2B9DA

Crystal structure of hpv e7 cr3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, viral protein
molecule keywords E7 protein
publication title Structure of the human Papillomavirus E7 oncoprotein and its mechanism for inactivation of the retinoblastoma tumor suppressor.
pubmed doi rcsb
source organism Human papillomavirus type 1a
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.330 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b9dA01
2B9DA
chains in the Genus database with same CATH superfamily
2YTGA 2JPAA 2B9DA 2FV4B 3JU0A 1YPNA 5A6AA 4K0KE 2EE8A 1X49A 2YRKA 1T4NA 4X8WA 5CFFE 2EOYA 4L5NC 1FJGE 1N33E 2DMYA 2HC5A 4IJDA 1YUJA 2DIXA 4JYAE 1IMUA 2YSOA 2DLKA 4LF6E 2EM9A 2EMHA 2EM7A 2DMIA 1Z1BA 2D9HA 4F9AB 1DI2A 1FKAE 4M0VA 1WRJA 4R2QA 1T38A 2MDGA 3C6KA 5KL5A 2EPCA 2EMCA 2EOMA 2UUBE 2ELZA 2LTSA 1YFHA 2EM3A 2YT4A 2N3HA 2RS6A 2GHFA 2DGCA 4R2DA 2EMFA 2YSPA 2LJUA 1NCSA 2V89A 3C4TA 4DV6E 2JWOA 2DLQA 2ENCA 4DMIA 1A1IA 2LJHA 5AE3A 3L00A 5AE1A 3DJWA 2HHHE 2YTFA 5IWAE 1G2FC 1N36E 4DV0E 2M1SA 2NABA 5A6KA 1I94E 2NUEA 2M9AA 1JK1A 1QNTA 3LLHA 2BBGA 2EOHA 2EN4A 1TF6A 2YTEA 4L8NA 2EMWA 4DUZE 2ENHA 3BBGA 2YRMA 1UBDC 2EMZA 2EM6A 4DV3E 2JOBA 1UILA 5IV8B 4BHCA 2YTNA 3HTXA 1DQ3A 4X9JA 2J7JA 2ODRC 2L3CA 4BMJA 4FK5C 2JXPA 2L2KB 1IBLE 4GKJE 4LF8E 2EPMX 5LMUE 4TUIA 4R8OA 2DB2A 1T39A 1EH8A 2E5LE 2ADRA 1XNQE 3C6MA 1UHZA 2EOJA 4R2CA 4X66E 1X5WA 2EPNA 3HXLA 3IWDA 3VHTB 1HNXE 4X62E 4DV4E 4WXDA 2UXDE 2EMAA 4WPYA 2MDRA 4M9VC 2I13A 3VYYA 4LFAE 2WCC3 2LMZA 2EQ1A 3HPSA 3ADLA 4AQYE 2UXCE 4LF7E 2F4VE 1WXRA 4LF4E 5A2QC 1IBME 2CSHA 4YHHE 4JI8E 2EM4A 1PJQA 1SFEA 1AH5A 5TSEA 5AASA 2EM5A 3KWRA 2WZOA 4NXNE 2EPXA 5A69A 4GEQB 2EOQA 1X6FA 2EMYA 1GZ6A 5DNYA 2RS7A 5LL6R 3J80C 1MEYC 2EL4A 3JAMC 4F9BB 4KWYA 4DUYE 4ZYHA 1BBGA 2EM2A 3F6HA 2KONA 4B3RE 4WSPA 4DR1E 1ZBQA 4JI2E 2LVHA 1KJKA 2EOIA 1A1FA 2ZM6E 1A1HA 2E72A 5AE2A 4DR5E 2V8QB 2VQEE 3QG5C 2EL6A 2RPCA 1YZ9A 1A1GA 2CPNA 5FLXC 2LTRA 1HR0E 5KL2A 2M7QA 2EPLX 2A25A 2L8TA 4Q28A 2EM0A 4MLQA 4O5GA 2ELYA 2L3JA 3HPZA 4JI5E 2LRSA 2MC6A 