2JYAA

Nmr solution structure of protein atu1810 from agrobacterium tumefaciens. northeast structural genomics consortium target atr23, ontario centre for structural proteomics target atc1776
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1810
publication title Solution structure of protein ATU1810 form Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2jyaA00
2LJUA 2JYAA
chains in the Genus database with same CATH superfamily
1GTKA 3IWBA 2DLQA 3J80C 3JTZA 5TSEA 2EMZA 2V8QB 3ZOQB 2NUFA 2EJ4A 5KL6A 2EPXA 2LMZA 4LF7E 2YPNA 1UHZA 3VYYA 2RS7A 5BR8E 4R2SA 4RH8A 2ELYA 2GLIA 2CT1A 2KOUA 4F6MA 3QG5C 3BGHA 2HJJA 1X3CA 2EMWA 4DR5E 2JOXA 2V86A 3UK3C 2YTFA 1GZ6A 1X6HA 5LLQA 2HGHA 3ECRA 4K0KE 2EM5A 2MKNA 3EQ1A 2R76A 3F6HA 5AC4A 1DGCA 2HHHE 2RSIA 4IJDA 4KWYA 5A6BA 2ADRA 2DB2A 4F2JC 2EOHA 4O24A 2UU9E 4X65E 4R2RA 3VHTB 2ODRC 2LJHA 2EQ1A 2V88A 1EKZA 1LLMC 2E5LE 2ELZA 3THNA 2YSOA 5T6JA 1N3GA 2NUGA 1RC7A 4DR1E 1MGTA 4BHCA 2B9DA 4ZYHA 1TN9A 2PRTA 4GKKE 2EL6A 2L2NA 2Q8UA 3VYXA 2EN1A 2YT4A 4MLQA 2EPZA 4JI7E 2VE7C 2JYAA 4ZYDA 1N32E 2MC5A 4DR6E 2EL5A 4KHPE 2V89A 3MHHC 2M4IA 5IT9C 4LF4E 4R2QA 1YPNA 4P78A 1X5WA 1X6EA 2YZTA 4GEQB 1BBGA 2EN3A 2DSYA 3BBGA 2B7VA 5FLXC 2BBGA 4ZYGA 2L2MA 5LMUE 5AE2A 3J81C 2M9AA 2RTXA 2EL4A 3L00A 4B3TE 2HC5A 3F6GA 2EMBA 4R2CA 2EOJA 4YY3E 2BB8A 4M9VC 5F3WA 2JPAA 1WHNA 3VK6A 4HEIA 2ENAA 2NABA 4DV7E 2EN8A 5DNYA 4X62E 4LF6E 1PJTA 4L8NA 2LVHA 2YU8A 1YYOA 2EOZA 4F6NA 4LFAE 1DQ3A 2I13A 1UBDC 2LO3A 1T4NA 4DV4E 2ENHA 2VF1A 4JI4E 2LCEA 1SFEA 1YSAC 2RQLA 1B69A 2EMYA 5LMNE 2YTDA 1YUJA 2EOIA 2FTXB 4X8WA 1A1KA 1NCSA 3C6KA 4JI8E 2EN4A 4DUYE 2EMLA 3OMLA 4NXNE 1UN6B 2DMIA 4NZVA 3DJWA 2EOOA 2EN6A 4DV1E 2EP3A 2EPMX 4LFCE 3C4BA 3HTXA 1PJSA 2YTOA 2YTNA 2N3GA 4AQYE 1WXRA 2D9HA 2EMAA 3M99B 2EMIA 2NA2A 3HPSA 4WSPA 3HQ1A 4BBYA 3T1HE 2YTGA 4X66E 1HNXE 4DV5E 2EOYA 1KYQA 1O0WA 4I8OA 2R1FA 2UXBE 4R03A 1IBLE 2YTQA 3IWDA 4M0VA 2EN7A 4MLVA 3DF6A 4R2PA 2WZOA 1ZR9A 4NHRA 4R8OA 5KL4A 