2EQ1A

Solution structure of the 9th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Zinc finger protein 347
publication title Solution structure of the 9th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq1A01
2EM8A 2EMGA 2EM2A 2EMHA 1P47A 5KL6A 1RMDA 2EM4A 2EN1A 3MHHC 1NCSA 2EM9A 2EMYA 2EORA 2RSIA 4F2JC 2EOYA 2ELZA 2EPZA 2EPUA 1B69A 2YU8A 1ZR9A 2YTJA 2EMCA 2WCC3 3EPJA 1A1GA 2DLKA 1Z1BA 5KL4A 1ZAAC 2JP9A 2EM3A 2WBUA 2GHFA 3MHSC 4GZNC 4IS1C 2EPCA 4M9VC 2EOOA 1ZU1A 3EPHA 1A1HA 4R2SA 1TF6A 2I13A 2EMLA 1YSAC 2ENHA 4R2RA 1KJKA 2EN7A 1BB8A 2YTNA 2YTGA 2EN6A 2DMIA 2ELYA 2EP3A 2EQ1A 2EOZA 1X5WA 2YU5A 5KL3A 1A1KA 1G2FC 1YUJA 3EPLA 3M99B 2YTQA 5KL7A 2LV2A 2LCEA 1BBOA 1F2IG 2PRTA 2DLQA 2EM5A 2E72A 4IJDA 2EMZA 2ADRA 2EJ4A 2EPPA 1X6EA 2EE8A 2EN8A 1A1IA 2YTEA 1TF3A 2R1FA 1A1LA 3UK3C 1YUIA 5KL2A 2NABA 2YRKA 2YTDA 2YSPA 4R2AA 2EOXA 2RPCA 2EOJA 2EPAA 2DGCA 2EOHA 5KL5A 2EOMA 2EPRA 2EMFA 2A25A 2ENAA 4F6NA 1A1FA 1LLMC 2EN4A 2YSOA 2LVHA 4WSGA 2LT7A 2EMAA 2EMXA 2EOEA 4F6MA 2EMIA 2EOIA 2EL5A 2EOQA 2YTIA 2EOFA 2BB8A 2EMBA 2EMKA 2EOSA 2EL6A 1X6HA 2EMWA 1UN6B 2ENCA 2GLIA 2EN2A 2LO3A 2DRPA 2MKNA 3VHTB 1JK2A 1TN9A 2WBTA 2EQ3A 4R2PA 2CT1A 2YRMA 4FK5C 3EPKA 2HGHA 2MDGA 2YRHA 1UBDC 1A1JA 4R2EA 2VRDA 2CTDA 2YTOA 4R2DA 1AAYA 2YTFA 1G2DC 2EQ0A 2YTPA 4R2QA 1X6FA 2WBSA 1JK1A 2MKDA 4X9JA 1WJPA 2JPAA 2EL4A 2EM6A 2EN3A 2EPXA 2M9AA 1DGCA 1X3CA 4R2CA 1MEYC 2EM7A 2CSHA 2EM0A 2J7JA 2D9HA
chains in the Genus database with same CATH superfamily
2EM8A 1EH7A 2EMHA 1P47A 4BHBA 1YYKA 2HHHE 2EPLX 4R8OA 2EOYA 2F8BA 1WHNA 4MLQA 1IBKE 3ZOQB 1IQSA 3EPJA 5AASA 2DLKA 5KL4A 3C6KA 3VYYA 1ZAAC 2LBSB 1X49A 4GZNC 4M9VC 2EOOA 3P1XA 1ZBTA 1HNZE 4HEIA 2I13A 2EPMX 2FTXB 1RQ0A 3HPSA 1YSAC 4LF8E 1WHQA 3BBGA 2L3JA 3AV0A 2ELYA 2MC6A 1X5WA 2B3TB 3M99B 2YTQA 1F2IG 4KHPE 4DV6E 2EPPA 1TF3A 1A1LA 4WSPA 4X8WA 2UUCE 2K4VA 1YUIA 4GKKE 2V85A 3HPZA 2EOXA 2UUAE 2EOJA 2EPAA 4O24A 2EOHA 2L6MA 3ADGA 2A25A 1YYOA 4Q35B 