2B9DA

Crystal structure of hpv e7 cr3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human Papillomavirus E7 oncoprotein and its mechanism for inactivation of the retinoblastoma tumor suppressor.
pubmed doi rcsb
source organism Human papillomavirus type 1a
molecule tags Transcription, viral protein
molecule keywords E7 protein
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.330 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b9dA01
2B9DA
chains in the Genus database with same CATH superfamily
2CSHA 1N34E 4Q28A 4J8ZA 1LLMC 1A1LA 2IHR1 4X9JA 2DIXA 2LTSA 2VRDA 2LUPB 2EM4A 1IBME 1WRJA 2DB2A 2EP3A 1N32E 4R2QA 2YTNA 3AUZA 1X5WA 4YY3E 2UXBE 3JAMC 1IBLE 3VK6A 2K4VA 3C6KA 4DV0E 4DR4E 2I9IA 2EMCA 2EL5A 1WJPA 5IT9C 2UU9E 4MLVA 1T4LB 2DGCA 2NA2A 3MHSC 1A1FA 1ZR9A 3ECRA 4LU9A 2CT1A 1YUJA 1XMQE 4LFAE 5A6BA 4B3SE 3THNA 2EOHA 2EM3A 4MLQA 2B3TB 2EOQA 2YTIA 1I94E 2KONA 2M1SA 2L3CA 2JXPA 1QNTA 1JK2A 2EPLX 2RPCA 4ZYGA 5AASA 5AC4A 2KHXA 4NZVA 1RMDA 3HQ1A 2LT7A 3LMLA 1A1IA 2LBSB 4JI7E 4NXME 2DLQA 2RTXA 4DR2E 1KJKA 2EPNA 2K7IA 1BBOA 2UUBE 3T1YE 2LUQA 2EQ0A 4F54A 2MDGA 2ENAA 1IQOA 4JI2E 2RQLA 4Q35B 2NUEA 1IQSA 2EMAA 4HEIA 2E72A 4R03A 1J5EE 4JI6E 2EPOA 4ZYDA 2YRHA 4R2DA 1ZBTA 1YZ9A 1BBGA 5TSEA 4JI1E 2MKDA 1YYOA 5IXMB 2EWLA 5AE2A 1MEYC 2MC5A 4GKJE 2EMKA 2L2MA 4WYQB 2EN4A 5A6KA 1Z1BA 5AE1A 3KZZA 2FV4B 2EPRA 2A25A 2Q8UA 2EM5A 4DV3E 4F6MA 4B3ME 4BCAA 1PDAA 3OMLA 4WXCA 2YZTA 1F2IG 1T4NA 3C4TA 3VYYA 2EM0A 2JY9A 1WXRA 4JYAE 3UK3C 2EMYA 1XNQE 1SFEA 2R76A 4DV5E 4OOGC 5AE3A 2CPNA 4JI0E 2EOEA 1EH8A 1HNXE 4K0KE 4LF6E 2BB8A 2GHFA 3P1XA 3HTXA 1FKAE 1X48A 1DGCA 1MGTA 4WX9A 4AQYE 1EKZA 4BS9A 1X49A 2EMBA 4L5NC 4N4RB 4KHPE 5KL7A 2UXCE 4BMJA 2EOFA 2EL6A 1ZBQA 3THOB 4DV4E 4R2SA 3EPKA 1EH7A 2YTDA 2BBGA 2RS6A 3MSWA 2V89A 2LJUA 2YRMA 5A6BD 2EM9A 2EJ4A 4IJDA 2L8TA 3T1HE 3EPJA 5F3WA 4F9AB 2EMGA 5LMUE 3BIDA 2YTGA 1PJTA 2KOUA 3BGHA 2M4IA 1J26A 3HPSA 2YU5A 4DUZE 2LCEA 5LMNE 1SR9A 4JI3E 2FTXB 4DR3E 3MHHC 3K6QA 2EPMX 4X66E 4KZSA 4BHCA 2NUGA 3OTOE 4GZNC 2V8QB 2V85A 1T39A 3IWCA 2ELYA 