4R8OA

Crystal structure of a duf3836 family protein (bvu_1206) from bacteroides vulgatus atcc 8482 at 2.50 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
DNLIYNAEEVNGVVVSETIFKMEGTMLTNYMKHNYKYDANNQRTEDEAQKWNSNKNRWENNLCIRYTYGNKSMTTEYYKWNSKKKEYILVPEMTVTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BVU_1206) from Bacteroides vulgatus ATCC 8482 at 2.50 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 15
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r8oA00
4R8OA 3MSWA 4R03A
chains in the Genus database with same CATH superfamily
2EPZA 1A1GA 2NUGA 4O43A 2R1FA 2EM9A 4WSGA 2EMIA 3DF6A 3KZYA 1P47A 1A1JA 2CSHA 5AE1A 2FGGA 2LV2A 5A6AA 4DUZE 2EPUA 2B3TB 2JOBA 1T39A 2YTEA 2EJ4A 4BC9A 3L00A 2YU5A 5LLQA 2YWQA 2EMCA 2V88A 2LVHA 2YTDA 2EOFA 3HPSA 4KWYA 3J7AG 4DV1E 4DV0E 2L2KB 2EP3A 4WX9A 1X48A 2EPMX 2YT4A 3AUZA 2YRHA 4LU9A 4AQYE 4BHBA 1YYKA 2LUPB 4X8WA 3JAMC 5DNYA 1G2FC 2V83A 2WZOA 2YTFA 2MKNA 2IHR1 4B3RE 4F9BB 3OTOE 2EOSA 1EH8A 3EPHA 2UUBE 2KHXA 4R2CA 2EOOA 2EOIA 2RSMA 3EQ1A 1XMOE 4NXME 4KZSA 1XMQE 2RQLA 1NEIA 4Q28A 4ZYGA 4GKJE 5A69A 4GKKE 2F4VE 2LJUA 5IWAE 2ODRD 4LFCE 2DB2A 2EN2A 2EN1A 3OMLA 2MC5A 2M9AA 2UXCE 4OX9E 1ZR9A 2E1MA 1PJSA 2EM6A 1J26A 4GEQB 3J81C 2EMKA 5KL5A 2LUQA 2E72A 4R2QA 1A1IA 2EL4A 2EOHA 4JI3E 1WHQA 4R2DA 3ADLA 4DUYE 3H09A 2EOQA 2EOJA 2H36X 1A1LA 1HNXE 4F6NA 2EN7A 2NUEA 2JOXA 1MEYC 3JTZA 3QG5C 2EZ6A 2N3HA 2EN4A 2MDRA 4BCAA 1X6EA 2NA2A 3IWBA 5KL6A 5IT9C 5IXMB 5CFFE 2EPXA 4DV2E 3HXLA 1IBME 1N34E 4WFTA 4JI5E 4LF9E 2A25A 1DQ3A 2EMGA 2V86A 1L4SA 1X49A 1PJTA 1N32E 1GZ6A 2EMBA 2VE7C 4X62E 1X6FA 3KZZA 5AC5A 4B3TE 2NABA 2LT7A 5KL7A 2DMYA 5LL6R 1IBLE 4DV4E 2EL5A 4P78A 2YTPA 1UHZA 1EH7A 1A1KA 1N33E 2RS6A 2EM8A 1T38A 4LF4E 2YPNA 4YHHE 4R2SA 2L2MA 1WXRA 1ZBQA 4DV7E 3BIDA 4B3ME 1IMUA 1BBOA 1WHNA 2EMAA 1TN9A 1N3GA 2LMZA 2ENAA 4R2RA 2EPLX 1G2DC 1IBKE 5FLXC 3JU0A 1IQSA 2HJJA 4NHRA 5KL4A 2YTOA 2V85A 2MKDA 2EPOA 2YSOA 3RMPA 1X6HA 2EMWA 2UXBE 3VHTB 1UBDC 5AC4A 2EORA 2VRDA 4DV6E 3J80C 4LF8E 1BBGA 2LBSB 2JYAA 4O24A 4R8OA 1T4OA 4L8NA 4F9AB 4J8ZA 