4R8OA

Crystal structure of a duf3836 family protein (bvu_1206) from bacteroides vulgatus atcc 8482 at 2.50 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
DNLIYNAEEVNGVVVSETIFKMEGTMLTNYMKHNYKYDANNQRTEDEAQKWNSNKNRWENNLCIRYTYGNKSMTTEYYKWNSKKKEYILVPEMTVTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BVU_1206) from Bacteroides vulgatus ATCC 8482 at 2.50 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 15
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r8oA00
3MSWA 4R03A 4R8OA
chains in the Genus database with same CATH superfamily
1BBOA 2ELYA 2L8TA 2ODRC 5A2QC 4KWYA 2NABA 2RPCA 1X6HA 2L3CA 2PRTA 4DV4E 1MEYC 1UHZA 1HNWE 1UBDC 5A6BD 4O24A 2JY9A 4R2CA 2V86A 2RS7A 2V83A 2L2NA 2MKDA 4O43A 2M7QA 1IQOA 2EMKA 2JXPA 1RC7A 1RQ0A 2UXDE 1FKAE 2LRSA 1IBME 2YTIA 1YYKA 4LU9A 2WZOA 2YTJA 3MHHC 2YRHA 2FV4B 2R1FA 4DV3E 5IV8B 5A69A 4GKJE 4DV5E 2GHFA 3ADGA 3VHTB 5CFFE 4N4RB 1PJQA 2EMHA 2EOEA 5TSEA 1A1FA 1N33E 2EP3A 2DRPA 2EOSA 2H36X 2HGHA 2BB8A 1A1IA 2EN4A 1TN9A 2YTDA 3EPJA 2EM3A 1FJGE 2EM9A 3VYYA 2E72A 1F2IG 2YTNA 4X65E 4LFBE 3M99B 3F6GA 1WRJA 1N36E 2JR1A 3MHSC 3OMLA 1A1HA 4GZNC 1JK1A 3ADIA 2VRDA 3BIDA 2ADRA 2UXBE 1NCSA 4DR1E 5F3WA 4DR5E 1WHQA 5KL5A 2EPZA 2EL4A 1UILA 4L8NA 2LUQA 2EN1A 4OX9E 1HR0E 3TQMA 5IWAE 4WXDA 4LF5E 1YUIA 2L6MA 5AE1A 4R8OA 2YSPA 1G2FC 1T39A 2NUFA 2EPPA 2I13A 2DB2A 2EOMA 5LMNE 4B3ME 5T6JA 4BHCA 3KZYA 3JAMC 1IBKE 2D9HA 4RHBB 2YTGA 3EPKA 3UK3C 2NA2A 2R76A 4HTGA 2L3JA 5IT9C 3ADLA 1NEIA 2EMXA 1ZU1A 3ADJA 3IWBA 3THNA 4DV0E 4JI4E 2EM2A 4NXME 2EMIA 2ENCA 2N3HA 2UU9E 4DKKA 2B7VA 4KZSA 2EWLA 3IWDA 4R2PA 2EZ6A 2LBSB 4F2JC 3FIGA 5IXMB 3HPZA 1YFHA 4JI5E 4F9CB 4WFTA 2EPNA 1YYOA 2JVAA 2V85A 4TUGA 2EN7A 2G7HA 1IQSA 4R2SA 1WXRA 5AE3A 4F54A 3K6QA 4B3SE 2DSYA 1I94E 2EMZA 2RTXA 1BBGA 1XNRE 4F9BB 1RMDA 2EMWA 4WPYA 3OTOE 4F6NA 2M9AA 3ZOQB 3THOB 1YYWA 2DMIA 1ZBQA 1GQEA 2WCC3 1KYQA 1T4NA 5AC5A 1YSAC 3J81C 4L5NC 2DIXA 2Q8UA 2VQFE 2CPNA 2YTEA 4OOGC 1X5WA 1JK2A 5A6JA 3J7AG 1N32E 2JWOA 2LE2A 2CTDA 1UN6B 4DR3E 2JP9A 2EJ4A 3F6HA 2UUCE 3AV0A 2EOQA 2J7JA 2EM7A 