4R2CA 3DJWA 1IMUA 4JI8E 4R2RA 3J81C 3VYXA 2EPXA 2LVHA 2VF1A 1T38A 4JI4E 3J80C 2MDRA 2R1FA 2VQEE 1NCSA 4LF7E 3H09A 1JK1A 2WZOA 3TQMA 2RSMA 2LJHA 2EMZA 3FIGA 2NABA 2GLIA 2EM6A 2YRKA 1N33E 1TF3A 4DMIA 4ZYEA 2JOBA 1TN9A 2YT4A 5A6AA 2VQFE 4GEQB 2EORA 2LE2A 2L3JA 2WBUA 4X62E 3DF6A 2EPCA 2YWQA 5FLXC 4WFTA 4O5GA 3C4BA 1UILA 4LF4E 4DR7E 1ZU1A 4M9VC 2EN8A 2EPUA 1YSAC 4DV1E 1G2FC 1GTKA 2MKNA 4OX9E 4DV2E 2LO3A 2LTRA 2WBSA 5AC5A 4X8WA 1UHZA 2EQ1A 2EMXA 3HXLA 2EMHA 2FGGA 5IV8B 1A1KA 2EN7A 2L2NA 2ODRD 2I13A 2N8XA 2LMZA 4P7DA 4LF5E 3ADGA 1O0WA 1UN6B 2B7VA 4NXNE 2UUCE 4X65E 3JTZA 2J7JA 3J7Yp 1HNWE 4LFBE 1B69A 4M2ZA 2JR1A 5IWAE 2YTEA 3KWRA 2RSIA 2M9AA 4F2JC 3ADLA 1YFHA 1ZAAC 4DV6E 4YHHE 2DSYA 2JOXA 2YU8A 4DR1E 5A69A 1HNZE 5A6JA 4JI5E 2V88A 3AV0A 4O24A 3IWBA 4LF8E 2D9HA 4B3RE 2EL4A 2EN3A 3EQ1A 2MC6A 1N36E 2HGHA 1GZ6A 2ADRA 2EN6A 4DV7E 4F6NA 1A1HA 3L00A 1RQ0A 2E5LE 2L33A 3KZYA 1DQ3A 4F9CB 2EM8A 1IBKE 2EZ6A 2WCC3 1X6HA 2YTJA 2JPAA 2DLKA 2EPAA 3ADJA 3F6GA 4TUGA 2YTQA 1FJGE 1L4SA 2ELZA 2HC5A 4M30A 2UUAE 1YYWA 2NUFA 2H36X 2YSOA 2M7QA 2N3GA 5KL2A 5KL6A 2L2KB 3JU0A 4WPYA 3J7AG 1PJQA 2RS7A 3QG5C 2B9DA 1P47A 2EOMA 1STUA 3BBGA 4WSGA 2JVAA 2EMWA 2YTOA 1GQEA 2EMIA 2EOJA 2EE8A 4O43A 3VHTB 3C6MA 2DMYA 5ADZA 1EH6A 2LV2A 4BC9A 3ZOQB 2N3HA 4NHRA 4BC7A 1UBDC 1QU6A 2EOSA 4LFCE 5DNYA 2LRSA 1YPNA 2EOYA 4R2AA 2ENHA 5A2QC 2L92A 2HJJA 4KWYA 2EPZA 1PKPA 1WHNA 1TF6A 2UXDE 2V86A 2ODRC 5CFFE 2JWOA 5BR8E 3EPLA 1N3GA 1A1JA 2VE7C 2EQ3A 1YUIA 2YPNA 1X3CA 4GKKE 2EN1A 4RHBB 2G7HA 1HR0E 2ENCA 2L6MA 1WHQA 4R2EA 2EOOA 2F8BA 2EPPA 1RC7A 1BB8A 2JYAA 4R2PA 5LLQA 1XMOE 2EOZA 4BHBA 4F9BB 1PJSA 4B3TE 2EM2A 4I8OA 4M0VA 4TUIA 3M99B 1AH5A 3LLHA 4DUYE 2DMIA 3IWDA 5KL5A 2B7TA 1AAYA 3ADIA 5LL6R 4FK5C 1A1GA 3F6HA 3HPZA 1KYQA 4P78A 2V83A 4HTGA 1DI2A 4ZYHA 2DRPA 2E1MA 3EPHA 2EM7A 5KL3A 4DR6E 2YTFA 2F4VE 1YYKA 2EOXA 1T4OA 5KL4A 2JP9A 4BBYA 1G2DC 1X47A 2GPIA 2ZM6E 2YSPA 4X64E 4JV5E 1NEIA 2CTDA 4IS1C 4LF9E 5T6JA 2V87A 4L8NA 4O4KA 2WBTA 4LTYA 2EOIA 2YTPA 1X6FA 2PRTA 2HHHE 1XNRE 2EMFA 2EPKX 4R8OA 4WSPA 3BF2A 1X6EA 4DKKA 4RH8A 3RMPA 4DR5E 2EN2A 4WXDA 2EMLA