2EN4A 3OTOE 1SR9A 5AE2A 1AH5A 5DNYA 2EMIA 3RMPA 4DR1E 2BB8A 2EMKA 4B3RE 2M4IA 4DV7E 4AQYE 2UU9E 2WBTA 4B3TE 4FK5C 1XNRE 4DV2E 1PJTA 5LL6R 4Q28A 1XMOE 1T38A 1AAYA 4BC7A 2M1SA 2EWLA 4JI5E 3JAMC 4P78A 4X9JA 2JY9A 2V87A 1T4LB 4O5GA 2YT4A 4DKKA 2VQFE 1YYWA 1DGCA 2CPNA 5A6AA 4LF7E 2EM7A 1X48A 3EQ1A 2D9HA 4DMIA 5KL6A 1RMDA 2EM4A 2E5LE 4BC9A 2HC5A 4M30A 2EPZA 4JI0E 4R03A 2LJUA 3ADLA 2YU8A 2ZM6E 4DR5E 3K6QA 2YTJA 4ZYEA 1GZ6A 2WCC3 2BBGA 1A1GA 2JP9A 2WBUA 4LFBE 4DV1E 3DJWA 4RH8A 4BBYA 1UILA 1A1HA 4L5NC 3THOB 2ENHA 4LF5E 4R2RA 1BB8A 1HNXE 2EP3A 1N36E 1DQ3A 5KL7A 2DB2A 2LV2A 1IQOA 3H09A 5IT9C 4IJDA 2EMZA 2ADRA 2RTXA 1X6EA 2EN8A 2UXCE 2VF1A 4ZYGA 1DI2A 3F6HA 2YSPA 2RPCA 4X62E 3J81C 2UXBE 4LU9A 1J26A 2ENAA 4WXCA 1A1FA 1NEIA 4WPYA 1LLMC 4DR3E 4K0KE 2YSOA 1HNWE 2LVHA 4WSGA 2EMXA 2L2MA 4F6MA 4TUIA 2EL5A 2EOQA 2EOFA 2FGGA 3J7AG 1X47A 4NXNE 2H36X 5AC5A 2EN2A 2DRPA 2EPNA 4DR7E 1XMQE 5IXMB 4R2PA 4P7DA 2YRMA 4HTGA 3BGHA 4OX9E 2WZOA 4GEQB 2LUQA 1UBDC 3LLHA 1A1JA 3J80C 4LF9E 3QG5C 2YTFA 4LF6E 4R2QA 3THNA 4BCAA 4JYAE 1X6FA 3T1HE 2WBSA 4M2ZA 1WJPA 2LTSA 5AE1A 3OMLA 2YWQA 4B3SE 2V8QB 2M9AA 4O4KA 1I94E 4LFAE 4MLVA 1PDAA 3IWDA 2KHXA 4WXDA 1J5EE 1HR0E 2LMZA 1L4SA 4I8OA 1N34E 2EN1A 2EM9A 4O43A 1SFEA 2EORA 4DR6E 2N3GA 4JI3E 1B69A 2L92A 1T4OA 2EPUA 1ZR9A 3TQMA 4M0VA 3ADJA 2V88A 4JI4E 4BMJA 1FKAE 2EM3A 4LTYA 5A6JA 4DUZE 2GHFA 3AUZA 2G7HA 4IS1C 2EPCA 5A2QC 4L8NA 2IHR1 5F3WA 2YPNA 1T4NA 4DV0E 4WFTA 1MGTA 2EMLA 1KJKA 3KZYA 3J7Yp 3C6MA 2EN7A 2V89A 2YTGA 2EQ1A 2V86A 3IWCA 2KONA 5KL3A 2JVAA 5FLXC 4ZYDA 3KZZA 2LCEA 2NUEA 2RS6A 3IWBA 2PRTA 3HQ1A 3VK6A 2EJ4A 4F9BB 2LUPB 2GPIA 2L33A 4KWYA 2R1FA 4WYQB 3UK3C 5KL2A 2YRKA 2YTDA 5A69A 2DGCA 3VYXA 2EPRA 2EOMA 2EMFA 1EH6A 2B7VA 5BR8E 4F6NA 5AE3A 5AC4A 2EMAA 1BBGA 2EOEA 1IMUA 2EOIA 2N8XA 2YTIA 2EMBA 1EKZA 1ZBQA 2RSMA 1UN6B 2ENCA 4JI7E 2JOXA 2DMYA 1JK2A 1TN9A 2EQ3A 4NZVA 4YY3E 4JI1E 3EPKA 2HGHA 1XNQE 2LJHA 2MDGA 2L3CA 2MC5A 4X66E 3KWRA 4NHRA 2CTDA 