2HGHA 2V8QB 2D9HA 2YSPA 2EOEA 2EMFA 2RTXA 2NUFA 2EE8A 5A6JA 4DR3E 2EM2A 2ADRA 3BF2A 4LFAE 1RC7A 1JK2A 1F2IG 4X9JA 2F8BA 5A2QC 2EPPA 4DMIA 1PJQA 3F6HA 3ADGA 2WBTA 2GHFA 1YPNA 2K4VA 2R76A 4M30A 2WBUA 2N8XA 4DV5E 3IWDA 5A6BA 3C4BA 5ADZA 4HEIA 2JVAA 3ADJA 2I9IA 2EM5A 2J7JA 2LTSA 1JK1A 2YRKA 2EN6A 2L92A 2EPKX 5KL2A 5LMUE 2EMLA 4BC7A 2FV4B 4N4RB 2RSIA 4DR5E 4RH8A 4F6MA 2EPAA 2EM0A 1TF6A 5T6JA 4LF6E 2ZM6E 2KOUA 2V87A 1I94E 2L3JA 4JV5E 3BGHA 3MSWA 2BBGA 4WPYA 1GQEA 2M1SA 1B69A 4JI6E 3VYYA 4TUGA 5A6BD 1KJKA 4LF5E 5TSEA 2FTXB 3C4TA 2MDGA 4MLQA 1A1FA 4OOGC 2LTRA 2YZTA 2JWOA 5A6KA 4WXDA 4X64E 2CTDA 3VK6A 4M9VC 1YFHA 3MHSC 3HPZA 4B3SE 1PKPA 4DR4E 4X66E 2EL6A 3C6KA 2YU8A 2JP9A 2EPRA 1ZU1A 3LLHA 2UUCE 4BHCA 3HQ1A 4WSPA 1FJGE 2CT1A 2B7TA 2LE2A 2GLIA 2EQ1A 1LLMC 1YZ9A 2EOXA 4K0KE 2VQEE 1FKAE 1KYQA 4NXNE 1SR9A 2G7HA 2EQ3A 1AAYA 2N3GA 3ZOQB 4JI1E 1PDAA 1MGTA 2JR1A 4I8OA 1Z1BA 4ZYEA 2EN8A 4LFBE 1YSAC 2DLKA 2YTNA 3BBGA 2YTQA 4O5GA 2I13A 4JI4E 2L8TA 4FK5C 2EOYA 1GTKA 2EMYA 2ELYA 2LCEA 2EMXA 3C6MA 4JI8E 4DKKA 4JI0E 3THNA 4R2PA 2DLQA 2LRSA 2VF1A 1YUJA 3THOB 4NZVA 2VQFE 2EN3A 1IQOA 3MHHC 1HNZE 4DR1E 4DR7E 4BMJA 2ODRC 4O4KA 2YTIA 4MLVA 3UK3C 1HR0E 5BR8E 4Q35B 3VYXA 2WCC3 2WBSA 4HTGA 4L5NC 2EMHA 2DSYA 4F2JC 2HC5A 1QNTA 2L33A 2ELZA 1X47A 3LMLA 2EM4A 2YRMA 4LF7E 2EQ0A 1RQ0A 1XNQE 2UUAE 2L2NA 4DR6E 2EMZA 2EOMA 4IJDA 3M99B 3FIGA 5AE3A 2JXPA 2M7QA 2UXDE 4R2AA 1A1HA 3ECRA 4M2ZA 3ADIA 4YY3E 2GPIA 3KWRA 3T1HE 3EPLA 2KONA 2K7IA 1N36E 5LMNE 4JI2E 4KHPE 2EM3A 4GZNC 1RMDA 4RHBB 4F54A 2RS7A 4IS1C 2EM7A 1DI2A 1ZAAC 2DIXA 5AE2A 1HNWE 1ZBTA 4LTYA 1UILA 1O0WA 2BB8A 1X5WA 2M4IA 1X3CA 2CPNA 1EKZA 5IV8B 2YTGA 2EWLA 1TF3A 2EPCA 1T4NA 2PRTA 3DJWA 1YYWA 2JPAA 4BS9A 5KL3A 1NCSA 1SFEA 3IWCA 1YYOA 3TQMA 5F3WA 4DR2E 1QU6A 1STUA 1EH6A 2EOZA 2EPNA 1DGCA 1UN6B 2MC6A 2DRPA 2B7VA 1WRJA 3T1YE 1T4LB 2HHHE 3P1XA 4JI7E 4P7DA 3K6QA 4BBYA 2RPCA 3AV0A 4X65E 4JYAE 2UU9E 2DMIA 3HTXA 2JY9A 2LJHA 4TUIA 4M0VA 4WYQB 2YTJA 4R03A 4DV3E 2DGCA 2L6MA 5AASA 4WXCA 3F6GA 2E5LE 1WJPA 2Q8UA 4ZYHA 1BB8A 3J7Yp 1XNRE 4F9CB 2L3CA 2B9DA 1AH5A 2LO3A 4R2EA 4ZYDA 3EPKA 2ENCA 3EPJA 2V89A 2ENHA 1YUIA 1J5EE
