4R8OA

Crystal structure of a duf3836 family protein (bvu_1206) from bacteroides vulgatus atcc 8482 at 2.50 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
DNLIYNAEEVNGVVVSETIFKMEGTMLTNYMKHNYKYDANNQRTEDEAQKWNSNKNRWENNLCIRYTYGNKSMTTEYYKWNSKKKEYILVPEMTVTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BVU_1206) from Bacteroides vulgatus ATCC 8482 at 2.50 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 15
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r8oA00
4R03A 3MSWA 4R8OA
chains in the Genus database with same CATH superfamily
1WHQA 2EPXA 2EPKX 2EPPA 4RHBB 2EQ0A 3MHSC 4Q35B 1YUJA 2NUEA 2EPZA 4R03A 5F3WA 2B7VA 1G2DC 2V83A 3C6KA 5A2QC 4M2ZA 2EM0A 2EL6A 2RSIA 4WXDA 4IS1C 2JYAA 2YU8A 2WBUA 2LE2A 2YWQA 2EM8A 2LTRA 3ADLA 1N33E 2HJJA 1A1LA 1F2IG 1N3GA 4BC9A 3C6MA 2PRTA 1I94E 3VYYA 1UHZA 4LF4E 2EL4A 2ENHA 4GKJE 1X6EA 2EM9A 2EPLX 4F2JC 5BR8E 2EMYA 1HNWE 3AV0A 1YZ9A 4JI8E 2V85A 2EORA 1UN6B 1YYKA 4WX9A 4DV1E 2YTFA 1STUA 2VE7C 2YTOA 4R2EA 3DF6A 3LLHA 4MLQA 2EMKA 1T4LB 2YSPA 4F9CB 1PJQA 1ZR9A 2K4VA 2E72A 1BBGA 2VQEE 4LFBE 1T4NA 5KL3A 2YTPA 2EZ6A 5KL6A 2RQLA 2EM3A 2NUFA 4GKKE 2GHFA 2CPNA 4KZSA 3T1HE 2EOFA 1T38A 3J7Yp 3ADIA 2B9DA 2DIXA 2YTGA 2EMBA 2UXCE 1IQSA 2DRPA 1XNQE 2V86A 2L92A 1B69A 1TF3A 4R8OA 4BHCA 4ZYDA 2EMZA 2YTDA 4J8ZA 4DR6E 2UUBE 2N8XA 4WSPA 1YYWA 5TSEA 2EMFA 2G7HA 1T4OA 1X48A 2LTSA 4RH8A 5A6AA 2EQ1A 1DGCA 3QG5C 1MEYC 4DV6E 2ZM6E 3IWCA 2A25A 1FKAE 5LL6R 5AE3A 3J7AG 3HPSA 2EE8A 4LFAE 2ELYA 4HTGA 4BHBA 3THOB 2M1SA 4JI6E 2EMGA 1AAYA 2RS6A 2EM4A 1X5WA 4DV7E 2V87A 2EOZA 3KZYA 1N36E 2RPCA 2YT4A 4KHPE 2ENCA 5DNYA 1A1GA 2Q8UA 3JTZA 1XMQE 2EM7A 2EMCA 2EOMA 2VRDA 2BB8A 1X3CA 2VQFE 2EMIA 2ENAA 2MDGA 3H09A 4O24A 4JI0E 1YUIA 4MLVA 1LLMC 2EN8A 2WBTA 4F9AB 3J80C 3T1YE 2BBGA 4JI1E 2DB2A 2EL5A 4R2CA 2EPRA 4BCAA 4M9VC 4DR2E 4LF9E 2ADRA 3EQ1A 4X9JA 2EN6A 3LMLA 1YFHA 4LTYA 2E5LE 2EN4A 3TQMA 4WPYA 4DV5E 2LJHA 4O4KA 2V8QB 3IWDA 4B3ME 1GTKA 2EOXA 2NABA 5AC5A 1ZAAC 2JOBA 4LF6E 3JAMC 4YHHE 5AC4A 3VYXA 2N3HA 4JI2E 1A1FA 4AQYE 1XMOE 1RC7A 4M30A 3F6GA 2RTXA 