2B9DA

Crystal structure of hpv e7 cr3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E7 protein
publication title Structure of the human Papillomavirus E7 oncoprotein and its mechanism for inactivation of the retinoblastoma tumor suppressor.
pubmed doi rcsb
source organism Human papillomavirus type 1a
molecule tags Transcription, viral protein
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.330 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b9dA01
2B9DA
chains in the Genus database with same CATH superfamily
4AQYE 4N4RB 2DLKA 3C4TA 4F9AB 1GZ6A 2K7IA 2EN3A 4I8OA 4M0VA 5KL4A 4DR3E 1N34E 4DR6E 4KZSA 2EOXA 2EOIA 3THOB 2EPKX 4F6NA 4DR4E 2YPNA 5FLXC 3VK6A 5IWAE 4WSGA 4M9VC 4R2RA 3T1YE 4P7DA 2WBTA 1P47A 4DR7E 2JR1A 2EN7A 2B7TA 2CPNA 2EN8A 2KONA 2LO3A 3BIDA 2JPAA 2MKDA 1UILA 2UUBE 3OTOE 2EWLA 2EE8A 4R2CA 1EKZA 2DLQA 2LVHA 4DR2E 5T6JA 4NZVA 3RMPA 2GLIA 4O4KA 2EN2A 4DV0E 2LBSB 4LTYA 2MDRA 2RSIA 3ZOQB 2EOFA 2V87A 3KZYA 4YY3E 2YSOA 5AE1A 3JAMC 4B3ME 4KWYA 2JY9A 2EL4A 4HEIA 2HHHE 1DQ3A 4NXNE 4JI4E 2K4VA 1Z1BA 1DI2A 4Q35B 4GKJE 2L92A 2VQFE 2EOMA 4TUIA 1N36E 3ADIA 3M99B 3F6HA 4R2PA 1N33E 2KHXA 4BCAA 1X6FA 2V89A 2YT4A 4JI2E 1T39A 1O0WA 2EM0A 2JYAA 2EM9A 1AH5A 2RQLA 5KL6A 4R2EA 4LF7E 4LF9E 2EPUA 2Q8UA 4DV1E 3AUZA 5LL6R 1A1HA 2EOHA 3HPSA 2EMBA 5KL2A 3HXLA 3KWRA 2LV2A 1WHQA 1X6EA 3BBGA 5ADZA 2ELZA 2UUAE 2LT7A 2MC6A 4B3TE 2EL5A 2YU5A 2NABA 1YUJA 2EPNA 2G7HA 5IXMB 1X48A 1EH7A 2DMYA 1TF6A 1X5WA 4P78A 2EPXA 4LF4E 2EL6A 3KZZA 2JVAA 2F4VE 1YPNA 3J81C 2EM8A 2UXCE 1GQEA 5AASA 4WX9A 3ECRA 3F6GA 1A1GA 4HTGA 4X64E 2CSHA 4Q28A 4JI3E 2LUQA 4B3RE 4B3SE 3HQ1A 2UU9E 4TUGA 2YTEA 3DF6A 2I9IA 1X49A 2PRTA 2EMZA 4X8WA 2LUPB 4NXME 4WFTA 5LMNE 3L00A 1ZBTA 1B69A 3VHTB 2EMKA 2EMGA 2EPLX 2LJUA 2M7QA 2YTDA 1BBOA 2EMCA 2NA2A 4JI1E 1J26A 2R1FA 3LLHA 5LMUE 4DV4E 1N32E 2DSYA 2MDGA 1G2DC 1EH8A 2FV4B 1YYOA 5AC5A 3VYYA 4M2ZA 2EPRA 1JK1A 1HNZE 4JI7E 1L4SA 4DKKA 4WSPA 2ODRC 3THNA 1PDAA 4LF5E 1STUA 4F2JC 1AAYA 1XMQE 4LFCE 4DV3E 3EPLA 2GPIA 3ADGA 5A69A 1HNWE 1X6HA 4ZYDA 1ZU1A 2VQEE 