2EQ1A

Solution structure of the 9th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 347
publication title Solution structure of the 9th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq1A01
2YTIA 4X9JA 2LT7A 2PRTA 2EMXA 2LV2A 1NCSA 4R2RA 2EN1A 1YSAC 2EMLA 2R1FA 1ZU1A 2EPAA 2NABA 1A1HA 4R2QA 2EM6A 2A25A 2EL6A 2EQ0A 3EPLA 2ADRA 2EM8A 2EOEA 4F6NA 2EOJA 2EM0A 2EN6A 1WJPA 1UBDC 2MDGA 1BB8A 2EMIA 2LO3A 2EL5A 4R2DA 2EMAA 1ZAAC 2MKDA 2YTEA 5KL3A 2MKNA 2EMHA 2EPCA 2CSHA 2EE8A 2BB8A 1X6EA 2EP3A 3UK3C 2EOXA 1RMDA 2YTGA 1X6FA 2EMZA 2DRPA 2EMBA 1TF3A 2GLIA 2EOZA 1TF6A 1LLMC 4F6MA 1ZR9A 2EM9A 2EOIA 2EM4A 2EPZA 2EOHA 3MHSC 2EMYA 2ENHA 2EM7A 2EPXA 2JPAA 1JK1A 2EOMA 2EQ1A 2YRMA 4GZNC 1TN9A 2EN3A 2VRDA 2DLQA 3MHHC 5KL4A 2LCEA 2EN2A 2EPPA 3EPKA 2EOOA 1A1LA 2ENAA 4WSGA 1A1IA 4FK5C 2ELZA 2ELYA 1X5WA 1YUIA 2EQ3A 1A1FA 2EPUA 2DLKA 2LVHA 5KL6A 4R2PA 1F2IG 2YU8A 2EMFA 3EPJA 2WBUA 2EN7A 2YTQA 2JP9A 2D9HA 2YTNA 2GHFA 2YTPA 2YRHA 1G2FC 2I13A 1X6HA 2M9AA 5KL5A 2EMKA 1KJKA 2EN8A 2EN4A 1YUJA 4R2EA 1P47A 2WBTA 1JK2A 4F2JC 1AAYA 4R2AA 1DGCA 2YTJA 2EM2A 1UN6B 2CT1A 2EOFA 2RSIA 2J7JA 5KL2A 2YRKA 2YTFA 1B69A 2ENCA 5KL7A 1A1KA 3VHTB 2EJ4A 2CTDA 1X3CA 2EOSA 2EPRA 3M99B 2HGHA 3EPHA 1BBOA 2WBSA 2EOYA 2EMCA 2RPCA 2YTDA 4IS1C 1G2DC 4IJDA 2EL4A 2WCC3 1A1GA 2YSPA 1A1JA 4R2SA 2YTOA 2EOQA 2YU5A 2EORA 2EMWA 2EMGA 2DMIA 2DGCA 4M9VC 2EM3A 2EM5A 4R2CA 1MEYC 1Z1BA 2E72A 2YSOA
chains in the Genus database with same CATH superfamily
2YTIA 5AE3A 2PRTA 2EMXA 4R2RA 2NUGA 1IMUA 2FV4B 1YSAC 2B7VA 2R1FA 5A6BD 1A1HA 4DR5E 4R2QA 2EWLA 2EM8A 3AV0A 1BB8A 4WSPA 2YT4A 2YPNA 1PJQA 4R2DA 2DIXA 2YTEA 2MKNA 3ADGA 2LJHA 1MGTA 2R76A 5A2QC 2CSHA 2K4VA 1X6EA 2EP3A 2DB2A 2N3HA 3BF2A 2M7QA 4KHPE 1RMDA 4YHHE 2F4VE 3FIGA 3DF6A 2GLIA 3C4BA 4DUYE 4LF4E 1QNTA 1X47A 4P7DA 1EKZA 1RQ0A 2JY9A 3LMLA 1HR0E 2EPXA 2IHR1 5AC4A 2YRMA 3K6QA 3ADJA 3T1HE 2F8BA 1T38A 1TN9A 5KL4A 2LCEA 2RSMA 4L5NC 4DV6E 1A1LA 2ENAA 2UUAE 2ELZA 