1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
2BBYA 1XSXA 3RKWA 5LHIA 4HF2A 1O3SA 2XUBA 2G7HA 1P4AA 4AIHA 1G4DA 1QZZA 5E1WA 3E3VA 4Y17A 3AAFA 2CQKA 2L02A 1GHCA 1ZHFA 5IT3A 4GGGA 4PDKA 2J5PA 3QAHA 5DCFA 2OA4A 4UXNA 1PDNC 3KE2A 1TNTA 2ZNZA 1MKMA 4AVPA 5KK1A 2P7VB 2EWNA 1TQIA 3F8NA 3MEXA 5ICCA 1PUEE 1XB4A 3GXOA 2G7UA 2OQRA 1TQPA 3EQLF 4EMSA 1R22A 2WV0A 4R79A 1FT9A 2FXAA 3J81K 3ZMVA 5HS9A 5F1RA 1J2XA 2LF8A 4IVNA 2E1NA 2GQQA 2RDPA 1REPC 3S2WA 3I59B 5DV5A 3PQJA 2FSWA 4JK1X 4WXHA 2L3DA 3HHGA 4D0PA 2X4HA 4I98B 3IKVA 2PJPA 4BYYA 2XASA 5L3CA 4ZYDA 5TRDA 1LDKB 1X3UA 4KDPA 2Q8KA 1G3YA 2MBFA 1YYVA 4Z2YA 2P5KA 1U5TB 3KLNA 3ELKA 4YIIA 4G7OF 2D1VA 2VBZA 1QNTA 2V79A 3KEOA 2IA0A 2QQAA 4RGRA 4I0BA 1MJAA 4YFNF 4BAYA 3BPXA 1BI3A 1F4KA 3KP4A 3ZMSA 3ECOA 4R8HA 5DUIA 3Q9VA 3JAMK 4I01A 5KVRA 3HOSA 3KZYA 2VBYA 1R00A 1F1ZA 4S05A 3WTSC 3JTGA 1ZARA 1ZG5A 2H27A 3GFMA 4ENKA 2JPBA 4XRFA 2RC4A 2F5FA 2VONA 1A04A 1IN4A 1ULYA 4OIPF 3H3UA 4QLCU 4P9UA 1BBYA 4WX9A 3E6CC 3KP7A 2QQBA 3KP5A 4A6EA 4LJZF 2QQ9A 3V8KA 2BYVE 1PP8F 1KU9A 4DNCA 1T98A 3GFJA 6PAXA 4L5JA 1IRGA 2GA1A 1XSDA 1B59A 3O6BB 4N9HA 2JT1A 2XKOA 5CVJA 2CGPA 4XSXF 3TOAA 2HTJA 4EM2A 2DO7A 1LJ9A 2DBBA 3P9KA 3GX4X 3FXUA 4LLGF 1I1GA 1RNLA 2BEOA 2PMUA 1SD4A 2IP2A 3L00A 5ICFA 2IVMA 1WRJA 4HQMA 5ILUA 2DW4A 4KUMA 3WU1B 2VE9A 4MEYF 4XSZF 3LQQA 1ZAOA 2AXLA 2ZO4A 3DKWA 1OPCA 1FYMA 4RGUA 1DDNA 3BWGA 5D8KB 3GZ5A 1P4XA 4KIFA 3CUQA 3RYRA 2FU4A 2VBXA 5CVIA 1I6XA 4MGRA 2YPRA 4IHSA 5CJ9A 4RB2C 4UV8A 1ON2A 1BC8C 4ASNA 2FMLA 1BI2A 3SQNA 4P96A 4IF4A 5LEKA 4HOBA 1Z7UA 5H20A 1OR7A 5ILSA 1XGSA 2IA1A 4LMYA 1UHWA 5FLXZ 3I53A 1DP7P 1E2XA 3NEUA 4RB0A 4KMUX 2RQPA 3ABUA 5D5VB 1YQAA 4P55A 1ZYRF 1OKRA 1FBUA 3ZMTA 4RGSA 4L9TA 4KIGA 1H9TA 4A2UA 1Z05A 2DFIA 1SFEA 3DQVC 5LGUA 5LHHA 3COAC 1IAWA 2P5VA 4CGZA 2BV6A 4MHGA 1RZ4A 1K7AA 4WCGA 2EFPA 1ODDA 1SD7A 5DCMA 4LB5A 2DI3A 3E5QA 5LGNA 3K69A 3REOA 3WG9A 1L0OC 1G6NA 1R5HA 4OMZA 3WTXC 3PFIA 4ZYHA 4EJOA 5ILVA 3P9CA 4BH9A 2Z33A 4NHJA 3I54A 3WTVC 1HKSA 3WGIA 2VC1A 3DXJF 2Z5UA 4G6QA 5FFZA 2A5YB 5BS6A 4HBLA 2HS5A 4MQVA 3WU0A 2P7CB 3WE2A 4ON0A 4PGGA 4YG2F 5A2QZ 5F6FA 2D2WA 4U7DA 4EGYA 2NNNA 2ZCWA 1AWCA 2QVOA 1CF7A 4PGHA 4HZFA 1FY7A 2JSCA 4AIKA 3I5UA 1GXQA 4MQ9F 1Q1HA 1JHFA 2XGXA 5A2QK 1RUOA 4ZH4F 3BP8A 1QQIA 1YS6A 1O7LA 3RDIA 2KIFA 2XRNA 2HDCA 3QP6A 2QM3A 3ROUA 1P6RA 3GZ6A 4L9VA 4GO1A 4Q4ZF 4HLYA 1Z1DA 1OMIA 3QU3A 4MTDA 3TQNA 3R0AA 4M9SA 3RYPA 1G3WA 1S29A 3MFKA 2GAUA 2VN2A 1XMAA 2KKOA 4YIFA 3PQKA 1LNWA 2EV0A 1BM9A 4L0ZB 5JR3A 4BXUA 4M9XA 2Z3YA 4Y15A 3LFKA 2FF4A 4KFCA 1E17A 2CO5A 2FNPA 4UV9A 3WGGA 2YSRA 2HFHA 5LEJA 3WTTC 3GO5A 3QPTA 3TDZC 2GXGA 1KGSA 2M30A 1SMTA 2CWEA 4BHBA 1SD5A 1HW2A 4EQQA 4CO8A 2X0LA 4KT5C 3ZQ7A 1KU2A 2V1XA 4A0YA 1IZ1A 4EV0A 4L0YB 2BGCA 3JAMZ 1U6GA 2XVCA 2LF7A 3OOPA 1BI0A 2A69F 1U5TC 4LG0B 3KCCA 4EGZA 1IW7F 1RI7A 3D0SA 4ENJA 3FMRA 5BPDA 1Z6TA 3R6SA 4E70A 3ZMUA 1XMKA 1OYWA 2DQLA 3HOTA 2E7XA 5HLGA 1WWXA 4Q5SF 4M71A 2ISZA 4HA8A 2YX4A 4XBFA 1HSTA 1K78A 2W84A 5DD4A 3KETA 1FOKA 1WI9A 1GVJA 1QPMA 1KU3A 5L3BA 2RN7A 2P6SA 4IXAA 4BHCA 3HSRA 1EV7A 4OIQF 2IPQX 3BDDA 4RAZA 1S3JA 3FM5A 3R60A 2DK8A 5K1YA 4H0EA 2O3FA 3I59A 4HLXA 5E8IA 1DPRA 3K1MA 1UHMA 2CG4A 3J81Z 4BNCA 2KIMA 2EV5A 2O0YA 4KA4A 4U88A 1W5SA 1MZBA 4CHUA 4U0VA 4BHPA 3H3ZA 4GYIA 3BY6A 3U2RA 2ISYA 3K1NA 3HRTA 5AIPA 2FA5A 4OU0A 4M6XA 3HUGA 1U78A 4UHTA 3DFGA 1KU7A 3HIFA 4CDGA 1BIBA 5BPIA 2HKXA 2OBPA 2FE3A 2WTEA 4YFKF 5ICEA 2EFWA 2GWRA 4CXFA 2OQGA 4IHTA 2MH2A 1YTYA 2ELHA 1G3TA 3K1PA 3CDHA 3QU6A 4HX4A 1JHHA 3JSPA 3F72A 2O6GE 1BOAA 5CLSA 4NQWA 2L54A 4L9JA 4LK0F 3U1DA 5E8GA 5K5RA 1BIAA 4UVCA 1FBQA 2EV6A 1HSJA 4QWQA 2Z9OA 2L4AA 2RNJA 2KRFA 2HOEA 1KQ8A 5HDNA 3BJOA 3VEPA 4P9FA 2PG4A 3TO6A 3KP2A 1FP1D 2UXNA 3QPHA 4ESFA 4BQAA 1BJAA 1T38A 4CYDA 2HGCA 4ESJA 2CFXA 4IRHA 4M72A 2O8XA 3GLXA 3E5UA 2EK5A 2NAZA 1IRFA 3EYYA 1HW5A 3QP5A 2GIVA 2HQRA 3E97A 5D5XB 1O57A 2K02A 1V4RA 3J80K 4OMYA 1XCVA 4YFXF 2ZMEB 1IN6A 4XLPF 1ZG1A 1USTA 4RB1A 3HSFA 2OAZA 5ED4A 1XDSA 2QUFA 4PCQA 2M1BA 3HSEA 3WTZA 3F3XA 1JE8A 3ZN1A 5D8LB 5DYMA 3DEUA 2STTA 2FRHA 2DPDA 5ICGA 1O3QA 2XROA 1U5TA 1QBJA 3IWFA 2A68F 2R7DA 1STZA 3HTSB 1CGPA 3FX3A 1IXCA 4M73A 1J5YA 4MEXF 4Q47A 1AOYA 2IA2A 1B6AA 3DPLC 2K27A 3J80Z 3TGNA 2ADUA 2F5DA 3HRSA 1BN5A 4EJVA 2BE5F 3FMQA 5DDGA 5J8FA 2PFBA 2DLLA 1D5VA 3T1BA 4RGXA 3F8FA 2P8TA 2PEXA 2LSOA 5D4SA 4HV6A 4AIJA 1MJ9A 1L3LA 2VBWA 2ZKZA 1P92A 3ABTA 3K9TA 1T39A 3WE3A 4G9YA 2O61A 2HYFA 4UNOA 4L9NA 3GUDA 2VC0A 2EB7A 2DQRA 3E6DA 1TNSA 2L01A 2R7FA 5L3DA 2HQNA 4L5IA 2A61A 4HDUA 2HWVA 3F6OA 3V8LA 1WQ2A 2OU2A 4RS8A 4RB3C 5D5WB 1F9NA 1ZLKA 4OIOF 3BROA 3G3ZA 3M8FA 3ISPA 4WXDA 4KIBA 2JRTA 2XKPA 3SZTA 4FX0A 2OZ6A 2RKHA 3DP7A 1FX7A 2P5LC 1P2FA 1MDMA 5J8CA 2R3SA 1KYWA 1IUYA 3I71A 5LGTA 3M8EA 3LA7A 3M7GA 4FX4A 3G73A 1KYZA 3F8MA 5E18F 1U2WA 2XV4S 2LNBA 5D5UB 3IRRA 5AONA 4UUVA 2ACJA 1FSEA 2ZNYA 2JTVA 5HS7A 1KQ9A 2EA2A 3CUOA 3VB2A 1GXPA 2V6CA 5HOOA 2KIUA 1I27A 3GFIA 1FLIA 4U0WA 1ZG3A 3BJ6A 1T6SA 1W5TA 2YX7A 3NRVA 1LQ1A 