1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
3FXUA 3FX3A 4YFKF 1ZH5A 2Z5UA 4ETSA 1E17A 1ZGJA 5JVTA 2DPUA 1BM9A 4OIPF 5J8CA 1O3TA 2ZJ2A 2ZNYA 3LFKA 5CVIA 4AD9A 5CJ9A 3AAFA 3I58A 5J8FA 1JHFA 3EUHA 2A5YB 1G3YA 2YR2A 2FXAA 2XKOA 4B8XA 2O0YA 1U5TB 1IF1A 1ODDA 4GCVA 4CO8A 3LQRA 4TV7A 5CVUA 1IXCA 2F5DA 1QZYA 3BZ6A 5J6XA 4I7HA 2GA2A 3I59A 4PGGA 1P4WA 5LRRA 1IZ1A 2QBYB 1EH7A 1BOAA 1E2XA 3COAC 3ZMUA 3T5XA 4HBLA 4HF0A 3DXJF 5DUIA 3I59B 3LWFA 2UXNA 3BWGA 1MZBA 3KEOA 1BI0A 2ZMEB 1Z1DA 2YX4A 1U78A 2KKOA 4G94A 1R36A 3CTAA 1TW2A 2HGCA 1WI9A 4B09A 1IN7A 1YS6A 3M8FA 1MJBA 2M45A 4EM0B 5DDGA 2CGPA 3HRSA 3CO7C 3GWZA 3GZ5A 3GXOA 5DCFA 1FOKA 4UVCA 3WTYC 3QP6A 3JAMK 4M73A 3ABTA 2LDUA 4D0PA 1SAXA 2J5OA 4KDPA 4IF4A 5H20A 1V3FA 2NNNA 2PMUA 3M8EA 2CFXA 2HTJA 2FRHA 3Q9SA 1IN5A 4Y15A 1BI2A 2XVCA 3GFMA 1J59A 3P9KA 1IXRC 4EM2A 5EEGA 1P92A 5D5VB 5FFXA 5DV5A 2EA4A 2ZFWA 4KIBA 1OYIA 3QP5A 1KU2A 3V7SA 2EV5A 2DAOA 2HWVA 3N4MA 1XCVA 4UNOA 5LGTA 5F6FA 2Y48A 4U0YA 3JW4A 4RB2C 2QQ9A 1S7AA 1YW9A 4WXHA 4BYYA 3HOSA 4M9ZA 1XB4A 4U0VA 1G3WA 2XGXA 3KP7A 2VBZA 4RB0A 1BC8C 4UV8A 4L18B 4HA8A 4BH9A 3IHUA 4L0YB 4LLNA 2IA1A 3U1DA 2Q0OA 2DU9A 1QGPA 4I02A 2F5CA 1FT9A 3KP4A 3MZYA 4LK1F 2MH2A 3DPLC 2DK5A 1FZPB 2HOEA 2HR3A 2PI0A 2CG4A 1K7AA 6PAXA 2EV0A 2EK5A 5TRDA 2XV4S 5HS9A 4P96A 3TQNA 2O61A 2ELHA 3RKWA 4BAYA 1R5GA 5CVVA 4CYDA 4K2EA 4R8HA 3HRUA 3F8NA 2E7WA 1AOYA 1H9GA 2L4MA 1P6RA 2FMYA 1B1BA 4MEYF 1KU3A 2ESHA 4AIJA 3HSRA 2DT5A 2L54A 3N97A 4Q5SF 1OKRA 3F6OA 3JAMZ 2GXBA 1I1SA 1QZZA 2FMLA 4KIGA 3HHGA 2HEOA 1ON2A 1I1GA 3GFJA 2UZKA 2X4HA 2VE9A 2J5PA 5FFZA 2LF7A 5ICGA 5HS7A 3RKXA 4BNCA 2RDPA 4FHTA 4AVPA 3WGIA 3F72A 2V6CA 2IT0A 2RKHA 4I01A 5KVRA 2Z33A 1ULYA 4GYIA 4L0ZB 1YO5C 2JT1A 1USSA 1ZREA 1I5ZA 2P5VA 3RYRA 1J75A 5D8LB 4A5MA 4A0XA 2IP2A 1EV7A 4KYWA 1R1TA 4OIOF 2G7UA 2QVOA 2EJRA 4WWCA 3BJAA 3WE3A 4U7BA 2W84A 2RGVA 1XDSA 1LEBA 2FBHA 1BI3A 3C7JA 4MQ9F 3G73A 3EQLF 2VT2A 3MFKA 4H0EA 4LB5A 5K5OA 3QPTA 5FD6A 5D8KB 1JE8A 3R61A 1KA8A 1ZG3A 2XKPA 2Y75A 4RGSA 1BBYA 1B9NA 5A2QK 5EEHA 1ZG1A 4XLNF 1S8NA 5DD4A 1XGOA 3TO7A 2E7XA 4HYEA 4KFCA 4EJTA 2IW5A 1R7JA 3M1EA 5LLQA 4CZZA 1CF7B 4MGRA 2ISZA 4KT5C 3J80Z 2K27A 1KYWA 2KIUA 3FM5A 4WX9A 2V1XA 1TLHB 2XAFA 3OOPA 5CLSA 3IL2A 1XD7A 5DCMA 3FMRA 4ZH4F 1UB9A 2X0LA 2OZUA 3MZHA 2M8EA 4MNUA 1HKTA 3DEUA 3BPVA 3NQOA 1OPCA 4CDGA 2RN7A 1P4XA 4LFUA 1J2XA 1CGPA 2M1BA 1IAWA 2KIFA 1SFEA 1RIOH 1ZLJA 1R5HA 3K0LA 3GFIA 3H3ZA 1D3YA 2DFIA 1Z6RA 1A04A 3CUQA 4RS8A 3SXYA 1HW2A 2RNJA 4OU0A 4ZZLA 2FF4A 1H9TA 4YG2F 3P9CA 4A6DA 2IVMA 2AS5F 1KQ9A 1FBQA 5LHGA 2P7VB 2VBXA 3WODF 1ZHFA 1W5TA 3V4GA 1FPQA 3F8CA 1ZGAA 2XAGA 2VBYA 2PMHA 2KRFA 2CSOA 3QRFF 5F1RA 1LDJA 3KZYA 2KJBA 3VFZA 4CGZA 4M6YA 4HV6A 3WGGA 2E1CA 1W7PB 