2YTOA 4R2DA 1G2DC 2NUGA 2EQ0A 2YTPA 4ZYHA 2L8TA 2LRSA 1STUA 1JK1A 2JPAA 2EM6A 2EPXA 2E1MA 2L2KB 1O0WA 2JR1A 5IV8B 1X3CA 4R2CA 3C4TA 4B3ME 1MEYC 2F4VE 5TSEA 1UHZA 2CSHA 2JOBA 2ODRD 3FIGA 5A6BA 2EMGA 2EM2A 2KOUA 3MHHC 1NCSA 5LMNE 2EMYA 2JWOA 2RSIA 4F2JC 4BS9A 2ELZA 2K7IA 5ADZA 3HXLA 1PJQA 4RHBB 1N3GA 2EMCA 1Z1BA 4DV4E 4X64E 2B9DA 2UUBE 2NUFA 2UXDE 4JI2E 1PJSA 3MHSC 1KYQA 2MDRA 1ZU1A 3EPHA 1FJGE 4F54A 4R2SA 1TF6A 1YPNA 4KZSA 2VE7C 2LTRA 4WX9A 2B7TA 3F6GA 2N3HA 3MSWA 2M7QA 2YTNA 4BHCA 2EN6A 2DMIA 2EOZA 2YU5A 1WXRA 5IWAE 1G2FC 1YUJA 1A1KA 3LMLA 3ADIA 3EPLA 1BBOA 4JI6E 4J8ZA 2YZTA 4TUGA 2R76A 2DLQA 2EM5A 2E72A 3DF6A 1A1IA 2EE8A 5LMUE 1PKPA 2YTEA 1N33E 5CFFE 4LF4E 3BF2A 2NABA 4GKJE 4R2AA 1T39A 1GTKA 4X65E 2RS7A 5KL5A 4F9CB 2Q8UA 5LLQA 1IBLE 4DV5E 1QNTA 2VQEE 2LT7A 4YHHE 2EPKX 2DSYA 4DR4E 1N32E 2EOSA 3HTXA 2EL6A 1QU6A 2L2NA 1X6HA 2DIXA 2EMWA 2EPOA 3JU0A 4OOGC 2GLIA 2MKNA 2LO3A 3VHTB 3C4BA 3BIDA 2CT1A 2NA2A 2JYAA 2JXPA 3ECRA 5T6JA 4NXME 2YRHA 2V83A 4R2EA 2VRDA 2EZ6A 4N4RB 2LE2A 1YZ9A 2MKDA 4F9AB 4DUYE 2FV4B 2EL4A 2EN3A 4JV5E 4LFCE 3JTZA 4DV3E 3L00A 5A6BD 4JI8E 1IBME 2RQLA 3T1YE 1RC7A 2HJJA 4DR2E 2I9IA 1EH8A 5A6KA 1YFHA 2EM0A 2ODRC 2J7JA 1WRJA 1GQEA
chains in the Genus database with same CATH topology
2EM8A 2EMGA 2EM2A 2EMHA 1P47A 5KL6A 1RMDA 2EM4A 2EN1A 3MHHC 1NCSA 2EM9A 2EMYA 2EORA 2RSIA 4F2JC 2EOYA 2ELZA 2EPZA 2EPUA 1B69A 2YU8A 1ZR9A 2YTJA 2EMCA 2WCC3 3EPJA 1A1GA 2DLKA 1Z1BA 5KL4A 1ZAAC 2JP9A 2EM3A 2WBUA 2GHFA 3MHSC 4GZNC 4IS1C 2EPCA 4M9VC 2EOOA 1ZU1A 3EPHA 1A1HA 4R2SA 1TF6A 2I13A 2EMLA 1YSAC 2ENHA 4R2RA 1KJKA 2EN7A 1BB8A 2YTNA 2YTGA 2EN6A 2DMIA 2ELYA 2EP3A 2EQ1A 2EOZA 1X5WA 2YU5A 5KL3A 1A1KA 1G2FC 1YUJA 3EPLA 3M99B 2YTQA 5KL7A 2LV2A 2LCEA 1BBOA 1F2IG 2PRTA 2DLQA 2EM5A 2E72A 4IJDA 2EMZA 2ADRA 2EJ4A 2EPPA 1X6EA 2EE8A 2EN8A 1A1IA 2YTEA 1TF3A 2R1FA 1A1LA 3UK3C 1YUIA 5KL2A 2NABA 2YRKA 2YTDA 2YSPA 4R2AA 2EOXA 2RPCA 2EOJA 2EPAA 2DGCA 2EOHA 5KL5A 2EOMA 2EPRA 