1Z9CA 3EDPA 1R23A 3TOBA 4LD5A 1BC7C 4KN4X 2DAOA 1K78B 4IRIA 5HLHA 1C0WA 4IPAA 1SMYF 2ETHA 2Y0MA 4ZYEA 3BOQA 5FFXA 2IW5A 1IXRC 1YS7A 1SFXA 2L4MA 5CVUA 2PLYA 1YO5C 3FXRA 1TW3A 1FWZA 2DU9A 2ESNA 3HTUA 3RKXA 2VXZA 2EFQA 4GYGA 5E17F 3B02A 3CO7C 2IJLA 3M1EA 3KZZA 1XCBA 3IWZA 5FD6A 1Y0UA 2MLGA 5JHUA 1R36A 4I2OA 2RGVA 4FHTA 5H6RA 1SD6A 2NNYA 1R1UA 5LLQA 1K79A 3HYIA 5HDGA 5LRSA 4JBAA 2W57A 4EJUA 3M9AA 2QENA 3BZ6A 4M6YA 5E1ZB 2YU3A 4LLNA 3IRQA 4EVIA 2HKOA 2VOPA 3KLOA 3F6VA 4GCVA 2ZXJA 1G3SA 3T5XA 3D5LA 2ZMEA 1YIOA 4ETSA 3LWFA 4F7ZA 4LG0A 2D45A 2Z99A 2H6CA 3L7WA 3E6BA 2MC3A 5DD8A 3TO9A 2F5EA 2UXXA 4WF2A 3C3WA 2O03A 4Y13A 3R4KA 1D8JA 3T0YA 4ESBA 3DPTA 1Z6RA 4UVBA 4EJTA 3KEQA 3ZMZA 2FEZA 3DV8A 2FBKA 2H6BA 1HXDA 3K2ZA 2M87A 4JQFA 1IN5A 3WTWC 1R5GA 1FPQA 2QWWA 3ZN0A 3T8RA 1J59A 2FNAA 1ZN2A 3ZMDA 1QZYA 4I09A 3CLOA 3IKTA 3O3KA 2IRFG 4UVAA 4CZZA 4O3MA 5IT9Z 2QYOA 2NYXA 2PI0A 3F8CA 2W24A 4G94A 1J75A 5L3GA 2E1CA 3IC7A 3K0LA 4ENMA 1WKMA 3W6KB 2WC2A 1T0FA 3MWMA 2OD5A 2A3SA 3CJNA 1YFHA 1FNNA 1TQMA 3GVAA 1YLFA 2CSOA 3RJPA 3I4PA 4L18B 3I64A 1UB9A 1W4MA 2DK5A 2ZBKA 2HEOA 1W7PA 2QBYA 4KYWA 1S7AA 2LDUA 2Q0OA 5LHGA 5HS8A 4I02A 1RIOH 4ZZDA 2MD5A 3CTAA 3MZHA 1MJBA 4EM0B 2A6EF 3L9FA 3GFLA 2M8EA 1OYIA 1W7PB 1IF1A 5E20A 1XGNA 2PN6A 5HLIA 3IL2A 2W85A 5FGMA 4MTEA 1HW1A 4PZJA 1WSUA 2WWYA 4LGWA 5TJJA 2PMHA 2HTSA 3SFZA 1SFUA 1S7OA 1ZRDA 5FD5A 1LB2A 2V1DA 1R1VA 1R58A 4I7HA 1V3FA 5F64A 3T8TA 3L2CA 3TKYA 3WGHA 1KQ0A 3TO7A 1LVAA 4NB5A 4DQ2A 4FT8A 1HBXG 1T2KA 1HKTA 1XGOA 4WWCA 2STWA 2KJBA 3ERED 4LB6B 1F5TA 5EEHA 1O7FA 3E6MA 5FLXK 3C1DA 1NHAA 2CYYA 3O2PE 4ENNA 3MAJA 1EH7A 2QZ8A 2V9VA 4GXOA 3BPVA 3F22A 5HDKA 4G6DA 2JZYA 3MCZA 1ZGAA 5L3FA 4HAMA 2EFNA 2KJCA 2M45A 1ZRFA 4G7ZF 4TV7A 2E7WA 2OZUA 1EH8A 2DPUA 1S6LA 2RVCA 1UCRA 4S04A 4Q48A 5E1XA 2UWMA 1P4WA 1Z91A 2HR3A 4HW0A 3V4GA 3KP6A 3V7SA 4LK1F 3ULQB 3RPUA 1U8RA 1HKQA 4A6DA 5AIQA 4P5OA 3ZP5A 3Q9SA 3RIRA 3HRMA 1W7PD 3MZYA 5BOXA 4AWXB 2COMA 2K4BA 3FWEA 1TBXA 3OV8A 1QO0D 4HDVA 4A12A 1U3EM 1PP7U 3WTYC 1XSVA 5K5OA 1LEAA 2K7LA 3RPQA 4B09A 1USSA 4HYEA 5L3EA 5CVRA 1S8NA 3JW4A 3LA3A 4EM1A 1ZLJA 3E5XA 1IN7A 1MGTA 1ZREA 3DF8A 1TLHB 4M74A 4HF1A 1LDJA 5FO5A 1ZH5A 2MH9A 5K5QA 5LBQA 4WXCA 5DUKA 1RUNA 1O3RA 2NS0A 1B4AA 1HQCA 3FF5A 3LQRA 2P4WA 2M5WA 4ZZLA 3H92A 2DTRA 1TTYA 5DCMB 5D6EA 1K6OA 1UFMA 1JGSA 3TDUC 5JFRA 2DT5A 1YW7A 4MNUA 1D8KA 5LRRA 2HZTA 4B8XA 1XDUA 2HYGD 2J5OA 2C6YA 3F23A 2D1HA 2EFOA 1MDMB 1I1SA 3CUQB 1D3YA 4G8XA 1FYKA 1EH6A 1B9MA 1JXSA 3RI4A 1DPUA 3P7NA 3FZVA 5J6XA 4R1HA 4EJWA 2AS5F 1B1BA 2VT2A 1R1TA 4ZYGA 3VODA 3FHZA 2ZJ2A 1YG2A 3V8JA 2YR2A 1ZGJA 2CW0F 3MQ0A 4A5NA 3I0TA 3SXYA 4A0ZA 5IT9K 1TW2A 2GA2A 2GZWA 3R61A 3ML6A 2NRAC 3RKYA 1CF7B 3EYIA 3I58A 3WODF 2ZFWA 3ECHA 1ONVA 1ON1A 1J0RA 5FB2A 4IJAA 4M9ZA 4U0YA 3L09A 1VTNC 2F5CA 3V7RA 3WTUC 2TDXA 1XN7A 1YW9A 1SAXA 4KNYA 3KP3A 4RAYA 2QLZA 3HRUA 2RV8A 1OYYA 4O6JA 3EUHA 2LKPA 4IRGA 4CICA 2FQ3A 2XAFA 1H9GA 5JVTA 1LDDA 2VE8A 2G9WA 3W6JB 4A5MA 3FXQA 3CO6C 2EJRA 3CUQC 3V7CA 3GYHX 2H09A 2FBIA 2MLKA 3VOEA 3EETA 2K86A 5H6QA 1XD7A 5CVVA 4HX7A 5BMZA 2V1UA 1XGMA 2F2EA 3GW2A 3GWZA 1J9IA 2PQ8A 4I0AA 1LEBA 2FOKA 2JPCA 1FZPB 4A0XA 4K2EA 3IHUA 2K4JA 2ESHA 3B73A 5BQTA 1DUXC 4HX8A 1QGPA 2H94A 3NQOA 4N9IA 2XAQA 1FC3A 5DEQA 2XAGA 4LFUA 4OIRF 3F21A 2Q2EA 3LAJA 2XIGA 5EEGA 1KA8A 1YW8A 1MD0A 3HHHA 2FBHA 1ZRCA 3R0JA 2XAHA 2A6HF 5D4RA 3ZPLA 1R7JA 3RTRA 3BJAA 1FBSA 3U9GA 1IXSB 1H0MA 2W25A 2VOOA 5D6FA 2A07F 5JI6A 2Y75A 4AD9A 4HQEA 5HVQC 3LA2A 3LSTA 3QOPA 1I5ZA 3N97A 3GF2A 3C18A 3F8BA 3VFZA 2VODA 4KN7X 1FYLA 4G7HF 3SZPA 3N4MA 1O3TA 1J7KA 1FP2A 1IN8A 4OOIA 4WK8F 2XHKA 5CYVA 1FSHA 4KMFA 2XAJA 3KFWX 3FMSA 5ERIA 3SHFA 2P6TA 1B9NA 4U7BA 2QBYB 4N0BA 2MA3A 4LLLA 3QRFF 2UZKA 3C7JA 4HV5A 4OINF 3GEZA 2EA4A 2Y48A 3FM3A 2GXBA 1BI1A 3Q5FA 3P9IA 3J7AO 3JSOA 4O5VA 2IT0A 2B0LA 2PBIA 2FMYA 4HF0A 4XLNF 3LAPA 4KICA 3JTHA 2VT3A
chains in the Genus database with same CATH superfamily
2NS7A 2BBYA 4R2PA 1XSXA 3RKWA 3VHTB 2EOEA 4XKBA 5LHIA 4BY1J 3VK6A 3OYDA 2E1MC 4XICA 4ZC3A 1O3SA 4HF2A 2XUBA 2G7HA 1P4AA 4AIHA 1G4DA 1MSEC 3VYXA 1QZZA 5E1WA 2V85A 3E3VA 4Y17A 3AAFA 2V9KA 2CQKA 2L02A 3BZKA 2BY2A 4A93J 2F5VA 1GHCA 2DB2A 5KL5A 1MMDA 2EQ1A 4F6NA 2NVTJ 3MZ8A 4IOAF 1OJLA 1ZHFA 1VQ6I 2LBFB 2IGMA 4PJ0C 1YYOA 5IT3A 4GGGA 2YTQA 3KPHA 4PDKA 2IS6A 2J5PA 3QAHA 1K4SA 5DCFA 4DZJA 2BB8A 3DPUA 2OA4A 2P0WA 2CV2A 4UXNA 1ZTRA 1PDNC 3KE2A 1TNTA 2ZNZA 1MKMA 4AVPA 3JR9A 1G59A 5CPRB 2EMKA 5KK1A 3K6QA 4HNTA 3CLQA 2P7VB 5AASA 2EWNA 5EGOB 1P7JA 1TQIA 3J7YJ 3F8NA 4PFPA 2BVLA 2Z16A 2JOBA 3MEXA 5ICCA 3FXJA 2BXZA 1PUEE 3K7AJ 1W0TA 1DQ3A 1XB4A 3GXOA 4BMJA 2HXIA 2BY0A 2G7UA 3AUZA 2OQRA 1TWFJ 1TQPA 5IP6A 3EQLF 4EMSA 1R22A 4ZDLA 3B6CA 1HA8A 2MW8A 2WV0A 2EMZA 4ZTFA 2CW7A 5GAEJ 4R79A 1FT9A 2FXAA 3J81K 3ZMVA 1ZGWA 2CTDA 2CQQA 5HS9A 3ZQHA 1F36A 4A3MJ 1JKPC 3JRHA 2V87A 2YZTA 5F1RA 1J2XA 2LF8A 3DEEA 3RSNA 1VZ0A 2KZGA 4IVNA 3MKZA 4NBQA 1MMNA 1OCRH 2XF5A 2LLKA 2E1NA 3K4KA 1O0WA 2GQQA 3PUBA 5CQGA 2VKDA 2RDPA 4AVZA 1REPC 4A3KJ 3LSKA 