMZ A;  2UUB E;  2UUA E;  4ZYD A;  2EN4 A;  4L8N A;  4LFB E;  1YPN A;  1BBO A;  2LJH A;  2EOO A;  4DKK A;  4R03 A;  1MGT A;  2NUG A;  4R2P A;  1X6H A;  2EOQ A;  4Q35 B;  4OX9 E;  1KYQ A;  2EPC A;  1JK1 A;  1HNX E;  1EKZ A;  2BB8 A;  4ZYE A;  2EPA A;  2DLQ A;  2M4I A;  1N36 E;  2B9D A;  4R2A A;  3ADJ A;  4JI7 E;  4R2R A;  4F6N A;  4R8O A;  4AQY E;  2DIX A;  1A1I A;  2L2M A;  4WYQ B;  3EPH A;  1ZU1 A;  4O24 A;  4B3M E;  2EN1 A;  4YY3 E;  4FK5 C;  4DR4 E;  1IQS A;  4X65 E;  2YTI A;  4ZYH A;  2EMH A;  1G2D C;  1X49 A;  3MHH C;  3F6H A;  2UU9 E;  2JP9 A;  4LF6 E;  4X62 E;  1LLM C;  4DV2 E;  2EOS A;  1DQ3 A;  2CPN A;  1XNR E;  4BC9 A;  4WXC A;  1IBL E;  2A25 A;  4LU9 A;  1HNW E;  2EOJ A;  4DR2 E;  2FV4 B;  1TN9 A;  5CFF E;  4P78 A;  5T6J A;  2LBS B;  2RS6 A;  1X5W A;  2YTO A;  2JR1 A;  2LUQ A;  4F2J C;  2K7I A;  3M99 B;  2EZ6 A;  2EPZ A;  4LF5 E;  4LFA E;  1HR0 E;  4DR1 E;  3BGH A;  5KL4 A;  2EMC A;  2R76 A;  2ELZ A;  1YZ9 A;  4WPY A;  1UN6 B;  2E1M A;  2JWO A;  2J7J A;  2LTS A;  2YU8 A;  2L3C A;  5IV8 B;  2RSI A;  2JXP A;  4JI2 E;  2LO3 A;  3QG5 C;  1A1G A;  4M9V C;  2YU5 A;  4RHB B;  4B3S E;  4X66 E;  2E72 A;  1YYO A;  2EM8 A;  1GTK A;  2EMA A;  4IS1 C;  2K4V A;  1A1J A;  4LF9 E;  2EOZ A;  3J81 C;  2EL4 A;  5KL2 A;  5A6B A;  2LV2 A;  3VYX A;  3ADL A;  5TSE A;  2B7V A;  1NCS A;  3ECR A;  4M0V A;  2LTR A;  4O4K A;  4RH8 A;  4LF8 E;  2NA2 A;  2EL5 A;  2YTJ A;  2EL6 A;  2EML A;  1J5E E;  4LF7 E;  1PDA A;  5A6K A;  1ZBT A;  1BB8 A;  2ODR C;  2JYA A;  2G7H A;  1WXR A;  2EN3 A;  3EQ1 A;  4R2D A;  2EJ4 A;  1G2F C;  1YFH A;  2FTX B;  1P47 A;  1A1F A;  4TUG A;  2HC5 A;  2MKD A;  3K6Q A;  2EMF A;  2B7T A;  2YPN A;  2UUC E;  2EOR A;  1T4N A;  1N3G A;  4M30 A;  2EPN A;  2MDG A;  1X3C A;  3BID A;  2BBG A;  2EM4 A;  2EMX A;  4O5G A;  5DNY A;  1FJG E;  4F9B B;  1YSA C;  2EM9 A;  4N4R B;  3L00 A;  4WXD A;  3RMP A;  2EN8 A;  2NUE A;  4JI8 E;  5LL6 R;  2LVH A;  2LT7 A;  5AE3 A;  1PJQ A;  2PRT A;  4B3T E;  2ENA A;  2YWQ A;  3HPZ A;  2EP3 A;  4DV3 E;  1WRJ A;  4R2C A;  2EM2 A;  2EPM X;  2EPU A;  4B3R E;  2DSY A;  1T4L B;  2YSP A;  4KZS A;  2MKN A;  1AH5 A;  4L5N C;  2EM0 A;  2L8T A;  2EPK X;  1SR9 A;  2HHH E;  2IHR 1;  2EMZ A; 
#chains in the Genus database with same CATH homology
 2JYA A;  2LJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...