4NZVA 2LV2A 1J5EE 2VF1A 2LTSA 2EPRA 5A6AA 2RS6A 2EMYA 3C4TA 4F6MA 2LMZA 4R2QA 1DGCA 1XNQE 2RQLA 4DR6E 1XMQE 2HHHE 4ZYGA 3KZZA 5AC4A 3EPHA 1A1LA 1N3GA 1MGTA 2VQEE 4LF4E 2GPIA 2F4VE 2ELZA 4R2AA 2EMFA 2DLKA 5KL6A 3C4BA 1EH7A 2KHXA 2F8BA 3EQ1A 2HC5A 2JOXA 1Z1BA 4JI3E 4KHPE 4JYAE 3QG5C 1YZ9A 1T4OA 4LF6E 3MSWA 3VK6A 1TF3A 1G2DC 3J80C 5BR8E 2UUAE 3ECRA 2EMGA 1N34E 2UXCE 3DF6A 1SFEA 2LCEA 4X62E 5LLQA 2ZM6E 1EKZA 1YUJA 3EPLA 3DJWA 1PJSA 4DR2E 2EM6A 2EOJA 1AH5A 1T4LB 1WJPA 2KONA 4O5GA 4IS1C 4R2RA 4DR7E 1P47A 2DMYA 1TF6A 2L92A 2EOOA 3IWCA 5A6BA 2EOXA 2YRMA 4M0VA 5KL2A 4JI1E 2V87A 4P78A 2M4IA 4JI2E 4M9VC 4IJDA 2MKNA 1B69A 2E5LE 4LFCE 3HXLA 3J7Yp 2EN2A 4NHRA 1GZ6A 3BGHA 1QU6A 2CT1A 2YU8A 5KL7A 1PJTA 3VYXA 2ODRD 1X47A 2EQ1A 1X49A 4I8OA 2VE7C 2EL6A 1A1JA 2M1SA 5AASA 2V88A 3AUZA 5KL4A 2EPXA 2GLIA 1STUA 3HQ1A 2EN3A 2JOBA 4ZYDA 4TUIA 2ENHA 4MLQA 1HNZE 3H09A 2B3TB 2EOFA 1X48A 2E1MA 4DUZE 4R2DA 1J26A 4LF8E 5ADZA 1GTKA 2YPNA 2YSOA 1AAYA 1KJKA 3KWRA 2EL5A 2EN8A 2FTXB 2YU5A 3HPSA 2I9IA 2YWQA 4FK5C 2BBGA 2WBTA 5KL3A 2JPAA 2KOUA 2YTFA 4AQYE 4DMIA 3LLHA 1IBLE 2B9DA 1LLMC 2YTPA 1WHNA 1EH6A 5LMUE 4R2EA 4JV5E 2EPUA 2HJJA 2EM8A 4DUYE 2FGGA 3RMPA 4X8WA 2K7IA 2MC5A 2EQ3A 2EPAA 1EH8A 4X9JA 4DV7E 2YTQA 4YHHE 1X6EA 1HNXE 1X6FA 4O4KA 4BC9A 2EM4A 2MC6A 1IMUA 5LL6R 4DR4E 3C6KA 5DNYA 2LJHA 2L2MA 3T1HE 2NUEA 2LT7A 2MDGA 2EPLX 4HEIA 4MLVA 4GKKE 3JU0A 2RSMA 1YPNA 4BHBA 4BBYA 1XMOE 2EOHA 4Q28A 4Q35B 4ZYHA 4M30A 2EN6A 2EOYA 4F9AB 2ENAA 4ZYEA 2A25A 5A6KA 5AE2A 3BBGA 2B7TA 1BB8A 3JTZA 3BF2A 1O0WA 4JI0E 2CSHA 2EOIA 2EMLA 3L00A 2RSIA 1A1KA 4P7DA 2LJUA 4M2ZA 4B3RE 2LVHA 1PDAA 2EE8A 1QNTA 1ZAAC 4WYQB 2EQ0A 1T38A 1DI2A 2WBUA 2EMCA 2YTOA 3C6MA 2DLQA 2EPCA 4WSPA 2EPOA 4K0KE 4DV2E 4LFAE 1X3CA 1PKPA 3P1XA 2JYAA 2IHR1 3LMLA 4J8ZA 4WXCA 4DV1E 4JI7E 4LTYA 5FLXC 1L4SA 1DQ3A 2V89A 4JI6E 2NUGA 2EM0A 1SR9A 2YZTA 4BC7A 4JI8E 3HTXA 2K4VA 4R03A 4DV6E 2UUBE 2EPMX 2YT4A 2N3GA 2LUPB 2EM5A 4WSGA 3T1YE 1ZR9A 2MDRA 2EMBA 4WX9A 2L33A 2LO3A 2L2KB 1A1GA 4LF7E 4BCAA 2EOZA 4LF9E 4X64E 4X66E 4GEQB 2DGCA 2N8XA 2WBSA 4RH8A 4B3TE 4YY3E 2EMAA 2YRKA 4BS9A 4NXNE 1ZBTA 2EPKX 2EORA 4BMJA 2LTRA 2V8QB