2LVHA 1TN9A 2LBSB 2MC6A 1XNRE 4IJDA 4F54A 2JR1A 3THNA 3BF2A 4N4RB 1DQ3A 3AUZA 2JPAA 1EH6A 1FJGE 2LV2A 4WFTA 2FGGA 2HGHA 2GPIA 1P47A 2EPMX 4B3SE 4LU9A 4OX9E 5A6KA 2YZTA 1L4SA 1EKZA 3BIDA 1TF6A 2EOEA 2CSHA 2LRSA 2KHXA 4FK5C 3EPJA 2HC5A 2UXDE 5LMUE 4KWYA 2B3TB 2LCEA 5AASA 1EH7A 2WCC3 2F8BA 2EJ4A 1YSAC 2L2MA 5LMNE 4JV5E 2M4IA 2YTQA 3HXLA 1HNZE 2EOOA 4GZNC 2EOJA 3HQ1A 4X66E 2WZOA 1YYOA 4JI4E 4NXNE 1IQOA 4B3RE 3MSWA 4OOGC 2EOSA 4JI3E 2YRHA 2RSMA 1PDAA 2WBSA 2EQ3A 1KYQA 5AE2A 3HPZA 2DLQA 1G2FC 5IT9C 2N3GA 2EPCA 3DJWA 1Z1BA 1UBDC 4I8OA 1NCSA 2EN3A 2NA2A 4X8WA 4R2DA 4DMIA 2MC5A 4HEIA 4DV4E 2L6MA 1X49A 5KL2A 3IWBA 1QU6A 1IBLE 2I13A 5A6BA 3EPHA 4BC7A 3HTXA 5A6JA 5KL7A 1AH5A 2L8TA 2YTJA 1RQ0A 4DKKA 1WHNA 2LUQA 1J5EE 2JP9A 4LF8E 1SFEA 2IHR1 4F6MA 4DV3E 2EWLA 2YU5A 1PJSA 1DI2A 3KZZA 4F9BB 1X6FA 3ZOQB 5A6BD 3C4TA 4WSGA 4L8NA 4M0VA 2EPAA 3J81C 2F4VE 2E1MA 1N32E 2JVAA 2L3JA 1X6HA 4LFCE 1NEIA 2B7TA 4DR5E 4Q28A 3ADJA 2ELZA 1GQEA 5FLXC 4R2RA 5ADZA 4JI5E 4X62E 1UILA 2EP3A 4P7DA 2YPNA 2DMYA 2ODRC 2K7IA 1X47A 1YPNA 3EPKA 2DSYA 2GLIA 2MKDA 1WXRA 1HR0E 2EMWA 1N34E 4R2PA 1JK1A 2RS7A 4DV0E 3VHTB 1GZ6A 4DR3E 1MGTA 2UUAE 1BB8A 2EM6A 4ZYHA 1IBKE 2EPOA 4NXME 2LUPB 4TUIA 3EPLA 2UUCE 4DR1E 2L3CA 1WRJA 2MDRA 3M99B 1A1JA 2EN7A 1J26A 2J7JA 3FIGA 2LO3A 1ZU1A 5KL5A 4TUGA 5IWAE 4DR4E 5LLQA 2EOQA 4JI7E 1IBME 3MHHC 1A1KA 2EM2A 3BGHA 1PKPA 3RMPA 4NHRA 2LJUA 2R1FA 2EMXA 4BS9A 3F6HA 2V88A 2EM5A 3UK3C 4DV2E 2R76A 3P1XA 4GEQB 4R2SA 4DR7E 4WXCA 5AE1A 4YY3E 2LT7A 2CTDA 2DLKA 4R2QA 2VF1A 2YTIA 1BBOA 4WYQB 1HNXE 2V89A 4DUYE 4K0KE 4B3TE 2YRKA 3JU0A 5A69A 4O5GA 2YTEA 2CT1A 4LF7E 4NZVA 2EMLA 3KWRA 4ZYEA 1EH8A 3OTOE 2L2KB 4R2AA 4LF5E 5CFFE 2KOUA 2JWOA 5T6JA 2JXPA 2EN1A 4X64E 2EOIA 2EMHA 3ADGA 2YTNA 3C4BA 4BBYA 3ECRA 2ODRD 1ZBTA 1O0WA 2NUGA 4O43A 4P78A 5IXMB 5IV8B 1WJPA 1SR9A 2UU9E 2EN2A 2EOYA 3VK6A 2UXBE 5KL4A 1PJTA 4X65E 2D9HA 4L5NC 2EPNA 2DMIA 2I9IA 2L33A 4DUZE 2DGCA 1KJKA 1RMDA 2EPUA 2JOXA 2EMAA 3BBGA 3K6QA 2YRMA 1JK2A 4F6NA 2L2NA 2YSOA 3OMLA 4ZYGA 1IMUA 1A1HA 4JYAE 2LMZA 2M9AA 2H36X 1T39A 3L00A 1ZBQA 2EOHA 2KONA 2HHHE 2JY9A 1A1IA 1QNTA 2M7QA 4BMJA 2FTXB 2MKNA 2FV4B