5DNYA 2EPAA 2EPCA 1QU6A 4R03A 1X47A 2EMYA 1A1KA 2JOBA 3QG5C 2ELYA 3J80C 2ADRA 2EQ1A 2L3JA 2EJ4A 4LU9A 5A6BD 5A6KA 5LLQA 1WHNA 1I94E 2L33A 5A6AA 2NUFA 1IQOA 2YRMA 1JK2A 3ADJA 2YTPA 4ZYEA 1A1LA 2EN6A 4LFBE 2B3TB 1YZ9A 4RHBB 2DRPA 4FK5C 1SFEA 3HPZA 1UN6B 2GHFA 2YU8A 2N8XA 2UXDE 4X9JA 5CFFE 2DGCA 1GTKA 2ODRD 3ADLA 3EPHA 4X66E 4BS9A 1IBME 1X3CA 2EM3A 2EOYA 2MKNA 2JXPA 4JI6E 1EH6A 1T4OA 2EM4A 1T4NA 2M1SA 4IS1C 1XNRE 1PJQA 2DIXA 2L6MA 2LCEA 4GZNC 2NUEA 2J7JA 1KJKA 2LE2A 2EPZA 4F54A 1PKPA 3MHSC 1HNXE 4LFAE 4DUZE 2YTQA 2RS7A 4DV6E 2EM7A 4DV7E 2WBSA 2B7VA 4DV2E 2YZTA 2R76A 2LJHA 1TF3A 2CTDA 1A1FA 2ENCA 5AE3A 2WZOA 3C6KA 1HR0E 2YWQA 2VF1A 5AE2A 4R8OA 2JWOA 2V85A 2FGGA 3K6QA 4NHRA 2EOOA 5A2QC 1J5EE 4O43A 2VRDA 2EOSA 2EORA 4JI8E 2EPPA 3MSWA 3JTZA 4BC7A 1G2FC 2V88A 2V83A 3IWBA 4YHHE 1FJGE 3J7AG 4GKKE 2UXBE 2F8BA 1F2IG 1UHZA 1IQSA 5AC4A 1PJSA 2E1MA 2RS6A 1ZAAC 2EOJA 2M9AA 2RPCA 2WBUA 5A6BA 1IBKE 1BB8A 4WXDA 2DMIA 4LF8E 4J8ZA 2KOUA 1IBLE 1YUIA 1RMDA 2LRSA 1MEYC 1WRJA 2YTFA 3J7Yp 2EMWA 2YTJA 5BR8E 3EPJA 1QNTA 4DR5E 5F3WA 2EQ0A 5KL5A 1XMOE 2BBGA 2YSPA 2EP3A 4OX9E 2YTGA 1XNQE 2VE7C 3BF2A 2RTXA 4F9CB 1PJTA 3BGHA 1WJPA 3JU0A 4JI5E 3MHHC 4R2AA 2N3HA 2YRHA 5IT9C 2YTIA 4MLVA 1DGCA 2D9HA 4JV5E 2L8TA 1RQ0A 4MLQA 1FKAE 2I13A 1NEIA 2M4IA 4OOGC 1NCSA 2L2KB 2FTXB 4RH8A 2E72A 2EMHA 4F6MA 1WXRA 1TN9A 2YTOA 2B9DA 4KHPE 4DR1E 4JI0E 1YSAC 4IJDA 2N3GA 2A25A 1A1JA 4GEQB 1IMUA 2EOEA 4DMIA 4LF6E 2LTRA 5IV8B 3FIGA 4O24A 4L8NA 2ZM6E 4DV5E 2JP9A 2HC5A 4R2DA 5TSEA 2CT1A 2L2MA 2JOXA 4X62E 2L3CA 3EQ1A 3C4BA 2EMLA 2ENAA 2V8QB 4WYQB 2V86A 2DB2A 2E5LE 2EMFA 2NUGA 4BC9A 2EM5A 2EM2A 1MGTA 1ZBQA 4L5NC 4ZYGA 1ZR9A 2UUCE 2H36X 3DJWA 4K0KE 1BBGA 2IHR1 2L2NA 1A1IA 4BBYA 4BHBA 1LLMC 2EPMX 3C6MA 4R2QA 4DUYE 1YYKA 4WXCA 2HGHA 1UBDC 4M30A 2BB8A 3UK3C 1KYQA 2EN4A 2EQ3A 1T38A 2LMZA 3H09A 3T1HE 5KL7A 4WPYA 1N3GA 3IWDA 1T4LB 2MC5A 3LMLA 1YFHA 3EPKA 2ENHA 2EMIA 3TQMA 3IWCA 4ZYHA 2EOZA 4BMJA 1YYWA 5KL3A 3OMLA 1RC7A 2EN1A 4BHCA 2EPOA 3AV0A 3HTXA 2YRKA 2HJJA 2EZ6A 2EM6A 4F9BB 5A6JA 2EOQA 4O5GA 2EMAA 3P1XA 4X65E 2WCC3 3VYXA 2LTSA 1SR9A 2YTNA 2RSMA 4JYAE 4R2SA 2EMXA