chains in the Genus database with same CATH topology
2L92A 2NA2A 2NUGA 3IWBA 2L33A 5LMUE 4BC7A 1X47A 2FV4B 3LMLA 5CFFE 3DF6A 5IT9C 4DV2E 4LF7E 4DR5E 1XNQE 1RQ0A 3HXLA 5AE1A 1N34E 4WFTA 1IBME 2FGGA 4JI5E 4LF9E 5T6JA 1DQ3A 2UUAE 4LF6E 2ZM6E 2KOUA 4DUZE 2L2NA 2B3TB 2JOBA 2V87A 4DR6E 2V86A 1I94E 3FIGA 4BC9A 5AE3A 2M7QA 2L3JA 4JV5E 2UXDE 1X49A 2F4VE 3MSWA 1N32E 4WPYA 1GQEA 2V88A 1GZ6A 4M2ZA 2VE7C 4X62E 3ADIA 2M1SA 4YY3E 4B3TE 4JI6E 3VYYA 4TUGA 2DMYA 3KWRA 3T1HE 2KONA 5LL6R 1N36E 1IBLE 4LF5E 5LMNE 4DV4E 4JI2E 2FTXB 4P78A 4KHPE 3C4TA 3HPSA 4OOGC 2LTRA 2YZTA 3J7AG 2JWOA 1UHZA 4DV1E 4DV0E 2L2KB 4X64E 1N33E 2RS6A 3VK6A 1X48A 4F54A 2RS7A 4LF4E 1DI2A 2YT4A 3AUZA 3HPZA 4YHHE 4LU9A 4AQYE 2L2MA 2DIXA 4B3SE 5AE2A 1WXRA 1ZBQA 4DV7E 1PKPA 4DR4E 4X66E 1HNWE 4B3ME 1ZBTA 4LTYA 1UILA 1WHNA 1O0WA 1YYKA 3LLHA 2LUPB 2LMZA 2UUCE 4X8WA 3HQ1A 2M4IA 4WSPA 3JAMC 1FJGE 2B7TA 5DNYA 2LE2A 2CPNA 2V83A 2WZOA 1EKZA 1IBKE 1YZ9A 2EWLA 5FLXC 2IHR1 1T4NA 2VQEE 3JU0A 4K0KE 3DJWA 1YYWA 4B3RE 4F9BB 3OTOE 4BS9A 1FKAE 2UUBE 2KHXA 1YYOA 3IWCA 2V85A 4NXNE 1SR9A 2G7HA 5F3WA 2N3GA 3RMPA 3ZOQB 2RSMA 4DR2E 4JI1E 1QU6A 2JR1A 4I8OA 2UXBE 1XMOE 4NXME 1STUA 4KZSA 1XMQE 4LFBE 2MC6A 4DV6E 2B7VA 3J80C 3T1YE 4Q28A 1T4LB 2HHHE 4LF8E 2LBSB 3P1XA 4JI7E 4P7DA 3K6QA 4GKJE 4R8OA 4BBYA 4GKKE 1T4OA 3AV0A 4L8NA 4F9AB 4X65E 4JI4E 4J8ZA 2L8TA 2ODRD 5IWAE 2UU9E 4LFCE 4JYAE 2V8QB 2DB2A 3HTXA 2JY9A 2LJHA 4TUIA 3OMLA 4M0VA 4WYQB 2MC5A 2UXCE 4JI8E 4OX9E 2E1MA 4DKKA 2RTXA 2NUFA 4JI0E 4DR3E 4R03A 1J26A 4GEQB 4DV3E 2L6MA 1RC7A 4LFAE 3J81C 5AASA 2LUQA 2F8BA 2LRSA 5A2QC 3F6GA 2E5LE 2VF1A 4JI3E 1WHQA 4DMIA 3F6HA 3ADLA 4DUYE 3ADGA 2VQFE 3H09A 3J7Yp 4DR1E 2H36X 1HNXE 2K4VA 1HNZE 4DR7E 4BMJA 2ODRC 4M30A 1XNRE 4DV5E 4F9CB 2L3CA 3IWDA 1HR0E 3C4BA 5BR8E 2B9DA 2NUEA 2JOXA 5ADZA 2JVAA 3ADJA 3JTZA 3VYXA 2EZ6A 2N3HA 2MDRA 2LTSA 2V89A 4BCAA 4L5NC 1J5EE 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8O A;  3MSW A;  4R03 A; 
#chains in the Genus database with same CATH topology