chains in the Genus database with same CATH topology
1WHQA 1J26A 5DNYA 5AE2A 3JTZA 1XMQE 3HPZA 2NUEA 4R03A 5IT9C 5F3WA 2B7VA 3FIGA 2V83A 2N3GA 2VQFE 3DJWA 5A2QC 3H09A 4I8OA 4JI0E 4M2ZA 4TUGA 5IWAE 4DR4E 2NA2A 4X8WA 4F9AB 2LE2A 4DMIA 4JI7E 2MC5A 3J80C 3T1YE 4JI1E 1IBME 2LTRA 2DB2A 2L6MA 4DV4E 3ADLA 1X49A 1N33E 3IWBA 4BC9A 1QU6A 4BCAA 1PKPA 4DR2E 1IBLE 4BC7A 3RMPA 4LF9E 3HTXA 1I94E 3LMLA 3VYYA 1UHZA 2E5LE 4LTYA 4LF4E 4BS9A 3F6HA 2V88A 4WPYA 4DV2E 4DV5E 4GKJE 2L8TA 2LJHA 3P1XA 4GEQB 1RQ0A 4DKKA 4DR7E 5BR8E 5AE1A 1HNWE 2V8QB 3AV0A 3IWDA 4YY3E 4JI8E 1YZ9A 2V85A 1WHNA 2LUQA 2VF1A 4B3ME 1YYKA 1J5EE 4DV1E 1STUA 4LF8E 2VE7C 4WYQB 1HNXE 2V89A 2IHR1 3DF6A 3LLHA 4DUYE 1T4LB 4K0KE 2JOBA 4F9CB 4B3TE 3JU0A 2EWLA 3JAMC 4YHHE 4DV3E 4LF6E 3VYXA 1DI2A 2N3HA 4JI2E 2K4VA 4AQYE 1XMOE 1RC7A 4LF7E 4M30A 2VQEE 4LFBE 1T4NA 3KWRA 3F6GA 3ZOQB 4F9BB 2RTXA 2EZ6A 3C4TA 3OTOE 2MC6A 4L8NA 2LBSB 2NUFA 2L2KB 4F54A 4M0VA 1XNRE 2JR1A 2CPNA 3J81C 2F4VE 4LF5E 2E1MA 4KZSA 5CFFE 2JVAA 2JWOA 2KOUA 3J7Yp 2L3JA 3T1HE 1N32E 2B9DA 3ADIA 4LFCE 5T6JA 2B7TA 1DQ3A 2DIXA 3AUZA 4Q28A 4X64E 3ADJA 4DR5E 2UXCE 3C4BA 3ADGA 4BBYA 1FJGE 1XNQE 1GQEA 2V86A 2L92A 5FLXC 2ODRD 4WFTA 2FGGA 1ZBTA 1O0WA 5ADZA 4B3SE 2NUGA 4P78A 4JI5E 4LU9A 4X62E 1SR9A 4R8OA 4OX9E 4KHPE 1UILA 2UU9E 2YZTA 4P7DA 3VK6A 4J8ZA 2UXBE 4DR6E 1EKZA 2DMYA 4X65E 2UUBE 2ODRC 4WSPA 1YYWA 4L5NC 2G7HA 1X47A 1T4OA 2L33A 4DUZE 1X48A 2DSYA 2LTSA 2LRSA 2JOXA 2KHXA 4DV6E 2ZM6E 1WXRA 3IWCA 1HR0E 2UXDE 5LMUE 1N34E 2B3TB 3K6QA 1FKAE 5LL6R 5AASA 2RS7A 5AE3A 4DV0E 3J7AG 2L2NA 3HPSA 1GZ6A 2F8BA 3OMLA 4LFAE 4DR3E 2L2MA 5LMNE 2UUAE 4JV5E 2M4IA 3HXLA 2M1SA 1IBKE 4GKKE 4JYAE 4JI6E 2LMZA 1HNZE 2H36X 4NXME 1ZBQA 3HQ1A 2RS6A 4X66E 2WZOA 1YYOA 4JI4E 4NXNE 2KONA 2HHHE 2JY9A 4TUIA 4DV7E 2LUPB 2UUCE 4B3RE 3MSWA 4OOGC 4DR1E 2M7QA 4BMJA 2V87A 2L3CA 2FTXB 2MDRA 4JI3E 2RSMA 2FV4B 1N36E 2YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R03 A;  3MSW A;  4R8O A; 
#chains in the Genus database with same CATH topology