chains in the Genus database with same CATH topology
4JI4E 2L8TA 4YHHE 2ZM6E 2ODRC 5A2QC 1EKZA 1HNXE 4NXME 2N3HA 2UU9E 4DKKA 2B7VA 4KZSA 2EWLA 3DJWA 2MC6A 3IWDA 5LL6R 4BC9A 2L3CA 4DR2E 4DR4E 4DV4E 5DNYA 2LJHA 1UHZA 2EZ6A 2LBSB 2L2MA 3T1HE 1HNWE 1T4LB 3FIGA 2KONA 2NUEA 2JY9A 3HPZA 4JI5E 2V86A 2RS7A 2V83A 4F9CB 4WFTA 2L2NA 1YYOA 2M7QA 2JVAA 4DV7E 4GKKE 2V85A 3JU0A 4TUGA 1RC7A 2RSMA 4DR7E 1RQ0A 2DMYA 2UXDE 2G7HA 4BBYA 1FKAE 2LRSA 1IBME 1WXRA 5AE3A 1XMOE 4F54A 1YYKA 4Q28A 3K6QA 4B3SE 2DSYA 4LU9A 2WZOA 1I94E 2L92A 3IWCA 4JI1E 4M30A 4F9AB 2RTXA 2FV4B 4M0VA 2V87A 4P78A 1XNRE 2M4IA 4F9BB 4JI2E 5AE2A 2E5LE 4LFCE 4DV3E 4GKJE 2B7TA 4DV5E 4WPYA 3HXLA 3JTZA 3J7Yp 1O0WA 3ZOQB 3OTOE 3ADGA 4JI0E 1GZ6A 1QU6A 5CFFE 1YYWA 1ZBQA 1N33E 1GQEA 4P7DA 3VYXA 4M2ZA 4B3RE 2ODRD 1T4NA 1X47A 3J81C 4L5NC 2H36X 1X49A 2DIXA 4I8OA 2VE7C 4WYQB 1DI2A 2VQFE 2CPNA 2M1SA 4OOGC 1FJGE 1N36E 5AASA 2V88A 3AUZA 3VYYA 4WSPA 3J7AG 1N32E 4X65E 4K0KE 2JWOA 4DV2E 2LE2A 4LFAE 4LFBE 1PKPA 3F6GA 1STUA 2IHR1 3HQ1A 2JR1A 3LMLA 3P1XA 4J8ZA 2JOBA 4JI7E 4TUIA 4LTYA 3OMLA 4DV1E 4DR3E 3H09A 2B3TB 3F6HA 1HNZE 2UUCE 1X48A 3AV0A 2E1MA 4DUZE 5FLXC 3ADIA 1J5EE 1J26A 2VF1A 2LTSA 4LF8E 1DQ3A 2V89A 2RS6A 5ADZA 4JI6E 2UXBE 3C4TA 3KWRA 2NUGA 2FTXB 4DR1E 2LMZA 1SR9A 2YZTA 3HPSA 5F3WA 4BC7A 1WHQA 4JI8E 2K4VA 4DR5E 3HTXA 4R03A 4DV6E 2UUBE 1XNQE 1UILA 2YT4A 4DR6E 4L8NA 2N3GA 2LUPB 1XMQE 2LUQA 2HHHE 3T1YE 4OX9E 2MDRA 1HR0E 5IWAE 2KOUA 2L33A 2VQEE 4LF5E 2L6MA 5AE1A 4AQYE 4LF4E 4R8OA 4DMIA 2L2KB 4LF7E 3LLHA 4BCAA 1IBLE 2F4VE 2B9DA 2NUFA 4LF9E 2DB2A 4X64E 1WHNA 4X66E 4GEQB 5LMNE 5LMUE 4B3ME 4JV5E 5T6JA 3C4BA 2KHXA 2F8BA 3JAMC 4B3TE 4YY3E 2JOXA 1IBKE 4DUYE 4JI3E 4JYAE 1YZ9A 4KHPE 2FGGA 1T4OA 2NA2A 4BS9A 3RMPA 4LF6E 1ZBTA 4X8WA 4NXNE 3MSWA 2L3JA 3VK6A 5IT9C 3ADLA 2MC5A 4BMJA 3J80C 5BR8E 2UUAE 1N34E 2LTRA 2UXCE 3DF6A 3ADJA 3IWBA 4DV0E 4X62E 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSW A;  4R03 A;  4R8O A; 
#chains in the Genus database with same CATH topology