1T4OA 1YYKA 2F4VE 2N3HA 2N8XA 2F8BA 2RSMA 1SR9A 4DUZE 2EM0A 2EM4A 2M7QA 1PKPA 2EPPA 4O43A 4X64E 5KL3A 2A25A 5A69A 2JWOA 5KL7A 2L8TA 1Z1BA 2DGCA 2YWQA 2KHXA 1N36E 4Q35B 4B3RE 4LF5E 2CTDA 2MKDA 1XMOE 1TF3A 1FJGE 5A6JA 2YU5A 1EH7A 1X47A 1HNWE 2EQ3A 2JXPA 4B3ME 2K4VA 2LUQA 3ADIA 2YRKA 4F9BB 2EPUA 4BS9A 3C4TA 1T38A 2B3TB 1QU6A 2GHFA 1X6FA 2YTJA 5AE3A 2UUBE 1PDAA 2EM6A 2ENCA 2M1SA 2EOXA 1HNZE 4DMIA 4YHHE 2L2KB 1XMQE 2LT7A 1WHQA 2EOMA 2EPOA 2EMFA 5KL5A 3HXLA 4L5NC 4TUGA 5IXMB 1J26A 4HTGA 2JP9A 4DR7E 4ZYEA 5CFFE 1N33E 5AASA 5A2QC 5KL2A 4X9JA 2MC6A 1MEYC 2UXDE 2EPCA 4BC7A 4LF8E 3J7Yp 3THOB 4WXDA 2UXCE 1N34E 4BHBA 1STUA 4LTYA 4LFBE 2FV4B 2L6MA 2EPNA 1A1FA 3KZZA 3JAMC 4RHBB 5AE1A 2RS6A 1TF6A 1EH6A 2EORA 1A1JA 1YUIA 1YZ9A 4JI5E 4KZSA 1EH8A 2EMXA 3ADJA 2WBSA 3EPKA 1L4SA 3TQMA 5A6AA 1ZBTA 1GQEA 4BC9A 4DV0E 1G2DC 3MHSC 2DLKA 2JVAA 3AV0A 1JK1A 4OX9E 2FGGA 1IQSA 2EPKX 3IWCA 2VQEE 4R2AA 4JI1E 2EM9A 1AAYA 1ZBQA 2YRHA 1RQ0A 4JI0E 1A1GA 2EPAA 2WCC3 2EN2A 4NXME 5IWAE 3FIGA 3H09A 2LUPB 1A1IA 2EPLX 1T39A 3HPZA 3J7AG 4WSGA 4LF9E 5LL6R 4BMJA 1NEIA 1J5EE 4R2DA 4WPYA 1FKAE 1ZU1A 2V87A 2V83A 5A6BD 4O4KA 4DR2E 1P47A 2DMYA 3OTOE 2CPNA 2EOQA 2B7TA 1I94E 2LJUA 4JI2E 2LE2A 2ODRD 3P1XA 4DV3E 2DRPA 2L3JA 4F9CB 4DV2E 4WFTA 4DR3E 1IBKE 2LBSB 1X48A 1KJKA 2MDGA 1RMDA 1JK2A 2YRMA 1IMUA 1T4LB 3BIDA 3LMLA 4IS1C 1QNTA 2KONA 2DIXA 3JU0A 1BB8A 2EM3A 4JI6E 3KZYA 1DI2A 2WBTA 5IV8B 2EWLA 2EM8A 1G2FC 3KWRA 4R2EA 4LU9A 2K7IA 4Q28A 2EMHA 4WX9A 2E1MA 1XNRE 2J7JA 2YSPA 1WRJA 2EM2A 3RMPA 2V85A 2NUEA 1A1HA 1ZAAC 1AH5A 4J8ZA 2GPIA 4F9AB 4JYAE 4WYQB 1PJQA 3AUZA 4TUIA 4DKKA 2LV2A 2L92A 4N4RB 2CSHA 2L33A 2UUAE 2MDRA 5ADZA 2WBUA 3C6MA 1YFHA 1F2IG 4GKJE 2EOSA 2H36X 3T1YE 2JR1A 3K6QA 2EPRA 2YTIA 4F54A 1WJPA 2E72A 1X49A 2JOBA 1HR0E 2LTRA 2UUCE 3EPHA 2EMKA 4DV6E 2EOEA 4DR4E 3BF2A 2EZ6A 2LTSA 2EQ0A 2VQFE 2EE8A 5AC5A 2LRSA 3EPJA 2YTEA 4WXCA 1UILA 2L3CA 4M2ZA 1YYWA 2G7HA 2RPCA 1A1LA 1BBOA 2VRDA 2EMCA 4GZNC 3MSWA 4BCAA 1XNQE 3EPLA 4O5GA 1IBME 4M30A 4JV5E 3LLHA 4FK5C 3ADLA 1IQOA 4P7DA 2EM7A 2IHR1 2I9IA 2EOFA 2YTPA 4B3SE 4OOGC 2EMGA 2JY9A 2ZM6E 3ADGA 4JI3E 5A6KA