3VK6A 2EQ3A 2CPNA 4ZYHA 5KL6A 1T39A 4YY3E 2YTNA 2N8XA 2UUCE 4OOGC 3HQ1A 2EN4A 4F9AB 4R2EA 4F2JC 2L2KB 2YWQA 3DJWA 2UXDE 3ECRA 2V89A 1UN6B 3J7AG 2RSIA 2JYAA 5BR8E 2J7JA 2ODRC 2UU9E 4GKJE 3IWCA 1STUA 4R8OA 5KL7A 2EJ4A 2EOSA 1X3CA 5AE2A 2LUPB 2EOYA 2RPCA 2RTXA 1FKAE 4IS1C 4LF6E 4F54A 2WCC3 4BMJA 1A1GA 2YSPA 3HXLA 4J8ZA 5F3WA 4NXME 5LMUE 3VYYA 2DGCA 4WPYA 2EM3A 4LF5E 2EPNA 1MEYC 4DR6E 4M0VA 1PJSA 2E72A 4DR2E 4WX9A 5DNYA 2LJUA 4KZSA 4Q35B 1XMOE 2ZM6E 4M2ZA 5A6BA 4JI3E 4JI1E 1YYOA 1ZU1A 2EPAA 2EL6A 2EQ0A 3EPLA 2ADRA 4WXDA 1J5EE 2EOEA 2EM0A 2MDGA 2V83A 1GQEA 2LO3A 4OX9E 2EL5A 1PDAA 1ZAAC 2MKDA 2FGGA 1T4LB 4F9CB 4B3RE 4DV3E 2BB8A 1GZ6A 3H09A 3JU0A 1N36E 4X66E 3OMLA 2JXPA 2YTGA 2DRPA 1X48A 4BC9A 2VE7C 5A69A 1WRJA 2EM9A 5FLXC 3ZOQB 2V86A 2LTRA 2EOIA 1PKPA 2EPZA 5IXMB 5T6JA 4AQYE 3MHSC 4JI5E 2JPAA 4MLQA 3BGHA 3HTXA 2VRDA 2N3GA 2JOBA 4GEQB 2EN2A 1IBKE 2UXBE 2JVAA 4X64E 1GTKA 1YUIA 4DV0E 3ADLA 1DQ3A 1A1FA 2DLKA 2LVHA 2VQFE 4R03A 3EPJA 2L33A 3F6HA 2EN7A 2YTQA 2JWOA 1X6HA 5KL5A 4BHBA 4LF7E 4DV5E 2B9DA 1YUJA 4MLVA 1JK2A 2EPMX 2MDRA 2YTJA 1L4SA 1EH8A 2CT1A 2YRKA 2YTFA 1B69A 2ENCA 1IQOA 5CFFE 1O0WA 3VHTB 1HNWE 3EPHA 2EPRA 1BBOA 2WBSA 3TQMA 3C4TA 1XNRE 4JI6E 2EMCA 3LLHA 5ADZA 2YTDA 4JV5E 4IJDA 1FJGE 1A1JA 4B3ME 2VQEE 2EORA 2EMGA 2DMIA 2EPOA 2EM5A 3JAMC 3C6KA 4JI8E 5IV8B 4M30A 2YSOA 4X9JA 2LT7A 2LV2A 2WZOA 1YYKA 1WHNA 3BBGA 5LMNE 1T4NA 2UXCE 5TSEA 2DMYA 3IWDA 2VF1A 2EMLA 4X8WA 3VYXA 2NABA 2A25A 3J7Yp 1N33E 4WFTA 4F6NA 4JYAE 1NEIA 2EN6A 2LUQA 4ZYEA 2EMAA 2FTXB 4JI7E 4DR4E 5LL6R 2I9IA 2EMHA 2RS6A 4GKKE 2EE8A 5AE1A 3UK3C 4TUGA 4B3TE 1ZBTA 2B7TA 1X49A 2E1MA 2EMZA 1TF3A 2EOZA 1TF6A 1YFHA 4WYQB 4F6MA 2B3TB 4L8NA 4HEIA 3T1YE 2EOHA 1IBLE 3KZYA 2YZTA 2EMYA 2EM7A 3L00A 4NZVA 2JR1A 1N32E 1JK1A 2EOMA 2EQ1A 3OTOE 3IWBA 2EN3A 2HJJA 3QG5C 2EPPA 3C6MA 1A1IA 4FK5C 2ELYA 1BBGA 1X5WA 2L3CA 2V87A 2LBSB 4R2PA 1F2IG 2EMFA 4BC7A 4DUZE 2LTSA 3KZZA 2GHFA 2YRHA 2I13A 1RC7A 4LTYA 2EN8A 2V8QB 