2EMFA 2A25A 2ENAA 4F6NA 1A1FA 1LLMC 2EN4A 2YSOA 2LVHA 4WSGA 2LT7A 2EMAA 2EMXA 2EOEA 4F6MA 2EMIA 2EOIA 2EL5A 2EOQA 2YTIA 2EOFA 2BB8A 2EMBA 2EMKA 2EOSA 2EL6A 1X6HA 2EMWA 1UN6B 2ENCA 2GLIA 2EN2A 2LO3A 2DRPA 2MKNA 3VHTB 1JK2A 1TN9A 2WBTA 2EQ3A 4R2PA 2CT1A 2YRMA 4FK5C 3EPKA 2HGHA 2MDGA 2YRHA 1UBDC 1A1JA 4R2EA 2VRDA 2CTDA 2YTOA 4R2DA 1AAYA 2YTFA 1G2DC 2EQ0A 2YTPA 4R2QA 1X6FA 2WBSA 1JK1A 2MKDA 4X9JA 1WJPA 2JPAA 2EL4A 2EM6A 2EN3A 2EPXA 2M9AA 1DGCA 1X3CA 4R2CA 1MEYC 2EM7A 2CSHA 2EM0A 2J7JA 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM8 A;  2EMG A;  2EM2 A;  2EMH A;  1P47 A;  5KL6 A;  1RMD A;  2EM4 A;  2EN1 A;  3MHH C;  1NCS A;  2EM9 A;  2EMY A;  2EOR A;  2RSI A;  4F2J C;  2EOY A;  2ELZ A;  2EPZ A;  2EPU A;  1B69 A;  2YU8 A;  1ZR9 A;  2YTJ A;  2EMC A;  2WCC 3;  3EPJ A;  1A1G A;  2DLK A;  1Z1B A;  5KL4 A;  1ZAA C;  2JP9 A;  2EM3 A;  2WBU A;  2GHF A;  3MHS C;  4GZN C;  4IS1 C;  2EPC A;  4M9V C;  2EOO A;  1ZU1 A;  3EPH A;  1A1H A;  4R2S A;  1TF6 A;  2I13 A;  2EML A;  1YSA C;  2ENH A;  4R2R A;  1KJK A;  2EN7 A;  1BB8 A;  2YTN A;  2YTG A;  2EN6 A;  2DMI A;  2ELY A;  2EP3 A;  2EQ1 A;  2EOZ A;  1X5W A;  2YU5 A;  5KL3 A;  1A1K A;  1G2F C;  1YUJ A;  3EPL A;  3M99 B;  2YTQ A;  5KL7 A;  2LV2 A;  2LCE A;  1BBO A;  1F2I G;  2PRT A;  2DLQ A;  2EM5 A;  2E72 A;  4IJD A;  2EMZ A;  2ADR A;  2EJ4 A;  2EPP A;  1X6E A;  2EE8 A;  2EN8 A;  1A1I A;  2YTE A;  1TF3 A;  2R1F A;  1A1L A;  3UK3 C;  1YUI A;  5KL2 A;  2NAB A;  2YRK A;  2YTD A;  2YSP A;  4R2A A;  2EOX A;  2RPC A;  2EOJ A;  2EPA A;  2DGC A;  2EOH A;  5KL5 A;  2EOM A;  2EPR A;  2EMF A;  2A25 A;  2ENA A;  4F6N A;  1A1F A;  1LLM C;  2EN4 A;  2YSO A;  2LVH A;  4WSG A;  2LT7 A;  2EMA A;  2EMX A;  2EOE A;  4F6M A;  2EMI A;  2EOI A;  2EL5 A;  2EOQ A;  2YTI A;  2EOF A;  2BB8 A;  2EMB A;  2EMK A;  2EOS A;  2EL6 A;  1X6H A;  2EMW A;  1UN6 B;  2ENC A;  2GLI A;  2EN2 A;  2LO3 A;  2DRP A;  2MKN A;  3VHT B;  1JK2 A;  1TN9 A;  