chains in the Genus database with same CATH topology
1IBME 4LF4E 4AQYE 1FKAE 2JVAA 3C4TA 2F4VE 4F9AB 1GZ6A 2M4IA 4OOGC 4I8OA 4M0VA 2L2KB 2FTXB 3J81C 4DR3E 1N34E 1T4OA 4JI6E 1T4NA 4DR6E 2UXCE 1GQEA 4KZSA 5AASA 2M1SA 3F6GA 1XNRE 4DR4E 1WXRA 5FLXC 2B9DA 4X64E 3VK6A 2DIXA 2L6MA 4Q28A 5IWAE 4JI3E 2LUQA 4B3RE 3T1YE 4B3SE 4KHPE 3HQ1A 4DR1E 2UU9E 4JI0E 2NUEA 4P7DA 4TUGA 4DR7E 3DF6A 2LE2A 2JR1A 1X49A 2N3GA 4NXME 4X8WA 4F54A 2B7TA 1PKPA 2CPNA 2KONA 4WFTA 5LMNE 4GEQB 2LUPB 1ZBTA 1HNXE 4LFAE 4DMIA 1UILA 4LF6E 2LTRA 4DUZE 3FIGA 2UUBE 2RS7A 4L8NA 3OTOE 2ZM6E 2EWLA 2M7QA 4DV5E 4DV6E 1EKZA 4DV7E 2NA2A 4DR2E 2B7VA 4DV2E 5T6JA 4BS9A 4JI1E 2YZTA 1J26A 2LJHA 3RMPA 2L2MA 3LLHA 2JOXA 4DV0E 4X62E 5LMUE 2LBSB 2L3CA 3C4BA 4DV4E 1N32E 2V8QB 2DSYA 4LTYA 2MDRA 4WYQB 3J7AG 2V86A 5AE3A 2DB2A 2FV4B 2WZOA 1YYOA 1HR0E 5AE2A 2VF1A 2E5LE 3ZOQB 2NUGA 4R8OA 3VYYA 4M2ZA 4BC9A 2JWOA 2V85A 2FGGA 3K6QA 5A2QC 1J5EE 2V87A 4YY3E 1HNZE 1ZBQA 4JI8E 4JI7E 4L5NC 5AE1A 4DKKA 3MSWA 4WSPA 2ODRC 3JAMC 2UUCE 2H36X 4LF5E 3JTZA 3DJWA 4B3ME 4K0KE 1STUA 4BC7A 2IHR1 2L2NA 2JY9A 2HHHE 2V88A 1DQ3A 2V83A 3IWBA 4BBYA 4YHHE 1XMQE 4LFCE 4NXNE 2F8BA 1FJGE 4DV3E 4GKKE 2UXBE 1UHZA 4JI4E 3ADGA 2K4VA 4DUYE 1YYKA 1DI2A 1HNWE 2E1MA 4GKJE 2L92A 2RS6A 2VQFE 4TUIA 4M30A 1N36E 2VQEE 5DNYA 3ADIA 1QU6A 4R03A 1IBKE 1X47A 2JOBA 4LF8E 2LMZA 3H09A 4J8ZA 3T1HE 2KOUA 4WPYA 3IWDA 3F6HA 1T4LB 1IBLE 2MC5A 3LMLA 2KHXA 4BCAA 1N33E 2V89A 2YT4A 3J80C 4JI2E 1O0WA 2LRSA 2L3JA 4LU9A 3IWCA 3J7Yp 1WHNA 1I94E 2L33A 4BMJA 5BR8E 1YYWA 3OMLA 4LF7E 4DR5E 2NUFA 1RC7A 4LF9E 3ADJA 5F3WA 4DV1E 3AV0A 3AUZA 1XMOE 5LL6R 3HTXA 2B3TB 1YZ9A 4LFBE 3HPSA 2EZ6A 4OX9E 4F9BB 1XNQE 2VE7C 3HXLA 2RTXA 3KWRA 3HPZA 4F9CB 1WHQA 5ADZA 3P1XA 4X65E 3JU0A 2UUAE 2UXDE 2MC6A 4JI5E 4B3TE 3VYXA 5CFFE 2LTSA 2G7HA 1SR9A 2N3HA 1X48A 2RSMA 2DMYA 5IT9C 2ODRD 3ADLA 4JYAE 4X66E 4JV5E 4P78A 2L8TA 1RQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9D A; 
#chains in the Genus database with same CATH topology