2LRSA 4NXNE 1SR9A 4JI2E 4LF8E 1XMQE 4DV2E 5A6JA 3HPSA 1WHQA 1A1KA 4O4KA 2CTDA 4Q28A 3THOB 3BIDA 1YYWA 2Q8UA 3THNA 4DR1E 2LE2A 2LMZA 4O43A 4ZYGA 1G2DC 3RMPA 2EL4A 2L8TA 3ADIA 2YTOA 2EOQA 2YU5A 2H36X 5A6KA 4O5GA 4M9VC 1PJTA 4R2CA 4DR7E 1Z1BA 4LFBE 1WXRA 4TUIA 4LU9A 4ZYDA 1IQSA 2BBGA 3JTZA 1NCSA 2EN1A 4DKKA 2HHHE 2EM6A 2V85A 5LLQA 2EOJA 1WJPA 1UBDC 1UILA 2EMIA 4DV1E 3J80C 2KOUA 2EPKX 4LFAE 5KL3A 4B3SE 1T4OA 1AH5A 2EPCA 4LF9E 3F6GA 2EPLX 1YZ9A 5IWAE 2E5LE 1IBME 4JI4E 2M4IA 2EOXA 1I94E 2NUEA 1X6FA 2EMBA 1J26A 4JI0E 2RQLA 2ODRD 1HNZE 2RS7A 1LLMC 2K7IA 1ZR9A 1EH7A 2EZ6A 4F9BB 2EM4A 1SFEA 4BS9A 3AUZA 1N34E 2G7HA 2ENHA 4I8OA 4RHBB 2NUFA 4GZNC 2L2MA 2M1SA 4DR3E 3MHHC 2DLQA 2JOXA 5AASA 2UUBE 3EPKA 5A6AA 2EOOA 4WSGA 5AC5A 1QU6A 1EH6A 2EPUA 4DMIA 2YU8A 2WBUA 2HC5A 2JP9A 2D9HA 2YTPA 2MC6A 4DV4E 2L2NA 1G2FC 2KONA 2M9AA 2GPIA 2MC5A 4KWYA 4X65E 2EMKA 1XNQE 1KJKA 3P1XA 1ZBQA 2KHXA 4DV7E 4N4RB 1P47A 2WBTA 4BBYA 1AAYA 4R2AA 1DGCA 3KWRA 2EM2A 3HPZA 4HTGA 4BCAA 1UHZA 1DI2A 2EOFA 4RH8A 5KL2A 4BHCA 2NA2A 2V88A 4P78A 3EQ1A 3M99B 2HGHA 3J81C 1YPNA 1KYQA 4X62E 4R2SA 2L92A 2L3JA 4NHRA 4LFCE 4WXCA 2EMWA 2DSYA 1N3GA 2L6MA 4K0KE 3MSWA 4O24A 5IT9C 1HNXE
chains in the Genus database with same CATH topology
2YTIA 4X9JA 2LT7A 2PRTA 2EMXA 2LV2A 1NCSA 4R2RA 2EN1A 1YSAC 2EMLA 2R1FA 1ZU1A 2EPAA 2NABA 1A1HA 4R2QA 2EM6A 2A25A 2EL6A 2EQ0A 3EPLA 2ADRA 2EM8A 2EOEA 4F6NA 2EOJA 2EM0A 2EN6A 1WJPA 1UBDC 2MDGA 1BB8A 2EMIA 2LO3A 2EL5A 4R2DA 2EMAA 1ZAAC 2MKDA 2YTEA 5KL3A 2MKNA 2EMHA 2EPCA 2CSHA 2EE8A 2BB8A 1X6EA 2EP3A 3UK3C 2EOXA 1RMDA 2YTGA 1X6FA 2EMZA 2DRPA 2EMBA 1TF3A 2GLIA 2EOZA 1TF6A 1LLMC 4F6MA 1ZR9A 2EM9A 2EOIA 2EM4A 2EPZA 2EOHA 3MHSC 2EMYA 2ENHA 2EM7A 2EPXA 2JPAA 1JK1A 2EOMA 2EQ1A 2YRMA 4GZNC 1TN9A 2EN3A 2VRDA 2DLQA 3MHHC 5KL4A 2LCEA 2EN2A 2EPPA 3EPKA 2EOOA 1A1LA 2ENAA 4WSGA 1A1IA 4FK5C 2ELZA 2ELYA 1X5WA 1YUIA 2EQ3A 1A1FA 2EPUA 2DLKA 2LVHA 5KL6A 4R2PA 1F2IG 2YU8A 2EMFA 3EPJA 2WBUA 