1K79A 1QBJA 2P4WA 4YFXF 3Q9VA 3TDUC 1REPC 1XMKA 3ZN0A 3O2PE 1DDNA 2VN2A 2BV6A 3WTVC 1H0MA 5F64A 4FT8A 1DUXC 1ZAOA 2GIVA 3FXQA 2A3SA 2CO5A 2STWA 3I54A 3TKYA 1GVJA 2H27A 3GW2A 4HLYA 3T1BA 4ENMA 4QWQA 2W24A 1R1VA 1LEAA 2A6EF 2JSCA 5FB2A 3F22A 2PLYA 5ED4A 2M5WA 1V4RA 1JXSA 1R00A 2JTVA 2QM3A 2JZYA 5KK1A 3K2ZA 1U6GA 2ZMEA 4EVIA 1O3SA 3GEZA 4M6XA 3MEXA 4AIKA 4LLGF 3LAPA 2QWWA 3DQVC 2P7CB 2HQNA 3BJ6A 3FF5A 3WE2A 1J5YA 3JTHA 2M87A 2BBYA 4WXCA 1YLFA 3CUOA 3T8TA 2D1HA 2ZO4A 4KIFA 4LJZF 5TJJA 3BOQA 3DF8A 2EFWA 1BIAA 2HFHA 4EGZA 4EGYA 1XSVA 4RGXA 4RB1A 1U5TA 1T38A 1Q1HA 2VOPA 3HTSB 2WC2A 3KFWX 2BGCA 3E6DA 3P9IA 5ICEA 1XGNA 1KU7A 4G7HF 2NYXA 4AWXB 4M9XA 3GVAA 4ZYEA 4R79A 2V9VA 4RGRA 4UUVA 1IRFA 3RTRA 1ZN2A 2YSRA 4MHGA 2DW4A 3RI4A 3EETA 4HDVA 1FNNA 3IRQA 2FSWA 5ERIA 3TGNA 1HBXG 2VE8A 3FM3A 1DPUA 1L0OC 3KP3A 3TOAA 2LSOA 1ZRDA 4MTDA 4HX4A 5LGNA 2NNYA 1T39A 1F9NA 5HLHA 5D5XB 3H92A 3MCZA 2FNPA 1FX7A 3R60A 5LGUA 4EM1A 5BOXA 3I4PA 4CHUA 3DPTA 2O03A 3ZMSA 3CO6C 2VODA 3K69A 4P9UA 2F5FA 1FWZA 5BS6A 2XAJA 2XIGA 5IT3A 4G6DA 4OOIA 3RYPA 3RPUA 5IT9Z 3DV8A 1RZ4A 2GZWA 1BN5A 4NHJA 5JHUA 3ZMDA 3SZTA 1SMTA 3NEUA 3SQNA 1TNTA 5FD5A 4WF2A 4IRHA 1W7PA 3WU0A 4R1HA 4N0BA 1FBUA 2XROA 4L5IA 1BJAA 1ON1A 1PP8F 4FX0A 3GX4X 2OD5A 3E5UA 3ECOA 3WTWC 1IXSB 3C3WA 2QQBA 1XSDA 1YW7A 2Q8KA 4P5OA 2W85A 2PG4A 3O6BB 1Y0UA 4QLCU 3IC7A 2ZXJA 5E8IA 3WG9A 3QPHA 5IT9K 2WV0A 3Q5FA 1B9MA 3E5XA 3HRMA 4O3MA 2BEOA 4OMYA 5H6QA 3E5QA 1YFHA 3IKVA 1U5TC 2A68F 1FLIA 4GO1A 1FYMA 2UWMA 3I71A 5JR3A 1U8RA 2OQGA 5JFRA 3IWZA 3E6MA 1D5VA 5L3FA 3ZMVA 3F23A 4EJOA 4RB3C 4BHBA 2DO7A 4EJUA 3E6CC 1O3QA 4A2UA 1O3RA 3JSPA 3D5LA 1XSXA 2A6HF 2NAZA 2PBIA 4KN4X 1PUEE 1O7FA 2OAZA 2CQKA 3R4KA 3KP6A 4M74A 1PP7U 2D2WA 1QPMA 5ILSA 2F2EA 3SHFA 2RC4A 3VEPA 2EA2A 4Y17A 3SFZA 3ZMTA 5JI6A 1T6SA 5H6RA 2LNBA 2DTRA 5K5QA 5CYVA 1TQMA 2G9WA 2V1UA 3DFGA 2DLLA 4UVBA 3E97A 2KJCA 2DI3A 4HV5A 1XDUA 4ZZDA 3KLNA 3FMQA 3PQKA 2P6SA 3CUQC 1XCBA 4HQMA 3K1MA 4UVAA 2ACJA 3I53A 3GUDA 3WTXC 4P55A 4DNCA 3W6JB 2H6BA 3SZPA 3FWEA 4A6EA 4F7ZA 2UXXA 2K7LA 3FHZA 2RQPA 3T8RA 2K02A 2STTA 1O57A 1OYWA 3TOBA 4RAYA 1D8JA 5AIPA 1TBXA 4IXAA 4KMFA 4Y13A 3M9AA 1EH6A 5K5RA 2OU2A 4IRIA 2FNAA 4HF1A 3ISPA 1YG2A 4BHPA 3GZ6A 3JSOA 2Z9OA 5FGMA 4O5VA 4I2OA 1IRGA 1LNWA 1OR7A 5ICFA 1UCRA 3EYIA 2HYFA 3ML6A 1XMAA 4GYGA 1YIOA 4EQQA 3IKTA 5FLXK 3D0SA 4ON0A 4O6JA 5HDNA 4PDKA 2MBFA 5HS8A 2YPRA 2K4JA 4DQ2A 5ILVA 1MDMB 2EB7A 2GAUA 3B02A 5E1XA 2D45A 1ZLKA 5K1YA 1LDDA 1HSTA 1K78A 2AXLA 1RUOA 2E1NA 1GXQA 3HHHA 1HXDA 3BDDA 3NRVA 2ETHA 4JBAA 2CW0F 4ESFA 4YIFA 3K1PA 3VOEA 1YQAA 1STZA 2FQ3A 3S2WA 2NRAC 2JPCA 3RJPA 4ENNA 1G6NA 1EH8A 2IA2A 3ZPLA 2DK8A 4L9JA 1F1ZA 2FEZA 5DYMA 3KE2A 1RNLA 1XGSA 4HX8A 3CDHA 1W5SA 5E17F 3WTTC 4HQEA 