2B9DA

Crystal structure of hpv e7 cr3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E7 protein
publication title Structure of the human Papillomavirus E7 oncoprotein and its mechanism for inactivation of the retinoblastoma tumor suppressor.
pubmed doi rcsb
source organism Human papillomavirus type 1a
molecule tags Transcription, viral protein
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.330 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b9dA01
2B9DA
chains in the Genus database with same CATH superfamily
2LUQA 3C6KA 2MC5A 4JI0E 3JTZA 1PJQA 4F54A 2Q8UA 4OX9E 3TQMA 1NEIA 3MHSC 4LF5E 2DB2A 1SFEA 1WXRA 2CTDA 2DLKA 1X49A 2NUEA 2EJ4A 5A6BA 1YYWA 2VRDA 1JK2A 1YZ9A 3ADIA 2B7VA 1XNRE 4R2AA 1HNWE 2B3TB 4L5NC 1EKZA 1L4SA 1DGCA 2F8BA 2EMXA 2N3HA 2JR1A 2ENAA 4JI2E 1N32E 4R2PA 2EPAA 2NABA 4DR4E 1DQ3A 2ENCA 4ZYHA 1QNTA 2EOSA 4LF7E 4B3TE 2MC6A 1EH8A 3BIDA 4X65E 2JP9A 1NCSA 4BHBA 2UUBE 4JI1E 4J8ZA 2UU9E 1A1HA 1J5EE 2DMIA 2MDGA 3AV0A 2L2MA 4N4RB 2HC5A 2WBSA 5KL7A 2EP3A 5KL4A 5AC4A 1WHNA 4F9CB 2F4VE 2YU8A 2EOMA 2EMWA 2G7HA 2GPIA 5IT9C 3F6HA 2EL5A 4DR2E 4WSPA 3OMLA 4BBYA 3T1HE 5F3WA 4M9VC 1O0WA 1MEYC 2YTFA 2YTEA 2JXPA 3LMLA 3JAMC 1ZU1A 2EWLA 1ZBQA 3EPKA 1N34E 4RHBB 2V89A 4BS9A 2EPOA 2L8TA 1HNXE 2JOXA 2UXBE 2YSPA 3JU0A 2EN4A 2DIXA 2MKDA 3VHTB 4MLVA 4NXNE 2ELYA 5LL6R 2I9IA 2ADRA 3LLHA 2LUPB 2EMAA 2YPNA 3THOB 2CSHA 2V88A 2YRKA 2L2NA 2LBSB 2HHHE 2UUCE 4F9AB 4GKJE 3MHHC 1UN6B 1KYQA 4WXCA 4FK5C 2N3GA 4X66E 2VF1A 1PJSA 2GLIA 3VYXA 2YSOA 4RH8A 4LF8E 2EQ1A 4KZSA 2EL4A 1YYOA 1YUJA 2LJHA 2CPNA 2EM9A 1LLMC 2JYAA 2YTGA 4BMJA 3VK6A 2JY9A 1YYKA 3EPHA 5DNYA 4DUZE 2LMZA 4R2SA 2LTSA 2EMZA 3L00A 2EMFA 1T39A 2M7QA 2YTQA 4ZYEA 4R2RA 2FGGA 2RS7A 1B69A 2RS6A 4DR7E 1IBKE 4IJDA 5KL6A 2EPMX 4HEIA 1P47A 1ZBTA 3F6GA 4DV1E 2LV2A 5LMUE 4R2DA 2L3JA 3THNA 2K7IA 4LFBE 4O5GA 2DMYA 5KL5A 2EPPA 1PDAA 2EM0A 5A6KA 4IS1C 2VQFE 4WFTA 3IWDA 2A25A 3J7AG 2EOHA 4DKKA 2EMHA 4DV6E 3HPSA 4JI7E 2M1SA 2UXCE 4TUIA 4F6MA 2EORA 2GHFA 2JWOA 2YTOA 3EPLA 2UXDE 4K0KE 2D9HA 1PKPA 1IBLE 2EN6A 3OTOE 2LE2A 