2WBT A;  2EQ3 A;  4R2P A;  2CT1 A;  2YRM A;  4FK5 C;  3EPK A;  2HGH A;  2MDG A;  2YRH A;  1UBD C;  1A1J A;  4R2E A;  2VRD A;  2CTD A;  2YTO A;  4R2D A;  1AAY A;  2YTF A;  1G2D C;  2EQ0 A;  2YTP A;  4R2Q A;  1X6F A;  2WBS A;  1JK1 A;  2MKD A;  4X9J A;  1WJP A;  2JPA A;  2EL4 A;  2EM6 A;  2EN3 A;  2EPX A;  2M9A A;  1DGC A;  1X3C A;  4R2C A;  1MEY C;  2EM7 A;  2CSH A;  2EM0 A;  2J7J A;  2D9H A; 
#chains in the Genus database with same CATH topology
 2EM8 A;  1EH7 A;  2EMH A;  1P47 A;  4BHB A;  1YYK A;  2HHH E;  2EPL X;  4R8O A;  2EOY A;  2F8B A;  1WHN A;  4MLQ A;  1IBK E;  3ZOQ B;  1IQS A;  3EPJ A;  5AAS A;  2DLK A;  5KL4 A;  3C6K A;  3VYY A;  1ZAA C;  2LBS B;  1X49 A;  4GZN C;  4M9V C;  2EOO A;  3P1X A;  1ZBT A;  1HNZ E;  4HEI A;  2I13 A;  2EPM X;  2FTX B;  1RQ0 A;  3HPS A;  1YSA C;  4LF8 E;  1WHQ A;  3BBG A;  2L3J A;  3AV0 A;  2ELY A;  2MC6 A;  1X5W A;  2B3T B;  3M99 B;  2YTQ A;  1F2I G;  4KHP E;  4DV6 E;  2EPP A;  1TF3 A;  1A1L A;  4WSP A;  4X8W A;  2UUC E;  2K4V A;  1YUI A;  4GKK E;  2V85 A;  3HPZ A;  2EOX A;  2UUA E;  2EOJ A;  2EPA A;  4O24 A;  2EOH A;  2L6M A;  3ADG A;  2A25 A;  1YYO A;  4Q35 B;  2EN4 A;  3OTO E;  1SR9 A;  5AE2 A;  1AH5 A;  5DNY A;  2EMI A;  3RMP A;  4DR1 E;  2BB8 A;  2EMK A;  4B3R E;  2M4I A;  4DV7 E;  4AQY E;  2UU9 E;  2WBT A;  4B3T E;  4FK5 C;  1XNR E;  4DV2 E;  1PJT A;  5LL6 R;  4Q28 A;  1XMO E;  1T38 A;  1AAY A;  4BC7 A;  2M1S A;  2EWL A;  4JI5 E;  3JAM C;  4P78 A;  4X9J A;  2JY9 A;  2V87 A;  1T4L B;  4O5G A;  2YT4 A;  4DKK A;  2VQF E;  1YYW A;  1DGC A;  2CPN A;  5A6A A;  4LF7 E;  2EM7 A;  1X48 A;  3EQ1 A;  2D9H A;  4DMI A;  5KL6 A;  1RMD A;  2EM4 A;  2E5L E;  4BC9 A;  2HC5 A;  4M30 A;  2EPZ A;  4JI0 E;  4R03 A;  2LJU A;  3ADL A;  2YU8 A;  2ZM6 E;  4DR5 E;  3K6Q A;  2YTJ A;  4ZYE A;  1GZ6 A;  2WCC 3;  2BBG A;  1A1G A;  2JP9 A;  2WBU A;  4LFB E;  4DV1 E;  3DJW A;  4RH8 A;  4BBY A;  1UIL A;  1A1H A;  4L5N C;  3THO B;  2ENH