3AUZA 2PRTA 2FGGA 4JI1E 3BIDA 2ODRD 1GQEA 4O4KA 1RC7A 4JV5E 1TN9A 2JR1A 1B69A 2EN8A 1YYWA 5F3WA 1STUA 2EN3A 2L92A 2LUQA 4O24A 3RMPA 4R03A 4JI6E 1RMDA 4WFTA 1N3GA 1UN6B 4BHBA 1DGCA 2LCEA 1ZR9A 2LT7A 4LTYA 4BCAA 2FTXB 2MC5A 1L4SA 4LF9E 4B3TE 1YYOA 3P1XA 2RQLA 2V87A 4TUGA 2EORA 2JOXA 2JP9A 2DSYA 3MHHC 4M30A 4F6NA 2EMXA 2UU9E 3HQ1A 4F2JC 4NHRA 1A1LA 3IWCA 5IT9C 4HEIA 4P78A 3F6GA 1PKPA 5AC5A 5A6JA 2YWQA 2EM8A 2N3GA 2EPZA 3BF2A 4DR3E 1A1JA 3KZZA 4LFBE 2NUGA 4IS1C 3VK6A 5AC4A 2EWLA 4YY3E 3J7Yp 5LLQA 4RH8A 1T4OA 4X65E 2B7TA 5BR8E 4WXCA 4LU9A 2YZTA 2V85A 4DKKA 4BC9A 1X47A 1BB8A 1YYKA 1ZU1A 2K7IA 2I9IA 3C4BA 4OX9E 2B7VA 4BBYA 1EH7A 5KL4A 5T6JA 4DV2E 4NZVA 4F9CB 1BBOA 2RSIA 4N4RB 1EKZA 4KZSA 1ZAAC 5KL3A 2NUFA 4JI4E 4LFCE 4DR2E 1G2DC 2EN7A 2EJ4A 2EPPA 4F6MA 2GPIA 5KL7A 3VYXA 1KYQA 1IQSA 2NA2A 2V83A 1QU6A 3T1HE 3IWBA 2R76A 3ZOQB 2EOSA 1IBKE 2L2NA 4JI7E 4B3ME 3MHSC 3T1YE 2YTIA 2EOEA 2EOXA 4R2RA 2B3TB 2EMGA 2JYAA 2LV2A 4O43A 3EPHA 2VE7C 4X64E 1J5EE 2DRPA 2V86A 2YTPA 1TF3A 3ADJA 3THNA 1LLMC 2LE2A 1ZBTA 4WSGA 2K4VA 4F54A 2EMKA 2EZ6A 2YU8A 1RQ0A 2YTDA 3FIGA 1XNRE 2BB8A 4R2AA 4LF5E 2E1MA 3H09A 3DF6A 4ZYGA 2YTOA 4R2PA 4DV7E 4Q35B 2UXBE 2V88A 2WBUA 4NXME 4J8ZA 3EPLA 1X3CA 2MKDA 2KOUA 2EN6A 2EP3A 2F8BA 2WBSA 2L2MA 2YTJA 2EQ0A 3TQMA 4R2SA 5LMNE 3EPJA 1MGTA 2EN1A 4R2EA 5KL6A 3LMLA 1O0WA 2M4IA 1XMQE 3UK3C 2VRDA 3AV0A 2EPKX 1EH6A 1YSAC 4BS9A 4HTGA 5ADZA 2L33A 4OOGC 2EN2A 2YTQA 2EPRA 1F2IG 1P47A 3JTZA 2N8XA 4DR4E 1IQOA 4JI3E 1WHNA 1XMOE 2LUPB 2LO3A 2GLIA 2L6MA 1A1KA 1GTKA 2EOOA 2CT1A 2EQ3A 3OMLA 2EOZA 3MSWA 4WYQB 1AAYA 4GZNC 2EMIA 2EPAA 2JVAA 2IHR1 2YU5A 2YPNA 3BGHA 1YUIA 4M2ZA 1JK2A 2MKNA 1J26A 3EQ1A 4KHPE 1WHQA 3K6QA 3THOB 1T4LB 1N32E 4DV1E 3OTOE 2Q8UA 1PDAA 4BC7A 2HGHA 4WX9A 1WJPA 2EPOA 1X6EA 1N34E 2EL5A 4GKKE 2VF1A 1HNWE 2LBSB 2UUAE 4DR7E 4RHBB 3KZYA 2WBTA 3EPKA 3ECRA 2EMBA 1NEIA 2R1FA 4P7DA 2CTDA 4JI0E 1PJTA 2YRHA 5IXMB 1X48A 4DV5E 2EMLA 4ZYDA 2RSMA 1HNZE 2EOFA 2HJJA 3M99B 2G7HA 2H36X 4DR6E 4MLVA 1PJSA 5A6BD 2JY9A 4B3SE 1X6HA 2ENAA 2VQFE 2UUCE 4I8OA 4ZYEA 3J7AG 1SR9A 5A6BA 2RTXA 3ADIA 2EPUA 2KHXA 3ADGA 3J81C