1RI7A 4HZFA 4I98B 4PGHA 3R6SA 4CXFA 4KUMA 4NB5A 5ICCA 3KP5A 3ULQB 3V8KA 2IJLA 3KCCA 3IRRA 4G7OF 3F21A 1RUNA 2HDCA 2HS5A 2VONA 2CWEA 4S05A 3DP7A 4Z2YA 2B0LA 1T0FA 1W4MA 3F3XA 2Z3YA 3R0AA 4IHSA 5FO5A 1ZRCA 3E6BA 1R1UA 2XAHA 5E1WA 5LEJA 2O3FA 1K6OA 3HSFA 1S29A 4L9NA 3ELKA 3GO5A 2L4AA 1GXPA 1SD5A 1IN4A 4ZYHA 4YFNF 2QBYA 1Z9CA 3G3ZA 4OMZA 4HAMA 4IHTA 1HQCA 3TDZC 1QNTA 1YW8A 2W25A 4ZYDA 2MC3A 1SD7A 1WWXA 3ROUA 4IVNA 3K1NA 1LQ1A 3T0YA 1LB2A 4G8XA 2VBWA 1BIBA 3CJNA 3KP2A 1FYKA 5D4RA 2BE5F 1J7KA 2IPQX 4U88A 3J81Z 4E70A 2YX7A 4EV0A 1P4AA 5LRSA 2ZBKA 1J9IA 1XN7A 1LJ9A 1BC7C 1B59A 3PQJA 4G6QA 5CVJA 4LK0F 2A07F 1ZYRF 4WXDA 3O3KA 4RAZA 2BYVE 3BROA 2KIMA 4WK8F 1SMYF 3E3VA 3VODA 2FA5A 3DKWA 3LA2A 4IRGA 4G7ZF 2M30A 3LA7A 4AIHA 2VXZA 1FSHA 3V7RA 1TTYA 1W7PD 2P5KA 2TDXA 1WKMA 5ILUA 2L02A 5LBQA 1KQ8A 4KNYA 2P6TA 4XSXF 1F5TA 4LG0A 1TQIA 5E8GA 2HZTA 1IW7F 3ZN1A 2ZCWA 1WSUA 2XAQA 3MQ0A 1C0WA 1S7OA 5HLIA 4XSZF 2H6CA 2HQRA 3I0TA 3BY6A 1XGMA 2FE3A 3P7NA 4XBFA 2FOKA 2QYOA 1TW3A 1ZG5A 4XLPF 1HW5A 4UHTA 2MA3A 1R23A 3GFLA 4LGWA 3HUGA 2H94A 4YIIA 3ZP5A 4I0BA 3ABUA 2ESNA 3V8JA 5HVQC 3GYHX 1S3JA 5DEQA 2A61A 1KU9A 2JRTA 1GHCA 5BPIA 2P5LC 3L00A 3HIFA 2OA4A 4P9FA 1IN6A 2GQQA 5HDGA 1I27A 3HYIA 1X3UA 1KQ0A 5E18F 1F4KA 3L09A 2A69F 1FYLA 1YS7A 5HOOA 3LSTA 1JHHA 1FC3A 4M71A 4GXOA 5D5WB 2XUBA 2QQAA 2Z99A 3KETA 4UV9A 4RGUA 4Q4ZF 4HF2A 4JQFA 1DP7P 1QQIA 1D8KA 5AONA 3K9TA 2DBBA 3WTSC 5HDKA 4HW0A 1BI1A 3HSEA 5HLGA 2ISYA 4HOBA 1ZRFA 4U0WA 2CYYA 1OYYA 1DPRA 1FY7A 4PCQA 1Z7UA 2IRFG 5L3BA 5BPDA 1UHMA 1PDNC 4N9HA 2LKPA 3VB2A 3EYYA 4NQWA 5CVRA 2XRNA 4LLLA 2R3SA 3J81K 1B6AA 3GLXA 2GWRA 2XHKA 3CUQB 1ZARA 1SD4A 1R58A 5D6EA 4EJWA 2COMA 2V79A 4S04A 1TNSA 1FSEA 3L2CA 3OV8A 5DD8A 2PEXA 4L9TA 4BHCA 2GXGA 1T2KA 4KICA 2MD5A 4L5JA 2FBIA 2MLGA 3TO6A 4LD5A 1J0RA 4EMSA 3M7GA 2VT3A 2L3DA 3R0JA 4ENKA 2EFQA 5FLXZ 3WTUC 5LEKA 4ENJA 2DQLA 2EFOA 1T98A 1U2WA 4M72A 1LDKB 3QOPA 2QZ8A 2QLZA 4LG0B 1O7LA 3RPQA 5D6FA 3QU6A 2Y0MA 3GF2A 3V7CA 4KN7X 3F8MA 3HTUA 2RVCA 1SFXA 2O6GE 3L7WA 3F8BA 2ZNZA 3LQQA 2ADUA 3J80K 2QENA 4BQAA 2VOOA 3KLOA 2HTSA 4G9YA 2EWNA 1FP2A 4A12A 3ZMZA 2RV8A 5DCMB 5DUKA 2OQRA 5L3GA 2YU3A 1SFUA 1Z91A 3V8LA 3IWFA 3PFIA 1HKQA 4N9IA 3WU1B 2D1VA 4IJAA 4MQVA 4KA4A 1JGSA 1MJ9A 2W57A 2OBPA 2G7HA 1KYZA 1QO0D 3BP8A 1R22A 2FU4A 2XASA 2PJPA 4ESJA 3RIRA 4LB6B 4ESBA 3ZQ7A 3ERED 4A5NA 5D5UB 1L3LA 4A0ZA 4JK1X 3FMSA 2V1DA 3BPXA 2GA1A 3LAJA 4ZYGA 1G3TA 1P2FA 4MTEA 3RDIA 4WCGA 5L3CA 2K4BA 3HOTA 4L9VA 2P8TA 4PZJA 3U2RA 2C6YA 1MJAA 3B73A 3TO9A 1AWCA 4BXUA 1YTYA 4A0YA 1FP1D 1TQPA 1ONVA 2Q2EA 1Z6TA 2DPDA 1S6LA 5AIQA 3FZVA 4I09A 1VTNC 5BMZA 1G4DA 2WWYA 2QUFA 2F5EA 1UFMA 2PFBA 1CF7A 2HKXA 4GGGA 1IN8A 1K78B 3C1DA 2FBKA 2MLKA 4Q47A 2ZKZA 3HRTA 4U7DA 