A;  4LF5 E;  4R2R A;  1BB8 A;  1HNX E;  2EP3 A;  1N36 E;  1DQ3 A;  5KL7 A;  2DB2 A;  2LV2 A;  1IQO A;  3H09 A;  5IT9 C;  4IJD A;  2EMZ A;  2ADR A;  2RTX A;  1X6E A;  2EN8 A;  2UXC E;  2VF1 A;  4ZYG A;  1DI2 A;  3F6H A;  2YSP A;  2RPC A;  4X62 E;  3J81 C;  2UXB E;  4LU9 A;  1J26 A;  2ENA A;  4WXC A;  1A1F A;  1NEI A;  4WPY A;  1LLM C;  4DR3 E;  4K0K E;  2YSO A;  1HNW E;  2LVH A;  4WSG A;  2EMX A;  2L2M A;  4F6M A;  4TUI A;  2EL5 A;  2EOQ A;  2EOF A;  2FGG A;  3J7A G;  1X47 A;  4NXN E;  2H36 X;  5AC5 A;  2EN2 A;  2DRP A;  2EPN A;  4DR7 E;  1XMQ E;  5IXM B;  4R2P A;  4P7D A;  2YRM A;  4HTG A;  3BGH A;  4OX9 E;  2WZO A;  4GEQ B;  2LUQ A;  1UBD C;  3LLH A;  1A1J A;  3J80 C;  4LF9 E;  3QG5 C;  2YTF A;  4LF6 E;  4R2Q A;  3THN A;  4BCA A;  4JYA E;  1X6F A;  3T1H E;  2WBS A;  4M2Z A;  1WJP A;  2LTS A;  5AE1 A;  3OML A;  2YWQ A;  4B3S E;  2V8Q B;  2M9A A;  4O4K A;  1I94 E;  4LFA E;  4MLV A;  1PDA A;  3IWD A;  2KHX A;  4WXD A;  1J5E E;  1HR0 E;  2LMZ A;  1L4S A;  4I8O A;  1N34 E;  2EN1 A;  2EM9 A;  4O43 A;  1SFE A;  2EOR A;  4DR6 E;  2N3G A;  4JI3 E;  1B69 A;  2L92 A;  1T4O A;  2EPU A;  1ZR9 A;  3TQM A;  4M0V A;  3ADJ A;  2V88 A;  4JI4 E;  4BMJ A;  1FKA E;  2EM3 A;  4LTY A;  5A6J A;  4DUZ E;  2GHF A;  3AUZ A;  2G7H A;  4IS1 C;  2EPC A;  5A2Q C;  4L8N A;  2IHR 1;  5F3W A;  2YPN A;  1T4N A;  4DV0 E;  4WFT A;  1MGT A;  2EML A;  1KJK A;  3KZY A;  3J7Y p;  3C6M A;  2EN7 A;  2V89 A;  2YTG A;  2EQ1 A;  2V86 A;  3IWC A;  2KON A;  5KL3 A;  2JVA A;  5FLX C;  4ZYD A;  3KZZ A;  2LCE A;  2NUE A;  2RS6 A;  3IWB A;  2PRT A;  3HQ1 A;  3VK6 A;  2EJ4 A;  4F9B B;  2LUP B;  2GPI A;  2L33 A;  4KWY A;  2R1F A;  4WYQ B;  3UK3 C;  5KL2 A;  2YRK A;  2YTD A;  5A69 A;  2DGC A;  3VYX A;  2EPR A;  2EOM A;  2EMF A;  1EH6 A;  2B7V A;  5BR8 E;  4F6N A;  5AE3 A;  5AC4 A;  2EMA A;  1BBG A;  2EOE A;  1IMU A;  2EOI A;  2N8X A;  2YTI A;  2EMB A;  1EKZ A;  1ZBQ A;  2RSM A;  1UN6 B;  2ENC A;  