 1WHQ A;  2EPX A;  2EPK X;  2EPP A;  4RHB B;  2EQ0 A;  3MHS C;  4Q35 B;  1YUJ A;  2NUE A;  2EPZ A;  4R03 A;  5F3W A;  2B7V A;  1G2D C;  2V83 A;  3C6K A;  5A2Q C;  4M2Z A;  2EM0 A;  2EL6 A;  2RSI A;  4WXD A;  4IS1 C;  2JYA A;  2YU8 A;  2WBU A;  2LE2 A;  2YWQ A;  2EM8 A;  2LTR A;  3ADL A;  1N33 E;  2HJJ A;  1A1L A;  1F2I G;  1N3G A;  4BC9 A;  3C6M A;  2PRT A;  1I94 E;  3VYY A;  1UHZ A;  4LF4 E;  2EL4 A;  2ENH A;  4GKJ E;  1X6E A;  2EM9 A;  2EPL X;  4F2J C;  5BR8 E;  2EMY A;  1HNW E;  3AV0 A;  1YZ9 A;  4JI8 E;  2V85 A;  2EOR A;  1UN6 B;  1YYK A;  4WX9 A;  4DV1 E;  2YTF A;  1STU A;  2VE7 C;  2YTO A;  4R2E A;  3DF6 A;  3LLH A;  4MLQ A;  2EMK A;  1T4L B;  2YSP A;  4F9C B;  1PJQ A;  1ZR9 A;  2K4V A;  2E72 A;  1BBG A;  2VQE E;  4LFB E;  1T4N A;  5KL3 A;  2YTP A;  2EZ6 A;  5KL6 A;  2RQL A;  2EM3 A;  2NUF A;  4GKK E;  2GHF A;  2CPN A;  4KZS A;  3T1H E;  2EOF A;  1T38 A;  3J7Y p;  3ADI A;  2B9D A;  2DIX A;  2YTG A;  2EMB A;  2UXC E;  1IQS A;  2DRP A;  1XNQ E;  2V86 A;  2L92 A;  1B69 A;  1TF3 A;  4R8O A;  4BHC A;  4ZYD A;  2EMZ A;  2YTD A;  4J8Z A;  4DR6 E;  2UUB E;  2N8X A;  4WSP A;  1YYW A;  5TSE A;  2EMF A;  2G7H A;  1T4O A;  1X48 A;  2LTS A;  4RH8 A;  5A6A A;  2EQ1 A;  1DGC A;  3QG5 C;  1MEY C;  4DV6 E;  2ZM6 E;  3IWC A;  2A25 A;  1FKA E;  5LL6 R;  5AE3 A;  3J7A G;  3HPS A;  2EE8 A;  4LFA E;  2ELY A;  4HTG A;  4BHB A;  3THO B;  2M1S A;  4JI6 E;  2EMG A;  1AAY A;  2RS6 A;  2EM4 A;  1X5W A;  4DV7 E;  2V87 A;  2EOZ A;  3KZY A;  1N36 E;  2RPC A;  2YT4 A;  4KHP E;  2ENC A;  5DNY A;  1A1G A;  2Q8U A;  3JTZ A;  1XMQ E;  2EM7 A;  2EMC A;  2EOM A;  2VRD A;  2BB8 A;  1X3C A;  2VQF E;  2EMI A;  2ENA A;  2MDG A;  3H09 A;  4O24 A;  4JI0 E;  1YUI A;  4MLV A;  1LLM C;  2EN8 A;  2WBT A;  4F9A B;  3J80 C;  3T1Y E;  2BBG A;  4JI1 E;  2DB2 A;  2EL5 A;  4R2C A;  2EPR A;  4BCA A;  4M9V C;  4DR2 E;  4LF9 E;  2ADR A;  3EQ1 A;  4X9J A;  2EN6 A;  3LML A;  1YFH A;  4LTY A;  2E5L E;  2EN4 A;  3TQM A;  4WPY A;  4DV5 E;  2LJH A;  4O4K A;  2V8Q B;  3IWD A;  4B3M E;  1GTK A;  2EOX A;  