3S2WA 1BW5A 4EEFG 2L5QA 4JI7E 4XLHA 3ZGKA 2W48A 3I59B 3BGHA 5DV5A 3PQJA 1DGRM 2FSWA 2EOFA 1WPKA 3RPUD 2E72A 4JK1X 2KIQA 2OJED 1ZBQA 5BR8E 4WXHA 2DSYA 3ASNH 2RQLA 2L3DA 3HHGA 4BJTA 2X4HA 4D0PA 3JRGA 3HDDA 4LITA 1U8BA 2RPCA 4I98B 2NA2A 4DV4E 3DBLB 3IKVA 2PJPA 2VI6A 5M5YJ 1X1CA 1A31A 1RESA 2WBMA 4DR7E 4BYYA 2XASA 5L3CA 4F93B 1CQTA 1W36D 3CC4I 4IKFA 4ZYDA 2A6TA 5TRDA 1LDKB 4AYBA 1ETYA 1X3UA 3OR1C 4KDPA 2Q8KA 2I9IA 2IS2A 1G3YA 2MBFA 5KL6A 1YYVA 4Z2YA 3ZQCA 4BEHB 2KFDA 2P5KA 1U5TB 3VYTB 3KLNA 4XLAA 2I8DA 5FLMJ 3ELKA 4YIIA 4G7OF 1RC9A 2WAQA 2D1VA 2ZJRF 4O5GA 2VBZA 4PK4A 1QNTA 2V79A 3KEOA 1SEUA 2IA0A 2QQAA 2BY3A 2EPMX 4RGRA 2MKNA 5A6AA 4I0BA 1MJAA 4Y7NJ 4YFNF 3DTIA 4BAYA 1K61A 2R7VA 2YT4A 1FIPA 4D9JA 3BPXA 1BI3A 2EPKX 4JX5A 1JTYA 1Y0NA 1F4KA 2WBSA 3DBHB 2DMUA 5IYCJ 2JA6J 3KP4A 1WVRA 1AKHA 4QPQA 3ZMSA 3ECOA 1ETKA 4R8HA 4J8ZA 3BTIA 1SFOJ 2DMIA 5AC5A 4RHBB 3LNQA 5DUIA 2JA8J 1I3QJ 3GTQJ 3GLLA 4F9CB 3Q9VA 3TMOA 3JAMK 3ZQLA 2ZSIB 1V5GA 4I01A 5KVRA 3HOSA 2NUEA 1UG0A 3HOWJ 3KZYA 3A01B 3JRFA 2VBYA 1UZCA 4XLEA 4JOMA 2R7RA 4DV3E 1R00A 1F1ZA 4S05A 3WTSC 4UB6C 2A05A 4DBQA 3JTGA 4BUPA 2KT0A 1MNEA 1KONA 3TEDA 3RQ4A 1ZARA 5CKTA 2WBTA 4CSWA 1ZG5A 5ADZA 3OSFA 2H27A 3GFMA 3H5NA 3S32A 1IV8A 2JPBA 3CJQB 4ENKA 2EIMH 2EPZA 4XRFA 1JK2A 2KISA 2RC4A 1PUFB 1SVLA 2FJ1A 2F5FA 2VONA 2OC6A 4JP0A 3FISA 1A04A 1IN4A 1ULYA 4E7HA 2LYCA 4OIPF 2YPNA 3H3UA 2MC4A 3OIOA 4QLCU 4HTGA 3BG5A 4B48A 4P9UA 3CCJI 2M7BA 1BBYA 4WX9A 2JRMA 5IT9C 3E6CC 1X2NA 2QQ8A 3ABLH 3QYFA 3KP7A 2QQBA 4RM2A 3G1MA 3KP5A 4A6EA 4LJZF 2QQ9A 3V8KA 4BY7J 2LV2A 2BYVE 2CW8A 2GOMA 3CQZJ 1N75A 1PP8F 1KU9A 3HGYA 3SYTA 4CCNA 4DNCA 5B1AH 1T98A 3GFJA 1FJLA 2EM4A 6PAXA 1TP4A 4XRSA 2NOGA 4L5JA 1IMUA 2HQ5A 1IRGA 5AC4A 3QOEA 2GA1A 2NVYJ 1NH3A 1XSDA 1B59A 1TC3C 3O6BB 2EJ4A 4N9HA 1TN9A 2EMGA 2XPVA 2JT1A 5K7ZA 1T0FC 2XKOA 4B3SE 4FASD 2E34A 5CVJA 2FGGA 4HPQA 2CGPA 4ZDPA 4XSXF 3TOAA 2R93J 2HTJA 1LKXA 4EM2A 1TT5B 5FJ8J 2XPUA 2MFZA 5EYRA 2DO7A 3KX2A 1LJ9A 4CYCB 1WHQA 2EPUA 1YYWA 2DBBA 2M2EA 3P9KA 2IGOA 3GX4X 2Y9ZA 3FXUA 3ASOH 2V83A 4LLGF 1N77A 2V86A 1I1GA 4R2RA 1RNLA 1TWAJ 2UXBE 3TBIA 2BEOA 2PMUA 2PJRA 3S3MA 1SD4A 2IP2A 2VJJA 3QYEA 1OFCX 4XMYA 2L0KA 3L00A 5ICFA 3W2WA 2IVMA 1WRJA 1BB8A 1IQOA 2TCTA 4HQMA 2B9DA 5ILUA 1T8IA 3QWLA 4ZDOA 2DW4A 2VIXA 2OV7A 5EDNA 4KUMA 4MEYF 3WU1B 1BOBA 2VE9A 4XSZF 2CQNA 3LQQA 1ZAOA 1EF4A 4J00A 2R5ZA 2PMZA 1ZR9A 2L9NA 2YU8A 2AXLA 2ZO4A 3DKWA 4IL6C 1OPCA 1FYMA 2D5VA 3S1MJ 4RGUA 2EMCA 2GLIA 2EZLA 3K4LA 2GM4A 3GTLJ 1DDNA 1R4MB 4LIVA 3EPKA 2DA4A 4X64E 3BWGA 5D8KB 1ETQA 2CFOA 1YRNA 3GZ5A 4X62E 1ZR2A 4DR5E 1P4XA 4R2EA 4KIFA 3CUQA 1UG2A 3RYRA 2E60A 2FU4A 2X1DA 2YUSA 2LRSA 2VBXA 5CVIA 1I6XA 2RTXA 3A03A 1JKQC 3CMMA 2CUFA 3MSWA 4ANJA 3LMLA 4MGRA 3SFIA 1R9TJ 2YPRA 4IHSA 2KLOA 5CJ9A 4RB2C 3K4CA 3OYEA 4UV8A 3OYIA 1ON2A 1BC8C 3ZRGA 2FMLA 4ASNA 3KEYA 4A3EJ 1BI2A 4UB8C 3PSFA 3SQNA 3CCLI 4P96A 4W1UA 4XKVA 2UV1A 4XRMA 3KYLA 2HJJA 2H8WA 5A2QC 2LY2A 4F6MA 2F4IA 4V2GA 4IF4A 2ZB9A 4BBSJ 4XRSG 1WHUA 2LTSA 3BR0A 5LEKA 4KHPE 1I94E 4HOBA 1Z7UA 5H20A 2L2KB 1OR7A 3CCUI 3ABKH 1G8XA 1IJWC 3BR1A 1FMWA 4RLQA 1YE9A 1XGSA 5ILSA 5DS9A 2IA1A 1RR8C 1AU7A 4LMYA 1B8IA 3A02A 2JN6A 2I13A 2QSFX 1UHWA 2RSIA 3BTLA 2EL6A 5FLXZ 3I53A 4DMIA 1DP7P 2CUJA 1E2XA 4CCLA 3NEUA 4RB0A 1LUJB 4KMUX 4I99C 2RQPA 1X49A 3ABUA 5KL7A 3J7Yp 3HM5A 3FIWA 5D5VB 4GDFA 1YQAA 4II3A 1WGXA 2PMZN 4P55A 4GKKE 2H36X 1GUUA 2ZJPF 1ZYRF 1OKRA 1FBUA 2GIZA 3ZMTA 4RGSA 3G4SI 2EM2A 1RKTA 2ZXWH 3BR2A 5GTIC 1MBHA 4L9TA 1YITI 2MC6A 4KIGA 1MBEA 1H9TA 5HODA 4BE2A 3HOVJ 4A2UA 1Z05A 2DFIA 1SFEA 1FTZA 2HVRA 3DQVC 5LGUA 5KHDA 5LHHA 3COAC 1IAWA 1S5LC 3BF2A 3ECRA 2P5VA 2QKMB 2EM0A 3CJRB 2BV6A 4NC7A 3W2VA 4DJAA 4CGZA 3DF6A 4DV6E 1E0EA 4MO7A 4MHGA 3HOZJ 1RZ4A 2Y0SN 4N4OB 1K7AA 2FQ4A 3VSKA 4WCGA 1A1JA 3BG9A 2EFPA 1ODDA 1KYQA 1UELB 1SD7A 5DCMA 1XNRE 3LSMA 4LB5A 2DI3A 3E5QA 5LGNA 3K69A 4E7IA 3REOA 3WG9A 2F4VE 1L0OC 1G2FC 1G6NA 3C4BA 3GTPJ 3I4NJ 1R5HA 1J5EE 4B44A 5J4VA 4OMZA 3WTXC 2E1MB 3PFIA 5FKNA 2R5ZB 4A3JJ 4ZYHA 4EJOA 2W82A 2RREA 2ELYA 2LBSB 5ILVA 4B4CA 3P9CA 4BH9A 2ENAA 4DV5E 5KAIC 3S2DJ 4FETA 2Z33A 3GCMA 4NHJA 3OYCA 4BC9A 4NC6A 4PJLA 4UUSB 3HL2A 3BG7A 3I54A 1D0ZA 1Y39A 3WTVC 3H5AA 1IBME 4HRIA 1HKSA 4LFAE 1P47A 4C3JJ 3WGIA 3HKZA 2MSYA 2VC1A 3DXJF 2Z5UA 3E7LA 3P1XA 4G6QA 5FFZA 2YTGA 2DFEA 2A5YB 5BS6A 1IDZA 4HBLA 2HS5A 3MVPA 1YZ9A 3IP4B 4MQVA 3WU0A 1VQNI 2P7CB 2D9HA 2EPNA 3WE2A 1QU6A 2Y31A 1JKOC 2LRDA 4ON0A 4PGGA 4YG2F 4CH7A 5A2QZ 3FIGA 5F6FA 2D2WA 4U7DA 2XAUA 4EGYA 5B1BH 2NNNA 3KYCB 2XC7A 3CMAI 3JRIA 5EEAA 2JVGA 2ZCWA 1X3WB 1AWCA 2QVOA 3C6KA 3AFHA 4F9AB 3I9V2 4GRIA 2EPAA 1CF7A 4PGHA 2HGHA 4HZFA 3GTJJ 2EILH 3HQ1A 1FY7A 2DA1A 2JSCA 4AIKA 3I5UA 1GXQA 4MQ9F 5JLXA 1Q1HA 1ZU1A 1JHFA 2XGXA 4DR1E 1T08B 5A2QK 1Z3YA 1Z3XA 1RUOA 3ABMH 4ZH4F 3BP8A 3OL4A 3BT9A 4MFDA 4X8WA 3O8GA 2FTXB 3LL7A 1PJRA 1QQIA 4BQQA 2WV1A 2N3GA 2JVAA 1TF6A 2CQ7A 4M6VA 2VRDA 1VQ9I 2YWQA 1YS6A 4JI8E 1O7LA 3RDIA 1RKWA 4D1QA 2X6XA 5IP9J 3IAM2 3RQIA 2KIFA 2XRNA 2HDCA 3QP6A 2QM3A 