chains in the Genus database with same CATH topology
2UU9E 3HQ1A 4J8ZA 2LMZA 2B9DA 3HPSA 2FV4B 3ADLA 3JU0A 3IWCA 4AQYE 4K0KE 5IT9C 1X49A 4LF7E 4P78A 3F6GA 2KOUA 1T4NA 1PKPA 4X8WA 5CFFE 4L5NC 2F8BA 1WXRA 2N3GA 5A2QC 1IBME 2L2MA 4YHHE 1FJGE 1DI2A 1N33E 4DR3E 2DMYA 4JI8E 5LMNE 2UXCE 4LFBE 5AASA 2DIXA 3KWRA 2NUGA 2WZOA 4NXNE 4JYAE 3VK6A 4GEQB 3LMLA 4LF6E 1O0WA 2EWLA 2M4IA 4YY3E 1XMQE 3AV0A 3J7Yp 1GZ6A 4BS9A 3ADGA 2RS7A 5LL6R 4F9AB 1T4OA 3JAMC 5DNYA 4X65E 4M0VA 3J80C 2B7TA 2L33A 5ADZA 4OOGC 4F9BB 5BR8E 4DUYE 4LU9A 2YZTA 2V85A 4DKKA 3F6HA 2KONA 2UUBE 4B3RE 4WSPA 4DR1E 3JTZA 4BC9A 1X47A 1ZBQA 4JI2E 4DR4E 2LTSA 1YYKA 2YT4A 4JI3E 2ZM6E 3C4BA 2N3HA 4OX9E 2RS6A 1WHNA 2B7VA 4BBYA 5T6JA 1XMOE 5AE2A 2V89A 3C4TA 4DV2E 4F9CB 2V8QB 4DR5E 4DV6E 2JWOA 4DMIA 2LUPB 1EKZA 2LJHA 2VQEE 2F4VE 2L6MA 4KZSA 2NUFA 1YZ9A 4JI4E 5AE3A 3OMLA 4LFCE 3MSWA 2CPNA 4WYQB 5AE1A 4DR2E 5FLXC 2JVAA 3DJWA 2IHR1 2LTRA 4M30A 1HR0E 5IWAE 2HHHE 2M7QA 4M2ZA 1N36E 2L8TA 4DV0E 1J26A 2M1SA 4Q28A 4KHPE 1I94E 1WHQA 3K6QA 2NUEA 1T4LB 3VYXA 1N32E 2NA2A 4DV1E 2V83A 2L3JA 3LLHA 3OTOE 3HPZA 1QU6A 3T1HE 3IWBA 1FKAE 4BC7A 4JI5E 2LRSA 3ZOQB 2MC6A 3AUZA 2L2NA 4JI7E 4L8NA 4DUZE 1IBKE 4B3ME 3T1YE 1N34E 4GKKE 2FGGA 2VF1A 4JI1E 1HNWE 2ODRD 1GQEA 2LBSB 1RC7A 2UUAE 4JV5E 4DR7E 2JR1A 2JOBA 2B3TB 4DV3E 1YYWA 1UILA 3HTXA 5F3WA 1DQ3A 1STUA 2VE7C 4X64E 4P7DA 1J5EE 4JI0E 2V86A 1X48A 2L92A 2ODRC 2LUQA 3ADJA 2L3CA 4DV5E 2RSMA 2LE2A 1ZBTA 4BMJA 1HNZE 2K4VA 2L2KB 3RMPA 1IBLE 4R03A 2G7HA 2H36X 4LF8E 4GKJE 4LF4E 4DR6E 4F54A 4JI6E 2EZ6A 4WFTA 5LMUE 2JY9A 3FIGA 4R8OA 2DB2A 4TUIA 4B3SE 2E5LE 2VQFE 2UUCE 4I8OA 1XNQE 1XNRE 1UHZA 4LTYA 2FTXB 4BCAA 2MC5A 4LF5E 3J7AG 1SR9A 2E1MA 3H09A 4X66E 3IWDA 3DF6A 3HXLA 4LF9E 1HNXE 4B3TE 4X62E 4DV4E 3P1XA 1YYOA 2RTXA 2UXDE 4TUGA 2V87A 4DV7E 3ADIA 2JOXA 4WPYA 2MDRA 2DSYA 2UXBE 3VYYA 2KHXA 2V88A 1RQ0A 4NXME 3J81C 4LFAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9D A; 
#chains in the Genus database with same CATH topology