2EN7A 2YTQA 2JP9A 2D9HA 2YTNA 2GHFA 2YTPA 2YRHA 1G2FC 2I13A 1X6HA 2M9AA 5KL5A 2EMKA 1KJKA 2EN8A 2EN4A 1YUJA 4R2EA 1P47A 2WBTA 1JK2A 4F2JC 1AAYA 4R2AA 1DGCA 2YTJA 2EM2A 1UN6B 2CT1A 2EOFA 2RSIA 2J7JA 5KL2A 2YRKA 2YTFA 1B69A 2ENCA 5KL7A 1A1KA 3VHTB 2EJ4A 2CTDA 1X3CA 2EOSA 2EPRA 3M99B 2HGHA 3EPHA 1BBOA 2WBSA 2EOYA 2EMCA 2RPCA 2YTDA 4IS1C 1G2DC 4IJDA 2EL4A 2WCC3 1A1GA 2YSPA 1A1JA 4R2SA 2YTOA 2EOQA 2YU5A 2EORA 2EMWA 2EMGA 2DMIA 2DGCA 4M9VC 2EM3A 2EM5A 4R2CA 1MEYC 1Z1BA 2E72A 2YSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTI A;  4X9J A;  2LT7 A;  2PRT A;  2EMX A;  2LV2 A;  1NCS A;  4R2R A;  2EN1 A;  1YSA C;  2EML A;  2R1F A;  1ZU1 A;  2EPA A;  2NAB A;  1A1H A;  4R2Q A;  2EM6 A;  2A25 A;  2EL6 A;  2EQ0 A;  3EPL A;  2ADR A;  2EM8 A;  2EOE A;  4F6N A;  2EOJ A;  2EM0 A;  2EN6 A;  1WJP A;  1UBD C;  2MDG A;  1BB8 A;  2EMI A;  2LO3 A;  2EL5 A;  4R2D A;  2EMA A;  1ZAA C;  2MKD A;  2YTE A;  5KL3 A;  2MKN A;  2EMH A;  2EPC A;  2CSH A;  2EE8 A;  2BB8 A;  1X6E A;  2EP3 A;  3UK3 C;  2EOX A;  1RMD A;  2YTG A;  1X6F A;  2EMZ A;  2DRP A;  2EMB A;  1TF3 A;  2GLI A;  2EOZ A;  1TF6 A;  1LLM C;  4F6M A;  1ZR9 A;  2EM9 A;  2EOI A;  2EM4 A;  2EPZ A;  2EOH A;  3MHS C;  2EMY A;  2ENH A;  2EM7 A;  2EPX A;  2JPA A;  1JK1 A;  2EOM A;  2EQ1 A;  2YRM A;  4GZN C;  1TN9 A;  2EN3 A;  2VRD A;  2DLQ A;  3MHH C;  5KL4 A;  2LCE A;  2EN2 A;  2EPP A;  3EPK A;  2EOO A;  1A1L A;  2ENA A;  4WSG A;  1A1I A;  4FK5 C;  2ELZ A;  2ELY A;  1X5W A;  1YUI A;  2EQ3 A;  1A1F A;  2EPU A;  2DLK A;  2LVH A;  5KL6 A;  4R2P A;  1F2I G;  2YU8 A;  2EMF A;  3EPJ A;  2WBU A;  2EN7 A;  2YTQ A;  2JP9 A;  2D9H A;  2YTN A;  2GHF A;  2YTP A;  2YRH A;  1G2F C;  2I13 A;  1X6H A;  2M9A A;  5KL5 A;  2EMK A;  1KJK A;  2EN8 A;  2EN4 A;  1YUJ A;  4R2E A;  1P47 A;  2WBT A;  1JK2 A;  4F2J C;  1AAY A;  4R2A A;  1DGC A;  2YTJ A;  2EM2 A;  1UN6 B;  2CT1 A;  2EOF A;  2RSI A;  2J7J A;  5KL2 A;  2YRK A;  2YTF A;  1B69 A;  