2NAB A;  5AC5 A;  1ZAA C;  2JOB A;  4LF6 E;  3JAM C;  4YHH E;  5AC4 A;  3VYX A;  2N3H A;  4JI2 E;  1A1F A;  4AQY E;  1XMO E;  1RC7 A;  4M30 A;  3F6G A;  2RTX A;  2LVH A;  1TN9 A;  2LBS B;  2MC6 A;  1XNR E;  4IJD A;  4F54 A;  2JR1 A;  3THN A;  3BF2 A;  4N4R B;  1DQ3 A;  3AUZ A;  2JPA A;  1EH6 A;  1FJG E;  2LV2 A;  4WFT A;  2FGG A;  2HGH A;  2GPI A;  1P47 A;  2EPM X;  4B3S E;  4LU9 A;  4OX9 E;  5A6K A;  2YZT A;  1L4S A;  1EKZ A;  3BID A;  1TF6 A;  2EOE A;  2CSH A;  2LRS A;  2KHX A;  4FK5 C;  3EPJ A;  2HC5 A;  2UXD E;  5LMU E;  4KWY A;  2B3T B;  2LCE A;  5AAS A;  1EH7 A;  2WCC 3;  2F8B A;  2EJ4 A;  1YSA C;  2L2M A;  5LMN E;  4JV5 E;  2M4I A;  2YTQ A;  3HXL A;  1HNZ E;  2EOO A;  4GZN C;  2EOJ A;  3HQ1 A;  4X66 E;  2WZO A;  1YYO A;  4JI4 E;  4NXN E;  1IQO A;  4B3R E;  3MSW A;  4OOG C;  2EOS A;  4JI3 E;  2YRH A;  2RSM A;  1PDA A;  2WBS A;  2EQ3 A;  1KYQ A;  5AE2 A;  3HPZ A;  2DLQ A;  1G2F C;  5IT9 C;  2N3G A;  2EPC A;  3DJW A;  1Z1B A;  1UBD C;  4I8O A;  1NCS A;  2EN3 A;  2NA2 A;  4X8W A;  4R2D A;  4DMI A;  2MC5 A;  4HEI A;  4DV4 E;  2L6M A;  1X49 A;  5KL2 A;  3IWB A;  1QU6 A;  1IBL E;  2I13 A;  5A6B A;  3EPH A;  4BC7 A;  3HTX A;  5A6J A;  5KL7 A;  1AH5 A;  2L8T A;  2YTJ A;  1RQ0 A;  4DKK A;  1WHN A;  2LUQ A;  1J5E E;  2JP9 A;  4LF8 E;  1SFE A;  2IHR 1;  4F6M A;  4DV3 E;  2EWL A;  2YU5 A;  1PJS A;  1DI2 A;  3KZZ A;  4F9B B;  1X6F A;  3ZOQ B;  5A6B D;  3C4T A;  4WSG A;  4L8N A;  4M0V A;  2EPA A;  3J81 C;  2F4V E;  2E1M A;  1N32 E;  2JVA A;  2L3J A;  1X6H A;  4LFC E;  1NEI A;  2B7T A;  4DR5 E;  4Q28 A;  3ADJ A;  2ELZ A;  1GQE A;  5FLX C;  4R2R A;  5ADZ A;  4JI5 E;  4X62 E;  1UIL A;  2EP3 A;  4P7D A;  2YPN A;  2DMY A;  2ODR C;  2K7I A;  1X47 A;  1YPN A;  3EPK A;  2DSY A;  2GLI A;  2MKD A;  1WXR A;  1HR0 E;  2EMW A;  1N34 E;  4R2P A;  1JK1 A;  2RS7 A;  4DV0 E;  3VHT B;  1GZ6 A;  4DR3 E;  1MGT A;  2UUA E;  1BB8 A;  2EM6 A;  4ZYH A;  1IBK E;  2EPO A;  4NXM E;  2LUP B;  4TUI A;  3EPL A;  2UUC E;  4DR1 E;  2L3C A;  1WRJ A;  2MDR A;  3M99 B;  1A1J A;  2EN7 A;  1J26 A;  