chains in the Genus database with same CATH topology
3OMLA 2LE2A 2L3JA 4X62E 1N34E 4Q28A 4J8ZA 4BC9A 2YZTA 3DF6A 3ZOQB 2N3HA 1T4NA 3C4TA 4BC7A 3VYYA 2IHR1 5FLXC 4WFTA 2JY9A 1QU6A 1WXRA 4JYAE 3C4BA 2DIXA 2LTSA 4LFCE 2LUPB 1XNQE 1UILA 1IBME 5DNYA 2LRSA 4DV5E 4LF4E 4OOGC 2DB2A 5AE3A 2CPNA 1N32E 4DR7E 4JI0E 5A2QC 1HNXE 2L92A 4K0KE 4LF6E 3AUZA 4DV1E 4YY3E 2UXBE 3P1XA 3HTXA 4OX9E 3JAMC 1IBLE 1FKAE 4DV2E 1X48A 1WHNA 1PKPA 3VK6A 2UXDE 2K4VA 2LTRA 4DV0E 2V86A 2ODRC 4AQYE 4DR4E 5ADZA 1EKZA 5CFFE 4BS9A 2JWOA 4X8WA 1UHZA 1X49A 5BR8E 2VE7C 3HXLA 4L5NC 4KHPE 4GKJE 2FGGA 4GKKE 5IT9C 2L2NA 2UU9E 1T4LB 2ODRD 2UXCE 4BMJA 2NA2A 1ZBQA 2G7HA 1HR0E 4DV4E 2LMZA 2L6MA 1WHQA 4P7DA 4LF5E 3ADGA 1O0WA 4LU9A 2B7VA 2F8BA 2RS6A 1RC7A 2UUCE 4X65E 4NXNE 3MSWA 2V89A 3JTZA 3J7Yp 1XMQE 4LFAE 1HNWE 4LFBE 4B3SE 2L8TA 3T1HE 4M2ZA 2L2KB 2JR1A 2B3TB 4F9AB 5F3WA 1I94E 5IWAE 3KWRA 5LMUE 2KONA 1XMOE 4F9BB 2M1SA 2L3CA 2KOUA 4B3TE 4I8OA 2M4IA 1J26A 3ADLA 3HPSA 4M0VA 4TUIA 4DV6E 3LLHA 4DUYE 4DUZE 5AASA 4YHHE 5LMNE 1SR9A 2KHXA 4JI3E 2FTXB 3HQ1A 2DSYA 2JOXA 4DR3E 4DR1E 1HNZE 3IWDA 3LMLA 2LBSB 2B7TA 4JI7E 4NXME 2RTXA 3ADIA 4DR2E 4JI5E 5LL6R 2V88A 3AV0A 3F6HA 3K6QA 3HPZA 3IWBA 4P78A 2V83A 4KZSA 4X66E 2LUQA 3T1YE 2UUBE 4LF8E 3OTOE 2NUGA 4B3RE 1DI2A 4F54A 2V8QB 4JI2E 2V85A 2E1MA 2MC6A 1N36E 3IWCA 1GZ6A 4DV7E 3DJWA 4DR6E 2F4VE 4JI8E 2NUEA 3J81C 2E5LE 1RQ0A 1YYKA 2L33A 3VYXA 4R03A 1T4OA 1DQ3A 4BBYA 4F9CB 1J5EE 1IBKE 4JI6E 2EZ6A 2VF1A 1X47A 2ZM6E 4X64E 4JI4E 3J80C 2MDRA 4JV5E 1ZBTA 2VQEE 1YZ9A 3ADJA 3F6GA 4TUGA 4JI1E 4LF7E 1FJGE 3H09A 1YYOA 4LF9E 4M30A 2WZOA 2UUAE 2RSMA 2NUFA 2EWLA 5AE2A 1YYWA 2H36X 2LJHA 2MC5A 2N3GA 2V87A 3FIGA 4L8NA 5T6JA 2L2MA 4WYQB 2M7QA 3JU0A 4WPYA 3J7AG 4LTYA 2RS7A 5AE1A 2B9DA 2FV4B 1N33E 1STUA 4DV3E 2HHHE 1XNRE 2JVAA 4DMIA 4R8OA 1GQEA 4WSPA 2JOBA 4B3ME 2YT4A 4BCAA 4DKKA 3RMPA 4DR5E 2VQFE 4GEQB 2DMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9D A; 
#chains in the Genus database with same CATH topology