 2EPZ A;  1A1G A;  2NUG A;  4O43 A;  2R1F A;  2EM9 A;  4WSG A;  2EMI A;  3DF6 A;  3KZY A;  1P47 A;  1A1J A;  2CSH A;  5AE1 A;  2FGG A;  2LV2 A;  5A6A A;  4DUZ E;  2EPU A;  2B3T B;  2JOB A;  1T39 A;  2YTE A;  2EJ4 A;  4BC9 A;  3L00 A;  2YU5 A;  5LLQ A;  2YWQ A;  2EMC A;  2V88 A;  2LVH A;  2YTD A;  2EOF A;  3HPS A;  4KWY A;  3J7A G;  4DV1 E;  4DV0 E;  2L2K B;  2EP3 A;  4WX9 A;  1X48 A;  2EPM X;  2YT4 A;  3AUZ A;  2YRH A;  4LU9 A;  4AQY E;  4BHB A;  1YYK A;  2LUP B;  4X8W A;  3JAM C;  5DNY A;  1G2F C;  2V83 A;  2WZO A;  2YTF A;  2MKN A;  2IHR 1;  4B3R E;  4F9B B;  3OTO E;  2EOS A;  1EH8 A;  3EPH A;  2UUB E;  2KHX A;  4R2C A;  2EOO A;  2EOI A;  2RSM A;  3EQ1 A;  1XMO E;  4NXM E;  4KZS A;  1XMQ E;  2RQL A;  1NEI A;  4Q28 A;  4ZYG A;  4GKJ E;  5A69 A;  4GKK E;  2F4V E;  2LJU A;  5IWA E;  2ODR D;  4LFC E;  2DB2 A;  2EN2 A;  2EN1 A;  3OML A;  2MC5 A;  2M9A A;  2UXC E;  4OX9 E;  1ZR9 A;  2E1M A;  1PJS A;  2EM6 A;  1J26 A;  4GEQ B;  3J81 C;  2EMK A;  5KL5 A;  2LUQ A;  2E72 A;  4R2Q A;  1A1I A;  2EL4 A;  2EOH A;  4JI3 E;  1WHQ A;  4R2D A;  3ADL A;  4DUY E;  3H09 A;  2EOQ A;  2EOJ A;  2H36 X;  1A1L A;  1HNX E;  4F6N A;  2EN7 A;  2NUE A;  2JOX A;  1MEY C;  3JTZ A;  3QG5 C;  2EZ6 A;  2N3H A;  2EN4 A;  2MDR A;  4BCA A;  1X6E A;  2NA2 A;  3IWB A;  5KL6 A;  5IT9 C;  5IXM B;  5CFF E;  2EPX A;  4DV2 E;  3HXL A;  1IBM E;  1N34 E;  4WFT A;  4JI5 E;  4LF9 E;  2A25 A;  1DQ3 A;  2EMG A;  2V86 A;  1L4S A;  1X49 A;  1PJT A;  1N32 E;  1GZ6 A;  2EMB A;  2VE7 C;  4X62 E;  1X6F A;  3KZZ A;  5AC5 A;  4B3T E;  2NAB A;  2LT7 A;  5KL7 A;  2DMY A;  5LL6 R;  1IBL E;  4DV4 E;  2EL5 A;  4P78 A;  2YTP A;  1UHZ A;  1EH7 A;  1A1K A;  1N33 E;  2RS6 A;  2EM8 A;  1T38 A;  4LF4 E;  2YPN A;  4YHH E;  4R2S A;  2L2M A;  1WXR A;  1ZBQ A;  4DV7 E;  3BID A;  4B3M E;  1IMU A;  1BBO A;  1WHN A;  2EMA A;  1TN9 A;  1N3G A;  2LMZ A;  2ENA A;  4R2R A;  2EPL X;  1G2D C;  1IBK E;  5FLX C;  3JU0 A;  1IQS A;  2HJJ A;  4NHR A;  5KL4 A;  2YTO A;  2V85 A;  2MKD A;  2EPO A;  2YSO A;  3RMP A;  1X6H A;  2EMW A;  