chains in the Genus database with same CATH topology
2LJUA 2JYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJU A;  2JYA A; 
#chains in the Genus database with same CATH topology
 1GTK A;  3IWB A;  2DLQ A;  3J80 C;  3JTZ A;  5TSE A;  2EMZ A;  2V8Q B;  3ZOQ B;  2NUF A;  2EJ4 A;  5KL6 A;  2EPX A;  2LMZ A;  4LF7 E;  2YPN A;  1UHZ A;  3VYY A;  2RS7 A;  5BR8 E;  4R2S A;  4RH8 A;  2ELY A;  2GLI A;  2CT1 A;  2KOU A;  4F6M A;  3QG5 C;  3BGH A;  2HJJ A;  1X3C A;  2EMW A;  4DR5 E;  2JOX A;  2V86 A;  3UK3 C;  2YTF A;  1GZ6 A;  1X6H A;  5LLQ A;  2HGH A;  3ECR A;  4K0K E;  2EM5 A;  2MKN A;  3EQ1 A;  2R76 A;  3F6H A;  5AC4 A;  1DGC A;  2HHH E;  2RSI A;  4IJD A;  4KWY A;  5A6B A;  2ADR A;  2DB2 A;  4F2J C;  2EOH A;  4O24 A;  2UU9 E;  4X65 E;  4R2R A;  3VHT B;  2ODR C;  2LJH A;  2EQ1 A;  2V88 A;  1EKZ A;  1LLM C;  2E5L E;  2ELZ A;  3THN A;  2YSO A;  5T6J A;  1N3G A;  2NUG A;  1RC7 A;  4DR1 E;  1MGT A;  4BHC A;  2B9D A;  4ZYH A;  1TN9 A;  2PRT A;  4GKK E;  2EL6 A;  2L2N A;  2Q8U A;  3VYX A;  2EN1 A;  2YT4 A;  4MLQ A;  2EPZ A;  4JI7 E;  2VE7 C;  2JYA A;  4ZYD A;  1N32 E;  2MC5 A;  4DR6 E;  2EL5 A;  4KHP E;  2V89 A;  3MHH C;  2M4I A;  5IT9 C;  4LF4 E;  4R2Q A;  1YPN A;  4P78 A;  1X5W A;  1X6E A;  2YZT A;  4GEQ B;  1BBG A;  2EN3 A;  2DSY A;  3BBG A;  2B7V A;  5FLX C;  2BBG A;  4ZYG A;  2L2M A;  5LMU E;  5AE2 A;  3J81 C;  2M9A A;  2RTX A;  2EL4 A;  3L00 A;  4B3T E;  2HC5 A;  3F6G A;  2EMB A;  4R2C A;  2EOJ A;  4YY3 E;  2BB8 A;  4M9V C;  5F3W A;  2JPA A;  1WHN A;  3VK6 A;  4HEI A;  2ENA A;  2NAB A;  4DV7 E;  2EN8 A;  5DNY A;  4X62 E;  4LF6 E;  1PJT A;  4L8N A;  2LVH A;  2YU8 A;  1YYO A;  2EOZ A;  4F6N A;  4LFA E;  1DQ3 A;  2I13 A;  1UBD C;  2LO3 A;  1T4N A;  4DV4 E;  2ENH A;  2VF1 A;  4JI4 E;  2LCE A;  1SFE A;  1YSA C;  2RQL A;  1B69 