 1BBO A;  2ELY A;  2L8T A;  2ODR C;  5A2Q C;  4KWY A;  2NAB A;  2RPC A;  1X6H A;  2L3C A;  2PRT A;  4DV4 E;  1MEY C;  1UHZ A;  1HNW E;  1UBD C;  5A6B D;  4O24 A;  2JY9 A;  4R2C A;  2V86 A;  2RS7 A;  2V83 A;  2L2N A;  2MKD A;  4O43 A;  2M7Q A;  1IQO A;  2EMK A;  2JXP A;  1RC7 A;  1RQ0 A;  2UXD E;  1FKA E;  2LRS A;  1IBM E;  2YTI A;  1YYK A;  4LU9 A;  2WZO A;  2YTJ A;  3MHH C;  2YRH A;  2FV4 B;  2R1F A;  4DV3 E;  5IV8 B;  5A69 A;  4GKJ E;  4DV5 E;  2GHF A;  3ADG A;  3VHT B;  5CFF E;  4N4R B;  1PJQ A;  2EMH A;  2EOE A;  5TSE A;  1A1F A;  1N33 E;  2EP3 A;  2DRP A;  2EOS A;  2H36 X;  2HGH A;  2BB8 A;  1A1I A;  2EN4 A;  1TN9 A;  2YTD A;  3EPJ A;  2EM3 A;  1FJG E;  2EM9 A;  3VYY A;  2E72 A;  1F2I G;  2YTN A;  4X65 E;  4LFB E;  3M99 B;  3F6G A;  1WRJ A;  1N36 E;  2JR1 A;  3MHS C;  3OML A;  1A1H A;  4GZN C;  1JK1 A;  3ADI A;  2VRD A;  3BID A;  2ADR A;  2UXB E;  1NCS A;  4DR1 E;  5F3W A;  4DR5 E;  1WHQ A;  5KL5 A;  2EPZ A;  2EL4 A;  1UIL A;  4L8N A;  2LUQ A;  2EN1 A;  4OX9 E;  1HR0 E;  3TQM A;  5IWA E;  4WXD A;  4LF5 E;  1YUI A;  2L6M A;  5AE1 A;  4R8O A;  2YSP A;  1G2F C;  1T39 A;  2NUF A;  2EPP A;  2I13 A;  2DB2 A;  2EOM A;  5LMN E;  4B3M E;  5T6J A;  4BHC A;  3KZY A;  3JAM C;  1IBK E;  2D9H A;  4RHB B;  2YTG A;  3EPK A;  3UK3 C;  2NA2 A;  2R76 A;  4HTG A;  2L3J A;  5IT9 C;  3ADL A;  1NEI A;  2EMX A;  1ZU1 A;  3ADJ A;  3IWB A;  3THN A;  4DV0 E;  4JI4 E;  2EM2 A;  4NXM E;  2EMI A;  2ENC A;  2N3H A;  2UU9 E;  4DKK A;  2B7V A;  4KZS A;  2EWL A;  3IWD A;  4R2P A;  2EZ6 A;  2LBS B;  4F2J C;  3FIG A;  5IXM B;  3HPZ A;  1YFH A;  4JI5 E;  4F9C B;  4WFT A;  2EPN A;  1YYO A;  2JVA A;  2V85 A;  4TUG A;  2EN7 A;  2G7H A;  1IQS A;  4R2S A;  1WXR A;  5AE3 A;  4F54 A;  3K6Q A;  4B3S E;  2DSY A;  1I94 E;  2EMZ A;  2RTX A;  1BBG A;  1XNR E;  4F9B B;  1RMD A;  2EMW A;  4WPY A;  3OTO E;  4F6N A;  2M9A A;  3ZOQ B;  3THO B;  1YYW A;  2DMI A;  1ZBQ A;  1GQE A;  2WCC 3;  1KYQ A;  1T4N A;  5AC5 A;  1YSA C;  3J81 C;  4L5N C;  2DIX A;  2Q8U A;  2VQF E;  2CPN A;  2YTE A;  4OOG C;  