 4AQY E;  4N4R B;  2DLK A;  3C4T A;  4F9A B;  1GZ6 A;  2K7I A;  2EN3 A;  4I8O A;  4M0V A;  5KL4 A;  4DR3 E;  1N34 E;  4DR6 E;  4KZS A;  2EOX A;  2EOI A;  3THO B;  2EPK X;  4F6N A;  4DR4 E;  2YPN A;  5FLX C;  3VK6 A;  5IWA E;  4WSG A;  4M9V C;  4R2R A;  3T1Y E;  4P7D A;  2WBT A;  1P47 A;  4DR7 E;  2JR1 A;  2EN7 A;  2B7T A;  2CPN A;  2EN8 A;  2KON A;  2LO3 A;  3BID A;  2JPA A;  2MKD A;  1UIL A;  2UUB E;  3OTO E;  2EWL A;  2EE8 A;  4R2C A;  1EKZ A;  2DLQ A;  2LVH A;  4DR2 E;  5T6J A;  4NZV A;  3RMP A;  2GLI A;  4O4K A;  2EN2 A;  4DV0 E;  2LBS B;  4LTY A;  2MDR A;  2RSI A;  3ZOQ B;  2EOF A;  2V87 A;  3KZY A;  4YY3 E;  2YSO A;  5AE1 A;  3JAM C;  4B3M E;  4KWY A;  2JY9 A;  2EL4 A;  4HEI A;  2HHH E;  1DQ3 A;  4NXN E;  4JI4 E;  2K4V A;  1Z1B A;  1DI2 A;  4Q35 B;  4GKJ E;  2L92 A;  2VQF E;  2EOM A;  4TUI A;  1N36 E;  3ADI A;  3M99 B;  3F6H A;  4R2P A;  1N33 E;  2KHX A;  4BCA A;  1X6F A;  2V89 A;  2YT4 A;  4JI2 E;  1T39 A;  1O0W A;  2EM0 A;  2JYA A;  2EM9 A;  1AH5 A;  2RQL A;  5KL6 A;  4R2E A;  4LF7 E;  4LF9 E;  2EPU A;  2Q8U A;  4DV1 E;  3AUZ A;  5LL6 R;  1A1H A;  2EOH A;  3HPS A;  2EMB A;  5KL2 A;  3HXL A;  3KWR A;  2LV2 A;  1WHQ A;  1X6E A;  3BBG A;  5ADZ A;  2ELZ A;  2UUA E;  2LT7 A;  2MC6 A;  4B3T E;  2EL5 A;  2YU5 A;  2NAB A;  1YUJ A;  2EPN A;  2G7H A;  5IXM B;  1X48 A;  1EH7 A;  2DMY A;  1TF6 A;  1X5W A;  4P78 A;  2EPX A;  4LF4 E;  2EL6 A;  3KZZ A;  2JVA A;  2F4V E;  1YPN A;  3J81 C;  2EM8 A;  2UXC E;  1GQE A;  5AAS A;  4WX9 A;  3ECR A;  3F6G A;  1A1G A;  4HTG A;  4X64 E;  2CSH A;  4Q28 A;  4JI3 E;  2LUQ A;  4B3R E;  4B3S E;  3HQ1 A;  2UU9 E;  4TUG A;  2YTE A;  3DF6 A;  2I9I A;  1X49 A;  2PRT A;  2EMZ A;  4X8W A;  2LUP B;  4NXM E;  4WFT A;  5LMN E;  3L00 A;  1ZBT A;  1B69 A;  3VHT B;  2EMK A;  2EMG A;  2EPL X;  2LJU A;  2M7Q A;  2YTD A;  1BBO A;  2EMC A;  2NA2 A;  4JI1 E;  1J26 A;  2R1F A;  3LLH A;  5LMU E;  4DV4 E;  1N32 E;  2DSY A;  2MDG A;  1G2D C;  1EH8 A;  2FV4 B;  1YYO A;  5AC5 A;  3VYY A;  4M2Z A;  2EPR A;  1JK1 A;  1HNZ E;  4JI7 E;  1L4S A;  4DKK A;  4WSP A;  2ODR