4JI7 E;  2JOX A;  2DMY A;  1JK2 A;  1TN9 A;  2EQ3 A;  4NZV A;  4YY3 E;  4JI1 E;  3EPK A;  2HGH A;  1XNQ E;  2LJH A;  2MDG A;  2L3C A;  2MC5 A;  4X66 E;  3KWR A;  4NHR A;  2CTD A;  2YTO A;  4R2D A;  1G2D C;  2NUG A;  2EQ0 A;  2YTP A;  4ZYH A;  2L8T A;  2LRS A;  1STU A;  1JK1 A;  2JPA A;  2EM6 A;  2EPX A;  2E1M A;  2L2K B;  1O0W A;  2JR1 A;  5IV8 B;  1X3C A;  4R2C A;  3C4T A;  4B3M E;  1MEY C;  2F4V E;  5TSE A;  1UHZ A;  2CSH A;  2JOB A;  2ODR D;  3FIG A;  5A6B A;  2EMG A;  2EM2 A;  2KOU A;  3MHH C;  1NCS A;  5LMN E;  2EMY A;  2JWO A;  2RSI A;  4F2J C;  4BS9 A;  2ELZ A;  2K7I A;  5ADZ A;  3HXL A;  1PJQ A;  4RHB B;  1N3G A;  2EMC A;  1Z1B A;  4DV4 E;  4X64 E;  2B9D A;  2UUB E;  2NUF A;  2UXD E;  4JI2 E;  1PJS A;  3MHS C;  1KYQ A;  2MDR A;  1ZU1 A;  3EPH A;  1FJG E;  4F54 A;  4R2S A;  1TF6 A;  1YPN A;  4KZS A;  2VE7 C;  2LTR A;  4WX9 A;  2B7T A;  3F6G A;  2N3H A;  3MSW A;  2M7Q A;  2YTN A;  4BHC A;  2EN6 A;  2DMI A;  2EOZ A;  2YU5 A;  1WXR A;  5IWA E;  1G2F C;  1YUJ A;  1A1K A;  3LML A;  3ADI A;  3EPL A;  1BBO A;  4JI6 E;  4J8Z A;  2YZT A;  4TUG A;  2R76 A;  2DLQ A;  2EM5 A;  2E72 A;  3DF6 A;  1A1I A;  2EE8 A;  5LMU E;  1PKP A;  2YTE A;  1N33 E;  5CFF E;  4LF4 E;  3BF2 A;  2NAB A;  4GKJ E;  4R2A A;  1T39 A;  1GTK A;  4X65 E;  2RS7 A;  5KL5 A;  4F9C B;  2Q8U A;  5LLQ A;  1IBL E;  4DV5 E;  1QNT A;  2VQE E;  2LT7 A;  4YHH E;  2EPK X;  2DSY A;  4DR4 E;  1N32 E;  2EOS A;  3HTX A;  2EL6 A;  1QU6 A;  2L2N A;  1X6H A;  2DIX A;  2EMW A;  2EPO A;  3JU0 A;  4OOG C;  2GLI A;  2MKN A;  2LO3 A;  3VHT B;  3C4B A;  3BID A;  2CT1 A;  2NA2 A;  2JYA A;  2JXP A;  3ECR A;  5T6J A;  4NXM E;  2YRH A;  2V83 A;  4R2E A;  2VRD A;  2EZ6 A;  4N4R B;  2LE2 A;  1YZ9 A;  2MKD A;  4F9A B;  4DUY E;  2FV4 B;  2EL4 A;  2EN3 A;  4JV5 E;  4LFC E;  3JTZ A;  4DV3 E;  3L00 A;  5A6B D;  4JI8 E;  1IBM E;  2RQL A;  3T1Y E;  1RC7 A;  2HJJ A;  4DR2 E;  2I9I A;  1EH8 A;  5A6K A;  1YFH A;  2EM0 A;  2ODR C;  2J7J A;  1WRJ A;  1GQE A; 