 2YTG A;  2JPA A;  2B9D A;  2FV4 B;  3JU0 A;  1YPN A;  5A6A A;  4K0K E;  2EE8 A;  1X49 A;  2YRK A;  1T4N A;  4X8W A;  5CFF E;  2EOY A;  4L5N C;  1FJG E;  1N33 E;  2DMY A;  2HC5 A;  4IJD A;  1YUJ A;  2DIX A;  4JYA E;  1IMU A;  2YSO A;  2DLK A;  4LF6 E;  2EM9 A;  2EMH A;  2EM7 A;  2DMI A;  1Z1B A;  2D9H A;  4F9A B;  1DI2 A;  1FKA E;  4M0V A;  1WRJ A;  4R2Q A;  1T38 A;  2MDG A;  3C6K A;  5KL5 A;  2EPC A;  2EMC A;  2EOM A;  2UUB E;  2ELZ A;  2LTS A;  1YFH A;  2EM3 A;  2YT4 A;  2N3H A;  2RS6 A;  2GHF A;  2DGC A;  4R2D A;  2EMF A;  2YSP A;  2LJU A;  1NCS A;  2V89 A;  3C4T A;  4DV6 E;  2JWO A;  2DLQ A;  2ENC A;  4DMI A;  1A1I A;  2LJH A;  5AE3 A;  3L00 A;  5AE1 A;  3DJW A;  2HHH E;  2YTF A;  5IWA E;  1G2F C;  1N36 E;  4DV0 E;  2M1S A;  2NAB A;  5A6K A;  1I94 E;  2NUE A;  2M9A A;  1JK1 A;  1QNT A;  3LLH A;  2BBG A;  2EOH A;  2EN4 A;  1TF6 A;  2YTE A;  4L8N A;  2EMW A;  4DUZ E;  2ENH A;  3BBG A;  2YRM A;  1UBD C;  2EMZ A;  2EM6 A;  4DV3 E;  2JOB A;  1UIL A;  5IV8 B;  4BHC A;  2YTN A;  3HTX A;  1DQ3 A;  4X9J A;  2J7J A;  2ODR C;  2L3C A;  4BMJ A;  4FK5 C;  2JXP A;  2L2K B;  1IBL E;  4GKJ E;  4LF8 E;  2EPM X;  5LMU E;  4TUI A;  4R8O A;  2DB2 A;  1T39 A;  1EH8 A;  2E5L E;  2ADR A;  1XNQ E;  3C6M A;  1UHZ A;  2EOJ A;  4R2C A;  4X66 E;  1X5W A;  2EPN A;  3HXL A;  3IWD A;  3VHT B;  1HNX E;  4X62 E;  4DV4 E;  4WXD A;  2UXD E;  2EMA A;  4WPY A;  2MDR A;  4M9V C;  2I13 A;  3VYY A;  4LFA E;  2WCC 3;  2LMZ A;  2EQ1 A;  3HPS A;  3ADL A;  4AQY E;  2UXC E;  4LF7 E;  2F4V E;  1WXR A;  4LF4 E;  5A2Q C;  1IBM E;  2CSH A;  4YHH E;  4JI8 E;  2EM4 A;  1PJQ A;  1SFE A;  1AH5 A;  5TSE A;  5AAS A;  2EM5 A;  3KWR A;  2WZO A;  4NXN E;  2EPX A;  5A69 A;  4GEQ B;  2EOQ A;  1X6F A;  2EMY A;  1GZ6 A;  5DNY A;  2RS7 A;  5LL6 R;  3J80 C;  1MEY C;  2EL4 A;  3JAM C;  4F9B B;  4KWY A;  4DUY E;  4ZYH A;  1BBG A;  2EM2 A;  3F6H A;  2KON A;  4B3R E;  4WSP A;  4DR1 E;  1ZBQ A;  4JI2 E;  2LVH A;  1KJK A;  2EOI A;  1A1F A;  2ZM6 E;  1A1H A;  2E72 A;  5AE2 A;  4DR5 E;  2V8Q B;  2VQE E;  3QG5 C;  2EL6 A;  2RPC A;  1YZ9 