4ASNA 1YYVA 2JPBA 2HYGD 5LHHA 3I64A 3FXRA 3U9GA 3MWMA 3BJOA 1B4AA 2K86A 1WQ2A 1FBSA 1G3SA 3I5UA 2PN6A 1IUYA 2VC0A 5E1ZB 1OMIA 5A2QZ 2IA0A 2EFPA 4OINF 1MD0A 4EJVA 4CICA 3C18A 1UHWA 4OIQF 4FX4A 2H09A 1KGSA 3EDPA 1MDMA 3KEQA 2VC1A 5E20A 3LA3A 3MAJA 2L01A 3RKYA 2NS0A 1MGTA 4M9SA 1HW1A 1USTA 2R7DA 3F8FA 4MEXF 4OIRF 2PQ8A 5L3DA 5L3EA 1Z05A 4XRFA 2R7FA 1HKSA 1U3EM 4I0AA 3ECHA 3QU3A 3WTZA 1HSJA 1I6XA 3WGHA 2O8XA 3QAHA 4HDUA 3REOA 2HKOA 1WRJA 4LMYA 4Q48A 3KZZA 3JTGA 5BQTA 1LVAA 2MH9A 2OZ6A 4KMUX 2LF8A 3W6KB 5LHIA 3CLOA 4IPAA 1NHAA 3L9FA 1MKMA 1SD6A 2EFNA 3F6VA 3H3UA 5D4SA 2DQRA 4UXNA 4HX7A 2WTEA 2EV6A 3J7AO 4HLXA
chains in the Genus database with same CATH superfamily
4IO9F 3M99B 3FXUA 3FX3A 4YFKF 1ZH5A 2Z5UA 4XORA 1PJTA 5EEAA 3ABMH 3H5AA 1WGXA 4X62E 4ETSA 2DMNA 1E17A 4RBOA 1ZGJA 5JVTA 3OYGA 2IHR1 2I10A 1D0YA 5AASA 2DPUA 1BM9A 4KISA 1YRNA 3K6QA 4OIPF 5J8CA 1O3TA 2ZJ2A 2ZNYA 2R5YA 3LFKA 2RSIA 5CVIA 1MBGA 3JR9A 2Q8UA 1V5FA 4AD9A 5HNFA 3JRIA 2F8BA 5CJ9A 1X19A 3AAFA 1VNDA 1XMQE 1F36A 1VQ8I 3I58A 5J8FA 3ZQHA 2JVAA 1JHFA 4MIMA 3A0HC 4JI5E 3EUHA 3SEZA 3H36A 2VUMJ 1DGCA 2YTOA 3HEFA 2A5YB 2HQ5A 1G3YA 2YR2A 4JOMA 2FXAA 1FJGE 4CCLA 4YRVA 2XKOA 4B8XA 2O0YA 2LE2A 2B7VA 4DR1E 2X1DA 2EMWA 4UUSB 3F6GA 3HM5A 1U5TB 2OJED 1IF1A 1ODDA 4GCVA 2HOTA 2JK3A 3BGHA 4CO8A 3LQRA 5A6JA 2UXDE 4XKVA 3RKQA 3H3VK 4A3MJ 1EJ9A 4TV7A 4V2GA 3FBIB 5CVUA 4R2DA 3K70C 1IXCA 3S32A 1QU3A 2F5DA 1QZYA 4F9AB 2QSGX 3BZ6A 2OPTA 2EPCA 5J6XA 3BG5A 3UKGA 2X6XA 2KRHA 4ZJZA 4I7HA 3TL4X 2GA2A 3G1LA 3I59A 5K7HA 1FKAE 4PGGA 1P4WA 5LRRA 1IZ1A 2QBYB 1EH7A 1BOAA 1E2XA 3COAC 4J00A 1SR9A 1A1HA 3ZMUA 5A6BD 3D1NI 3T5XA 4HBLA 4HF0A 3DXJF 3G2BA 5DUIA 3I59B 3LWFA 2L9VA 1ZBQA 2UXNA 3BWGA 4D5CA 4NC7A 4P78A 1MZBA 5B66C 1VQKI 3KEOA 1BI0A 3SZGA 2FD5A 1TF6A 2QCOA 3Q0UA 3BTIA 1ZTRA 2ZMEB 1Z1DA 1YITI 2YX4A 1D5YA 1MBJA 1U78A 3EPHA 2KKOA 4G94A 4I76A 2VQHA 4IOCF 1R36A 3Q3SA 3CTAA 2EPUA 1TW2A 4YY3E 3BF2A 2HGCA 2LT7A 1WI9A 4B09A 1IN7A 1YS6A 3M8FA 4B3RE 3PO3J 1JUPA 1MJBA 4D9JA 2M45A 3PJRA 4X65E 4EM0B 2L3JA 1XPXA 2X6YA 1DGRM 5DDGA 3EPJA 5T6JA 4XKWA 2CGPA 2ID6A 4XOTA 1FMWA 3J7YJ 4X0GA 1WFXA 3RZDJ 4LIVA 3HRSA 3CO7C 2UXBE 2AHQA 4BJ6C 3I55I 3CCSI 3GWZA 5F04A 2OUMA 3GZ5A 3GXOA 2E2JJ 5DCFA 2EM7A 1FOKA 3KYDB 3CQZJ 1VI0A 4UVCA 3WTYC 1I94E 1HDDC 3DTKA 3QP6A 2JVGA 4E7ZA 4WYQB 3JAMK 4M73A 2CU7A 2EPAA 4BXFA 3ABTA 3EUAA 2MABA 2LDUA 1XX5A 4D0PA 1POGA 5KCMA 1SAXA 2J5OA 2DMIA 2H8WA 2JOXA 4KDPA 3T1YE 3C4TA 2J7JA 3FIWA 4IF4A 2X51A 5H20A 2IEKA 1V3FA 2NNNA 1NH3A 2PMUA 5EG0A 3M8EA 3BR3A 2CFXA 2HTJA 2FRHA 3Q9SA 1IN5A 4Y15A 3L1PA 3GTQJ 2EM6A 1BI2A 3FKJA 1NG7A 4DR7E 2XVCA 3GFMA 3OYHA 1TWCJ 4NUBA 1J59A 4GEQB 1N78A 3P9KA 4BJ5C 1GUUA 1IXRC 2EINH 1KONA 4QSHA 1A6QA 1S72I 4EM2A 9ANTA 