#chains in the Genus database with same CATH homology
 2EM8 A;  2EMG A;  2EM2 A;  2EMH A;  1P47 A;  5KL6 A;  1RMD A;  2EM4 A;  2EN1 A;  3MHH C;  1NCS A;  2EM9 A;  2EMY A;  2EOR A;  2RSI A;  4F2J C;  2EOY A;  2ELZ A;  2EPZ A;  2EPU A;  1B69 A;  2YU8 A;  1ZR9 A;  2YTJ A;  2EMC A;  2WCC 3;  3EPJ A;  1A1G A;  2DLK A;  1Z1B A;  5KL4 A;  1ZAA C;  2JP9 A;  2EM3 A;  2WBU A;  2GHF A;  3MHS C;  4GZN C;  4IS1 C;  2EPC A;  4M9V C;  2EOO A;  1ZU1 A;  3EPH A;  1A1H A;  4R2S A;  1TF6 A;  2I13 A;  2EML A;  1YSA C;  2ENH A;  4R2R A;  1KJK A;  2EN7 A;  1BB8 A;  2YTN A;  2YTG A;  2EN6 A;  2DMI A;  2ELY A;  2EP3 A;  2EQ1 A;  2EOZ A;  1X5W A;  2YU5 A;  5KL3 A;  1A1K A;  1G2F C;  1YUJ A;  3EPL A;  3M99 B;  2YTQ A;  5KL7 A;  2LV2 A;  2LCE A;  1BBO A;  1F2I G;  2PRT A;  2DLQ A;  2EM5 A;  2E72 A;  4IJD A;  2EMZ A;  2ADR A;  2EJ4 A;  2EPP A;  1X6E A;  2EE8 A;  2EN8 A;  1A1I A;  2YTE A;  1TF3 A;  2R1F A;  1A1L A;  3UK3 C;  1YUI A;  5KL2 A;  2NAB A;  2YRK A;  2YTD A;  2YSP A;  4R2A A;  2EOX A;  2RPC A;  2EOJ A;  2EPA A;  2DGC A;  2EOH A;  5KL5 A;  2EOM A;  2EPR A;  2EMF A;  2A25 A;  2ENA A;  4F6N A;  1A1F A;  1LLM C;  2EN4 A;  2YSO A;  2LVH A;  4WSG A;  2LT7 A;  2EMA A;  2EMX A;  2EOE A;  4F6M A;  2EMI A;  2EOI A;  2EL5 A;  2EOQ A;  2YTI A;  2EOF A;  2BB8 A;  2EMB A;  2EMK A;  2EOS A;  2EL6 A;  1X6H A;  2EMW A;  1UN6 B;  2ENC A;  2GLI A;  2EN2 A;  2LO3 A;  2DRP A;  2MKN A;  3VHT B;  1JK2 A;  1TN9 A;  2WBT A;  2EQ3 A;  4R2P A;  2CT1 A;  2YRM A;  4FK5 C;  3EPK A;  2HGH A;  2MDG A;  2YRH A;  1UBD C;  1A1J A;  4R2E A;  2VRD A;  2CTD A;  2YTO A;  4R2D A;  1AAY A;  2YTF A;  1G2D C;  2EQ0 A;  2YTP A;  4R2Q A;  1X6F A;  2WBS A;  1JK1 A;  2MKD A;  4X9J A;  1WJP A;  2JPA A;  2EL4 A;  2EM6 A;  2EN3 A;  2EPX A;  2M9A A;  1DGC A;  1X3C A;  4R2C A;  1MEY C;  2EM7 A;  2CSH A;  2EM0 A;  2J7J A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...