2HDDA 3CP8A 3ROUA 5GP9A 1ETOA 1P6RA 2ME6A 3GZ6A 4FQGA 4L9VA 2GOXB 3H1CA 1HNXE 4GO1A 2IEKA 3ZQGA 3ZR8X 4Q4ZF 4HLYA 3OYKA 1Z1DA 2EWLA 3K6GA 4CCJA 5IOZA 1OMIA 1TWHJ 3QU3A 2E5ZA 2Y2ZA 2VUMJ 2OTJI 1XMQE 4MTDA 4DV2E 3TQNA 2DMNA 3R0AA 4M9SA 4IO9F 1PDAA 2L7KA 2DA6A 2DDAA 1R5ID 3RYPA 3NARA 3EUKL 4GZNC 5GPAA 1G3WA 2EPCA 1S29A 3MFKA 2LH9A 2GAUA 2QGUA 2VN2A 1IBLE 1XMAA 2DCEA 5FKKA 2V4JC 4F2JC 5KL2A 3HB9A 2KKOA 4YIFA 3PQKA 1LNWA 2EV0A 4XOTA 1BM9A 4L0ZB 3NWTA 5JR3A 1LFUP 3RKQA 4QTRA 5EZGA 2LUQA 1QVTA 4BXUA 1MW7A 3FBNB 4HNUA 1VQOI 4M9XA 1O4XA 1ETXA 2LK2A 2Z3YA 1MSFC 5JVGF 1MNDA 3HOUJ 4Y15A 2K3FA 3LFKA 2FF4A 4KFCA 1E17A 2CO5A 2EZHA 1GVDA 1A6QA 2FNPA 2IHR1 4BBYA 1YYKA 4E4HA 5IWAE 4JI2E 4UV9A 3WGGA 3N05A 2JYAA 4JV5E 2YSRA 4HEIA 2HFHA 5LEJA 3WTTC 2E5NA 3GO5A 3QPTA 3F6HA 3TDZC 2GXGA 1KGSA 2M30A 2NUGA 1SMTA 2CWEA 4BHBA 1GT0C 3OR2C 1SD5A 1V55H 4EQQA 1HW2A 4BKXA 4CO8A 4O43A 2LMZA 2X0LA 4KT5C 3ZQ7A 1X6FA 1KU2A 2V1XA 4A0YA 2R7TA 1IZ1A 3CCQI 4EV0A 2Y0SA 1HCRA 2EM6A 4L0YB 4FISA 5M3MJ 1UHZA 2BGCA 1S72I 3JAMZ 4FE4A 1U6GA 2XVCA 2LF7A 1N32E 3OOPA 1BI0A 2LJHA 2A69F 1U5TC 2R7OA 3BLYA 3OYJA 4LG0B 3KCCA 4EGZA 1IW7F 2LVHA 5IPAA 3M99B 1RI7A 1QA6A 3D0SA 4ENJA 3FMRA 4D7NA 3HPGA 5BPDA 1Z77A 1Z6TA 2R76A 3R6SA 4X65E 3FKJA 5IYBJ 4OAYA 4B3TE 3BCBA 3RMPA 4E70A 3ZMUA 1XMKA 3MMYB 1QPIA 1OYWA 2DQLA 2ELKA 3HOTA 2E7XA 2GXAA 5HLGA 2M9HA 1WWXA 4Q5SF 4M71A 1BBGA 4K0KE 2ISZA 1A1IA 5F04A 4HA8A 2WY8Q 2EMWA 2A5WA 2YX4A 1E3HA 1BR2A 4XBFA 1HSTA 2LKSA 1YOVB 1FJGE 1BBOA 1K78A 2W84A 4NNJA 5DD4A 2HNHA 2DOFA 2LR8A 2PX9A 3CZ6A 1WI9A 3KETA 2VKVA 3L2RA 1YX5A 2HOAA 1IV6A 1GVJA 2EMYA 2L8TA 4Y52J 1QPMA 1X1DA 1KU3A 2Z1DA 4N4RB 5L3BA 2RS7A 2M4KA 3W3CA 4R2QA 3GTGJ 3V42A 1ETWA 3C4TA 2RN7A 3UKGA 2P6SA 3PNTA 4IXAA 4BHCA 5C3EJ 2QKLB 4IEJA 3HSRA 1EV7A 4IHVA 2YTEA 4JI3E 4OIQF 2IPQX 3BDDA 4MLOA 3MKYB 4DKKA 1T33A 4RAZA 2KMUA 2AQFA 1S3JA 3FM5A 5IV8B 2LVSA 3R60A 2L7MP 1OR7C 1K83J 2DK8A 5K1YA 3ZQIA 1PVEA 3VPRA 5DM6F 3S1RJ 4H0EA 1WH5A 1Y8QB 2O3FA 4PFOA 3I59A 4HLXA 5E8IA 1DPRA 3Q0VA 4LOCA 1DI2A 3K1MA 1UHMA 4CZCA 2CG4A 4KJZA 3J81Z 4BNCA 5FRNA 3B6AA 1IBKE 4D5FA 2EM3A 2KIMA 3M07A 2EV5A 2EN6A 2O0YA 2X6YA 1V54H 3PFYA 2MABA 3H0DA 4KA4A 4O4KA 1DGWY 4A3CJ 4U88A 1W5SA 2EP3A 1MZBA 3J7ZI 3LSJA 4FTHA 2H8RA 4CHUA 4U0VA 4BHPA 1LFPA 5CFFE 3H3ZA 1BW6A 4B43A 4GYIA 3E1SA 3BY6A 4KISA 4RAGA 3AV0A 2QEXI 3CCEI 2CS3A 3U2RA 3DWLE 2Q1ZB 2ISYA 2JWTA 3K1NA 3AL0B 4RA2A 3HRTA 5A69A 3IV5A 5AIPA 2FA5A 4OU0A 4M6XA 1A1FA 1EA3A 5E3MA 3HUGA 1U78A 1PJQA 5AE1A 4UHTA 3DFGA 1W1WE 1OQYA 4KT6A 4YELA 1KU7A 3HIFA 4CDGA 2MG4A 2DFHA 4QIWN 1BIBA 5TSEA 5BPIA 2HKXA 2JA7J 2UUZA 2OBPA 3SEZA 2FE3A 2XGCA 4E7JA 3CDIA 2JVHA 4LFBE 2WTEA 4YFKF 4XM3A 3Q3SA 5ICEA 2EFWA 2GWRA 4CXFA 3RZOJ 1GTKA 2OQGA 4IHTA 3GZNB 2MH2A 1R6RA 3CMYA 1MIJA 3DKYA 4LIUA 5E79C 5J1YA 1YTYA 2ELHA 1G3TA 3IWDA 2XGEA 1VQ4I 3K1PA 3CDHA 3K4NA 3QU6A 1UILA 4HX4A 3I56I 3DTKA 2YS9A 1JHHA 3JSPA 3F72A 2O6GE 2E1OA 2KRHA 4B3AA 1BOAA 2O9LA 2JWOA 5CLSA 2CU7A 4NQWA 2L54A 5J3LA 4ZTJA 4L9JA 5E3LA 3OYMA 3FXLA 4LK0F 3U1DA 4X6AJ 2ZM6E 5E8GA 4R2CA 3ZXSA 5K5RA 2ELJA 4GFBA 1BIAA 4R8OA 4N4NB 5HLTA 2OF7A 3CP2A 4UVCA 3EPHA 1V5FA 1FBQA 2EV6A 4F52A 1HSJA 2L4AA 2RNJA 4QWQA 2KRFA 2HOEA 2Z9OA 1KQ8A 5LMNE 5HDNA 3OYFA 4IS1C 5F08A 3OYBA 2EN3A 3BJOA 3VEPA 2CUEA 2JPAA 4P9FA 4LF8E 2PG4A 2CPNA 3VYYA 2I5UA 3KP2A 3TO6A 1FP1D 2UXNA 2Y30A 2IS1A 3QPHA 5LFAA 4A3IJ 5E3OA 2EM8A 4ESFA 4BQAA 4JI6E 1IUFA 1MBJA 2EN4A 1WJEA 4JI5E 3BR6A 1BJAA 2BXYA 1T38A 3MKWB 2DYRH 4DV7E 1ZK8A 4CYDA 2HGCA 1YHQI 4ESJA 4XL9A 2CFXA 4IRHA 4DGWB 4M72A 3GLXA 2O8XA 3E5UA 1P9QC 2EK5A 5M5WJ 2VLAA 1SVMA 2NAZA 3K10A 1MEYC 1IRFA 1D0YA 2RQQA 2XRLA 4A3BJ 3HGGA 3EYYA 1HW5A 2L3JA 3QP5A 2GIVA 2HQRA 3DJWA 3E97A 5D5XB 2MD0A 2EE8A 1O57A 2K02A 1B69A 1V4RA 2R0QC 2EPOA 4BXXJ 4DV1E 2YTOA 3U21A 2CSHA 4BE1A 3WHCA 3J80K 4OMYA 1XCVA 4YFXF 4UUSA 4IZZA 2ZMEB 3L2UA 1K4TA 4WYQB 1IN6A 3D5SC 1WFXA 4XLPF 1ZG1A 1USTA 4RB1A 3HSFA 2OAZA 1LFBA 1VQ5I 2NUFA 2VJ4A 5ED4A 2EPXA 4ZJZA 1XDSA 2QUFA 4X9JA 4PCQA 3CCVI 2M1BA 1FOKA 1UN6B 1J26A 2BZTA 4C3HJ 3HSEA 3WTZA 5JLWA 4JX4A 1T4NA 4XIDA 3F3XA 1JE8A 3DU5A 3ZN1A 4XQFA 5D8LB 3BG6A 5DYMA 3G2BA 1VQKI 2L3CA 4JI1E 1U9NA 3DEUA 2FV4B 3MKLA 4F92B 2EPRA 4F9BB 1XPXA 2VJIA 5KL4A 2K9LA 4LF9E 2STTA 3HZJA 3M3YJ 3CCSI 3FXKA 5EG0A 2BW3B 2FRHA 1ORKA 2DPDA 5ICGA 2AHQA 1O3QA 2XROA 1U5TA 1QBJA 3IWFA 2A68F 3DBRB 2R7DA 1STZA 1W0UA 3HTSB 1CGPA 2ZSHB 2R7QA 3M1CA 4IQJA 3FX3A 4XLFA 1IXCA 4RMNA 4M73A 1J5YA 1VNDA 4Q47A 4CCKA 4MEXF 5J40A 2K4VA 2YTJA 1AOYA 2IA2A 2YRMA 5TISC 1B6AA 3DPLC 2WCC3 2K27A 2IGNA 2XSJC 3J80Z 3TGNA 1A6IA 3JRCA 2X48A 2ADUA 2F5DA 1H88C 3HRSA 1BN5A 4EJVA 1I50J 4HG2A 2BE5F 1N33E 3FMQA 3TP3A 5DDGA 3DLAA 1JUMA 2LUPB 5J8FA 2HI3A 2PFBA 3GBGA 4KITB 5GAHJ 3HPHA 2DLLA 2YTDA 1XC5A 1D5VA 3AL0C 3T1BA 4RGXA 3QG5C 3QODA 3F8FA 2HOSA 5IYDJ 2P8TA 4F55A 2PEXA 2UXCE 1IQSA 2B63J 2LSOA 3TL4X 2HOTA 4R2SA 4P7DA 2DA3A 4HV6A 5D4SA 4AIJA 1MJ9A 1L3LA 2AO9A 3HTXA 3L2VA 2VBWA 5GAGJ 2HZDA 4PJMA 3JCUC 4NC8A 2R1FA 2OCCH 3PM1A 4FK5C 3HOXJ 4C2UA 2ZKZA 