2ENC A;  5KL7 A;  1A1K A;  3VHT B;  2EJ4 A;  2CTD A;  1X3C A;  2EOS A;  2EPR A;  3M99 B;  2HGH A;  3EPH A;  1BBO A;  2WBS A;  2EOY A;  2EMC A;  2RPC A;  2YTD A;  4IS1 C;  1G2D C;  4IJD A;  2EL4 A;  2WCC 3;  1A1G A;  2YSP A;  1A1J A;  4R2S A;  2YTO A;  2EOQ A;  2YU5 A;  2EOR A;  2EMW A;  2EMG A;  2DMI A;  2DGC A;  4M9V C;  2EM3 A;  2EM5 A;  4R2C A;  1MEY C;  1Z1B A;  2E72 A;  2YSO A; 
#chains in the Genus database with same CATH topology
 2YTI A;  5AE3 A;  2PRT A;  2EMX A;  4R2R A;  2NUG A;  1IMU A;  2FV4 B;  1YSA C;  2B7V A;  2R1F A;  5A6B D;  1A1H A;  4DR5 E;  4R2Q A;  2EWL A;  2EM8 A;  3AV0 A;  1BB8 A;  4WSP A;  2YT4 A;  2YPN A;  1PJQ A;  4R2D A;  2DIX A;  2YTE A;  2MKN A;  3ADG A;  2LJH A;  1MGT A;  2R76 A;  5A2Q C;  2CSH A;  2K4V A;  1X6E A;  2EP3 A;  2DB2 A;  2N3H A;  3BF2 A;  2M7Q A;  4KHP E;  1RMD A;  4YHH E;  2F4V E;  3FIG A;  3DF6 A;  2GLI A;  3C4B A;  4DUY E;  4LF4 E;  1QNT A;  1X47 A;  4P7D A;  1EKZ A;  1RQ0 A;  2JY9 A;  3LML A;  1HR0 E;  2EPX A;  2IHR 1;  5AC4 A;  2YRM A;  3K6Q A;  3ADJ A;  3T1H E;  2F8B A;  1T38 A;  1TN9 A;  5KL4 A;  2LCE A;  2RSM A;  4L5N C;  4DV6 E;  1A1L A;  2ENA A;  2UUA E;  2ELZ A;  3VK6 A;  2EQ3 A;  2CPN A;  4ZYH A;  5KL6 A;  1T39 A;  4YY3 E;  2YTN A;  2N8X A;  2UUC E;  4OOG C;  3HQ1 A;  2EN4 A;  4F9A B;  4R2E A;  4F2J C;  2L2K B;  2YWQ A;  3DJW A;  2UXD E;  3ECR A;  2V89 A;  1UN6 B;  3J7A G;  2RSI A;  2JYA A;  5BR8 E;  2J7J A;  2ODR C;  2UU9 E;  4GKJ E;  3IWC A;  1STU A;  4R8O A;  5KL7 A;  2EJ4 A;  2EOS A;  1X3C A;  5AE2 A;  2LUP B;  2EOY A;  2RPC A;  2RTX A;  1FKA E;  4IS1 C;  4LF6 E;  4F54 A;  2WCC 3;  4BMJ A;  1A1G A;  2YSP A;  3HXL A;  4J8Z A;  5F3W A;  4NXM E;  5LMU E;  3VYY A;  2DGC A;  4WPY A;  2EM3 A;  4LF5 E;  2EPN A;  1MEY C;  4DR6 E;  4M0V A;  1PJS A;  2E72 A;  4DR2 E;  4WX9 A;  5DNY A;  2LJU A;  4KZS A;  4Q35 B;  1XMO E;  2ZM6 E;  4M2Z A;  5A6B A;  4JI3 E;  4JI1 E;  1YYO A;  1ZU1 A;  2EPA A;  2EL6 