A;  1A1G A;  2CPN A;  5FLX C;  2LTR A;  1HR0 E;  5KL2 A;  2M7Q A;  2EPL X;  2A25 A;  2L8T A;  4Q28 A;  2EM0 A;  4MLQ A;  4O5G A;  2ELY A;  2L3J A;  3HPZ A;  4JI5 E;  2LRS A;  2MC6 A;  3AUZ A;  2PRT A;  2FGG A;  4JI1 E;  3BID A;  2ODR D;  1GQE A;  4O4K A;  1RC7 A;  4JV5 E;  1TN9 A;  2JR1 A;  1B69 A;  2EN8 A;  1YYW A;  5F3W A;  1STU A;  2EN3 A;  2L92 A;  2LUQ A;  4O24 A;  3RMP A;  4R03 A;  4JI6 E;  1RMD A;  4WFT A;  1N3G A;  1UN6 B;  4BHB A;  1DGC A;  2LCE A;  1ZR9 A;  2LT7 A;  4LTY A;  4BCA A;  2FTX B;  2MC5 A;  1L4S A;  4LF9 E;  4B3T E;  1YYO A;  3P1X A;  2RQL A;  2V87 A;  4TUG A;  2EOR A;  2JOX A;  2JP9 A;  2DSY A;  3MHH C;  4M30 A;  4F6N A;  2EMX A;  2UU9 E;  3HQ1 A;  4F2J C;  4NHR A;  1A1L A;  3IWC A;  5IT9 C;  4HEI A;  4P78 A;  3F6G A;  1PKP A;  5AC5 A;  5A6J A;  2YWQ A;  2EM8 A;  2N3G A;  2EPZ A;  3BF2 A;  4DR3 E;  1A1J A;  3KZZ A;  4LFB E;  2NUG A;  4IS1 C;  3VK6 A;  5AC4 A;  2EWL A;  4YY3 E;  3J7Y p;  5LLQ A;  4RH8 A;  1T4O A;  4X65 E;  2B7T A;  5BR8 E;  4WXC A;  4LU9 A;  2YZT A;  2V85 A;  4DKK A;  4BC9 A;  1X47 A;  1BB8 A;  1YYK A;  1ZU1 A;  2K7I A;  2I9I A;  3C4B A;  4OX9 E;  2B7V A;  4BBY A;  1EH7 A;  5KL4 A;  5T6J A;  4DV2 E;  4NZV A;  4F9C B;  1BBO A;  2RSI A;  4N4R B;  1EKZ A;  4KZS A;  1ZAA C;  5KL3 A;  2NUF A;  4JI4 E;  4LFC E;  4DR2 E;  1G2D C;  2EN7 A;  2EJ4 A;  2EPP A;  4F6M A;  2GPI A;  5KL7 A;  3VYX A;  1KYQ A;  1IQS A;  2NA2 A;  2V83 A;  1QU6 A;  3T1H E;  3IWB A;  2R76 A;  3ZOQ B;  2EOS A;  1IBK E;  2L2N A;  4JI7 E;  4B3M E;  3MHS C;  3T1Y E;  2YTI A;  2EOE A;  2EOX A;  4R2R A;  2B3T B;  2EMG A;  2JYA A;  2LV2 A;  4O43 A;  3EPH A;  2VE7 C;  4X64 E;  1J5E E;  2DRP A;  2V86 A;  2YTP A;  1TF3 A;  3ADJ A;  3THN A;  1LLM C;  2LE2 A;  1ZBT A;  4WSG A;  2K4V A;  4F54 A;  2EMK A;  2EZ6 A;  2YU8 A;  1RQ0 A;  2YTD A;  3FIG A;  1XNR E;  2BB8 A;  4R2A A;  4LF5 E;  2E1M A;  3H09 A;  3DF6 A;  4ZYG A;  2YTO A;  4R2P A;  4DV7 E;  4Q35 B;  2UXB E;  2V88 A;  2WBU A;  4NXM E;  4J8Z A;  3EPL A;  1X3C A;  2MKD A;  2KOU A;  2EN6 A;  2EP3 A;  2F8B