5EEGA 1P92A 5D5VB 2EMKA 5K7FA 5HNHA 3BR2A 5FFXA 5DV5A 3AFHA 2EA4A 2RQLA 1ZR2A 1GDTA 2BHZA 2ZFWA 1YPNA 4LF9E 3L2QA 1D0ZA 4KIBA 2HVSA 3MHHC 1OYIA 2PMZA 3CCMI 2M34A 1KU2A 3QP5A 1V5EA 1XNRE 3V7SA 3WHBA 2VPLA 2F4IA 4BS9A 2EV5A 2KDOA 2L7ZA 2DAOA 2HWVA 4CYCA 2R7VA 3N4MA 1XCVA 3NWTA 4UNOA 5LGTA 1OCOH 5F6FA 2IAIA 2Y48A 4U0YA 4JI1E 2EQ1A 4RAFA 3JW4A 4RB2C 2LRDA 5F0FA 2FQ4A 3DEEA 1N25A 2M9HA 2E5LE 2KONA 4M3EA 1FTTA 1K4SA 2QQ9A 3PM1A 4F3QA 1S7AA 1IRXA 3HUGB 3LSKA 1YW9A 4IX7A 4WXHA 3RPUD 4BYYA 3HOSA 4M9ZA 1JK1A 2I13A 1XB4A 4U0VA 1G3WA 2XGXA 3KP7A 3KYLA 1UAAA 3HKZA 4HG2A 4OAZA 2VBZA 2LJUA 1DQ3A 2LG4A 4RB0A 1G2DC 1BC8C 4UV8A 4L18B 3X2QH 4HA8A 4XRSA 2HVQA 4BH9A 2R93J 3IHUA 5F1JA 4L0YB 4LLNA 3OYEA 2IA1A 2MC4A 2F4MB 3U1DA 2WADA 2Q0OA 1MH3A 3VDXA 2DU9A 3HG9A 3OYBA 3CJRB 2ME0A 4WFTA 1QGPA 2JRMA 4LG3A 4I02A 1Q1VA 2EZIA 1ETWA 2F5CA 1FT9A 1EA3A 2IS1A 2CS3A 3KP4A 3MZYA 2B9SA 4LF6E 3CF2A 4LK1F 2MH2A 3DPLC 2GLIA 2FUG2 1IC8A 2ZSHB 3FXJA 3L2UA 2DK5A 3CC4I 4CCJA 1FZPB 3J7ZI 2HOEA 2CUZA 2E34A 4DR2E 1IBME 5KAIC 1HCRA 2X1EA 2BBGA 1RR7A 3F6HA 4ITVA 4XOPA 2HR3A 3VYSB 2PI0A 2CG4A 1K7AA 6PAXA 2WCC3 2AQFA 2EV0A 4CCKA 2OF7A 2EK5A 3BQYA 4XQFA 5TRDA 2KP6A 3B6AA 3IH3A 3LSGA 4CA0A 2GPIA 5FKMA 2EM9A 2XV4S 3K4JA 5HS9A 4P96A 3TQNA 2XPVA 2O61A 2R1FA 2EJ4A 4R8OA 3SYTA 2ELHA 3RKWA 2EOEA 1X1DA 4BAYA 1R5GA 5CVVA 5LL6R 3S1NJ 4CYDA 1V54H 4HSTA 4K2EA 4R8HA 1RC9A 3VYXA 2A6TA 2IGNA 2NS8A 3ZQIA 3LSPA 3HRUA 3ZQCA 3DCFA 3QYFA 3F8NA 2E7WA 2WAEA 1AOYA 1H9GA 3HOVJ 4DKKA 2L4MA 1QZEA 1P6RA 2IGOA 3CJTB 2FMYA 2CUJA 1IDZA 1FOXA 1Y1WJ 1YSAC 1B1BA 4MEYF 1KU3A 4XLHA 2ESHA 4AIJA 3HSRA 4AYBA 1FTZA 2DT5A 2L54A 5IWAE 4A3LJ 3N97A 2LBFA 3BR0A 1QHHD 2MD0A 3CZ6A 1N77A 4Q5SF 2Y69H 1OKRA 4KWYA 1LFPA 2A05A 3F6OA 3FIGA 1X49A 2PRTA 2EMZA 3JAMZ 2GXBA 1I1SA 2QGUA 1QZZA 4XN3A 2FMLA 4KIGA 3HHGA 2HEOA 1ON2A 5C3EJ 2VLAA 1MSEC 2QA4I 4LF5E 1I1GA 3GFJA 2UZKA 2X4HA 2OV7A 2EZLA 2IS2A 2VE9A 1IO2A 4GRIA 1YX3A 2J5PA 1G8XA 5FFZA 2LF7A 5ICGA 5HS7A 3OYLA 3JRDA 1HNWE 4HRIA 3RKXA 3HPSA 2XDVA 3OIPA 1R4NB 4NDLA 5FKKA 2RQQA 5DS9A 4BNCA 3CP8A 2RDPA 4RLFA 4FHTA 4AVPA 3WGIA 1QA6A 4O24A 4R2QA 2E36A 3F72A 3LMLA 2V6CA 2UUBE 2IT0A 1UJ8A 2RKHA 4I01A 5KVRA 2Z33A 1ULYA 4GYIA 3LNQA 4L0ZB 1YO5C 2LJHA 2JT1A 1USSA 1ETOA 5IY5H 1ZREA 5M3FJ 3PIOF 1I5ZA 2P5VA 3RYRA 1J75A 3A03A 5KL6A 5D8LB 3BG6A 4PJLA 2V86A 2LK2A 1YYOA 3CD6I 2EOFA 5GAHJ 3RQ4A 1QRYA 4A5MA 1JI8A 3DTIA 1I50J 2W4SA 3KYCB 4A0XA 2IP2A 3BIDA 1EV7A 4KYWA 1R1TA 2G7UA 2QVOA 4OIOF 1NCSA 2EJRA 4WWCA 2EL6A 3FXOA 3JRGA 3BJAA 4XRMA 3WE3A 4U7BA 2XF5A 2W84A 2RGVA 2FX0A 1XDSA 2K5CA 1SVOA 1LEBA 4B4CA 1J5EE 2BOLA 2FBHA 1BI3A 5ADZA 1Z77A 3C7JA 4MQ9F 1O4XA 5CKTA 4XLCA 3TEDA 3BZCA 3G73A 1PVEA 3EQLF 3DKXA 2VT2A 3MFKA 4H0EA 1G2HA 3I4NJ 4MLOA 1VQOI 