2EN7A 2DSYA 1UILA 1BB8A 4M2ZA 4JV5E 5AE1A 5A6BD 2YTIA 2EMLA 2ZM6E 4NHRA 2K4VA 4DV3E 4GZNC 1A1LA 4L8NA 2LT7A 4DV4E 5AE3A 4GEQB 2V85A 2B9DA 2LRSA 1IMUA 2LJUA 2V83A 2KONA 1PJTA 1N36E 1A1JA 4GKKE 2EN3A 4JYAE 2L2KB 4O43A 4MLQA 1SR9A 3KZYA 1WRJA 1IBME 2B7TA 2LO3A 3P1XA 4P7DA 2NUFA 4B3RE 1TF6A 4LF6E 1A1KA 3HQ1A 1X6EA 1RMDA 4B3ME 1GQEA 3ADLA 2EL6A 2L6MA 4OOGC 4DV5E 5ADZA 3C4TA 2YTJA 2EN1A 2EPLX 2DLQA 5TSEA 1A1IA 1I94E 2ELZA 1YPNA 5KL3A 2ODRC 2EM6A 3BBGA 2EM4A 2PRTA 4DMIA 4R2CA 4X8WA 3ADJA 2EOYA 4F6NA 5IWAE 1YUIA 2EPNA 5BR8E 3ZOQB 1IQOA 4JI6E 1X6FA 3DF6A 2KOUA 4Q28A 5A69A 4ZYDA 1GZ6A 3IWCA 4WYQB 2WCC3 2RTXA 4DV7E 2UUAE 2EMBA 4HTGA 4NXME 1X47A 2EM8A 2EM2A 1QU6A 2JVAA 1EH6A 1UHZA 2I13A 2CT1A 2RSIA 1A1FA 2DGCA 3ECRA 4O24A 4WXDA 4DV2E 2E1MA 3AUZA 1X3CA 4DR1E 1IQSA 2YTDA 2L33A 1MGTA 2JPAA 2EOIA 4LTYA 1T4NA 5LLQA 4DR3E 2DRPA 3VYYA 2BBGA 4LFAE 1WJPA 3QG5C 2EOXA 4Q35B 2BB8A 3HPZA 2EPXA 4LF4E 1JK1A 2NUGA 2V8QB 2EOQA 1XMQE 2EQ3A 2YU5A 2EMYA 4WPYA 1EH7A 1RQ0A 2EPCA 2WBTA 3BGHA 3H09A 2EMKA 2EOFA 3K6QA 2EM3A 2WZOA 4X64E 5T6JA 4DV0E 2EOOA 3M99B 4LF9E 2R1FA 1HR0E 1T4OA 5KL2A 1AH5A 3T1YE 3ADGA 2YWQA 2FV4B 2EMIA 4BHCA 3C6MA 1UBDC 5LMNE 2HGHA 2VQEE 1A1GA 2YRMA 5IV8B 2EOZA 2MDRA 5A6AA 2YZTA 1BBOA 1YSAC 2HJJA 3EPJA 2M9AA 2EMGA 3IWBA 5A2QC 4O4KA 2YRHA 5AC5A 3MSWA 2YTPA 3J80C 3KZZA 5CFFE 1Z1BA 3HXLA 1DI2A 2LCEA 2LVHA 1YFHA 1XNQE 4LFCE 1GTKA 2EM7A 1ZAAC 1X48A 4DR5E 2EN8A 2J7JA 2ENHA 2EOJA 2YT4A 3KWRA 2H36X 4JI8E 1FJGE 1TN9A 2R76A 2IHR1 2M4IA 3J81C 2V87A 2EMCA 3BF2A 2E5LE 2EOEA 2KHXA 2N8XA 3HTXA 2VE7C 1HNZE 4WX9A 5IXMB 5A6JA 4WSGA 1N3GA 2RPCA 2L3CA 2JOBA 2MKNA 1WHQA 1FKAE 4X9JA 4TUGA 1RC7A 4AQYE 2EPZA 2E72A 3EQ1A 3RMPA 4P78A 4DR6E 4R2QA 4BCAA 1XMOE 2YTNA 2EPUA 4YY3E 1T4LB 2EQ0A 2RSMA 1G2FC 2ODRD 2EE8A 5AE2A 1STUA 1N33E 2LTRA 4KHPE 2EPKX 1KJKA 4B3SE 4X62E 4R8OA 4NZVA 4JI3E 2EZ6A 4F9BB 1G2DC 1T38A 2EM5A 4ZYGA 2FTXB 1BBGA 4M30A 2RQLA 1X5WA 4JI5E 1TF3A 3C4BA 2WBUA 4F2JC 3J7Yp 2NA2A 4BC7A 4LU9A 5AASA 4R03A 4DUYE 3FIGA 1J26A 1ZR9A 4I8OA 3DJWA 2EPRA 4M0VA 4R2EA 5FLXC 4JI4E 2EN2A 1F2IG 1AAYA 2V86A 4KWYA 3UK3C 4YHHE 1X6HA 4BC9A 2L92A