A;  2EQ0 A;  3EPL A;  2ADR A;  4WXD A;  1J5E E;  2EOE A;  2EM0 A;  2MDG A;  2V83 A;  1GQE A;  2LO3 A;  4OX9 E;  2EL5 A;  1PDA A;  1ZAA C;  2MKD A;  2FGG A;  1T4L B;  4F9C B;  4B3R E;  4DV3 E;  2BB8 A;  1GZ6 A;  3H09 A;  3JU0 A;  1N36 E;  4X66 E;  3OML A;  2JXP A;  2YTG A;  2DRP A;  1X48 A;  4BC9 A;  2VE7 C;  5A69 A;  1WRJ A;  2EM9 A;  5FLX C;  3ZOQ B;  2V86 A;  2LTR A;  2EOI A;  1PKP A;  2EPZ A;  5IXM B;  5T6J A;  4AQY E;  3MHS C;  4JI5 E;  2JPA A;  4MLQ A;  3BGH A;  3HTX A;  2VRD A;  2N3G A;  2JOB A;  4GEQ B;  2EN2 A;  1IBK E;  2UXB E;  2JVA A;  4X64 E;  1GTK A;  1YUI A;  4DV0 E;  3ADL A;  1DQ3 A;  1A1F A;  2DLK A;  2LVH A;  2VQF E;  4R03 A;  3EPJ A;  2L33 A;  3F6H A;  2EN7 A;  2YTQ A;  2JWO A;  1X6H A;  5KL5 A;  4BHB A;  4LF7 E;  4DV5 E;  2B9D A;  1YUJ A;  4MLV A;  1JK2 A;  2EPM X;  2MDR A;  2YTJ A;  1L4S A;  1EH8 A;  2CT1 A;  2YRK A;  2YTF A;  1B69 A;  2ENC A;  1IQO A;  5CFF E;  1O0W A;  3VHT B;  1HNW E;  3EPH A;  2EPR A;  1BBO A;  2WBS A;  3TQM A;  3C4T A;  1XNR E;  4JI6 E;  2EMC A;  3LLH A;  5ADZ A;  2YTD A;  4JV5 E;  4IJD A;  1FJG E;  1A1J A;  4B3M E;  2VQE E;  2EOR A;  2EMG A;  2DMI A;  2EPO A;  2EM5 A;  3JAM C;  3C6K A;  4JI8 E;  5IV8 B;  4M30 A;  2YSO A;  4X9J A;  2LT7 A;  2LV2 A;  2WZO A;  1YYK A;  1WHN A;  3BBG A;  5LMN E;  1T4N A;  2UXC E;  5TSE A;  2DMY A;  3IWD A;  2VF1 A;  2EML A;  4X8W A;  3VYX A;  2NAB A;  2A25 A;  3J7Y p;  1N33 E;  4WFT A;  4F6N A;  4JYA E;  1NEI A;  2EN6 A;  2LUQ A;  4ZYE A;  2EMA A;  2FTX B;  4JI7 E;  4DR4 E;  5LL6 R;  2I9I A;  2EMH A;  2RS6 A;  4GKK E;  2EE8 A;  5AE1 A;  3UK3 C;  4TUG A;  4B3T E;  1ZBT A;  2B7T A;  1X49 A;  2E1M A;  2EMZ A;  1TF3 A;  2EOZ A;  1TF6 A;  1YFH A;  4WYQ B;  4F6M A;  2B3T B;  4L8N A;  4HEI A;  3T1Y E;  2EOH A;  1IBL E;  3KZY A;  2YZT A;  2EMY A;  2EM7 A;  3L00 A;  4NZV A;  2JR1 A;  1N32 E;  1JK1 A;  2EOM A;  2EQ1 A;  3OTO E;  3IWB A;  2EN3 A;  2HJJ A;  3QG5 C;  2EPP A;  3C6M A;  