5M5WJ 3GCMA 4LB5A 5K5OA 3QPTA 5FD6A 5D8KB 1JE8A 3R61A 5LMUE 4JI2E 2K9SA 1KA8A 1ZG3A 2XKPA 2Y75A 1IQSA 4RGSA 3M8JA 3WHCA 2R4GA 3H9QA 3N05A 5GAEJ 1AAYA 1BBYA 2BXYA 2JUGA 1B9NA 5A2QK 5EEHA 1ZG1A 2TCTA 3PUBA 4XLNF 1S8NA 5DD4A 2K7IA 1XGOA 3TO7A 4PJ0C 1T4LB 2E7XA 2GOXB 4HNVA 4HYEA 2NUEA 2I5UA 4KFCA 3DTEA 5C44J 4EJTA 4DYRA 2IW5A 1R7JA 4G12A 2MDGA 3M1EA 5LLQA 1D1BA 4CZZA 5KL4A 1CF7B 4MGRA 4F55A 2ISZA 2EORA 1N34E 4KT5C 2WBSA 3J80Z 2K27A 1KYWA 2KIUA 3FM5A 3IWDA 1J09A 4WX9A 2EPRA 2V1XA 1A1LA 1TLHB 2XAFA 2LTSA 3THOB 1WJFA 3OOPA 5CLSA 3IL2A 2XGDA 1XD7A 4A69C 2M0MA 2HOSA 1ZK8A 5DCMA 3LFUA 3FMRA 4ZH4F 1UB9A 2X0LA 2DA1A 3VPRA 4CH7A 1MW7A 2OZUA 1X1BA 5IT9C 2LO3A 3MZHA 2RREA 2M8EA 3ASOH 4MNUA 2CW7A 1HKTA 3DEUA 1LLMC 2CV2A 2F5VA 3BPVA 3H5NA 3NQOA 3VSLA 1OPCA 2Q1ZB 5A6AA 4CDGA 2DLKA 2RN7A 2DRPA 2YZTA 1P4XA 1JUMA 1MBFA 4HPQA 4LFUA 1J2XA 3RQIA 1ZBTA 1CGPA 2EN1A 1T56A 2MGQA 5CPRB 2IGKA 2EMLA 1N36E 4K0KE 2M1BA 3BZKA 1IAWA 4IHYA 2KIFA 1SFEA 1A6IA 1RIOH 1ZLJA 3ZOQB 4M3GA 3BG9A 4JX5A 1R5HA 1KZHA 3K0LA 5F0CA 3GFIA 2HDWA 5GTHC 4LTYA 3H3ZA 1D3YA 1U8BA 2M7AA 2DFIA 1VQ6I 1U9NA 3OS0A 5DNYA 3AL0B 1Z6RA 1A04A 4WPYA 3CUQA 4RS8A 3SXYA 2V9KA 4DOZA 3AV0A 1MBKA 1HW2A 2RNJA 2X85A 3VYTB 5IOYA 4OU0A 1XNQE 1WHQA 3L2RA 2EOOA 4NXME 2CJJA 2HVRA 4ZZLA 4H4KC 4JI7E 4PSWA 2FF4A 2MKDA 1H9TA 4YG2F 3P9CA 4A6DA 5J40A 2YWQA 2IVMA 2BVLA 2AS5F 3MN2A 1KQ9A 1FBQA 5LHGA 4BE2A 2BW3A 2DODA 1RKWA 2R7WA 4B3SE 2P7VB 4NNJA 3WG7H 4A3JJ 3JAMC 4OWRB 2VBXA 3WODF 4A3EJ 1ZHFA 4PK4A 1W5TA 3V4GA 1FPQA 2DMYA 1R4MB 3F8CA 2HNHA 5KL2A 1K4TA 1TWGJ 4JYKA 2EMGA 1ZGAA 2NVTJ 2XC7A 4BUPA 2XAGA 1Y39A 1OQYA 2VBYA 2EN7A 2PMHA 2M1SA 4X64E 2HPMA 2LBFB 2EMBA 1X1AA 2KRFA 2CSOA 3QRFF 3CCJI 2YTPA 5DTDA 5F1RA 1LDJA 1YE9A 2KJBA 3KZYA 2M4IA 2LC2A 3VFZA 3OOUA 4CGZA 4NC8A 4Y3OA 4M6YA 1OCTC 2H36X 4HV6A 3WGGA 3BLYA 1T8IA 3L2WA 2E1CA 1W7PB 1WH5A 3CLQA 1K79A 1NK2P 4LITA 1QBJA 2EMAA 2DFEA 2P4WA 4YFXF 3K4BA 2O5RA 4OX9E 3Q9VA 3TDUC 4LF4E 1REPC 1MMNA 1XMKA 2ZXIA 3ZN0A 3ADLA 3O2PE 1FJLA 1DDNA 4NHRA 1VQLI 2JUCA 2L6MA 4YIRX 3JU0A 4M3BA 1H89C 2NOJB 2VN2A 2BV6A 4C3IJ 3WTVC 2V83A 3BTCA 1H0MA 4QPOA 4BY7J 5F64A 4BGDA 4FT8A 1DUXC 1GV5A 1ZAOA 2GIVA 2CUFA 4IHXA 3FXQA 3S3NA 4EEFG 2A3SA 2CO5A 2JSPA 3M1CA 2HXIA 2VKEA 2STWA 2JVHA 2EPFA 4MO7A 1P7JA 3HKZN 1YZ9A 3I54A 2DOFA 2P81A 1QHGA 3TKYA 2HC5A 1GVJA 1JGGA 2BY1A 2H27A 4LIUA 4JP0A 3G1MA 1I6HJ 2V87A 3GW2A 2HOAA 3T1BA 4HLYA 4ENMA 2WAQN 2V7FA 2K9LA 3O8HA 4QWQA 5JVGF 2JY9A 1WVRA 2W24A 2Q2EB 1RR8C 1R1VA 1LEAA 2A6EF 2JSCA 3CMAI 5FB2A 3F22A 2PLYA 2ENHA 3C6MA 2BY3A 1YI2I 5ED4A 1ERDA 2M5WA 1V4RA 4DUYE 3I4MJ 2NS7A 2O7OA 1JXSA 1R00A 2JTVA 2CT1A 2QM3A 2VPRA 2JZYA 1X3CA 5KK1A 3K2ZA 1U6GA 2ZMEA 5IP9J 4EVIA 2EM4A 2ZC2A 1O3SA 4O43A 1P7IA 2K3FA 3GEZA 4M6XA 1DP3A 3S16J 3MEXA 3OYKA 4AIKA 5HODA 1W36D 4BDYA 4LLGF 3LAPA 3OYCA 2QWWA 3KEYA 3DQVC 3HPHA 2P7CB 2HQNA 3BJ6A 3FF5A 3WE2A 1J5YA 3JTHA 2M87A 2BBYA 4WXCA 1YLFA 4BXXJ 3GTMJ 3OY9A 3CUOA 4RA2A 3DLLF 3H09A 4X8WA 3T8TA 2D1HA 4GZNC 2ZO4A 4B44A 3OS2A 1MMGA 3O8GA 2QKLB 4KIFA 4LJZF 5TJJA 3BOQA 3DF8A 5EDNA 5EZGA 3SJMA 3QODA 4BEHB 2EFWA 1BIAA 2HFHA 3BCBA 1TWAJ 2LTPA 2DMPA 4EGZA 4EGYA 1H8AC 3ZXSA 1XSVA 1DU6A 2JWOA 1MNMC 3RSNA 3HPZA 1A1GA 4RGXA 4RB1A 1U5TA 4CUGA 1T38A 3FXMA 1SEUA 2DA2A 1Q1HA 1F2IG 2VOPA 3QPSA 3DPUA 3HTSB 2BVMA 4M0VA 3JTZA 2WC2A 2X6WA 2BGCA 3KFWX 3ZR8X 3E6DA 2XB0X 3HPGA 1Y1VJ 2R7ZJ 3P9IA 5ICEA 1RRJA 1XGNA 1KU7A 2AO9A 2KPMA 1XTAA 4G7HF 4E7SA 1JT6A 4DBRA 4GKKE 3G4SI 2NYXA 2WY7Q 5GP9A 2B9DA 4AWXB 2AXTC 1YJNI 2Y9YA 3GBGA 2W48A 4M9XA 4C2TA 3GVAA 3OTOE 2JA7J 2L9SA 2LR8A 1HC8A 4ZYEA 4R79A 2V9VA 2DA3A 4RGRA 5KNLA 1OJLA 4UUVA 4A3DJ 3J7AG 4DR5E 1IRFA 2HU9A 2RS7A 3RTRA 1ZN2A 2YSRA 2MKNA 4MHGA 2DW4A 3RI4A 2H1LA 3EETA 3MZ8A 4HDVA 1FNNA 1SFKA 2N3GA 3IRQA 3RMPA 1PKPA 2FSWA 3AG2H 1WZ2A 4GFBA 5ERIA 3TGNA 1ZGWA 1VQ4I 1HBXG 2YU9J 2DSYA 3BBGA 2VE8A 2E2IJ 4G6TB 2DFFA 3FM3A 2KFDA 3L2VA 1DPUA 1L0OC 1EKEA 1X58A 2IBDA 3LL7A 3U21A 4DYCA 3HOZJ 1N75A 2VQGA 2NVUB 3KP3A 3TOAA 2LSOA 1GQEA 3W2AA 1HDPA 2HXOA 1ZRDA 4MTDA 2EN4A 4HX4A 2EIJH 5LGNA 2NNYA 2FGGA 1T39A 4L8NA 1NG6A 1F9NA 5E79C 1IBKE 5HLHA 3AG1H 3K70D 5D5XB 4ZDLA 2LVHA 4O4KA 3H92A 3HC7A 3LLHA 4KITB 3MCZA 2FNPA 1YX5A 1FX7A 2EL4A 3R60A 5LGUA 4XICA 1JKPC 3S15J 4EM1A 3MVPA 3W3CA 2MSYA 1IV8A 3I4PA 3H0DA 5BOXA 3DPTA 4CHUA 2O03A 3S1QJ 3F0CA 4KT6A 3ZMSA 3CO6C 1YYWA 2VODA 2KRCA 3K69A 4P9UA 4FISA 2L2KB 4B3AA 3ADJA 2F5FA 5J47A 2MDRA 1FWZA 2K9MA 5EYRA 2XAJA 2XIGA 5BS6A 2WB1N 4G6DA 4OOIA 5IT3A 2EQ3A 3RYPA 3RPUA 4JV5E 5IT9Z 3DV8A 2I9IA 1RZ4A 2L7FP 2RAEA 4QTRA 4BBRJ 2GZWA 1BN5A 3EUHC 2E72A 4NHJA 4V19K 5JHUA 2KT0A 3ZMDA 3SZTA 1IV6A 3PNYA 2DLQA 1ETKA 1XMOE 5EF6A 3EQ1A 5F0HA 1SMTA 1BOBA 4C3JJ 2R7QA 2X9DA 1A36A 2CV1A 4F92B 3NEUA 5A6KA 2E2HJ 3PSFA 4NBQA 2HI3A 4IHWA 1YUJA 4LF7E 3SQNA 4DV4E 1TNTA 2KZVA 5FD5A 5J1RA 4WF2A 4IRHA 4U87A 2GM4A 3ZCOA 4DW6A 1UG0A 2CUEA 1W7PA 3WU0A 4R1HA 4N0BA 2GBYA 4E7HA 2YT4A 1FBUA 4RM2A 2XROA 1RESA 1QU6A 4L5IA 2YTJA 1GT0C 3S3MA 2O8KA 1BJAA 2JWTA 1WHNA 3HB9A 1UN6B 3K2AA 3S3OA 3A2KA 1ON1A 1PP8F 1A5JA 4FX0A 1P47A 3GX4X 1X3WB 3PFYA 2OD5A 3DU5A 3E5UA 3ECOA 2A25A 3WTWC 2EMIA 4RHBB 4DV2E 4PFOA 5M5YJ 1PJQA 1ZU1A 1W0UA 1IXSB 3C3WA 1IRZA 2R7TA 2QQBA 1XSDA 3CDLA 1YW7A 2Q8KA 4OOGC 2O9LA 4P5OA 2W85A 1WJPA 2EMXA 2PG4A 4R2RA 3O6BB 1Y0UA 2ODRC 4JYAE 2CPNA 3J80C 4QLCU 4IHVA 4M30A 3IC7A 2ZXJA 2BHYA 5E8IA 1ACIA 3QQAA 3WG9A 1T33A 4PFPA 4II3A 2RPCA 4GKJE 4AIDA 3QPHA 3A0BC 5IT9K 2WV0A 3Q5FA 2EQ0A 2RTXA 1B9MA 3PUFA 4L5EA 2NUFA 2RNGA 3E5XA 2LY9A 1OFCX 