C;  3THN A;  1PDA A;  4LF5 E;  1STU A;  4F2J C;  1AAY A;  1XMQ E;  4LFC E;  4DV3 E;  3EPL A;  2GPI A;  3ADG A;  5A69 A;  1HNW E;  1X6H A;  4ZYD A;  1ZU1 A;  2VQE E;  5DNY A;  2EPA A;  2EPC A;  1QU6 A;  4R03 A;  1X47 A;  2EMY A;  1A1K A;  2JOB A;  3QG5 C;  2ELY A;  3J80 C;  2ADR A;  2EQ1 A;  2L3J A;  2EJ4 A;  4LU9 A;  5A6B D;  5A6K A;  5LLQ A;  1WHN A;  1I94 E;  2L33 A;  5A6A A;  2NUF A;  1IQO A;  2YRM A;  1JK2 A;  3ADJ A;  2YTP A;  4ZYE A;  1A1L A;  2EN6 A;  4LFB E;  2B3T B;  1YZ9 A;  4RHB B;  2DRP A;  4FK5 C;  1SFE A;  3HPZ A;  1UN6 B;  2GHF A;  2YU8 A;  2N8X A;  2UXD E;  4X9J A;  5CFF E;  2DGC A;  1GTK A;  2ODR D;  3ADL A;  3EPH A;  4X66 E;  4BS9 A;  1IBM E;  1X3C A;  2EM3 A;  2EOY A;  2MKN A;  2JXP A;  4JI6 E;  1EH6 A;  1T4O A;  2EM4 A;  1T4N A;  2M1S A;  4IS1 C;  1XNR E;  1PJQ A;  2DIX A;  2L6M A;  2LCE A;  4GZN C;  2NUE A;  2J7J A;  1KJK A;  2LE2 A;  2EPZ A;  4F54 A;  1PKP A;  3MHS C;  1HNX E;  4LFA E;  4DUZ E;  2YTQ A;  2RS7 A;  4DV6 E;  2EM7 A;  4DV7 E;  2WBS A;  2B7V A;  4DV2 E;  2YZT A;  2R76 A;  2LJH A;  1TF3 A;  2CTD A;  1A1F A;  2ENC A;  5AE3 A;  2WZO A;  3C6K A;  1HR0 E;  2YWQ A;  2VF1 A;  5AE2 A;  4R8O A;  2JWO A;  2V85 A;  2FGG A;  3K6Q A;  4NHR A;  2EOO A;  5A2Q C;  1J5E E;  4O43 A;  2VRD A;  2EOS A;  2EOR A;  4JI8 E;  2EPP A;  3MSW A;  3JTZ A;  4BC7 A;  1G2F C;  2V88 A;  2V83 A;  3IWB A;  4YHH E;  1FJG E;  3J7A G;  4GKK E;  2UXB E;  2F8B A;  1F2I G;  1UHZ A;  1IQS A;  5AC4 A;  1PJS A;  2E1M A;  2RS6 A;  1ZAA C;  2EOJ A;  2M9A A;  2RPC A;  2WBU A;  5A6B A;  1IBK E;  1BB8 A;  4WXD A;  2DMI A;  4LF8 E;  4J8Z A;  2KOU A;  1IBL E;  1YUI A;  1RMD A;  2LRS A;  1MEY C;  1WRJ A;  2YTF A;  3J7Y p;  2EMW A;  2YTJ A;  5BR8 E;  3EPJ A;  1QNT A;  4DR5 E;  5F3W A;  2EQ0 A;  5KL5 A;  1XMO E;  2BBG A;  2YSP A;  2EP3 A;  4OX9 E;  2YTG A;  1XNQ E;  2VE7 C;  3BF2 A;  2RTX A;  4F9C B;  1PJT A;  3BGH A;  1WJP A;  3JU0 A;  4JI5 E;  3MHH C;  4R2A A;  2N3H A;  2YRH A;  5IT9 C;  2YTI A;  4MLV A;  1DGC A;  2D9H A;  4JV5 E;  2L8T A;  1RQ0 A;  4MLQ A;  1FKA