1X5W A;  1JK2 A;  5A6J A;  3J7A G;  1N32 E;  2JWO A;  2LE2 A;  2CTD A;  1UN6 B;  4DR3 E;  2JP9 A;  2EJ4 A;  3F6H A;  2UUC E;  3AV0 A;  2EOQ A;  2J7J A;  2EM7 A;  4NZV A;  2LV2 A;  1J5E E;  2VF1 A;  2LTS A;  2EPR A;  5A6A A;  2RS6 A;  2EMY A;  3C4T A;  4F6M A;  2LMZ A;  4R2Q A;  1DGC A;  1XNQ E;  2RQL A;  4DR6 E;  1XMQ E;  2HHH E;  4ZYG A;  3KZZ A;  5AC4 A;  3EPH A;  1A1L A;  1N3G A;  1MGT A;  2VQE E;  4LF4 E;  2GPI A;  2F4V E;  2ELZ A;  4R2A A;  2EMF A;  2DLK A;  5KL6 A;  3C4B A;  1EH7 A;  2KHX A;  2F8B A;  3EQ1 A;  2HC5 A;  2JOX A;  1Z1B A;  4JI3 E;  4KHP E;  4JYA E;  3QG5 C;  1YZ9 A;  1T4O A;  4LF6 E;  3MSW A;  3VK6 A;  1TF3 A;  1G2D C;  3J80 C;  5BR8 E;  2UUA E;  3ECR A;  2EMG A;  1N34 E;  2UXC E;  3DF6 A;  1SFE A;  2LCE A;  4X62 E;  5LLQ A;  2ZM6 E;  1EKZ A;  1YUJ A;  3EPL A;  3DJW A;  1PJS A;  4DR2 E;  2EM6 A;  2EOJ A;  1AH5 A;  1T4L B;  1WJP A;  2KON A;  4O5G A;  4IS1 C;  4R2R A;  4DR7 E;  1P47 A;  2DMY A;  1TF6 A;  2L92 A;  2EOO A;  3IWC A;  5A6B A;  2EOX A;  2YRM A;  4M0V A;  5KL2 A;  4JI1 E;  2V87 A;  4P78 A;  2M4I A;  4JI2 E;  4M9V C;  4IJD A;  2MKN A;  1B69 A;  2E5L E;  4LFC E;  3HXL A;  3J7Y p;  2EN2 A;  4NHR A;  1GZ6 A;  3BGH A;  1QU6 A;  2CT1 A;  2YU8 A;  5KL7 A;  1PJT A;  3VYX A;  2ODR D;  1X47 A;  2EQ1 A;  1X49 A;  4I8O A;  2VE7 C;  2EL6 A;  1A1J A;  2M1S A;  5AAS A;  2V88 A;  3AUZ A;  5KL4 A;  2EPX A;  2GLI A;  1STU A;  3HQ1 A;  2EN3 A;  2JOB A;  4ZYD A;  4TUI A;  2ENH A;  4MLQ A;  1HNZ E;  3H09 A;  2B3T B;  2EOF A;  1X48 A;  2E1M A;  4DUZ E;  4R2D A;  1J26 A;  4LF8 E;  5ADZ A;  1GTK A;  2YPN A;  2YSO A;  1AAY A;  1KJK A;  3KWR A;  2EL5 A;  2EN8 A;  2FTX B;  2YU5 A;  3HPS A;  2I9I A;  2YWQ A;  4FK5 C;  2BBG A;  2WBT A;  5KL3 A;  2JPA A;  2KOU A;  2YTF A;  4AQY E;  4DMI A;  3LLH A;  1IBL E;  2B9D A;  1LLM C;  2YTP A;  1WHN A;  1EH6 A;  5LMU E;  4R2E A;  4JV5 E;  2EPU A;  2HJJ A;  2EM8 A;  4DUY E;  2FGG A;  3RMP A;  4X8W A;  2K7I A;  2MC5 A;  2EQ3 A;  2EPA A;  1EH8 A;  4X9J A;  4DV7 E;  2YTQ A;  4YHH E;  1X6E A;  1HNX E;  1X6F A;  4O4K A;  