2UXB E;  3VHT B;  1UBD C;  5AC4 A;  2EOR A;  2VRD A;  4DV6 E;  3J80 C;  4LF8 E;  1BBG A;  2LBS B;  2JYA A;  4O24 A;  4R8O A;  1T4O A;  4L8N A;  4F9A B;  4J8Z A;  2HGH A;  2V8Q B;  2D9H A;  2YSP A;  2EOE A;  2EMF A;  2RTX A;  2NUF A;  2EE8 A;  5A6J A;  4DR3 E;  2EM2 A;  2ADR A;  3BF2 A;  4LFA E;  1RC7 A;  1JK2 A;  1F2I G;  4X9J A;  2F8B A;  5A2Q C;  2EPP A;  4DMI A;  1PJQ A;  3F6H A;  3ADG A;  2WBT A;  2GHF A;  1YPN A;  2K4V A;  2R76 A;  4M30 A;  2WBU A;  2N8X A;  4DV5 E;  3IWD A;  5A6B A;  3C4B A;  5ADZ A;  4HEI A;  2JVA A;  3ADJ A;  2I9I A;  2EM5 A;  2J7J A;  2LTS A;  1JK1 A;  2YRK A;  2EN6 A;  2L92 A;  2EPK X;  5KL2 A;  5LMU E;  2EML A;  4BC7 A;  2FV4 B;  4N4R B;  2RSI A;  4DR5 E;  4RH8 A;  4F6M A;  2EPA A;  2EM0 A;  1TF6 A;  5T6J A;  4LF6 E;  2ZM6 E;  2KOU A;  2V87 A;  1I94 E;  2L3J A;  4JV5 E;  3BGH A;  3MSW A;  2BBG A;  4WPY A;  1GQE A;  2M1S A;  1B69 A;  4JI6 E;  3VYY A;  4TUG A;  5A6B D;  1KJK A;  4LF5 E;  5TSE A;  2FTX B;  3C4T A;  2MDG A;  4MLQ A;  1A1F A;  4OOG C;  2LTR A;  2YZT A;  2JWO A;  5A6K A;  4WXD A;  4X64 E;  2CTD A;  3VK6 A;  4M9V C;  1YFH A;  3MHS C;  3HPZ A;  4B3S E;  1PKP A;  4DR4 E;  4X66 E;  2EL6 A;  3C6K A;  2YU8 A;  2JP9 A;  2EPR A;  1ZU1 A;  3LLH A;  2UUC E;  4BHC A;  3HQ1 A;  4WSP A;  1FJG E;  2CT1 A;  2B7T A;  2LE2 A;  2GLI A;  2EQ1 A;  1LLM C;  1YZ9 A;  2EOX A;  4K0K E;  2VQE E;  1FKA E;  1KYQ A;  4NXN E;  1SR9 A;  2G7H A;  2EQ3 A;  1AAY A;  2N3G A;  3ZOQ B;  4JI1 E;  1PDA A;  1MGT A;  2JR1 A;  4I8O A;  1Z1B A;  4ZYE A;  2EN8 A;  4LFB E;  1YSA C;  2DLK A;  2YTN A;  3BBG A;  2YTQ A;  4O5G A;  2I13 A;  4JI4 E;  2L8T A;  4FK5 C;  2EOY A;  1GTK A;  2EMY A;  2ELY A;  2LCE A;  2EMX A;  3C6M A;  4JI8 E;  4DKK A;  4JI0 E;  3THN A;  4R2P A;  2DLQ A;  2LRS A;  2VF1 A;  1YUJ A;  3THO B;  4NZV A;  2VQF E;  2EN3 A;  1IQO A;  3MHH C;  1HNZ E;  4DR1 E;  4DR7 E;  4BMJ A;  2ODR C;  4O4K A;  2YTI A;  4MLV A;  3UK3 C;  1HR0 E;  5BR8 E;  4Q35 B;  3VYX A;  2WCC 3;  2WBS A;  4HTG A;  4L5N C;  2EMH A;  2DSY A;  4F2J C;  2HC5 A;  1QNT A;  2L33 A;  2ELZ A;  1X47 A;  3LML A;  2EM4 A;  2YRM A;  4LF7 E;  2EQ0 A;  1RQ0 A;  1XNQ E;  2UUA E;  2L2N A;  4DR6 E;  2EMZ A;  2EOM A;  4IJD A;  3M99 B;  3FIG A;  5AE3 A;  2JXP A;  2M7Q A;  2UXD E;  4R2A A;  1A1H A;  3ECR A;  4M2Z A;  3ADI A;  4YY3 E;  2GPI A;  3KWR A;  3T1H E;  3EPL A;  2KON A;  2K7I A;  1N36 E;  5LMN E;  4JI2 E;  4KHP E;  2EM3 A;  4GZN C;  1RMD A;  4RHB B;  4F54 A;  2RS7 A;  4IS1 C;  2EM7 A;  1DI2 A;  1ZAA C;  2DIX A;  5AE2 A;  1HNW E;  1ZBT A;  4LTY A;  1UIL A;  1O0W A;  2BB8 A;  1X5W A;  2M4I A;  1X3C A;  2CPN A;  1EKZ A;  5IV8 B;  2YTG A;  2EWL A;  1TF3 A;  2EPC A;  1T4N A;  2PRT A;  3DJW A;  1YYW A;  2JPA A;  4BS9 A;  5KL3 A;  1NCS A;  1SFE A;  3IWC A;  1YYO A;  3TQM A;  5F3W A;  4DR2 E;  1QU6 A;  1STU A;  1EH6 A;  2EOZ A;  2EPN A;  1DGC A;  1UN6 B;  2MC6 A;  2DRP A;  2B7V A;  1WRJ A;  3T1Y E;  1T4L B;  2HHH E;  3P1X A;  4JI7 E;  4P7D A;  3K6Q A;  4BBY A;  2RPC A;  3AV0 A;  4X65 E;  4JYA E;  2UU9 E;  2DMI A;  3HTX A;  2JY9 A;  2LJH A;  4TUI A;  4M0V A;  4WYQ B;  2YTJ A;  4R03 A;  4DV3 E;  2DGC A;  2L6M A;  5AAS A;  4WXC A;  3F6G A;  2E5L E;  1WJP A;  2Q8U A;  4ZYH A;  1BB8 A;  3J7Y p;  1XNR E;  4F9C B;  2L3C A;  2B9D A;  1AH5 A;  2LO3 A;  4R2E A;  4ZYD A;  3EPK A;  2ENC A;  3EPJ A;  2V89 A;  2ENH A;  1YUI A;  1J5E E; 
#chains in the Genus database with same CATH homology
 2L92 A;  2NA2 A;  2NUG A;  3IWB A;  2L33 A;  5LMU E;  4BC7 A;  1X47 A;  2FV4 B;  3LML A;  5CFF E;  3DF6 A;  5IT9 C;  4DV2 E;  4LF7 E;  4DR5 E;  1XNQ E;  1RQ0 A;  3HXL A;  5AE1 A;  1N34 E;  4WFT A;  1IBM E;  2FGG A;  4JI5 E;  4LF9 E;  5T6J A;  1DQ3 A;  2UUA E;  4LF6 E;  2ZM6 E;  2KOU A;  4DUZ E;  2L2N A;  2B3T B;  2JOB A;  2V87 A;  4DR6 E;  2V86 A;  1I94 E;  3FIG A;  4BC9 A;  5AE3 A;  2M7Q A;  2L3J A;  4JV5 E;  2UXD E;  1X49 A;  2F4V E;  3MSW A;  1N32 E;  4WPY A;  1GQE A;  2V88 A;  1GZ6 A;  4M2Z A;  2VE7 C;  4X62 E;  3ADI A;  2M1S A;  4YY3 E;  4B3T E;  4JI6 E;  3VYY A;  4TUG A;  2DMY A;  3KWR A;  3T1H E;  2KON A;  5LL6 R;  1N36 E;  1IBL E;  4LF5 E;  5LMN E;  4DV4 E;  4JI2 