chains in the Genus database with same CATH topology
4B3ME 1GQEA 2LUQA 3ADLA 2MC5A 4JI0E 4GKJE 5LMNE 3JTZA 2L6MA 4DV5E 4OOGC 2VQEE 4F54A 2N3GA 4OX9E 4X66E 2VF1A 5ADZA 4LF5E 3C4TA 2DB2A 2MDRA 2YZTA 3VYXA 1WXRA 1I94E 4LF8E 3IWBA 5A2QC 1X49A 4KZSA 1YYOA 2NUEA 1YYWA 2LJHA 2CPNA 2ODRC 3MSWA 1YZ9A 4BMJA 3VK6A 2JY9A 3J80C 1YYKA 4DMIA 5CFFE 3HXLA 3ADIA 2B7VA 1DI2A 4X8WA 1XNQE 1XNRE 5DNYA 4LFCE 1HNWE 2B3TB 4DUZE 3ADJA 2LMZA 4L5NC 2LTSA 1X48A 4DR5E 1EKZA 2M7QA 5IWAE 2YT4A 2F8BA 2N3HA 3KWRA 2JR1A 2H36X 2FGGA 4JI2E 4JI8E 2RS7A 1FJGE 1N32E 5BR8E 3ZOQB 2RS6A 2IHR1 4JI6E 2M4IA 3DF6A 3J81C 4DR7E 2KOUA 2V87A 1IBKE 4Q28A 4DR4E 1DQ3A 2E5LE 1GZ6A 3IWCA 4WYQB 2KHXA 2RTXA 3HTXA 4LF7E 2VE7C 4B3TE 2MC6A 1HNZE 4DV7E 2UUAE 1ZBTA 3F6GA 4DV1E 4NXME 1X47A 4X65E 5LMUE 2L3CA 1QU6A 2JOBA 2JVAA 1UHZA 1WHQA 2L3JA 1FKAE 4TUGA 4LFBE 2DMYA 2LBSB 1RC7A 2UUBE 4J8ZA 4JI1E 4AQYE 2UU9E 1J5EE 4DV2E 3AV0A 3RMPA 4P78A 2L2MA 4DR6E 2E1MA 3AUZA 2VQFE 4WFTA 3IWDA 4BCAA 4DR1E 1XMOE 1WHNA 4F9CB 2F4VE 4YY3E 3J7AG 1T4LB 4DKKA 2L33A 2G7HA 4DV6E 4LTYA 5IT9C 3F6HA 2RSMA 1T4NA 4DR3E 2ODRD 3HPSA 4JI7E 4DR2E 3VYYA 5AE2A 1STUA 4WSPA 2M1SA 3OMLA 4LFAE 1N33E 2LTRA 2UXCE 4F9AB 4BBYA 3T1HE 5F3WA 4KHPE 4TUIA 3HPZA 4B3SE 2JWOA 4X62E 4R8OA 4LF4E 1O0WA 4JI3E 2EZ6A 4F9BB 2NUGA 2UXDE 4K0KE 2V8QB 1PKPA 3LMLA 2FTXB 1IBLE 3JAMC 4M30A 3OTOE 2LE2A 1XMQE 2DSYA 2EWLA 1UILA 1ZBQA 1N34E 4JI5E 4LF6E 3C4BA 2V89A 4BS9A 4M2ZA 5AE1A 2L8TA 4JV5E 4WPYA 3J7Yp 2NA2A 1RQ0A 4BC7A 4LU9A 2ZM6E 3H09A 2JOXA 1HNXE 2UXBE 2K4VA 5AASA 4R03A 4DV3E 4DUYE 3K6QA 3JU0A 3FIGA 2WZOA 4L8NA 4X64E 5T6JA 1J26A 4DV4E 5AE3A 2DIXA 4DV0E 4I8OA 4GEQB 3DJWA 2V85A 2B9DA 2LRSA 4NXNE 2V83A 2KONA 5LL6R 4LF9E 3LLHA 1N36E 4M0VA 1HR0E 1T4OA 5FLXC 2LUPB 4GKKE 4JI4E 4JYAE 2V88A 2L2KB 2V86A 1SR9A 3T1YE 1IBME 2B7TA 3P1XA 4P7DA 3ADGA 4YHHE 2NUFA 4B3RE 2UUCE 4BC9A 2L2NA 2FV4B 2HHHE 3HQ1A 2L92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9D A; 
#chains in the Genus database with same CATH topology