E;  2I13 A;  1NEI A;  2M4I A;  4OOG C;  1NCS A;  2L2K B;  2FTX B;  4RH8 A;  2E72 A;  2EMH A;  4F6M A;  1WXR A;  1TN9 A;  2YTO A;  2B9D A;  4KHP E;  4DR1 E;  4JI0 E;  1YSA C;  4IJD A;  2N3G A;  2A25 A;  1A1J A;  4GEQ B;  1IMU A;  2EOE A;  4DMI A;  4LF6 E;  2LTR A;  5IV8 B;  3FIG A;  4O24 A;  4L8N A;  2ZM6 E;  4DV5 E;  2JP9 A;  2HC5 A;  4R2D A;  5TSE A;  2CT1 A;  2L2M A;  2JOX A;  4X62 E;  2L3C A;  3EQ1 A;  3C4B A;  2EML A;  2ENA A;  2V8Q B;  4WYQ B;  2V86 A;  2DB2 A;  2E5L E;  2EMF A;  2NUG A;  4BC9 A;  2EM5 A;  2EM2 A;  1MGT A;  1ZBQ A;  4L5N C;  4ZYG A;  1ZR9 A;  2UUC E;  2H36 X;  3DJW A;  4K0K E;  1BBG A;  2IHR 1;  2L2N A;  1A1I A;  4BBY A;  4BHB A;  1LLM C;  2EPM X;  3C6M A;  4R2Q A;  4DUY E;  1YYK A;  4WXC A;  2HGH A;  1UBD C;  4M30 A;  2BB8 A;  3UK3 C;  1KYQ A;  2EN4 A;  2EQ3 A;  1T38 A;  2LMZ A;  3H09 A;  3T1H E;  5KL7 A;  4WPY A;  1N3G A;  3IWD A;  1T4L B;  2MC5 A;  3LML A;  1YFH A;  3EPK A;  2ENH A;  2EMI A;  3TQM A;  3IWC A;  4ZYH A;  2EOZ A;  4BMJ A;  1YYW A;  5KL3 A;  3OML A;  1RC7 A;  2EN1 A;  4BHC A;  2EPO A;  3AV0 A;  3HTX A;  2YRK A;  2HJJ A;  2EZ6 A;  2EM6 A;  4F9B B;  5A6J A;  2EOQ A;  4O5G A;  2EMA A;  3P1X A;  4X65 E;  2WCC 3;  3VYX A;  2LTS A;  1SR9 A;  2YTN A;  2RSM A;  4JYA E;  4R2S A;  2EMX A; 
#chains in the Genus database with same CATH homology
 1IBM E;  4LF4 E;  4AQY E;  1FKA E;  2JVA A;  3C4T A;  2F4V E;  4F9A B;  1GZ6 A;  2M4I A;  4OOG C;  4I8O A;  4M0V A;  2L2K B;  2FTX B;  3J81 C;  4DR3 E;  1N34 E;  1T4O A;  4JI6 E;  1T4N A;  4DR6 E;  2UXC E;  1GQE A;  4KZS A;  5AAS A;  2M1S A;  3F6G A;  1XNR E;  4DR4 E;  1WXR A;  5FLX C;  2B9D A;  4X64 E;  3VK6 A;  2DIX A;  2L6M A;  4Q28 A;  5IWA E;  4JI3 E;  2LUQ A;  4B3R E;  3T1Y E;  4B3S E;  4KHP E;  3HQ1 A;  4DR1 E;  2UU9 E;  4JI0 E;  2NUE A;  4P7D A;  4TUG A;  4DR7 E;  3DF6 A;  2LE2 A;  2JR1 A;  1X49 A;  2N3G A;  4NXM E;  4X8W A;  4F54 A;  2B7T A;  1PKP A;  2CPN A;  2KON A;  4WFT A;  5LMN E;  4GEQ B;  2LUP B;  1ZBT A;  1HNX E;  4LFA E;  4DMI A;  1UIL A;  4LF6 E;  2LTR A;  4DUZ E;  3FIG A;  2UUB E;  2RS7 A;  4L8N A;  3OTO E;  2ZM6 E;  2EWL A;  2M7Q A;  4DV5 E;  4DV6 E;  1EKZ A;  4DV7 E;  2NA2 A;  4DR2 E;  2B7V A;  4DV2 E;  5T6J A;  4BS9 A;  4JI1 E;  2YZT A;  1J26 A;  2LJH A;  3RMP A;  2L2M A;  3LLH A;  2JOX A;  4DV0 E;  4X62 E;  5LMU E;  2LBS B;  2L3C A;  3C4B A;  4DV4 E;  1N32 E;  2V8Q B;  2DSY A;  4LTY A;  2MDR A;  4WYQ B;  3J7A G;  2V86 A;  5AE3 A;  2DB2 A;  2FV4 B;  2WZO A;  1YYO A;  1HR0 E;  5AE2 A;  2VF1 A;  2E5L E;  3ZOQ B;  2NUG A;  4R8O A;  3VYY A;  4M2Z A;  4BC9 A;  2JWO A;  2V85 A;  2FGG A;  3K6Q A;  5A2Q C;  1J5E E;  2V87 A;  4YY3 E;  1HNZ E;  1ZBQ A;  4JI8 E;  4JI7 E;  4L5N C;  5AE1 A;  4DKK A;  3MSW A;  4WSP A;  2ODR C;  3JAM C;  2UUC E;  2H36 X;  4LF5 E;  3JTZ A;  3DJW A;  4B3M E;  4K0K E;  1STU A;  4BC7 A;  2IHR 1;  2L2N A;  2JY9 A;  2HHH E;  2V88 A;  1DQ3 A;  2V83 A;  3IWB A;  4BBY A;  4YHH E;  1XMQ E;  4LFC E;  4NXN E;  2F8B A;  1FJG E;  4DV3 E;  4GKK E;  2UXB E;  1UHZ A;  4JI4 E;  3ADG A;  2K4V A;  4DUY E;  1YYK A;  1DI2 A;  1HNW E;  2E1M A;  4GKJ E;  2L92 A;  2RS6 A;  2VQF E;  4TUI A;  4M30 A;  1N36 E;  2VQE E;  5DNY A;  3ADI A;  1QU6 A;  4R03 A;  1IBK E;  1X47 A;  2JOB A;  4LF8 E;  2LMZ A;  3H09 A;  4J8Z A;  3T1H E;  2KOU A;  4WPY A;  3IWD A;  3F6H A;  1T4L B;  1IBL E;  2MC5 A;  3LML A;  2KHX A;  4BCA A;  1N33 E;  2V89 A;  2YT4 A;  3J80 C;  4JI2 E;  1O0W A;  2LRS A;  2L3J A;  4LU9 A;  3IWC A;  3J7Y p;  1WHN A;  1I94 E;  2L33 A;  4BMJ A;  5BR8 E;  1YYW A;  3OML A;  4LF7 E;  4DR5 E;  2NUF A;  1RC7 A;  4LF9 E;  3ADJ A;  5F3W A;  4DV1 E;  3AV0 A;  3AUZ A;  1XMO E;  5LL6 R;  3HTX A;  2B3T B;  1YZ9 A;  4LFB E;  3HPS A;  2EZ6 A;  4OX9 E;  4F9B B;  1XNQ E;  2VE7 C;  3HXL A;  2RTX A;  3KWR A;  3HPZ A;  4F9C B;  1WHQ A;  5ADZ A;  3P1X A;  4X65 E;  3JU0 A;  2UUA E;  2UXD E;  2MC6 A;  4JI5 E;  4B3T E;  3VYX A;  5CFF E;  2LTS A;  2G7H A;  1SR9 A;  2N3H A;  1X48 A;  2RSM A;  2DMY A;  5IT9 C;  2ODR D;  3ADL A;  4JYA E;  4X66 E;  4JV5 E;  4P78 A;  2L8T A;  1RQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...