E;  2FTX B;  4P78 A;  4KHP E;  3C4T A;  3HPS A;  4OOG C;  2LTR A;  2YZT A;  3J7A G;  2JWO A;  1UHZ A;  4DV1 E;  4DV0 E;  2L2K B;  4X64 E;  1N33 E;  2RS6 A;  3VK6 A;  1X48 A;  4F54 A;  2RS7 A;  4LF4 E;  1DI2 A;  2YT4 A;  3AUZ A;  3HPZ A;  4YHH E;  4LU9 A;  4AQY E;  2L2M A;  2DIX A;  4B3S E;  5AE2 A;  1WXR A;  1ZBQ A;  4DV7 E;  1PKP A;  4DR4 E;  4X66 E;  1HNW E;  4B3M E;  1ZBT A;  4LTY A;  1UIL A;  1WHN A;  1O0W A;  1YYK A;  3LLH A;  2LUP B;  2LMZ A;  2UUC E;  4X8W A;  3HQ1 A;  2M4I A;  4WSP A;  3JAM C;  1FJG E;  2B7T A;  5DNY A;  2LE2 A;  2CPN A;  2V83 A;  2WZO A;  1EKZ A;  1IBK E;  1YZ9 A;  2EWL A;  5FLX C;  2IHR 1;  1T4N A;  2VQE E;  3JU0 A;  4K0K E;  3DJW A;  1YYW A;  4B3R E;  4F9B B;  3OTO E;  4BS9 A;  1FKA E;  2UUB E;  2KHX A;  1YYO A;  3IWC A;  2V85 A;  4NXN E;  1SR9 A;  2G7H A;  5F3W A;  2N3G A;  3RMP A;  3ZOQ B;  2RSM A;  4DR2 E;  4JI1 E;  1QU6 A;  2JR1 A;  4I8O A;  2UXB E;  1XMO E;  4NXM E;  1STU A;  4KZS A;  1XMQ E;  4LFB E;  2MC6 A;  4DV6 E;  2B7V A;  3J80 C;  3T1Y E;  4Q28 A;  1T4L B;  2HHH E;  4LF8 E;  2LBS B;  3P1X A;  4JI7 E;  4P7D A;  3K6Q A;  4GKJ E;  4R8O A;  4BBY A;  4GKK E;  1T4O A;  3AV0 A;  4L8N A;  4F9A B;  4X65 E;  4JI4 E;  4J8Z A;  2L8T A;  2ODR D;  5IWA E;  2UU9 E;  4LFC E;  4JYA E;  2V8Q B;  2DB2 A;  3HTX A;  2JY9 A;  2LJH A;  4TUI A;  3OML A;  4M0V A;  4WYQ B;  2MC5 A;  2UXC E;  4JI8 E;  4OX9 E;  2E1M A;  4DKK A;  2RTX A;  2NUF A;  4JI0 E;  4DR3 E;  4R03 A;  1J26 A;  4GEQ B;  4DV3 E;  2L6M A;  1RC7 A;  4LFA E;  3J81 C;  5AAS A;  2LUQ A;  2F8B A;  2LRS A;  5A2Q C;  3F6G A;  2E5L E;  2VF1 A;  4JI3 E;  1WHQ A;  4DMI A;  3F6H A;  3ADL A;  4DUY E;  3ADG A;  2VQF E;  3H09 A;  3J7Y p;  4DR1 E;  2H36 X;  1HNX E;  2K4V A;  1HNZ E;  4DR7 E;  4BMJ A;  2ODR C;  4M30 A;  1XNR E;  4DV5 E;  4F9C B;  2L3C A;  3IWD A;  1HR0 E;  3C4B A;  5BR8 E;  2B9D A;  2NUE A;  2JOX A;  5ADZ A;  2JVA A;  3ADJ A;  3JTZ A;  3VYX A;  2EZ6 A;  2N3H A;  2MDR A;  2LTS A;  2V89 A;  4BCA A;  4L5N C;  1J5E E;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...