 2LUQ A;  3C6K A;  2MC5 A;  4JI0 E;  3JTZ A;  1PJQ A;  4F54 A;  2Q8U A;  4OX9 E;  3TQM A;  1NEI A;  3MHS C;  4LF5 E;  2DB2 A;  1SFE A;  1WXR A;  2CTD A;  2DLK A;  1X49 A;  2NUE A;  2EJ4 A;  5A6B A;  1YYW A;  2VRD A;  1JK2 A;  1YZ9 A;  3ADI A;  2B7V A;  1XNR E;  4R2A A;  1HNW E;  2B3T B;  4L5N C;  1EKZ A;  1L4S A;  1DGC A;  2F8B A;  2EMX A;  2N3H A;  2JR1 A;  2ENA A;  4JI2 E;  1N32 E;  4R2P A;  2EPA A;  2NAB A;  4DR4 E;  1DQ3 A;  2ENC A;  4ZYH A;  1QNT A;  2EOS A;  4LF7 E;  4B3T E;  2MC6 A;  1EH8 A;  3BID A;  4X65 E;  2JP9 A;  1NCS A;  4BHB A;  2UUB E;  4JI1 E;  4J8Z A;  2UU9 E;  1A1H A;  1J5E E;  2DMI A;  2MDG A;  3AV0 A;  2L2M A;  4N4R B;  2HC5 A;  2WBS A;  5KL7 A;  2EP3 A;  5KL4 A;  5AC4 A;  1WHN A;  4F9C B;  2F4V E;  2YU8 A;  2EOM A;  2EMW A;  2G7H A;  2GPI A;  5IT9 C;  3F6H A;  2EL5 A;  4DR2 E;  4WSP A;  3OML A;  4BBY A;  3T1H E;  5F3W A;  4M9V C;  1O0W A;  1MEY C;  2YTF A;  2YTE A;  2JXP A;  3LML A;  3JAM C;  1ZU1 A;  2EWL A;  1ZBQ A;  3EPK A;  1N34 E;  4RHB B;  2V89 A;  4BS9 A;  2EPO A;  2L8T A;  1HNX E;  2JOX A;  2UXB E;  2YSP A;  3JU0 A;  2EN4 A;  2DIX A;  2MKD A;  3VHT B;  4MLV A;  4NXN E;  2ELY A;  5LL6 R;  2I9I A;  2ADR A;  3LLH A;  2LUP B;  2EMA A;  2YPN A;  3THO B;  2CSH A;  2V88 A;  2YRK A;  2L2N A;  2LBS B;  2HHH E;  2UUC E;  4F9A B;  4GKJ E;  3MHH C;  1UN6 B;  1KYQ A;  4WXC A;  4FK5 C;  2N3G A;  4X66 E;  2VF1 A;  1PJS A;  2GLI A;  3VYX A;  2YSO A;  4RH8 A;  4LF8 E;  2EQ1 A;  4KZS A;  2EL4 A;  1YYO A;  1YUJ A;  2LJH A;  2CPN A;  2EM9 A;  1LLM C;  2JYA A;  2YTG A;  4BMJ A;  3VK6 A;  2JY9 A;  1YYK A;  3EPH A;  5DNY A;  4DUZ E;  2LMZ A;  4R2S A;  2LTS A;  2EMZ A;  3L00 A;  2EMF A;  1T39 A;  2M7Q A;  2YTQ A;  4ZYE A;  4R2R A;  2FGG A;  2RS7 A;  1B69 A;  2RS6 A;  4DR7 E;  1IBK E;  4IJD A;  5KL6 A;  2EPM X;  4HEI A;  1P47 A;  1ZBT A;  3F6G A;  4DV1 E;  2LV2 A;  5LMU E;  4R2D A;  2L3J A;  3THN A;  2K7I A;  4LFB E;  4O5G A;  2DMY A;  5KL5 A;  2EPP A;  1PDA A;  2EM0 A;  5A6K A;  4IS1 C;  2VQF E;  4WFT A;  3IWD A;  2A25 A;  3J7A G;  2EOH A;  4DKK A;  2EMH A;  4DV6 