1A1I A;  4FK5 C;  2ELY A;  1BBG A;  1X5W A;  2L3C A;  2V87 A;  2LBS B;  4R2P A;  1F2I G;  2EMF A;  4BC7 A;  4DUZ E;  2LTS A;  3KZZ A;  2GHF A;  2YRH A;  2I13 A;  1RC7 A;  4LTY A;  2EN8 A;  2V8Q B;  2LRS A;  4NXN E;  1SR9 A;  4JI2 E;  4LF8 E;  1XMQ E;  4DV2 E;  5A6J A;  3HPS A;  1WHQ A;  1A1K A;  4O4K A;  2CTD A;  4Q28 A;  3THO B;  3BID A;  1YYW A;  2Q8U A;  3THN A;  4DR1 E;  2LE2 A;  2LMZ A;  4O43 A;  4ZYG A;  1G2D C;  3RMP A;  2EL4 A;  2L8T A;  3ADI A;  2YTO A;  2EOQ A;  2YU5 A;  2H36 X;  5A6K A;  4O5G A;  4M9V C;  1PJT A;  4R2C A;  4DR7 E;  1Z1B A;  4LFB E;  1WXR A;  4TUI A;  4LU9 A;  4ZYD A;  1IQS A;  2BBG A;  3JTZ A;  1NCS A;  2EN1 A;  4DKK A;  2HHH E;  2EM6 A;  2V85 A;  5LLQ A;  2EOJ A;  1WJP A;  1UBD C;  1UIL A;  2EMI A;  4DV1 E;  3J80 C;  2KOU A;  2EPK X;  4LFA E;  5KL3 A;  4B3S E;  1T4O A;  1AH5 A;  2EPC A;  4LF9 E;  3F6G A;  2EPL X;  1YZ9 A;  5IWA E;  2E5L E;  1IBM E;  4JI4 E;  2M4I A;  2EOX A;  1I94 E;  2NUE A;  1X6F A;  2EMB A;  1J26 A;  4JI0 E;  2RQL A;  2ODR D;  1HNZ E;  2RS7 A;  1LLM C;  2K7I A;  1ZR9 A;  1EH7 A;  2EZ6 A;  4F9B B;  2EM4 A;  1SFE A;  4BS9 A;  3AUZ A;  1N34 E;  2G7H A;  2ENH A;  4I8O A;  4RHB B;  2NUF A;  4GZN C;  2L2M A;  2M1S A;  4DR3 E;  3MHH C;  2DLQ A;  2JOX A;  5AAS A;  2UUB E;  3EPK A;  5A6A A;  2EOO A;  4WSG A;  5AC5 A;  1QU6 A;  1EH6 A;  2EPU A;  4DMI A;  2YU8 A;  2WBU A;  2HC5 A;  2JP9 A;  2D9H A;  2YTP A;  2MC6 A;  4DV4 E;  2L2N A;  1G2F C;  2KON A;  2M9A A;  2GPI A;  2MC5 A;  4KWY A;  4X65 E;  2EMK A;  1XNQ E;  1KJK A;  3P1X A;  1ZBQ A;  2KHX A;  4DV7 E;  4N4R B;  1P47 A;  2WBT A;  4BBY A;  1AAY A;  4R2A A;  1DGC A;  3KWR A;  2EM2 A;  3HPZ A;  4HTG A;  4BCA A;  1UHZ A;  1DI2 A;  2EOF A;  4RH8 A;  5KL2 A;  4BHC A;  2NA2 A;  2V88 A;  4P78 A;  3EQ1 A;  3M99 B;  2HGH A;  3J81 C;  1YPN A;  1KYQ A;  4X62 E;  4R2S A;  2L92 A;  2L3J A;  4NHR A;  4LFC E;  4WXC A;  2EMW A;  2DSY A;  1N3G A;  2L6M A;  4K0K E;  3MSW A;  4O24 A;  5IT9 C;  1HNX E; 