4BC9 A;  2EM4 A;  2MC6 A;  1IMU A;  5LL6 R;  4DR4 E;  3C6K A;  5DNY A;  2LJH A;  2L2M A;  3T1H E;  2NUE A;  2LT7 A;  2MDG A;  2EPL X;  4HEI A;  4MLV A;  4GKK E;  3JU0 A;  2RSM A;  1YPN A;  4BHB A;  4BBY A;  1XMO E;  2EOH A;  4Q28 A;  4Q35 B;  4ZYH A;  4M30 A;  2EN6 A;  2EOY A;  4F9A B;  2ENA A;  4ZYE A;  2A25 A;  5A6K A;  5AE2 A;  3BBG A;  2B7T A;  1BB8 A;  3JTZ A;  3BF2 A;  1O0W A;  4JI0 E;  2CSH A;  2EOI A;  2EML A;  3L00 A;  2RSI A;  1A1K A;  4P7D A;  2LJU A;  4M2Z A;  4B3R E;  2LVH A;  1PDA A;  2EE8 A;  1QNT A;  1ZAA C;  4WYQ B;  2EQ0 A;  1T38 A;  1DI2 A;  2WBU A;  2EMC A;  2YTO A;  3C6M A;  2DLQ A;  2EPC A;  4WSP A;  2EPO A;  4K0K E;  4DV2 E;  4LFA E;  1X3C A;  1PKP A;  3P1X A;  2JYA A;  2IHR 1;  3LML A;  4J8Z A;  4WXC A;  4DV1 E;  4JI7 E;  4LTY A;  5FLX C;  1L4S A;  1DQ3 A;  2V89 A;  4JI6 E;  2NUG A;  2EM0 A;  1SR9 A;  2YZT A;  4BC7 A;  4JI8 E;  3HTX A;  2K4V A;  4R03 A;  4DV6 E;  2UUB E;  2EPM X;  2YT4 A;  2N3G A;  2LUP B;  2EM5 A;  4WSG A;  3T1Y E;  1ZR9 A;  2MDR A;  2EMB A;  4WX9 A;  2L33 A;  2LO3 A;  2L2K B;  1A1G A;  4LF7 E;  4BCA A;  2EOZ A;  4LF9 E;  4X64 E;  4X66 E;  4GEQ B;  2DGC A;  2N8X A;  2WBS A;  4RH8 A;  4B3T E;  4YY3 E;  2EMA A;  2YRK A;  4BS9 A;  4NXN E;  1ZBT A;  2EPK X;  2EOR A;  4BMJ A;  2LTR A;  2V8Q B; 
#chains in the Genus database with same CATH homology
 4JI4 E;  2L8T A;  4YHH E;  2ZM6 E;  2ODR C;  5A2Q C;  1EKZ A;  1HNX E;  4NXM E;  2N3H A;  2UU9 E;  4DKK A;  2B7V A;  4KZS A;  2EWL A;  3DJW A;  2MC6 A;  3IWD A;  5LL6 R;  4BC9 A;  2L3C A;  4DR2 E;  4DR4 E;  4DV4 E;  5DNY A;  2LJH A;  1UHZ A;  2EZ6 A;  2LBS B;  2L2M A;  3T1H E;  1HNW E;  1T4L B;  3FIG A;  2KON A;  2NUE A;  2JY9 A;  3HPZ A;  4JI5 E;  2V86 A;  2RS7 A;  2V83 A;  4F9C B;  4WFT A;  2L2N A;  1YYO A;  2M7Q A;  2JVA A;  4DV7 E;  4GKK E;  2V85 A;  3JU0 A;  4TUG A;  1RC7 A;  2RSM A;  4DR7 E;  1RQ0 A;  2DMY A;  2UXD E;  2G7H A;  4BBY A;  1FKA E;  2LRS A;  1IBM E;  1WXR A;  5AE3 A;  1XMO E;  4F54 A;  1YYK A;  4Q28 A;  3K6Q A;  4B3S E;  2DSY A;  4LU9 A;  2WZO A;  1I94 