1P92A 3ABTA 3SEQA 4KWYA 3K9TA 3EUAA 3DCFA 1T39A 3QPSA 3C6MA 2K9QA 3WE3A 3NWSA 4G9YA 2O61A 3CDLA 2LOOA 1HF0A 5F0CA 2YU5A 1OLTA 2DOAA 2HYFA 4UNOA 3KYDB 2VQLA 3OYLA 2JY9A 4L9NA 3GUDA 2VC0A 3PNVA 2EB7A 2V8QB 2DQRA 3E6DA 1IDYA 1TNSA 2ECCA 2NOJB 2ENHA 1AAYA 2L01A 2R7FA 2VJ5A 2VKEA 5L3DA 4JYAE 2HQNA 1YPNA 4L5IA 2EOQA 2A61A 4HDUA 2HWVA 1VQ7I 2EPFA 3LLHA 2JP9A 4AU7A 3F6OA 4XNFA 1WQ2A 3V8LA 3PO3J 3CC2I 4DW6A 2EOYA 2OU2A 1FKAE 1M1EB 1HR0E 1D1AA 4HSTA 4RS8A 4RB3C 5D5WB 1F9NA 1H89C 1RMDA 2EMFA 2VF1A 1ZLKA 2YSPA 3PUFA 3J7AG 2BW3A 4OIOF 3BROA 3G3ZA 1GZ6A 1XG1A 3M8FA 3ISPA 4WXDA 4KIBA 2WBUA 2EZ6A 2JRTA 2XKPA 2R5YA 3SZTA 5F1JA 1BA5A 3WG7H 4FX0A 4Q35B 2N3HA 2OZ6A 2RKHA 3DP7A 1EKZA 2E1MA 4BQOA 1FX7A 2P5LC 1P2FA 3ZOQB 1KJKA 4IX7A 1MDMA 4Y33A 5J8CA 2R3SA 1KYWA 3J7AY 4ITVA 1IUYA 2LO3A 3I71A 5FLVA 2R7ZJ 2JJ7A 5LGTA 3M8EA 5LMUE 3LA7A 5KL3A 3M7GA 4FX4A 4IHYA 3ZOBA 5GADJ 1VI0A 3G73A 1GQEA 1KYZA 2B7EA 1X47A 2ID3A 2VQGA 3F8MA 3A2KA 1U9OA 5E18F 2DT6A 1APLC 1U2WA 4X0GA 2XV4S 2LNBA 5IY5H 5D5UB 3IRRA 1QU3A 2KHXA 3BZCA 3LOCA 3D1NI 2AXTC 2L33A 2L7FP 1WJFA 5AONA 5J1RA 3DEWA 3RCOA 3OY9A 2ACJA 4UUVA 5EJCA 1FSEA 2ZNYA 2JTVA 5HS7A 1X4PA 1KQ9A 2EA2A 2EOSA 3K70C 3CUOA 3VB2A 4BJ5C 4F54A 2M4GA 1GXPA 1TWCJ 2V6CA 1F2IG 3CCMI 1T95A 3OS2A 4LF4E 5HOOA 1VQLI 2KIUA 1I27A 3KIOA 5KNLA 3BTJA 3GFIA 1FLIA 1D1CA 1SAUA 4U0WA 3L1PA 5M3FJ 1ZG3A 5A6BD 3BBGA 3BJ6A 1T6SA 4Q28A 1W5TA 2YX7A 4RDUA 3NRVA 5BNGA 1LQ1A 1Z9CA 3CD6I 2YRKA 2VKHA 4QSHA 3EDPA 1R23A 3TOBA 4LD5A 1MH4A 1BC7C 4KN4X 2DAOA 3LMMA 3BQYA 2LC2A 1K78B 4IRIA 1FIAA 4MFEA 5HLHA 2X6WA 2WAQN 1C0WA 1ITYA 4IPAA 1SMYF 2ETHA 1RC7A 2Y0MA 2NVUB 4ZYEA 4PJNA 4M3GA 3OIQA 3BOQA 5FFXA 2MDRA 2KOUA 3H35A 3SDBA 2EMAA 4A3FJ 2DMPA 4NQWB 2IW5A 3G1OA 1IXRC 1YS7A 3K2AA 1SFXA 2L4MA 1XNQE 5CVUA 3AG1H 1ZELA 1YUJA 4LF7E 2L2OA 2PLYA 4YIRX 1ZBTA 1YO5C 3FXRA 1TW3A 1FWZA 2DU9A 2O7OA 2ESNA 1OCOH 1AH5A 1YJ9I 3HTUA 2PRTA 3RKXA 4IHWA 3LSHA 2PJRB 2VXZA 1X6HA 2MYSA 2JMWA 4WSGA 2EFQA 4GYGA 1PKPA 2ZC2A 5E17F 5F0FA 2YU9J 4C30A 3B02A 5K7FA 3CO7C 1JT6A 2IJLA 5HNFA 2DLKA 3M1EA 4B3ME 3KZZA 1XCBA 3IWZA 5FD6A 1Y0UA 5K7HA 2MLGA 2R7SA 2HVSA 3DKXA 4G6TB 5JHUA 2Q2EB 1X5WA 1R36A 4I2OA 2EN1A 4NXNE 2EZIA 2RGVA 4FHTA 5H6RA 3CJTB 2HPMA 3O8HA 1SD6A 2NNYA 3VSLA 1R1UA 2IGKA 4XN0A 3OS1A 5LLQA 1K79A 4PJJA 2XB0X 3HYIA 5HDGA 2M8GX 2EMHA 5LRSA 4JBAA 2W57A 3PNYA 1X4OA 2E35A 4EJUA 4E7SA 3M9AA 4AC0A 3SJMA 2QENA 1YRNB 1G2DC 4WPYA 2N8XA 3BZ6A 4M6YA 4DUZE 2M9AA 1Y1VJ 4OWRB 5E1ZB 2YU3A 4LLNA 2KP6A 3IRQA 4XLCA 4BEHA 3DLLF 4EVIA 2HKOA 4CA0A 2VOPA 3KLOA 3F6VA 2RS6A 4GCVA 2ZXJA 3BC8A 1G3SA 2EMXA 2K40A 4U87A 3D5LA 3T5XA 2ZMEA 4BL0B 4BS9A 1Q1VA 1YIOA 2MGQA 3HC7A 4ETSA 3IH3A 3LWFA 2EN7A 2JSPA 4F7ZA 4R2DA 4LG0A 2D45A 5IOYA 2Z99A 3VYRB 2XSDC 2YSOA 2H6CA 3L7WA 3E6BA 3T1HE 2MC3A 4OOGC 5DD8A 3TO9A 2W7NA 2R7XA 2F5EA 3X2QH 4E7ZA 3GTMJ 5A6JA 2VQEE 5B5EC 2UXXA 4WF2A 4XKCA 5JHFA 1B72B 4Y3OA 5T6JA 3CC7I 2JOXA 3C3WA 2O03A 3G71I 4Y13A 1D0XA 1DQUA 3R4KA 1D8JA 3T0YA 3MHHC 3CESA 4YHHE 2EINH 1Z0XA 1OCZH 1DU6A 2ZXIA 3DPTA 4ESBA 2L2NA 1Z6RA 4UVBA 1WJPA 4EJTA 3KEQA 3ZMZA 2FEZA 3DV8A 1YSAC 2FBKA 2H6BA 2LJUA 2K85A 1J09A 1HXDA 3K2ZA 2EN8A 2F8BA 4JI4E 2M87A 4JQFA 5LL6R 1IN5A 4BQNA 3WTWC 1R5GA 1AHDP 4MIMA 5F3WA 2B7VA 1FPQA 2QWWA 3ZN0A 1R4NB 4AUXA 3EPJA 4NZVA 3T8RA 1J59A 2FNAA 3KWRA 1SFKA 1ZN2A 2VQHA 3ZMDA 1XMXA 1QZYA 4I09A 3CLOA 2DMYA 1QVUA 1I6HJ 3IKTA 3O3KA 2EQRA 1OISA 2IRFG 4UVAA 1Z7LA 3FK7A 1DP3A 4E7KA 4CZZA 2QA4I 2JK3A 2I10A 3M8JA 5EF6A 1S7EA 4DOZA 1Z67A 4O3MA 3OOUA 5IT9Z 1JUSA 2QYOA 2NYXA 2PI0A 1T4OA 3L2QA 2Z2SB 2V1NA 1HDPA 4NUBA 1X1AA 5F0HA 2IAIA 3F8CA 2V6EA 2KDOA 2W24A 4G94A 4AM3A 1V5EA 2LFBA 4D5CA 1JI8A 3A1YA 1J75A 2DIXA 5L3GA 2E1CA 4RLFA 1VFCA 1PJSA 2HVQA 3IC7A 3K0LA 3OYHA 4M2ZA 4ENMA 4B1RA 1P7IA 1WKMA 3W6KB 2WC2A 2NABA 2ZJQF 3EUHC 2UXDE 2KL4A 2Q8UA 4J19A 1T0FA 3MWMA 4GKJE 2L7ZA 2OD5A 2A3SA 2LREA 3HPZA 1JJ8C 3LSGA 3CJNA 1YFHA 3ZQQA 2OPTA 1OCCH 3AKZA 1FNNA 1TQMA 2X1CA 3GVAA 2ZMEC 2M0CA 4L5EA 4RM3A 1FMVA 1YLFA 2CSOA 2KZVA 3RJPA 3I4PA 3W2AA 4L18B 3I64A 3PL8A 3P5JA 5EZHA 1UB9A 3S14J 1MBFA 1W4MA 2DK5A 2ZBKA 2EZKA 3H9QA 3OMYA 3VYSB 4DYCA 4WFTA 3HJEA 2DFFA 1N36E 1MMAA 2HEOA 1W7PA 3G1LA 2QBYA 1LE8A 3UK3C 3CMEI 2F6CA 3IUOA 4BU2A 4KYWA 1S7AA 2LDUA 2Q0OA 3HUGB 5LHGA 2NVQJ 2EOXA 5HS8A 2FX0A 2EIKH 1X19A 2EORA 1WXRA 1W5CC 2HYJA 4I02A 1RIOH 1IRZA 1FOYA 4PUSA 1Y6IA 4S0HB 4EATA 1X3ZB 2WB1A 3BTCA 2FUG2 1WJAA 3S1NJ 4ZZDA 2MD5A 4A69C 2CQXA 2HXOA 1A1LA 4CCMA 1SR9A 4MLQA 5DNYA 1JUPA 3CTAA 3AG2H 3MZHA 2V7FA 1MJBA 2V26A 4EM0B 2OTLI 4BC7A 2EIJH 2A6EF 2EBIA 4O24A 3A0BC 3K4BA 2KHMA 2DA7A 4AIDA 2CJJA 2HU9A 1F43A 1PJTA 3L9FA 3GFLA 2M8EA 1OYIA 3PIOF 1W7PB 5E20A 3FHNA 1IF1A 2JQ7A 1XGNA 2PN6A 5HLIA 4NHRA 4M3BA 3VYUB 2EPPA 4HEA2 1YIJI 3THNA 2JUGA 2TRTA 3IL2A 4RAFA 1JKRC 2W85A 2LG4A 5FGMA 4MTEA 1HW1A 2B7TA 4PZJA 1WSUA 1UMQA 2WWYA 2YTFA 2F48A 4V2FA 4DYQA 4CYCA 1B72A 4LGWA 1HC8A 2DA5A 5C4JJ 1Y1WJ 3EPLA 2CH0A 5TJJA 2PMHA 2HTSA 2CMPA 3T1YE 3SFZA 3JRDA 5KAFC 4BDYA 2E19A 4FE7A 1SFUA 1S7OA 1ZRDA 5FD5A 1LB2A 