#chains in the Genus database with same CATH homology
 2YTI A;  4X9J A;  2LT7 A;  2PRT A;  2EMX A;  2LV2 A;  1NCS A;  4R2R A;  2EN1 A;  1YSA C;  2EML A;  2R1F A;  1ZU1 A;  2EPA A;  2NAB A;  1A1H A;  4R2Q A;  2EM6 A;  2A25 A;  2EL6 A;  2EQ0 A;  3EPL A;  2ADR A;  2EM8 A;  2EOE A;  4F6N A;  2EOJ A;  2EM0 A;  2EN6 A;  1WJP A;  1UBD C;  2MDG A;  1BB8 A;  2EMI A;  2LO3 A;  2EL5 A;  4R2D A;  2EMA A;  1ZAA C;  2MKD A;  2YTE A;  5KL3 A;  2MKN A;  2EMH A;  2EPC A;  2CSH A;  2EE8 A;  2BB8 A;  1X6E A;  2EP3 A;  3UK3 C;  2EOX A;  1RMD A;  2YTG A;  1X6F A;  2EMZ A;  2DRP A;  2EMB A;  1TF3 A;  2GLI A;  2EOZ A;  1TF6 A;  1LLM C;  4F6M A;  1ZR9 A;  2EM9 A;  2EOI A;  2EM4 A;  2EPZ A;  2EOH A;  3MHS C;  2EMY A;  2ENH A;  2EM7 A;  2EPX A;  2JPA A;  1JK1 A;  2EOM A;  2EQ1 A;  2YRM A;  4GZN C;  1TN9 A;  2EN3 A;  2VRD A;  2DLQ A;  3MHH C;  5KL4 A;  2LCE A;  2EN2 A;  2EPP A;  3EPK A;  2EOO A;  1A1L A;  2ENA A;  4WSG A;  1A1I A;  4FK5 C;  2ELZ A;  2ELY A;  1X5W A;  1YUI A;  2EQ3 A;  1A1F A;  2EPU A;  2DLK A;  2LVH A;  5KL6 A;  4R2P A;  1F2I G;  2YU8 A;  2EMF A;  3EPJ A;  2WBU A;  2EN7 A;  2YTQ A;  2JP9 A;  2D9H A;  2YTN A;  2GHF A;  2YTP A;  2YRH A;  1G2F C;  2I13 A;  1X6H A;  2M9A A;  5KL5 A;  2EMK A;  1KJK A;  2EN8 A;  2EN4 A;  1YUJ A;  4R2E A;  1P47 A;  2WBT A;  1JK2 A;  4F2J C;  1AAY A;  4R2A A;  1DGC A;  2YTJ A;  2EM2 A;  1UN6 B;  2CT1 A;  2EOF A;  2RSI A;  2J7J A;  5KL2 A;  2YRK A;  2YTF A;  1B69 A;  2ENC A;  5KL7 A;  1A1K A;  3VHT B;  2EJ4 A;  2CTD A;  1X3C A;  2EOS A;  2EPR A;  3M99 B;  2HGH A;  3EPH A;  1BBO A;  2WBS A;  2EOY A;  2EMC A;  2RPC A;  2YTD A;  4IS1 C;  1G2D C;  4IJD A;  2EL4 A;  2WCC 3;  1A1G A;  2YSP A;  1A1J A;  4R2S A;  2YTO A;  2EOQ A;  2YU5 A;  2EOR A;  2EMW A;  2EMG A;  2DMI A;  2DGC A;  4M9V C;  2EM3 A;  2EM5 A;  4R2C A;  1MEY C;  1Z1B A;  2E72 A;  2YSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...