A;  2EMY A;  5LMN E;  2YTD A;  1YUJ A;  2EOI A;  2FTX B;  4X8W A;  1A1K A;  1NCS A;  3C6K A;  4JI8 E;  2EN4 A;  4DUY E;  2EML A;  3OML A;  4NXN E;  1UN6 B;  2DMI A;  4NZV A;  3DJW A;  2EOO A;  2EN6 A;  4DV1 E;  2EP3 A;  2EPM X;  4LFC E;  3C4B A;  3HTX A;  1PJS A;  2YTO A;  2YTN A;  2N3G A;  4AQY E;  1WXR A;  2D9H A;  2EMA A;  3M99 B;  2EMI A;  2NA2 A;  3HPS A;  4WSP A;  3HQ1 A;  4BBY A;  3T1H E;  2YTG A;  4X66 E;  1HNX E;  4DV5 E;  2EOY A;  1KYQ A;  1O0W A;  4I8O A;  2R1F A;  2UXB E;  4R03 A;  1IBL E;  2YTQ A;  3IWD A;  4M0V A;  2EN7 A;  4MLV A;  3DF6 A;  4R2P A;  2WZO A;  1ZR9 A;  4NHR A;  4R8O A;  5KL4 A;  1T4O A;  1YYK A;  2F4V E;  2N3H A;  2N8X A;  2F8B A;  2RSM A;  1SR9 A;  4DUZ E;  2EM0 A;  2EM4 A;  2M7Q A;  1PKP A;  2EPP A;  4O43 A;  4X64 E;  5KL3 A;  2A25 A;  5A69 A;  2JWO A;  5KL7 A;  2L8T A;  1Z1B A;  2DGC A;  2YWQ A;  2KHX A;  1N36 E;  4Q35 B;  4B3R E;  4LF5 E;  2CTD A;  2MKD A;  1XMO E;  1TF3 A;  1FJG E;  5A6J A;  2YU5 A;  1EH7 A;  1X47 A;  1HNW E;  2EQ3 A;  2JXP A;  4B3M E;  2K4V A;  2LUQ A;  3ADI A;  2YRK A;  4F9B B;  2EPU A;  4BS9 A;  3C4T A;  1T38 A;  2B3T B;  1QU6 A;  2GHF A;  1X6F A;  2YTJ A;  5AE3 A;  2UUB E;  1PDA A;  2EM6 A;  2ENC A;  2M1S A;  2EOX A;  1HNZ E;  4DMI A;  4YHH E;  2L2K B;  1XMQ E;  2LT7 A;  1WHQ A;  2EOM A;  2EPO A;  2EMF A;  5KL5 A;  3HXL A;  4L5N C;  4TUG A;  5IXM B;  1J26 A;  4HTG A;  2JP9 A;  4DR7 E;  4ZYE A;  5CFF E;  1N33 E;  5AAS A;  5A2Q C;  5KL2 A;  4X9J A;  2MC6 A;  1MEY C;  2UXD E;  2EPC A;  4BC7 A;  4LF8 E;  3J7Y p;  3THO B;  4WXD A;  2UXC E;  1N34 E;  4BHB A;  1STU A;  4LTY A;  4LFB E;  2FV4 B;  2L6M A;  2EPN A;  1A1F A;  3KZZ A;  3JAM C;  4RHB B;  5AE1 A;  2RS6 A;  1TF6 A;  1EH6 A;  2EOR A;  1A1J A;  1YUI A;  1YZ9 A;  4JI5 E;  4KZS A;  1EH8 A;  2EMX A;  3ADJ A;  2WBS A;  3EPK A;  1L4S A;  3TQM A;  5A6A A;  1ZBT A;  1GQE A;  4BC9 A;  4DV0 E;  1G2D C;  3MHS C;  2DLK A;  2JVA A;  3AV0 A;  1JK1 A;  4OX9 E;  2FGG