 2CSH A;  1N34 E;  4Q28 A;  4J8Z A;  1LLM C;  1A1L A;  2IHR 1;  4X9J A;  2DIX A;  2LTS A;  2VRD A;  2LUP B;  2EM4 A;  1IBM E;  1WRJ A;  2DB2 A;  2EP3 A;  1N32 E;  4R2Q A;  2YTN A;  3AUZ A;  1X5W A;  4YY3 E;  2UXB E;  3JAM C;  1IBL E;  3VK6 A;  2K4V A;  3C6K A;  4DV0 E;  4DR4 E;  2I9I A;  2EMC A;  2EL5 A;  1WJP A;  5IT9 C;  2UU9 E;  4MLV A;  1T4L B;  2DGC A;  2NA2 A;  3MHS C;  1A1F A;  1ZR9 A;  3ECR A;  4LU9 A;  2CT1 A;  1YUJ A;  1XMQ E;  4LFA E;  5A6B A;  4B3S E;  3THN A;  2EOH A;  2EM3 A;  4MLQ A;  2B3T B;  2EOQ A;  2YTI A;  1I94 E;  2KON A;  2M1S A;  2L3C A;  2JXP A;  1QNT A;  1JK2 A;  2EPL X;  2RPC A;  4ZYG A;  5AAS A;  5AC4 A;  2KHX A;  4NZV A;  1RMD A;  3HQ1 A;  2LT7 A;  3LML A;  1A1I A;  2LBS B;  4JI7 E;  4NXM E;  2DLQ A;  2RTX A;  4DR2 E;  1KJK A;  2EPN A;  2K7I A;  1BBO A;  2UUB E;  3T1Y E;  2LUQ A;  2EQ0 A;  4F54 A;  2MDG A;  2ENA A;  1IQO A;  4JI2 E;  2RQL A;  4Q35 B;  2NUE A;  1IQS A;  2EMA A;  4HEI A;  2E72 A;  4R03 A;  1J5E E;  4JI6 E;  2EPO A;  4ZYD A;  2YRH A;  4R2D A;  1ZBT A;  1YZ9 A;  1BBG A;  5TSE A;  4JI1 E;  2MKD A;  1YYO A;  5IXM B;  2EWL A;  5AE2 A;  1MEY C;  2MC5 A;  4GKJ E;  2EMK A;  2L2M A;  4WYQ B;  2EN4 A;  5A6K A;  1Z1B A;  5AE1 A;  3KZZ A;  2FV4 B;  2EPR A;  2A25 A;  2Q8U A;  2EM5 A;  4DV3 E;  4F6M A;  4B3M E;  4BCA A;  1PDA A;  3OML A;  4WXC A;  2YZT A;  1F2I G;  1T4N A;  3C4T A;  3VYY A;  2EM0 A;  2JY9 A;  1WXR A;  4JYA E;  3UK3 C;  2EMY A;  1XNQ E;  1SFE A;  2R76 A;  4DV5 E;  4OOG C;  5AE3 A;  2CPN A;  4JI0 E;  2EOE A;  1EH8 A;  1HNX E;  4K0K E;  4LF6 E;  2BB8 A;  2GHF A;  3P1X A;  3HTX A;  1FKA E;  1X48 A;  1DGC A;  1MGT A;  4WX9 A;  4AQY E;  1EKZ A;  4BS9 A;  1X49 A;  2EMB A;  4L5N C;  4N4R B;  4KHP E;  5KL7 A;  2UXC E;  4BMJ A;  2EOF A;  2EL6 A;  1ZBQ A;  3THO B;  4DV4 E;  4R2S A;  3EPK A;  1EH7 A;  2YTD A;  2BBG A;  2RS6 A;  3MSW A;  2V89 A;  2LJU A;  2YRM A;  5A6B D;  2EM9 A;  2EJ4 A;  4IJD A;  2L8T A;  3T1H E;  3EPJ A;  5F3W A;  4F9A B;  2EMG A;  5LMU E;  3BID A;  2YTG A;  1PJT A;  2KOU A;  3BGH A;  2M4I A;  1J26 A;  3HPS A;  2YU5 A;  