E;  2L92 A;  3IWC A;  4JI1 E;  4M30 A;  4F9A B;  2RTX A;  2FV4 B;  4M0V A;  2V87 A;  4P78 A;  1XNR E;  2M4I A;  4F9B B;  4JI2 E;  5AE2 A;  2E5L E;  4LFC E;  4DV3 E;  4GKJ E;  2B7T A;  4DV5 E;  4WPY A;  3HXL A;  3JTZ A;  3J7Y p;  1O0W A;  3ZOQ B;  3OTO E;  3ADG A;  4JI0 E;  1GZ6 A;  1QU6 A;  5CFF E;  1YYW A;  1ZBQ A;  1N33 E;  1GQE A;  4P7D A;  3VYX A;  4M2Z A;  4B3R E;  2ODR D;  1T4N A;  1X47 A;  3J81 C;  4L5N C;  2H36 X;  1X49 A;  2DIX A;  4I8O A;  2VE7 C;  4WYQ B;  1DI2 A;  2VQF E;  2CPN A;  2M1S A;  4OOG C;  1FJG E;  1N36 E;  5AAS A;  2V88 A;  3AUZ A;  3VYY A;  4WSP A;  3J7A G;  1N32 E;  4X65 E;  4K0K E;  2JWO A;  4DV2 E;  2LE2 A;  4LFA E;  4LFB E;  1PKP A;  3F6G A;  1STU A;  2IHR 1;  3HQ1 A;  2JR1 A;  3LML A;  3P1X A;  4J8Z A;  2JOB A;  4JI7 E;  4TUI A;  4LTY A;  3OML A;  4DV1 E;  4DR3 E;  3H09 A;  2B3T B;  3F6H A;  1HNZ E;  2UUC E;  1X48 A;  3AV0 A;  2E1M A;  4DUZ E;  5FLX C;  3ADI A;  1J5E E;  1J26 A;  2VF1 A;  2LTS A;  4LF8 E;  1DQ3 A;  2V89 A;  2RS6 A;  5ADZ A;  4JI6 E;  2UXB E;  3C4T A;  3KWR A;  2NUG A;  2FTX B;  4DR1 E;  2LMZ A;  1SR9 A;  2YZT A;  3HPS A;  5F3W A;  4BC7 A;  1WHQ A;  4JI8 E;  2K4V A;  4DR5 E;  3HTX A;  4R03 A;  4DV6 E;  2UUB E;  1XNQ E;  1UIL A;  2YT4 A;  4DR6 E;  4L8N A;  2N3G A;  2LUP B;  1XMQ E;  2LUQ A;  2HHH E;  3T1Y E;  4OX9 E;  2MDR A;  1HR0 E;  5IWA E;  2KOU A;  2L33 A;  2VQE E;  4LF5 E;  2L6M A;  5AE1 A;  4AQY E;  4LF4 E;  4R8O A;  4DMI A;  2L2K B;  4LF7 E;  3LLH A;  4BCA A;  1IBL E;  2F4V E;  2B9D A;  2NUF A;  4LF9 E;  2DB2 A;  4X64 E;  1WHN A;  4X66 E;  4GEQ B;  5LMN E;  5LMU E;  4B3M E;  4JV5 E;  5T6J A;  3C4B A;  2KHX A;  2F8B A;  3JAM C;  4B3T E;  4YY3 E;  2JOX A;  1IBK E;  4DUY E;  4JI3 E;  4JYA E;  1YZ9 A;  4KHP E;  2FGG A;  1T4O A;  2NA2 A;  4BS9 A;  3RMP A;  4LF6 E;  1ZBT A;  4X8W A;  4NXN E;  3MSW A;  2L3J A;  3VK6 A;  5IT9 C;  3ADL A;  2MC5 A;  4BMJ A;  3J80 C;  5BR8 E;  2UUA E;  1N34 E;  2LTR A;  2UXC E;  3DF6 A;  3ADJ A;  3IWB A;  4DV0 E;  4X62 E;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...