2V1DA 4XORA 1BL0A 1JTXA 2LBFA 1R1VA 1R58A 2ICWG 3QPLA 2COBA 4I7HA 4LG3A 2VQCA 1GDTA 1AKHB 4DR4E 1V3FA 2EOMA 2AQEA 2ODRC 5F64A 2X9DA 2DA2A 3T8TA 3L2CA 1GLNA 3TW6A 2K9NA 1PYVA 3TW7A 3MN2A 3HKZN 3TKYA 3WGHA 1KQ0A 1QRYA 2X85A 1BR4A 3EPZA 3CF2A 3TO7A 5AE2A 1FOWA 1TF3A 5A6KA 4XOPA 1LVAA 4NB5A 3G6EI 4DQ2A 4FT8A 1HBXG 1T2KA 3VWBA 2EN2A 3MHSC 4I76A 1HKTA 2ODRD 1XGOA 4AYBN 4WWCA 5DTDA 1MNMC 2STWA 5GPCA 2KJBA 5FKLA 3ERED 2IXSA 4LFCE 3H9GA 1FOXA 4LB6B 4I6ZA 2LTRA 1F5TA 5EEHA 1O7FA 3E6MA 1PUFA 5FLXK 3C1DA 5GTHC 2IBDA 1I3AA 1NHAA 1N25A 2CYYA 3O2PE 2UUCE 2CT1A 4DZPA 1WHNA 4BE0A 4ENNA 3ADGA 3MAJA 1YJWI 1EH7A 2QZ8A 3A4CA 2V9VA 3JREA 4GXOA 3S93A 4NDLA 5F27A 3ZQFA 3H3VK 2KONA 1R71A 4ABZA 1MMGA 3BPVA 1Z21A 2HDWA 3F22A 1E3PA 4QPOA 5HDKA 4G6DA 2JZYA 3MCZA 1WH7A 3K70D 1ZGAA 2ENCA 5L3FA 2HC5A 4HAMA 1NK3P 4J01A 2EFNA 3FXOA 1ENHA 2KJCA 2WA0A 2M45A 2VPRA 3OYGA 2EOJA 1ZRFA 1XMOE 3VDXA 2XDVA 1FEXA 4G7ZF 4TV7A 2E7WA 1WZ2A 2LCEA 2OZUA 1EH8A 2W1OA 2DPUA 5B3SH 1JT0A 2V9PA 2DJIA 1S6LA 1HNZE 2V88A 2LE2A 2RVCA 2XB5A 1UCRA 4KZSA 4S04A 2WY7Q 4Q48A 5E1XA 2UWMA 1P4WA 1IRXA 1Z91A 4M3FA 4XN3A 4E6KG 3LSPA 3PO2J 2HR3A 4HW0A 2EMLA 3V4GA 3KP6A 3V7SA 4LK1F 4OAZA 2CRGA 1SVOA 3ULQB 3RPUA 1U8RA 1HKQA 1YI2I 2K3PA 1ZR4A 1VQMI 4A6DA 1NG7A 5AIQA 5FRMA 4F3QA 4P5OA 3ZP5A 3Q9SA 2E2HJ 5J1UA 2JUCA 3HRMA 3RIRA 2VE7C 1WJ5A 1W7PD 4DIQA 1G2HA 3MZYA 1NTCA 5A6BA 1T4LB 3HG9A 5BOXA 1N3GA 1X1PA 4UUTA 2B9SA 4YEJA 1B8IB 4V19K 4AWXB 2E71A 2DTZA 2J7JA 2COMA 2EMIA 3A01A 2K4BA 1RRJA 2R7UA 3FWEA 1TT0A 2EQ3A 1TBXA 3OTOE 3OV8A 3LSIA 2GPIA 4LF5E 1GV5A 1QO0D 4HDVA 4A12A 1U3EM 1PP7U 5HNHA 1MBGA 3FXMA 3OWTA 4BACA 2OCEA 3H9JA 4G12A 3WTYC 2ADRA 1XSVA 5K5OA 1JK1A 2R92J 1LEAA 2K7LA 3RPQA 4B09A 1USSA 1YX3A 4HYEA 1HOMA 5L3EA 3JU0A 4H4KC 2EH3A 5CVRA 1A1GA 1S8NA 3CCYA 4DV0E 1TL8A 4RBOA 3JW4A 3LA3A 3IWCA 4EM1A 1ZLJA 3E5XA 3ONQA 1TWGJ 1IN7A 1MGTA 4ZYAA 1ZREA 2LY9A 5IXMB 3DF8A 2DOEA 3I55I 3BR3A 2ZFUA 4L5NC 4LTYA 3THOB 1TLHB 1RPWA 3ESWB 4M74A 2DXIA 4HF1A 1N34E 4OX9E 1LDJA 5IP7J 2RSMA 5FO5A 4IJDA 1ZAAC 4NXME 1ZH5A 3SZGA 1YUIA 2Y9YA 2MH9A 1A36A 5K5QA 5LBQA 3NAUA 4WXCA 3HXLA 1IGNA 2CV0A 4DR2E 5DUKA 1X6EA 1RUNA 2YTNA 1QHGA 3GTKJ 2QCOA 1O3RA 2JA2A 2JR1A 4DR6E 2FD5A 2NS0A 2L92A 1B4AA 2Y69H 2CUZA 1HQCA 3FF5A 3BQZA 3LQRA 2P4WA 2M5WA 4ZZLA 3H92A 1DU0A 2DTRA 1X58A 1TTYA 3S3OA 1I39A 1A1KA 3S3NA 2YRHA 2EOHA 4LF6E 5DCMB 2UU9E 5D6EA 1K6OA 1UFMA 1JGSA 3TDUC 3A0HC 5JFRA 2DT5A 1YW7A 3OIPA 1XS9A 2QSGX 4AQYE 4MNUA 3WHBA 2DMQA 2MDGA 1D8KA 2W4SA 5LRRA 2HZTA 2LP0A 4B8XA 1XDUA 2HYGD 2J5OA 3JRBA 2LKXA 3J80C 3F0CA 4IQ4A 1IG7A 2C6YA 5EG0B 3F23A 4M30A 2D1HA 3IH4A 2EFOA 2G0EA 1MDMB 5J4YA 1I1SA 3CUQB 5CQEA 1TZLA 4HNVA 1D3YA 2K9MA 2LMDA 4G8XA 3JRAA 1FYKA 3D5RC 2UUAE 1EH6A 2M3AA 3QYBA 1B9MA 1JXSA 4Z6YA 3RI4A 1A35A 1DPUA 2R5YB 3P7NA 3FZVA 5J6XA 1WJDA 4W97A 2NXNB 4R1HA 1AA7A 1GV2A 4EJWA 2DMTA 2EM5A 2AS5F 1ERDA 1B1BA 2VT2A 5J47A 1SC7A 2CV1A 2DGCA 1R1TA 4C2TA 4XONA 1EKEA 3S8PA 4ZYGA 1VQPI 4PSWA 3VODA 3S15J 3FHZA 4JX6A 2ZJ2A 3HPSA 1YG2A 3JTZA 3V8JA 2YR2A 1ZGJA 5FLXC 2CW0F 3L2WA 2H1KA 3MQ0A 1OCTC 4BXFA 4A5NA 3I0TA 3SXYA 1RETA 2K9SA 4A0ZA 1TW2A 1WI3A 3C2GA 5IT9K 1X3CA 2WAFA 2GA2A 2GZWA 2YTIA 3R61A 3ML6A 2WZOA 2LTPA 3H36A 2NRAC 3GMEA 5B66C 3RKYA 5LD2C 3AG3H 5AE3A 2DDBA 1CF7B 3EYIA 3I58A 2ME0A 4P1WA 3WODF 1QZEA 2ZFWA 2XF6A 3ECHA 4BBRJ 2L2MA 4M0VA 4P78A 2NVXJ 1ONVA 1ON1A 3S16J 1IO2A 1J0RA 5FB2A 2HHHE 4IJAA 4M9ZA 2WADA 2DLQA 4C3IJ 5H2FC 3L09A 4C2MJ 3SDGA 4U0YA 1LPQA 3H5RA 3BR5A 1VTNC 1POGA 1T56A 2F5CA 4BDZA 1STUA 2OUMA 2ID6A 2XF7A 2QSHX 2M4IA 4R2AA 3V7RA 3FBIB 3JAMC 3WTUC 2TDXA 4A3DJ 1XN7A 1YW9A 1SAXA 2EOOA 3MD2A 4IOCF 2EPLX 4KNYA 3OYNA 2EMBA 2E2IJ 3KP3A 4RAYA 4A3GJ 2QLZA 2DT7B 3HRUA 3S2HJ 4D7MA 2RV8A 1OYYA 4JI0E 4O6JA 3EUHA 4DR3E 2WB1N 2LKPA 4IRGA 4CICA 1NCSA 2FQ3A 2MKDA 2XAFA 3BG3A 1H9GA 5JVTA 3FDYA 2IS4A 1LDDA 2O5RA 2G9WA 2VE8A 3W6JB 1XX5A 2LY1A 1W36C 2GHFA 1X2MA 4A5MA 3FXQA 3CO6C 2EJRA 4XK4A 3UNGC 3CUQC 3V7CA 1QHHD 3OYAA 2BHZA 1LVKA 3IAS2 3GYHX 2HQAA 2H09A 3DU6A 2A25A 2V89A 5FKOA 4X66E 1R49A 2EL4A 1A1HA 1WCMJ 1ZKGA 2FBIA 4UY8I 2MLKA 3VOEA 2NS8A 3ADJA 3F9KA 3EETA 1Y56A 2XPWA 3PJRA 1BR1A 2ELZA 3AG4H 1ACIA 3OMLA 2K86A 1K6YA 4B3RE 5H6QA 2BBGA 2JXPA 2VQFE 2VL8A 4B47A 1XD7A 2LT7A 4RH8A 1D5YA 3M4OJ 5CVVA 3I3LA 4L8NA 2F4OB 4HX7A 5FROA 5BMZA 2V1UA 3DTEA 1XGMA 2X51A 2F2EA 3GW2A 1U0JA 3KZIC 1HNWE 3GWZA 4YRVA 1J9IA 3BIDA 2PQ8A 3Q0UA 4I0AA 1A5JA 2BVMA 3S1QJ 5E3NA 2DJNA 2FOKA 1LEBA 3ZCOA 3BCAA 4BGDA 1JGGA 4M3DA 2JPCA 1FZPB 4XR6A 1NEIA 4A0XA 2ECBA 2WAEA 4K2EA 2UUBE 3IHUA 4TUGA 2K4JA 2ESHA 4CUGA 2KPMA 4X1EA 3B73A 2M7QA 3UR3C 3GTOJ 5BQTA 3S17J 2W00A 4II2A 1UBDC 1L4SA 1D1BA 1DUXC 3W6VA 4HX8A 1QGPA 2H94A 1RQ0A 3NQOA 2XAQA 4N9IA 1FC3A 1ZQ3P 2BOLA 2KDZA 5DEQA 4IHXA 1MMSA 2VXDA 2VASA 2XAGA 4LFUA 3I4MJ 4OIRF 2X6OA 2ZXHA 3F21A 2MC5A 2Q2EA 3LAJA 5FKMA 4PSXA 3F6GA 2XIGA 2L9VA 2GBYA 5DM7F 3IWBA 1WJBA 3K4JA 5EEGA 2R4GA 4A3LJ 1KA8A 3PIPF 3LFUA 2M7AA 2L6MA 2KQRA 1YW8A 2EM9A 1OCPA 2EQ0A 2L9SA 3U1KA 1HDDC 4MLVA 1MD0A 1LLMC 3HHHA 