4DUZ E;  2LCE A;  5LMN E;  1SR9 A;  4JI3 E;  2FTX B;  4DR3 E;  3MHH C;  3K6Q A;  2EPM X;  4X66 E;  4KZS A;  4BHC A;  2NUG A;  3OTO E;  4GZN C;  2V8Q B;  2V85 A;  1T39 A;  3IWC A;  2ELY A;  4R2C A;  3DJW A;  1IMU A;  4JI8 E;  4R2R A;  3J81 C;  3VYX A;  2EPX A;  2LVH A;  2VF1 A;  1T38 A;  4JI4 E;  3J80 C;  2MDR A;  2R1F A;  2VQE E;  1NCS A;  4LF7 E;  3H09 A;  1JK1 A;  2WZO A;  3TQM A;  2RSM A;  2LJH A;  2EMZ A;  3FIG A;  2NAB A;  2GLI A;  2EM6 A;  2YRK A;  1N33 E;  1TF3 A;  4DMI A;  4ZYE A;  2JOB A;  1TN9 A;  2YT4 A;  5A6A A;  2VQF E;  4GEQ B;  2EOR A;  2LE2 A;  2L3J A;  2WBU A;  4X62 E;  3DF6 A;  2EPC A;  2YWQ A;  5FLX C;  4WFT A;  4O5G A;  3C4B A;  1UIL A;  4LF4 E;  4DR7 E;  1ZU1 A;  4M9V C;  2EN8 A;  2EPU A;  1YSA C;  4DV1 E;  1G2F C;  1GTK A;  2MKN A;  4OX9 E;  4DV2 E;  2LO3 A;  2LTR A;  2WBS A;  5AC5 A;  4X8W A;  1UHZ A;  2EQ1 A;  2EMX A;  3HXL A;  2EMH A;  2FGG A;  5IV8 B;  1A1K A;  2EN7 A;  2L2N A;  2ODR D;  2I13 A;  2N8X A;  2LMZ A;  4P7D A;  4LF5 E;  3ADG A;  1O0W A;  1UN6 B;  2B7V A;  4NXN E;  2UUC E;  4X65 E;  3JTZ A;  2J7J A;  3J7Y p;  1HNW E;  4LFB E;  1B69 A;  4M2Z A;  2JR1 A;  5IWA E;  2YTE A;  3KWR A;  2RSI A;  2M9A A;  4F2J C;  3ADL A;  1YFH A;  1ZAA C;  4DV6 E;  4YHH E;  2DSY A;  2JOX A;  2YU8 A;  4DR1 E;  5A69 A;  1HNZ E;  5A6J A;  4JI5 E;  2V88 A;  3AV0 A;  4O24 A;  3IWB A;  4LF8 E;  2D9H A;  4B3R E;  2EL4 A;  2EN3 A;  3EQ1 A;  2MC6 A;  1N36 E;  2HGH A;  1GZ6 A;  2ADR A;  2EN6 A;  4DV7 E;  4F6N A;  1A1H A;  3L00 A;  1RQ0 A;  2E5L E;  2L33 A;  3KZY A;  1DQ3 A;  4F9C B;  2EM8 A;  1IBK E;  2EZ6 A;  2WCC 3;  1X6H A;  2YTJ A;  2JPA A;  2DLK A;  2EPA A;  3ADJ A;  3F6G A;  4TUG A;  2YTQ A;  1FJG E;  1L4S A;  2ELZ A;  2HC5 A;  4M30 A;  2UUA E;  1YYW A;  2NUF A;  2H36 X;  2YSO A;  2M7Q A;  2N3G A;  5KL2 A;  5KL6 A;  2L2K B;  3JU0 A;  4WPY A;  3J7A G;  1PJQ A;  2RS7 A;  3QG5 C;  2B9D A;  1P47 A;  2EOM A;  1STU A;  3BBG A;  4WSG A;  2JVA A;  2EMW A;  2YTO A;  1GQE A;  2EMI A;  2EOJ A;  2EE8 A;  4O43 A;  3VHT B;  3C6M A;  2DMY A;  5ADZ A;  