2J7J A;  3FIG A;  2LO3 A;  1ZU1 A;  5KL5 A;  4TUG A;  5IWA E;  4DR4 E;  5LLQ A;  2EOQ A;  4JI7 E;  1IBM E;  3MHH C;  1A1K A;  2EM2 A;  3BGH A;  1PKP A;  3RMP A;  4NHR A;  2LJU A;  2R1F A;  2EMX A;  4BS9 A;  3F6H A;  2V88 A;  2EM5 A;  3UK3 C;  4DV2 E;  2R76 A;  3P1X A;  4GEQ B;  4R2S A;  4DR7 E;  4WXC A;  5AE1 A;  4YY3 E;  2LT7 A;  2CTD A;  2DLK A;  4R2Q A;  2VF1 A;  2YTI A;  1BBO A;  4WYQ B;  1HNX E;  2V89 A;  4DUY E;  4K0K E;  4B3T E;  2YRK A;  3JU0 A;  5A69 A;  4O5G A;  2YTE A;  2CT1 A;  4LF7 E;  4NZV A;  2EML A;  3KWR A;  4ZYE A;  1EH8 A;  3OTO E;  2L2K B;  4R2A A;  4LF5 E;  5CFF E;  2KOU A;  2JWO A;  5T6J A;  2JXP A;  2EN1 A;  4X64 E;  2EOI A;  2EMH A;  3ADG A;  2YTN A;  3C4B A;  4BBY A;  3ECR A;  2ODR D;  1ZBT A;  1O0W A;  2NUG A;  4O43 A;  4P78 A;  5IXM B;  5IV8 B;  1WJP A;  1SR9 A;  2UU9 E;  2EN2 A;  2EOY A;  3VK6 A;  2UXB E;  5KL4 A;  1PJT A;  4X65 E;  2D9H A;  4L5N C;  2EPN A;  2DMI A;  2I9I A;  2L33 A;  4DUZ E;  2DGC A;  1KJK A;  1RMD A;  2EPU A;  2JOX A;  2EMA A;  3BBG A;  3K6Q A;  2YRM A;  1JK2 A;  4F6N A;  2L2N A;  2YSO A;  3OML A;  4ZYG A;  1IMU A;  1A1H A;  4JYA E;  2LMZ A;  2M9A A;  2H36 X;  1T39 A;  3L00 A;  1ZBQ A;  2EOH A;  2KON A;  2HHH E;  2JY9 A;  1A1I A;  1QNT A;  2M7Q A;  4BMJ A;  2FTX B;  2MKN A;  2FV4 B; 
#chains in the Genus database with same CATH homology
 1WHQ A;  1J26 A;  5DNY A;  5AE2 A;  3JTZ A;  1XMQ E;  3HPZ A;  2NUE A;  4R03 A;  5IT9 C;  5F3W A;  2B7V A;  3FIG A;  2V83 A;  2N3G A;  2VQF E;  3DJW A;  5A2Q C;  3H09 A;  4I8O A;  4JI0 E;  4M2Z A;  4TUG A;  5IWA E;  4DR4 E;  2NA2 A;  4X8W A;  4F9A B;  2LE2 A;  4DMI A;  4JI7 E;  2MC5 A;  3J80 C;  3T1Y E;  4JI1 E;  1IBM E;  2LTR A;  2DB2 A;  2L6M A;  4DV4 E;  3ADL A;  1X49 A;  1N33 E;  3IWB A;  4BC9 A;  1QU6 A;  4BCA A;  1PKP A;  4DR2 E;  1IBL E;  4BC7 A;  3RMP A;  4LF9 E;  3HTX A;  1I94 E;  3LML A;  3VYY A;  1UHZ A;  2E5L E;  4LTY A;  4LF4 E;  4BS9 A;  3F6H A;  2V88 A;  4WPY A;  4DV2 E;  4DV5 E;  4GKJ E;  2L8T A;  2LJH A;  3P1X A;  4GEQ B;  1RQ0 A;  4DKK A;  4DR7 E;  5BR8 E;  5AE1 A;  1HNW E;  2V8Q B;  3AV0 A;  3IWD A;  4YY3 E;  4JI8 E;  1YZ9 A;  2V85 A;  1WHN A;  2LUQ A;  2VF1 A;  4B3M E;  1YYK A;  1J5E E;  4DV1 E;  1STU A;  4LF8 E;  2VE7 C;  4WYQ B;  1HNX E;  2V89 A;  2IHR 1;  3DF6 A;  3LLH A;  4DUY E;  1T4L B;  4K0K E;  2JOB A;  4F9C B;  4B3T E;  3JU0 A;  2EWL A;  3JAM C;  4YHH E;  4DV3 E;  4LF6 E;  3VYX A;  1DI2 A;  2N3H A;  4JI2 E;  2K4V A;  4AQY E;  1XMO E;  1RC7 A;  4LF7 E;  4M30 A;  2VQE E;  4LFB E;  1T4N A;  3KWR A;  3F6G A;  3ZOQ B;  4F9B B;  2RTX A;  2EZ6 A;  3C4T A;  3OTO E;  2MC6 A;  4L8N A;  2LBS B;  2NUF A;  2L2K B;  4F54 A;  4M0V A;  1XNR E;  2JR1 A;  2CPN A;  3J81 C;  2F4V E;  4LF5 E;  2E1M A;  4KZS A;  5CFF E;  2JVA A;  2JWO A;  2KOU A;  3J7Y p;  2L3J A;  3T1H E;  1N32 E;  2B9D A;  3ADI A;  4LFC E;  5T6J A;  2B7T A;  1DQ3 A;  2DIX A;  3AUZ A;  4Q28 A;  4X64 E;  3ADJ A;  4DR5 E;  2UXC E;  3C4B A;  3ADG A;  4BBY A;  1FJG E;  1XNQ E;  1GQE A;  2V86 A;  2L92 A;  5FLX C;  2ODR D;  4WFT A;  2FGG A;  1ZBT A;  1O0W A;  5ADZ A;  4B3S E;  2NUG A;  4P78 A;  4JI5 E;  4LU9 A;  4X62 E;  1SR9 A;  4R8O A;  4OX9 E;  4KHP E;  1UIL A;  2UU9 E;  2YZT A;  4P7D A;  3VK6 A;  4J8Z A;  2UXB E;  4DR6 E;  1EKZ A;  2DMY A;  4X65 E;  2UUB E;  2ODR C;  4WSP A;  1YYW A;  4L5N C;  2G7H A;  1X47 A;  1T4O A;  2L33 A;  4DUZ E;  1X48 A;  2DSY A;  2LTS A;  2LRS A;  2JOX A;  2KHX A;  4DV6 E;  2ZM6 E;  1WXR A;  3IWC A;  1HR0 E;  2UXD E;  5LMU E;  1N34 E;  2B3T B;  3K6Q A;  1FKA E;  5LL6 R;  5AAS A;  2RS7 A;  5AE3 A;  4DV0 E;  3J7A G;  2L2N A;  3HPS A;  1GZ6 A;  2F8B A;  3OML A;  4LFA E;  4DR3 E;  2L2M A;  5LMN E;  2UUA E;  4JV5 E;  2M4I A;  3HXL A;  2M1S A;  1IBK E;  4GKK E;  4JYA E;  4JI6 E;  2LMZ A;  1HNZ E;  2H36 X;  4NXM E;  1ZBQ A;  3HQ1 A;  2RS6 A;  4X66 E;  2WZO A;  1YYO A;  4JI4 E;  4NXN E;  2KON A;  2HHH E;  2JY9 A;  4TUI A;  4DV7 E;  2LUP B;  2UUC E;  4B3R E;  3MSW A;  4OOG C;  4DR1 E;  2M7Q A;  4BMJ A;  2V87 A;  2L3C A;  2FTX B;  2MDR A;  4JI3 E;  2RSM A;  2FV4 B;  1N36 E;  2YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...