A;  2WBS A;  2L2M A;  2YTJ A;  2EQ0 A;  3TQM A;  4R2S A;  5LMN E;  3EPJ A;  1MGT A;  2EN1 A;  4R2E A;  5KL6 A;  3LML A;  1O0W A;  2M4I A;  1XMQ E;  3UK3 C;  2VRD A;  3AV0 A;  2EPK X;  1EH6 A;  1YSA C;  4BS9 A;  4HTG A;  5ADZ A;  2L33 A;  4OOG C;  2EN2 A;  2YTQ A;  2EPR A;  1F2I G;  1P47 A;  3JTZ A;  2N8X A;  4DR4 E;  1IQO A;  4JI3 E;  1WHN A;  1XMO E;  2LUP B;  2LO3 A;  2GLI A;  2L6M A;  1A1K A;  1GTK A;  2EOO A;  2CT1 A;  2EQ3 A;  3OML A;  2EOZ A;  3MSW A;  4WYQ B;  1AAY A;  4GZN C;  2EMI A;  2EPA A;  2JVA A;  2IHR 1;  2YU5 A;  2YPN A;  3BGH A;  1YUI A;  4M2Z A;  1JK2 A;  2MKN A;  1J26 A;  3EQ1 A;  4KHP E;  1WHQ A;  3K6Q A;  3THO B;  1T4L B;  1N32 E;  4DV1 E;  3OTO E;  2Q8U A;  1PDA A;  4BC7 A;  2HGH A;  4WX9 A;  1WJP A;  2EPO A;  1X6E A;  1N34 E;  2EL5 A;  4GKK E;  2VF1 A;  1HNW E;  2LBS B;  2UUA E;  4DR7 E;  4RHB B;  3KZY A;  2WBT A;  3EPK A;  3ECR A;  2EMB A;  1NEI A;  2R1F A;  4P7D A;  2CTD A;  4JI0 E;  1PJT A;  2YRH A;  5IXM B;  1X48 A;  4DV5 E;  2EML A;  4ZYD A;  2RSM A;  1HNZ E;  2EOF A;  2HJJ A;  3M99 B;  2G7H A;  2H36 X;  4DR6 E;  4MLV A;  1PJS A;  5A6B D;  2JY9 A;  4B3S E;  1X6H A;  2ENA A;  2VQF E;  2UUC E;  4I8O A;  4ZYE A;  3J7A G;  1SR9 A;  5A6B A;  2RTX A;  3ADI A;  2EPU A;  2KHX A;  3ADG A;  3J81 C; 
#chains in the Genus database with same CATH homology
 2UU9 E;  3HQ1 A;  4J8Z A;  2LMZ A;  2B9D A;  3HPS A;  2FV4 B;  3ADL A;  3JU0 A;  3IWC A;  4AQY E;  4K0K E;  5IT9 C;  1X49 A;  4LF7 E;  4P78 A;  3F6G A;  2KOU A;  1T4N A;  1PKP A;  4X8W A;  5CFF E;  4L5N C;  2F8B A;  1WXR A;  2N3G A;  5A2Q C;  1IBM E;  2L2M A;  4YHH E;  1FJG E;  1DI2 A;  1N33 E;  4DR3 E;  2DMY A;  4JI8 E;  5LMN E;  2UXC E;  4LFB E;  5AAS A;  2DIX A;  3KWR A;  2NUG A;  2WZO A;  4NXN E;  4JYA E;  3VK6 A;  4GEQ B;  3LML A;  4LF6 E;  1O0W A;  2EWL A;  2M4I A;  4YY3 E;  1XMQ E;  3AV0 A;  3J7Y p;  1GZ6 A;  4BS9 A;  3ADG A;  2RS7 A;  5LL6 R;  4F9A B;  1T4O A;  3JAM C;  5DNY A;  4X65 E;  4M0V A;  3J80 C;  2B7T A;  2L33 A;  5ADZ A;  4OOG C;  4F9B B;  5BR8 E;  4DUY E;  4LU9 