1EH6 A;  2LV2 A;  4BC9 A;  3ZOQ B;  2N3H A;  4NHR A;  4BC7 A;  1UBD C;  1QU6 A;  2EOS A;  4LFC E;  5DNY A;  2LRS A;  1YPN A;  2EOY A;  4R2A A;  2ENH A;  5A2Q C;  2L92 A;  2HJJ A;  4KWY A;  2EPZ A;  1PKP A;  1WHN A;  1TF6 A;  2UXD E;  2V86 A;  2ODR C;  5CFF E;  2JWO A;  5BR8 E;  3EPL A;  1N3G A;  1A1J A;  2VE7 C;  2EQ3 A;  1YUI A;  2YPN A;  1X3C A;  4GKK E;  2EN1 A;  4RHB B;  2G7H A;  1HR0 E;  2ENC A;  2L6M A;  1WHQ A;  4R2E A;  2EOO A;  2F8B A;  2EPP A;  1RC7 A;  1BB8 A;  2JYA A;  4R2P A;  5LLQ A;  1XMO E;  2EOZ A;  4BHB A;  4F9B B;  1PJS A;  4B3T E;  2EM2 A;  4I8O A;  4M0V A;  4TUI A;  3M99 B;  1AH5 A;  3LLH A;  4DUY E;  2DMI A;  3IWD A;  5KL5 A;  2B7T A;  1AAY A;  3ADI A;  5LL6 R;  4FK5 C;  1A1G A;  3F6H A;  3HPZ A;  1KYQ A;  4P78 A;  2V83 A;  4HTG A;  1DI2 A;  4ZYH A;  2DRP A;  2E1M A;  3EPH A;  2EM7 A;  5KL3 A;  4DR6 E;  2YTF A;  2F4V E;  1YYK A;  2EOX A;  1T4O A;  5KL4 A;  2JP9 A;  4BBY A;  1G2D C;  1X47 A;  2GPI A;  2ZM6 E;  2YSP A;  4X64 E;  4JV5 E;  1NEI A;  2CTD A;  4IS1 C;  4LF9 E;  5T6J A;  2V87 A;  4L8N A;  4O4K A;  2WBT A;  4LTY A;  2EOI A;  2YTP A;  1X6F A;  2PRT A;  2HHH E;  1XNR E;  2EMF A;  2EPK X;  4R8O A;  4WSP A;  3BF2 A;  1X6E A;  4DKK A;  4RH8 A;  3RMP A;  4DR5 E;  2EN2 A;  4WXD A;  2EML A; 
#chains in the Genus database with same CATH homology
 3OML A;  2LE2 A;  2L3J A;  4X62 E;  1N34 E;  4Q28 A;  4J8Z A;  4BC9 A;  2YZT A;  3DF6 A;  3ZOQ B;  2N3H A;  1T4N A;  3C4T A;  4BC7 A;  3VYY A;  2IHR 1;  5FLX C;  4WFT A;  2JY9 A;  1QU6 A;  1WXR A;  4JYA E;  3C4B A;  2DIX A;  2LTS A;  4LFC E;  2LUP B;  1XNQ E;  1UIL A;  1IBM E;  5DNY A;  2LRS A;  4DV5 E;  4LF4 E;  4OOG C;  2DB2 A;  5AE3 A;  2CPN A;  1N32 E;  4DR7 E;  4JI0 E;  5A2Q C;  1HNX E;  2L92 A;  4K0K E;  4LF6 E;  3AUZ A;  4DV1 E;  4YY3 E;  2UXB E;  3P1X A;  3HTX A;  4OX9 E;  3JAM C;  1IBL E;  1FKA E;  4DV2 E;  1X48 A;  1WHN A;  1PKP A;  3VK6 A;  2UXD E;  2K4V A;  2LTR A;  4DV0 E;  2V86 A;  2ODR C;  4AQY E;  4DR4 E;  5ADZ A;  1EKZ A;  5CFF E;  4BS9 A;  2JWO A;  4X8W A;  1UHZ A;  1X49 A;  5BR8 E;  2VE7 C;  3HXL A;  4L5N C;  4KHP E;  4GKJ E;  2FGG A;  4GKK E;  5IT9 C;  2L2N A;  2UU9 E;  1T4L B;  2ODR D;  2UXC E;  4BMJ A;  2NA2 A;  1ZBQ A;  2G7H A;  1HR0 E;  4DV4 E;  2LMZ A;  2L6M A;  1WHQ A;  4P7D A;  4LF5 E;  3ADG A;  1O0W A;  4LU9 A;  2B7V A;  2F8B A;  2RS6 A;  1RC7 A;  2UUC E;  4X65 E;  4NXN E;  3MSW A;  2V89 A;  3JTZ A;  3J7Y p;  1XMQ E;  4LFA E;  1HNW E;  4LFB E;  4B3S E;  2L8T A;  3T1H E;  4M2Z A;  2L2K B;  2JR1 A;  2B3T B;  4F9A B;  5F3W A;  1I94 E;  5IWA E;  3KWR A;  5LMU E;  2KON A;  1XMO E;  4F9B B;  2M1S A;  2L3C A;  2KOU A;  4B3T E;  4I8O A;  2M4I A;  1J26 A;  3ADL A;  3HPS A;  4M0V A;  4TUI A;  4DV6 E;  3LLH A;  4DUY E;  4DUZ E;  5AAS A;  4YHH E;  5LMN E;  1SR9 A;  2KHX A;  4JI3 E;  2FTX B;  3HQ1 A;  2DSY A;  2JOX A;  4DR3 E;  4DR1 E;  1HNZ E;  3IWD A;  3LML A;  2LBS B;  2B7T A;  4JI7 E;  4NXM E;  2RTX A;  3ADI A;  4DR2 E;  4JI5 E;  5LL6 R;  2V88 A;  3AV0 A;  3F6H A;  3K6Q A;  3HPZ A;  3IWB A;  4P78 A;  2V83 A;  4KZS A;  4X66 E;  2LUQ A;  3T1Y E;  2UUB E;  4LF8 E;  3OTO E;  2NUG A;  4B3R E;  1DI2 A;  4F54 A;  2V8Q B;  4JI2 E;  2V85 A;  2E1M A;  2MC6 A;  1N36 E;  3IWC A;  1GZ6 A;  4DV7 E;  3DJW A;  4DR6 E;  2F4V E;  4JI8 E;  2NUE A;  3J81 C;  2E5L E;  1RQ0 A;  1YYK A;  2L33 A;  3VYX A;  4R03 A;  1T4O A;  1DQ3 A;  4BBY A;  4F9C B;  1J5E E;  1IBK E;  4JI6 E;  2EZ6 A;  2VF1 A;  1X47 A;  2ZM6 E;  4X64 E;  4JI4 E;  3J80 C;  2MDR A;  4JV5 E;  1ZBT A;  2VQE E;  1YZ9 A;  3ADJ A;  3F6G A;  4TUG A;  4JI1 E;  4LF7 E;  1FJG E;  3H09 A;  1YYO A;  4LF9 E;  4M30 A;  2WZO A;  2UUA E;  2RSM A;  2NUF A;  2EWL A;  5AE2 A;  1YYW A;  2H36 X;  2LJH A;  2MC5 A;  2N3G A;  2V87 A;  3FIG A;  4L8N A;  5T6J A;  2L2M A;  4WYQ B;  2M7Q A;  3JU0 A;  4WPY A;  3J7A G;  4LTY A;  2RS7 A;  5AE1 A;  2B9D A;  2FV4 B;  1N33 E;  1STU A;  4DV3 E;  2HHH E;  1XNR E;  2JVA A;  4DMI A;  4R8O A;  1GQE A;  4WSP A;  2JOB A;  4B3M E;  2YT4 A;  4BCA A;  4DKK A;  3RMP A;  4DR5 E;  2VQF E;  4GEQ B;  2DMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...