2FBHA 2EL5A 4R03A 1ZRCA 3R0JA 2XAHA 2F4MB 2A6HF 4I8OA 5D4RA 2VPLA 2X1EA 3ZPLA 1N78A 1R7JA 3ADLA 2K7IA 2E2JJ 3RTRA 3HEFA 2HPIA 1EJ9A 3TQMA 1Z1BA 3BJAA 1FBSA 3TP0A 3U9GA 1Y8RB 2DYSH 4JYKA 1IXSB 1BJZA 1X1BA 2M0MA 2K5CA 1H0MA 1DGCA 2W25A 2VOOA 5D6FA 2M34A 2A07F 5JI6A 2Y75A 4AD9A 3FKIJ 3C2BA 4HQEA 4WSPA 2FOWA 5KCMA 3E0JB 5HVQC 4GEQB 4TUIA 3LA2A 3LSTA 2XGDA 2LD5A 1VF9A 3QOPA 3H09A 1YJNI 1RR7A 1I5ZA 2GLOA 3N97A 2YTPA 3GF2A 4FCYA 1UHSA 2EM7A 3C18A 3F8BA 3VFZA 3ERMA 2VODA 3IH2A 4LU9A 2VB6A 1SANA 4XKWA 4KN7X 4Y4RA 4M3EA 1WJCA 2L9RA 2RNGA 1FYLA 4G7HF 3EQ1A 2P81A 3HBLA 3C2HA 3SZPA 4F91B 3N4MA 1O3TA 3OS0A 3FK6A 2N8GA 3Q0WA 1J7KA 2O8KA 9ANTA 5EGOA 1FP2A 1IN8A 4M9VC 4OOIA 4WK8F 2XHKA 5CYVA 1FSHA 2EOZA 4KMFA 5TGTA 1MH3A 4C9YA 2XAJA 3CF5F 4BJ6C 3KFWX 2E36A 3FMSA 1X48A 5ERIA 3CCRI 3SHFA 2P6TA 4DYRA 1VQ8I 1B9NA 4U7BA 2QBYB 4DUYE 4N0BA 3OL3A 1H8AC 2MA3A 4LLLA 4CCOA 3QRFF 5C44J 1ETVA 2BY1A 3H0GJ 2UZKA 3C7JA 4HV5A 3J81C 3WU2C 3RZDJ 4OINF 3GEZA 2EA4A 5C4XJ 1S9HA 1MBKA 3PSIA 2EOIA 2E5LE 3K4MA 2BHYA 2DODA 2JA5J 2M1SA 1NK2P 2Y48A 3FM3A 2GXBA 1BI1A 3Q5FA 3HOYJ 2DN0A 2KRCA 1FTTA 3ADIA 4B3XA 3OSGA 3P9IA 2B3TB 5M5XJ 3J7AO 3JSOA 2H1LA 3QQAA 1KZHA 4O5VA 2IT0A 2B0LA 2PBIA 2FMYA 1NG6A 1XTAA 2RAEA 1E3OC 1UAAA 1HLVA 4HF0A 4XLNF 4DBRA 1IC8A 1JJ6C 2R7WA 4YY3E 4E7LA 3LAPA 4BCAA 4KICA 3JTHA 1LE8B 2VT3A 4HSRA 2DRPA 2QF7A 3LSRA 1UJ8A
chains in the Genus database with same CATH topology
2BBYA 1XSXA 3RKWA 5LHIA 4HF2A 1O3SA 2XUBA 2G7HA 1P4AA 4AIHA 1G4DA 1QZZA 5E1WA 3E3VA 4Y17A 3AAFA 2CQKA 2L02A 1GHCA 1ZHFA 5IT3A 4GGGA 4PDKA 2J5PA 3QAHA 5DCFA 2OA4A 4UXNA 1PDNC 3KE2A 1TNTA 2ZNZA 1MKMA 4AVPA 5KK1A 2P7VB 2EWNA 1TQIA 3F8NA 3MEXA 5ICCA 1PUEE 1XB4A 3GXOA 2G7UA 2OQRA 1TQPA 3EQLF 4EMSA 1R22A 2WV0A 4R79A 1FT9A 2FXAA 3J81K 3ZMVA 5HS9A 5F1RA 1J2XA 2LF8A 4IVNA 2E1NA 2GQQA 2RDPA 1REPC 3S2WA 3I59B 5DV5A 3PQJA 2FSWA 4JK1X 4WXHA 2L3DA 3HHGA 4D0PA 2X4HA 4I98B 3IKVA 2PJPA 4BYYA 2XASA 5L3CA 4ZYDA 5TRDA 1LDKB 1X3UA 4KDPA 2Q8KA 1G3YA 2MBFA 1YYVA 4Z2YA 2P5KA 1U5TB 3KLNA 3ELKA 4YIIA 4G7OF 2D1VA 2VBZA 1QNTA 2V79A 3KEOA 2IA0A 2QQAA 4RGRA 4I0BA 1MJAA 4YFNF 4BAYA 3BPXA 1BI3A 1F4KA 3KP4A 3ZMSA 3ECOA 4R8HA 5DUIA 3Q9VA 3JAMK 4I01A 5KVRA 3HOSA 3KZYA 2VBYA 1R00A 1F1ZA 4S05A 3WTSC 3JTGA 1ZARA 1ZG5A 2H27A 3GFMA 4ENKA 2JPBA 4XRFA 2RC4A 2F5FA 2VONA 1A04A 1IN4A 1ULYA 4OIPF 3H3UA 4QLCU 4P9UA 1BBYA 4WX9A 3E6CC 3KP7A 2QQBA 3KP5A 4A6EA 4LJZF 2QQ9A 3V8KA 2BYVE 1PP8F 1KU9A 4DNCA 1T98A 3GFJA 6PAXA 4L5JA 1IRGA 2GA1A 1XSDA 1B59A 3O6BB 4N9HA 2JT1A 2XKOA 5CVJA 2CGPA 4XSXF 3TOAA 2HTJA 4EM2A 2DO7A 1LJ9A 2DBBA 3P9KA 3GX4X 3FXUA 4LLGF 1I1GA 1RNLA 2BEOA 2PMUA 1SD4A 2IP2A 3L00A 5ICFA 2IVMA 1WRJA 4HQMA 5ILUA 2DW4A 4KUMA 3WU1B 2VE9A 4MEYF 4XSZF 3LQQA 1ZAOA 2AXLA 2ZO4A 3DKWA 1OPCA 1FYMA 4RGUA 1DDNA 3BWGA 5D8KB 3GZ5A 1P4XA 4KIFA 3CUQA 3RYRA 2FU4A 2VBXA 5CVIA 1I6XA 4MGRA 2YPRA 4IHSA 5CJ9A 4RB2C 4UV8A 1ON2A 1BC8C 4ASNA 2FMLA 1BI2A 3SQNA 4P96A 4IF4A 5LEKA 4HOBA 1Z7UA 5H20A 1OR7A 5ILSA 1XGSA 2IA1A 4LMYA 1UHWA 5FLXZ 3I53A 1DP7P 1E2XA 3NEUA 4RB0A 4KMUX 2RQPA 3ABUA 5D5VB 1YQAA 4P55A 1ZYRF 1OKRA 1FBUA 3ZMTA 4RGSA 4L9TA 4KIGA 1H9TA 4A2UA 1Z05A 2DFIA 1SFEA 3DQVC 5LGUA 5LHHA 3COAC 1IAWA 2P5VA 4CGZA 2BV6A 4MHGA 1RZ4A 1K7AA 4WCGA 2EFPA 1ODDA 1SD7A 5DCMA 4LB5A 2DI3A 3E5QA 5LGNA 3K69A 3REOA 3WG9A 1L0OC 1G6NA 1R5HA 4OMZA 3WTXC 3PFIA 4ZYHA 4EJOA 5ILVA 3P9CA 4BH9A 2Z33A 4NHJA 3I54A 3WTVC 1HKSA 3WGIA 2VC1A 3DXJF 2Z5UA 4G6QA 5FFZA 2A5YB 5BS6A 4HBLA 2HS5A 4MQVA 3WU0A 2P7CB 3WE2A 4ON0A 4PGGA 4YG2F 5A2QZ 5F6FA 2D2WA 4U7DA 4EGYA 2NNNA 2ZCWA 1AWCA 2QVOA 1CF7A 4PGHA 4HZFA 1FY7A 2JSCA 4AIKA 3I5UA 1GXQA 4MQ9F 1Q1HA 1JHFA 2XGXA 5A2QK 1RUOA 4ZH4F 3BP8A 1QQIA 1YS6A 1O7LA 3RDIA 2KIFA 2XRNA 2HDCA 3QP6A 2QM3A 3ROUA 1P6RA 3GZ6A 4L9VA 4GO1A 4Q4ZF 4HLYA 1Z1DA 1OMIA 3QU3A 4MTDA 3TQNA 3R0AA 4M9SA 3RYPA 1G3WA 1S29A 3MFKA 2GAUA 2VN2A 1XMAA 2KKOA 4YIFA 3PQKA 1LNWA 2EV0A 1BM9A 4L0ZB 5JR3A 4BXUA 4M9XA 2Z3YA 4Y15A 3LFKA 2FF4A 4KFCA 1E17A 2CO5A 2FNPA 4UV9A 3WGGA 2YSRA 2HFHA 5LEJA 3WTTC 3GO5A 3QPTA 3TDZC 2GXGA 1KGSA 2M30A 1SMTA 2CWEA 4BHBA 1SD5A 1HW2A 4EQQA 4CO8A 2X0LA 4KT5C 3ZQ7A 1KU2A 2V1XA 4A0YA 1IZ1A 4EV0A 4L0YB 2BGCA 3JAMZ 1U6GA 2XVCA 2LF7A 3OOPA 1BI0A 2A69F 1U5TC 4LG0B 3KCCA 4EGZA 1IW7F 1RI7A 3D0SA 4ENJA 3FMRA 5BPDA 1Z6TA 3R6SA 4E70A 3ZMUA 1XMKA 1OYWA 2DQLA 3HOTA 2E7XA 5HLGA 1WWXA 4Q5SF 4M71A 2ISZA 4HA8A 2YX4A 4XBFA 1HSTA 1K78A 2W84A 5DD4A 3KETA 1FOKA 1WI9A 1GVJA 1QPMA 1KU3A 5L3BA 2RN7A 2P6SA 4IXAA 4BHCA 3HSRA 1EV7A 4OIQF 2IPQX 3BDDA 4RAZA 1S3JA 3FM5A 3R60A 2DK8A 5K1YA 4H0EA 2O3FA 3I59A 4HLXA 5E8IA 1DPRA 3K1MA 1UHMA 2CG4A 3J81Z 4BNCA 2KIMA 2EV5A 2O0YA 4KA4A 4U88A 1W5SA 1MZBA 4CHUA 4U0VA 4BHPA 3H3ZA 4GYIA 3BY6A 3U2RA 2ISYA 3K1NA 3HRTA 5AIPA 2FA5A 4OU0A 4M6XA 3HUGA 1U78A 4UHTA 3DFGA 1KU7A 3HIFA 4CDGA 1BIBA 5BPIA 2HKXA 2OBPA 2FE3A 2WTEA 4YFKF 5ICEA 2EFWA 2GWRA 4CXFA 2OQGA 4IHTA 2MH2A 1YTYA 2ELHA 1G3TA 3K1PA 3CDHA 3QU6A 4HX4A 1JHHA 3JSPA 3F72A 2O6GE 1BOAA 5CLSA 4NQWA 2L54A 4L9JA 4LK0F 3U1DA 5E8GA 5K5RA 1BIAA 4UVCA 1FBQA 