A;  2YZT A;  2V85 A;  4DKK A;  3F6H A;  2KON A;  2UUB E;  4B3R E;  4WSP A;  4DR1 E;  3JTZ A;  4BC9 A;  1X47 A;  1ZBQ A;  4JI2 E;  4DR4 E;  2LTS A;  1YYK A;  2YT4 A;  4JI3 E;  2ZM6 E;  3C4B A;  2N3H A;  4OX9 E;  2RS6 A;  1WHN A;  2B7V A;  4BBY A;  5T6J A;  1XMO E;  5AE2 A;  2V89 A;  3C4T A;  4DV2 E;  4F9C B;  2V8Q B;  4DR5 E;  4DV6 E;  2JWO A;  4DMI A;  2LUP B;  1EKZ A;  2LJH A;  2VQE E;  2F4V E;  2L6M A;  4KZS A;  2NUF A;  1YZ9 A;  4JI4 E;  5AE3 A;  3OML A;  4LFC E;  3MSW A;  2CPN A;  4WYQ B;  5AE1 A;  4DR2 E;  5FLX C;  2JVA A;  3DJW A;  2IHR 1;  2LTR A;  4M30 A;  1HR0 E;  5IWA E;  2HHH E;  2M7Q A;  4M2Z A;  1N36 E;  2L8T A;  4DV0 E;  1J26 A;  2M1S A;  4Q28 A;  4KHP E;  1I94 E;  1WHQ A;  3K6Q A;  2NUE A;  1T4L B;  3VYX A;  1N32 E;  2NA2 A;  4DV1 E;  2V83 A;  2L3J A;  3LLH A;  3OTO E;  3HPZ A;  1QU6 A;  3T1H E;  3IWB A;  1FKA E;  4BC7 A;  4JI5 E;  2LRS A;  3ZOQ B;  2MC6 A;  3AUZ A;  2L2N A;  4JI7 E;  4L8N A;  4DUZ E;  1IBK E;  4B3M E;  3T1Y E;  1N34 E;  4GKK E;  2FGG A;  2VF1 A;  4JI1 E;  1HNW E;  2ODR D;  1GQE A;  2LBS B;  1RC7 A;  2UUA E;  4JV5 E;  4DR7 E;  2JR1 A;  2JOB A;  2B3T B;  4DV3 E;  1YYW A;  1UIL A;  3HTX A;  5F3W A;  1DQ3 A;  1STU A;  2VE7 C;  4X64 E;  4P7D A;  1J5E E;  4JI0 E;  2V86 A;  1X48 A;  2L92 A;  2ODR C;  2LUQ A;  3ADJ A;  2L3C A;  4DV5 E;  2RSM A;  2LE2 A;  1ZBT A;  4BMJ A;  1HNZ E;  2K4V A;  2L2K B;  3RMP A;  1IBL E;  4R03 A;  2G7H A;  2H36 X;  4LF8 E;  4GKJ E;  4LF4 E;  4DR6 E;  4F54 A;  4JI6 E;  2EZ6 A;  4WFT A;  5LMU E;  2JY9 A;  3FIG A;  4R8O A;  2DB2 A;  4TUI A;  4B3S E;  2E5L E;  2VQF E;  2UUC E;  4I8O A;  1XNQ E;  1XNR E;  1UHZ A;  4LTY A;  2FTX B;  4BCA A;  2MC5 A;  4LF5 E;  3J7A G;  1SR9 A;  2E1M A;  3H09 A;  4X66 E;  3IWD A;  3DF6 A;  3HXL A;  4LF9 E;  1HNX E;  4B3T E;  4X62 E;  4DV4 E;  3P1X A;  1YYO A;  2RTX A;  2UXD E;  4TUG A;  2V87 A;  4DV7 E;  3ADI A;  2JOX A;  4WPY A;  2MDR A;  2DSY A;  2UXB E;  3VYY A;  2KHX A;  2V88 A;  1RQ0 A;  4NXM E;  3J81 C;  4LFA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...