E;  3HPS A;  4JI7 E;  2M1S A;  2UXC E;  4TUI A;  4F6M A;  2EOR A;  2GHF A;  2JWO A;  2YTO A;  3EPL A;  2UXD E;  4K0K E;  2D9H A;  1PKP A;  1IBL E;  2EN6 A;  3OTO E;  2LE2 A;  2EN7 A;  2DSY A;  1UIL A;  1BB8 A;  4M2Z A;  4JV5 E;  5AE1 A;  5A6B D;  2YTI A;  2EML A;  2ZM6 E;  4NHR A;  2K4V A;  4DV3 E;  4GZN C;  1A1L A;  4L8N A;  2LT7 A;  4DV4 E;  5AE3 A;  4GEQ B;  2V85 A;  2B9D A;  2LRS A;  1IMU A;  2LJU A;  2V83 A;  2KON A;  1PJT A;  1N36 E;  1A1J A;  4GKK E;  2EN3 A;  4JYA E;  2L2K B;  4O43 A;  4MLQ A;  1SR9 A;  3KZY A;  1WRJ A;  1IBM E;  2B7T A;  2LO3 A;  3P1X A;  4P7D A;  2NUF A;  4B3R E;  1TF6 A;  4LF6 E;  1A1K A;  3HQ1 A;  1X6E A;  1RMD A;  4B3M E;  1GQE A;  3ADL A;  2EL6 A;  2L6M A;  4OOG C;  4DV5 E;  5ADZ A;  3C4T A;  2YTJ A;  2EN1 A;  2EPL X;  2DLQ A;  5TSE A;  1A1I A;  1I94 E;  2ELZ A;  1YPN A;  5KL3 A;  2ODR C;  2EM6 A;  3BBG A;  2EM4 A;  2PRT A;  4DMI A;  4R2C A;  4X8W A;  3ADJ A;  2EOY A;  4F6N A;  5IWA E;  1YUI A;  2EPN A;  5BR8 E;  3ZOQ B;  1IQO A;  4JI6 E;  1X6F A;  3DF6 A;  2KOU A;  4Q28 A;  5A69 A;  4ZYD A;  1GZ6 A;  3IWC A;  4WYQ B;  2WCC 3;  2RTX A;  4DV7 E;  2UUA E;  2EMB A;  4HTG A;  4NXM E;  1X47 A;  2EM8 A;  2EM2 A;  1QU6 A;  2JVA A;  1EH6 A;  1UHZ A;  2I13 A;  2CT1 A;  2RSI A;  1A1F A;  2DGC A;  3ECR A;  4O24 A;  4WXD A;  4DV2 E;  2E1M A;  3AUZ A;  1X3C A;  4DR1 E;  1IQS A;  2YTD A;  2L33 A;  1MGT A;  2JPA A;  2EOI A;  4LTY A;  1T4N A;  5LLQ A;  4DR3 E;  2DRP A;  3VYY A;  2BBG A;  4LFA E;  1WJP A;  3QG5 C;  2EOX A;  4Q35 B;  2BB8 A;  3HPZ A;  2EPX A;  4LF4 E;  1JK1 A;  2NUG A;  2V8Q B;  2EOQ A;  1XMQ E;  2EQ3 A;  2YU5 A;  2EMY A;  4WPY A;  1EH7 A;  1RQ0 A;  2EPC A;  2WBT A;  3BGH A;  3H09 A;  2EMK A;  2EOF A;  3K6Q A;  2EM3 A;  2WZO A;  4X64 E;  5T6J A;  4DV0 E;  2EOO A;  3M99 B;  4LF9 E;  2R1F A;  1HR0 E;  1T4O A;  5KL2 A;  1AH5 A;  3T1Y E;  3ADG A;  2YWQ A;  2FV4 B;  2EMI A;  4BHC A;  3C6M A;  1UBD C;  5LMN E;  2HGH A;  2VQE E;  1A1G A;  2YRM A;  5IV8 B;  2EOZ A;  2MDR A;  5A6A A;  2YZT A;  1BBO A;  1YSA C;  2HJJ A;  3EPJ A;  2M9A A;  2EMG A;  3IWB A;  5A2Q C;  4O4K A;  2YRH A;  5AC5 A;  3MSW A;  2YTP A;  3J80 C;  3KZZ A;  5CFF E;  1Z1B A;  3HXL A;  1DI2 A;  2LCE A;  2LVH A;  1YFH A;  1XNQ E;  4LFC E;  1GTK A;  2EM7 A;  1ZAA C;  1X48 A;  4DR5 E;  2EN8 A;  2J7J A;  2ENH A;  2EOJ A;  2YT4 A;  3KWR A;  2H36 X;  4JI8 E;  1FJG E;  1TN9 A;  2R76 A;  2IHR 1;  2M4I A;  3J81 C;  2V87 A;  2EMC A;  3BF2 A;  2E5L E;  2EOE A;  2KHX A;  2N8X A;  3HTX A;  2VE7 C;  1HNZ E;  4WX9 A;  5IXM B;  5A6J A;  4WSG A;  1N3G A;  2RPC A;  2L3C A;  2JOB A;  2MKN A;  1WHQ A;  1FKA E;  4X9J A;  4TUG A;  1RC7 A;  4AQY E;  2EPZ A;  2E72 A;  3EQ1 A;  3RMP A;  4P78 A;  4DR6 E;  4R2Q A;  4BCA A;  1XMO E;  2YTN A;  2EPU A;  4YY3 E;  1T4L B;  2EQ0 A;  2RSM A;  1G2F C;  2ODR D;  2EE8 A;  5AE2 A;  1STU A;  1N33 E;  2LTR A;  4KHP E;  2EPK X;  1KJK A;  4B3S E;  4X62 E;  4R8O A;  4NZV A;  4JI3 E;  2EZ6 A;  4F9B B;  1G2D C;  1T38 A;  2EM5 A;  4ZYG A;  2FTX B;  1BBG A;  4M30 A;  2RQL A;  1X5W A;  4JI5 E;  1TF3 A;  3C4B A;  2WBU A;  4F2J C;  3J7Y p;  2NA2 A;  4BC7 A;  4LU9 A;  5AAS A;  4R03 A;  4DUY E;  3FIG A;  1J26 A;  1ZR9 A;  4I8O A;  3DJW A;  2EPR A;  4M0V A;  4R2E A;  5FLX C;  4JI4 E;  2EN2 A;  1F2I G;  1AAY A;  2V86 A;  4KWY A;  3UK3 C;  4YHH E;  1X6H A;  4BC9 A;  2L92 A; 
#chains in the Genus database with same CATH homology
 4B3M E;  1GQE A;  2LUQ A;  3ADL A;  2MC5 A;  4JI0 E;  4GKJ E;  5LMN E;  3JTZ A;  2L6M A;  4DV5 E;  4OOG C;  2VQE E;  4F54 A;  2N3G A;  4OX9 E;  4X66 E;  2VF1 A;  5ADZ A;  4LF5 E;  3C4T A;  2DB2 A;  2MDR A;  2YZT A;  3VYX A;  1WXR A;  1I94 E;  4LF8 E;  3IWB A;  5A2Q C;  1X49 A;  4KZS A;  1YYO A;  2NUE A;  1YYW A;  2LJH A;  2CPN A;  2ODR C;  3MSW A;  1YZ9 A;  4BMJ A;  3VK6 A;  2JY9 A;  3J80 C;  1YYK A;  4DMI A;  5CFF E;  3HXL A;  3ADI A;  2B7V A;  1DI2 A;  4X8W A;  1XNQ E;  1XNR E;  5DNY A;  4LFC E;  1HNW E;  2B3T B;  4DUZ E;  3ADJ A;  2LMZ A;  4L5N C;  2LTS A;  1X48 A;  4DR5 E;  1EKZ A;  2M7Q A;  5IWA E;  2YT4 A;  2F8B A;  2N3H A;  3KWR A;  2JR1 A;  2H36 X;  2FGG A;  4JI2 E;  4JI8 