2EV6A 1HSJA 4QWQA 2Z9OA 2L4AA 2RNJA 2KRFA 2HOEA 1KQ8A 5HDNA 3BJOA 3VEPA 4P9FA 2PG4A 3TO6A 3KP2A 1FP1D 2UXNA 3QPHA 4ESFA 4BQAA 1BJAA 1T38A 4CYDA 2HGCA 4ESJA 2CFXA 4IRHA 4M72A 2O8XA 3GLXA 3E5UA 2EK5A 2NAZA 1IRFA 3EYYA 1HW5A 3QP5A 2GIVA 2HQRA 3E97A 5D5XB 1O57A 2K02A 1V4RA 3J80K 4OMYA 1XCVA 4YFXF 2ZMEB 1IN6A 4XLPF 1ZG1A 1USTA 4RB1A 3HSFA 2OAZA 5ED4A 1XDSA 2QUFA 4PCQA 2M1BA 3HSEA 3WTZA 3F3XA 1JE8A 3ZN1A 5D8LB 5DYMA 3DEUA 2STTA 2FRHA 2DPDA 5ICGA 1O3QA 2XROA 1U5TA 1QBJA 3IWFA 2A68F 2R7DA 1STZA 3HTSB 1CGPA 3FX3A 1IXCA 4M73A 1J5YA 4MEXF 4Q47A 1AOYA 2IA2A 1B6AA 3DPLC 2K27A 3J80Z 3TGNA 2ADUA 2F5DA 3HRSA 1BN5A 4EJVA 2BE5F 3FMQA 5DDGA 5J8FA 2PFBA 2DLLA 1D5VA 3T1BA 4RGXA 3F8FA 2P8TA 2PEXA 2LSOA 5D4SA 4HV6A 4AIJA 1MJ9A 1L3LA 2VBWA 2ZKZA 1P92A 3ABTA 3K9TA 1T39A 3WE3A 4G9YA 2O61A 2HYFA 4UNOA 4L9NA 3GUDA 2VC0A 2EB7A 2DQRA 3E6DA 1TNSA 2L01A 2R7FA 5L3DA 2HQNA 4L5IA 2A61A 4HDUA 2HWVA 3F6OA 3V8LA 1WQ2A 2OU2A 4RS8A 4RB3C 5D5WB 1F9NA 1ZLKA 4OIOF 3BROA 3G3ZA 3M8FA 3ISPA 4WXDA 4KIBA 2JRTA 2XKPA 3SZTA 4FX0A 2OZ6A 2RKHA 3DP7A 1FX7A 2P5LC 1P2FA 1MDMA 5J8CA 2R3SA 1KYWA 1IUYA 3I71A 5LGTA 3M8EA 3LA7A 3M7GA 4FX4A 3G73A 1KYZA 3F8MA 5E18F 1U2WA 2XV4S 2LNBA 5D5UB 3IRRA 5AONA 4UUVA 2ACJA 1FSEA 2ZNYA 2JTVA 5HS7A 1KQ9A 2EA2A 3CUOA 3VB2A 1GXPA 2V6CA 5HOOA 2KIUA 1I27A 3GFIA 1FLIA 4U0WA 1ZG3A 3BJ6A 1T6SA 1W5TA 2YX7A 3NRVA 1LQ1A 1Z9CA 3EDPA 1R23A 3TOBA 4LD5A 1BC7C 4KN4X 2DAOA 1K78B 4IRIA 5HLHA 1C0WA 4IPAA 1SMYF 2ETHA 2Y0MA 4ZYEA 3BOQA 5FFXA 2IW5A 1IXRC 1YS7A 1SFXA 2L4MA 5CVUA 2PLYA 1YO5C 3FXRA 1TW3A 1FWZA 2DU9A 2ESNA 3HTUA 3RKXA 2VXZA 2EFQA 4GYGA 5E17F 3B02A 3CO7C 2IJLA 3M1EA 3KZZA 1XCBA 3IWZA 5FD6A 1Y0UA 2MLGA 5JHUA 1R36A 4I2OA 2RGVA 4FHTA 5H6RA 1SD6A 2NNYA 1R1UA 5LLQA 1K79A 3HYIA 5HDGA 5LRSA 4JBAA 2W57A 4EJUA 3M9AA 2QENA 3BZ6A 4M6YA 5E1ZB 2YU3A 4LLNA 3IRQA 4EVIA 2HKOA 2VOPA 3KLOA 3F6VA 4GCVA 2ZXJA 1G3SA 3T5XA 3D5LA 2ZMEA 1YIOA 4ETSA 3LWFA 4F7ZA 4LG0A 2D45A 2Z99A 2H6CA 3L7WA 3E6BA 2MC3A 5DD8A 3TO9A 2F5EA 2UXXA 4WF2A 3C3WA 2O03A 4Y13A 3R4KA 1D8JA 3T0YA 4ESBA 3DPTA 1Z6RA 4UVBA 4EJTA 3KEQA 3ZMZA 2FEZA 3DV8A 2FBKA 2H6BA 1HXDA 3K2ZA 2M87A 4JQFA 1IN5A 3WTWC 1R5GA 1FPQA 2QWWA 3ZN0A 3T8RA 1J59A 2FNAA 1ZN2A 3ZMDA 1QZYA 4I09A 3CLOA 3IKTA 3O3KA 2IRFG 4UVAA 4CZZA 4O3MA 5IT9Z 2QYOA 2NYXA 2PI0A 3F8CA 2W24A 4G94A 1J75A 5L3GA 2E1CA 3IC7A 3K0LA 4ENMA 1WKMA 3W6KB 2WC2A 1T0FA 3MWMA 2OD5A 2A3SA 3CJNA 1YFHA 1FNNA 1TQMA 3GVAA 1YLFA 2CSOA 3RJPA 3I4PA 4L18B 3I64A 1UB9A 1W4MA 2DK5A 2ZBKA 2HEOA 1W7PA 2QBYA 4KYWA 1S7AA 2LDUA 2Q0OA 5LHGA 5HS8A 4I02A 1RIOH 4ZZDA 2MD5A 3CTAA 3MZHA 1MJBA 4EM0B 2A6EF 3L9FA 3GFLA 2M8EA 1OYIA 1W7PB 1IF1A 5E20A 1XGNA 2PN6A 5HLIA 3IL2A 2W85A 5FGMA 4MTEA 1HW1A 4PZJA 1WSUA 2WWYA 4LGWA 5TJJA 2PMHA 2HTSA 3SFZA 1SFUA 1S7OA 1ZRDA 5FD5A 1LB2A 2V1DA 1R1VA 1R58A 4I7HA 1V3FA 5F64A 3T8TA 3L2CA 3TKYA 3WGHA 1KQ0A 3TO7A 1LVAA 4NB5A 4DQ2A 4FT8A 1HBXG 1T2KA 1HKTA 1XGOA 4WWCA 2STWA 2KJBA 3ERED 4LB6B 1F5TA 5EEHA 1O7FA 3E6MA 5FLXK 3C1DA 1NHAA 2CYYA 3O2PE 4ENNA 3MAJA 1EH7A 2QZ8A 2V9VA 4GXOA 3BPVA 3F22A 5HDKA 4G6DA 2JZYA 3MCZA 1ZGAA 5L3FA 4HAMA 2EFNA 2KJCA 2M45A 1ZRFA 4G7ZF 4TV7A 2E7WA 2OZUA 1EH8A 2DPUA 1S6LA 2RVCA 1UCRA 4S04A 4Q48A 5E1XA 2UWMA 1P4WA 1Z91A 2HR3A 4HW0A 3V4GA 3KP6A 3V7SA 4LK1F 3ULQB 3RPUA 1U8RA 1HKQA 4A6DA 5AIQA 4P5OA 3ZP5A 3Q9SA 3RIRA 3HRMA 1W7PD 3MZYA 5BOXA 4AWXB 2COMA 2K4BA 3FWEA 1TBXA 3OV8A 1QO0D 4HDVA 4A12A 1U3EM 1PP7U 3WTYC 1XSVA 5K5OA 1LEAA 2K7LA 3RPQA 4B09A 1USSA 4HYEA 5L3EA 5CVRA 1S8NA 3JW4A 3LA3A 4EM1A 1ZLJA 3E5XA 1IN7A 1MGTA 1ZREA 3DF8A 1TLHB 4M74A 4HF1A 1LDJA 5FO5A 1ZH5A 2MH9A 5K5QA 5LBQA 4WXCA 5DUKA 1RUNA 1O3RA 2NS0A 1B4AA 1HQCA 3FF5A 3LQRA 2P4WA 2M5WA 4ZZLA 3H92A 2DTRA 1TTYA 5DCMB 5D6EA 1K6OA 1UFMA 1JGSA 3TDUC 5JFRA 2DT5A 1YW7A 4MNUA 1D8KA 5LRRA 2HZTA 4B8XA 1XDUA 2HYGD 2J5OA 2C6YA 3F23A 2D1HA 2EFOA 1MDMB 1I1SA 3CUQB 1D3YA 4G8XA 1FYKA 1EH6A 1B9MA 1JXSA 3RI4A 1DPUA 3P7NA 3FZVA 5J6XA 4R1HA 4EJWA 2AS5F 1B1BA 2VT2A 1R1TA 4ZYGA 3VODA 3FHZA 2ZJ2A 1YG2A 3V8JA 2YR2A 1ZGJA 2CW0F 3MQ0A 4A5NA 3I0TA 3SXYA 4A0ZA 5IT9K 1TW2A 2GA2A 2GZWA 3R61A 3ML6A 2NRAC 3RKYA 1CF7B 3EYIA 3I58A 3WODF 2ZFWA 3ECHA 1ONVA 1ON1A 1J0RA 5FB2A 4IJAA 4M9ZA 4U0YA 3L09A 1VTNC 2F5CA 3V7RA 3WTUC 2TDXA 1XN7A 1YW9A 1SAXA 4KNYA 3KP3A 4RAYA 2QLZA 3HRUA 2RV8A 1OYYA 4O6JA 3EUHA 2LKPA 4IRGA 4CICA 2FQ3A 2XAFA 1H9GA 5JVTA 1LDDA 2VE8A 2G9WA 3W6JB 4A5MA 3FXQA 3CO6C 2EJRA 3CUQC 3V7CA 3GYHX 2H09A 2FBIA 2MLKA 3VOEA 3EETA 2K86A 5H6QA 1XD7A 5CVVA 4HX7A 5BMZA 2V1UA 1XGMA 2F2EA 3GW2A 3GWZA 1J9IA 2PQ8A 4I0AA 1LEBA 2FOKA 2JPCA 1FZPB 4A0XA 4K2EA 3IHUA 2K4JA 2ESHA 3B73A 5BQTA 1DUXC 4HX8A 1QGPA 2H94A 3NQOA 4N9IA 2XAQA 1FC3A 5DEQA 2XAGA 4LFUA 4OIRF 3F21A 2Q2EA 3LAJA 2XIGA 5EEGA 1KA8A 1YW8A 1MD0A 3HHHA 2FBHA 1ZRCA 3R0JA 2XAHA 2A6HF 5D4RA 3ZPLA 1R7JA 3RTRA 3BJAA 1FBSA 3U9GA 1IXSB 1H0MA 2W25A 2VOOA 5D6FA 2A07F 5JI6A 2Y75A 4AD9A 4HQEA 5HVQC 3LA2A 3LSTA 3QOPA 1I5ZA 3N97A 3GF2A 3C18A 3F8BA 3VFZA 2VODA 4KN7X 1FYLA 4G7HF 3SZPA 3N4MA 1O3TA 1J7KA 1FP2A 1IN8A 4OOIA 4WK8F 2XHKA 5CYVA 1FSHA