A;  1IQS A;  2EPK X;  3IWC A;  2VQE E;  4R2A A;  4JI1 E;  2EM9 A;  1AAY A;  1ZBQ A;  2YRH A;  1RQ0 A;  4JI0 E;  1A1G A;  2EPA A;  2WCC 3;  2EN2 A;  4NXM E;  5IWA E;  3FIG A;  3H09 A;  2LUP B;  1A1I A;  2EPL X;  1T39 A;  3HPZ A;  3J7A G;  4WSG A;  4LF9 E;  5LL6 R;  4BMJ A;  1NEI A;  1J5E E;  4R2D A;  4WPY A;  1FKA E;  1ZU1 A;  2V87 A;  2V83 A;  5A6B D;  4O4K A;  4DR2 E;  1P47 A;  2DMY A;  3OTO E;  2CPN A;  2EOQ A;  2B7T A;  1I94 E;  2LJU A;  4JI2 E;  2LE2 A;  2ODR D;  3P1X A;  4DV3 E;  2DRP A;  2L3J A;  4F9C B;  4DV2 E;  4WFT A;  4DR3 E;  1IBK E;  2LBS B;  1X48 A;  1KJK A;  2MDG A;  1RMD A;  1JK2 A;  2YRM A;  1IMU A;  1T4L B;  3BID A;  3LML A;  4IS1 C;  1QNT A;  2KON A;  2DIX A;  3JU0 A;  1BB8 A;  2EM3 A;  4JI6 E;  3KZY A;  1DI2 A;  2WBT A;  5IV8 B;  2EWL A;  2EM8 A;  1G2F C;  3KWR A;  4R2E A;  4LU9 A;  2K7I A;  4Q28 A;  2EMH A;  4WX9 A;  2E1M A;  1XNR E;  2J7J A;  2YSP A;  1WRJ A;  2EM2 A;  3RMP A;  2V85 A;  2NUE A;  1A1H A;  1ZAA C;  1AH5 A;  4J8Z A;  2GPI A;  4F9A B;  4JYA E;  4WYQ B;  1PJQ A;  3AUZ A;  4TUI A;  4DKK A;  2LV2 A;  2L92 A;  4N4R B;  2CSH A;  2L33 A;  2UUA E;  2MDR A;  5ADZ A;  2WBU A;  3C6M A;  1YFH A;  1F2I G;  4GKJ E;  2EOS A;  2H36 X;  3T1Y E;  2JR1 A;  3K6Q A;  2EPR A;  2YTI A;  4F54 A;  1WJP A;  2E72 A;  1X49 A;  2JOB A;  1HR0 E;  2LTR A;  2UUC E;  3EPH A;  2EMK A;  4DV6 E;  2EOE A;  4DR4 E;  3BF2 A;  2EZ6 A;  2LTS A;  2EQ0 A;  2VQF E;  2EE8 A;  5AC5 A;  2LRS A;  3EPJ A;  2YTE A;  4WXC A;  1UIL A;  2L3C A;  4M2Z A;  1YYW A;  2G7H A;  2RPC A;  1A1L A;  1BBO A;  2VRD A;  2EMC A;  4GZN C;  3MSW A;  4BCA A;  1XNQ E;  3EPL A;  4O5G A;  1IBM E;  4M30 A;  4JV5 E;  3LLH A;  4FK5 C;  3ADL A;  1IQO A;  4P7D A;  2EM7 A;  2IHR 1;  2I9I A;  2EOF A;  2YTP A;  4B3S E;  4OOG C;  2EMG A;  2JY9 A;  2ZM6 E;  3ADG A;  4JI3 E;  5A6K A; 
#chains in the Genus database with same CATH homology
 2LJU A;  2JYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...