E;  2RS7 A;  1FJG E;  1N32 E;  5BR8 E;  3ZOQ B;  2RS6 A;  2IHR 1;  4JI6 E;  2M4I A;  3DF6 A;  3J81 C;  4DR7 E;  2KOU A;  2V87 A;  1IBK E;  4Q28 A;  4DR4 E;  1DQ3 A;  2E5L E;  1GZ6 A;  3IWC A;  4WYQ B;  2KHX A;  2RTX A;  3HTX A;  4LF7 E;  2VE7 C;  4B3T E;  2MC6 A;  1HNZ E;  4DV7 E;  2UUA E;  1ZBT A;  3F6G A;  4DV1 E;  4NXM E;  1X47 A;  4X65 E;  5LMU E;  2L3C A;  1QU6 A;  2JOB A;  2JVA A;  1UHZ A;  1WHQ A;  2L3J A;  1FKA E;  4TUG A;  4LFB E;  2DMY A;  2LBS B;  1RC7 A;  2UUB E;  4J8Z A;  4JI1 E;  4AQY E;  2UU9 E;  1J5E E;  4DV2 E;  3AV0 A;  3RMP A;  4P78 A;  2L2M A;  4DR6 E;  2E1M A;  3AUZ A;  2VQF E;  4WFT A;  3IWD A;  4BCA A;  4DR1 E;  1XMO E;  1WHN A;  4F9C B;  2F4V E;  4YY3 E;  3J7A G;  1T4L B;  4DKK A;  2L33 A;  2G7H A;  4DV6 E;  4LTY A;  5IT9 C;  3F6H A;  2RSM A;  1T4N A;  4DR3 E;  2ODR D;  3HPS A;  4JI7 E;  4DR2 E;  3VYY A;  5AE2 A;  1STU A;  4WSP A;  2M1S A;  3OML A;  4LFA E;  1N33 E;  2LTR A;  2UXC E;  4F9A B;  4BBY A;  3T1H E;  5F3W A;  4KHP E;  4TUI A;  3HPZ A;  4B3S E;  2JWO A;  4X62 E;  4R8O A;  4LF4 E;  1O0W A;  4JI3 E;  2EZ6 A;  4F9B B;  2NUG A;  2UXD E;  4K0K E;  2V8Q B;  1PKP A;  3LML A;  2FTX B;  1IBL E;  3JAM C;  4M30 A;  3OTO E;  2LE2 A;  1XMQ E;  2DSY A;  2EWL A;  1UIL A;  1ZBQ A;  1N34 E;  4JI5 E;  4LF6 E;  3C4B A;  2V89 A;  4BS9 A;  4M2Z A;  5AE1 A;  2L8T A;  4JV5 E;  4WPY A;  3J7Y p;  2NA2 A;  1RQ0 A;  4BC7 A;  4LU9 A;  2ZM6 E;  3H09 A;  2JOX A;  1HNX E;  2UXB E;  2K4V A;  5AAS A;  4R03 A;  4DV3 E;  4DUY E;  3K6Q A;  3JU0 A;  3FIG A;  2WZO A;  4L8N A;  4X64 E;  5T6J A;  1J26 A;  4DV4 E;  5AE3 A;  2DIX A;  4DV0 E;  4I8O A;  4GEQ B;  3DJW A;  2V85 A;  2B9D A;  2LRS A;  4NXN E;  2V83 A;  2KON A;  5LL6 R;  4LF9 E;  3LLH A;  1N36 E;  4M0V A;  1HR0 E;  1T4O A;  5FLX C;  2LUP B;  4GKK E;  4JI4 E;  4JYA E;  2V88 A;  2L2K B;  2V86 A;  1SR9 A;  3T1Y E;  1IBM E;  2B7T A;  3P1X A;  4P7D A;  3ADG A;  4YHH E;  2NUF A;  4B3R E;  2UUC E;  4BC9 A;  2L2N A;  2FV4 B;  2HHH E;  3HQ1 A;  2L92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...