2DIXA 5LD2C 3HRMA 4O3MA 2BEOA 2N8XA 4OMYA 3CESA 5H6QA 2EPKX 3BC8A 4F9BB 3E5QA 4E7IA 4F9CB 5E3OA 2GHFA 1YFHA 2I8DA 2LBSB 3IKVA 2QSFX 4FETA 1U5TC 3K4KA 3MKLA 2L2OA 2A68F 1FLIA 4GO1A 1Z1BA 1FYMA 3IH4A 2UWMA 4CCNA 3I71A 5JR3A 5GPCA 4IEJA 4A3FJ 3HOXJ 4AQYE 1U8RA 1VQNI 5KL5A 2OQGA 5JFRA 3IWZA 2YTQA 1FIAA 3E6MA 4ZDPA 4J01A 1ZKGA 1D5VA 5L3FA 3ZMVA 3B6CA 3F23A 3GLLA 1TT5B 3VYUB 4EJOA 2ELYA 4F91B 4RB3C 3ZGKA 4X9JA 1ORKA 1ETXA 4BHBA 1IDYA 2DO7A 4EJUA 4I6ZA 3E6CC 1X47A 2WBUA 5J4VA 3I9V2 1O3QA 4F2JC 5GAGJ 2EOXA 4A2UA 2LCEA 3TP3A 1LFUP 2YU8A 1O3RA 2L92A 1E3HA 3JSPA 4AVZA 3D5LA 1XSXA 2OTJI 4DV7E 2RSMA 1X5WA 2A5WA 3KIOA 2A6HF 1HR0E 3IH2A 1BB8A 2NAZA 2PBIA 5E3NA 1WJBA 1X1PA 4KN4X 2EPNA 2EZ6A 4UB8C 4WSGA 1PUEE 4DUZE 1O7FA 1LFBA 1ETYA 5DM7F 2OAZA 2EPPA 2EMHA 3TMOA 4PSXA 2CQKA 1KYQA 3R4KA 3DBRB 1Y0NA 2EOYA 3KP6A 2LY2A 3OS1A 4M74A 1PP7U 1L4SA 2D2WA 2M7BA 3JRBA 2R7RA 1QPMA 5ILSA 4PJJA 4IOAF 3TQMA 4AUXA 2F2EA 3SHFA 3MKZA 2RC4A 4Y52J 3VEPA 2L8TA 2M4KA 2EILH 4PJMA 2EA2A 4Y17A 3SFZA 3ZMTA 5JI6A 3ABLH 1JJ8C 4A3BJ 3M3YJ 1T6SA 4V2FA 5H6RA 4BE0A 2LNBA 2CV0A 2DTRA 1ENHA 5K5QA 1X2NA 1TQMA 1NTCA 5CYVA 4B3ME 3FXKA 4Z6YA 4BE1A 2G9WA 2V1UA 1RC7A 2BY0A 3DFGA 2F48A 2DLLA 1MBEA 4UVBA 3E97A 2KJCA 2DI3A 4XM3A 2GXAA 2CQNA 4HV5A 2WAQA 5K7ZA 1XDUA 4D5FA 4ZZDA 1UMQA 1S7EA 3KLNA 4IZZA 3FMQA 3PQKA 2P6SA 3CUQC 2LVSA 1E3PA 3S93A 3IAM2 1X2MA 4LFAE 1XCBA 2FJ1A 4HQMA 2E5ZA 4IKFA 3K1MA 3S2DJ 3FDYA 4UVAA 2ACJA 3ECRA 3I53A 4F54A 1MMDA 4JX4A 3GUDA 3WTXC 2R7XA 2NOGA 2ZFUA 5J4YA 4P55A 3VWBA 4DNCA 5JLXA 1D0XA 2ZB9A 2B7TA 1RPWA 3W6JB 3OR1C 5KAFC 2H6BA 3SZPA 4HNTA 3LSJA 3FWEA 3CJQB 1JKQC 3VYYA 4A6EA 3SDGA 4F7ZA 4GDFA 1R5ID 2UXXA 5GPAA 4EATA 2K7LA 3FHZA 1T0FC 2RQPA 3T8RA 2K02A 3RZOJ 1RMDA 3PL8A 2M4GA 4CSWA 2STTA 5EJCA 4BQNA 4DYQA 3A02A 4RDUA 1O57A 4DGWB 1OYWA 3TOBA 2EBIA 4RAYA 1CQTA 1DI2A 2YTDA 1BBGA 3ADGA 1D8JA 3CMMA 5AIPA 2ECCA 1X6HA 5FRMA 1TBXA 2WZOA 4IXAA 1RKTA 4Y13A 4KMFA 5IYDJ 2X1CA 2EP3A 3M9AA 1W36C 2JP9A 1EH6A 1K83J 1TT0A 5K5RA 2OU2A 5F3WA 4IRIA 4ZTFA 3I3LA 2FNAA 3QYBA 4JX6A 1VQMI 4HF1A 4C2MJ 3ISPA 2TRTA 1YG2A 3QOEA 1W0TA 4BHPA 3GZ6A 1QPIA 2EOSA 4IQ4A 2L2MA 5M3MJ 2V88A 3JSOA 4DV1E 5TISC 1X6EA 2QF7A 2Z9OA 4M3DA 5FGMA 2UV1A 4O5VA 4I2OA 2EPLX 1HNXE 1IRGA 5A6BA 3OMYA 2EM3A 1LNWA 1OR7A 3PO2J 5ICFA 1UCRA 4J19A 3EYIA 2HYFA 1EKZA 2P0WA 3ML6A 2EL5A 3D5RC 2OCEA 2EIKH 2VKDA 4NQWB 1XMAA 4GYGA 1XC5A 1YIOA 4EQQA 3IKTA 5J1YA 3AL0C 3AUZA 3BT9A 5FLXK 1XS9A 3D0SA 2EN3A 2KMUA 1A31A 4ON0A 1Z0XA 2CSHA 3LMMA 4FE7A 3ZQFA 1BW6A 4LF8E 4O6JA 4XONA 5HDNA 1JTXA 1X1CA 4PDKA 5KHDA 2H8RA 2YTIA 2ZJPF 1IQOA 4XMYA 2MBFA 5HS8A 4A3KJ 2FV4B 1YRNB 1EF4A 2YPRA 2K4JA 4DQ2A 3OYMA 5ILVA 1MDMB 2JA6J 2EPXA 2EB7A 1VFCA 5KL3A 2GAUA 3B02A 3W6VA 1FEXA 2R92J 4WSPA 2QQ8A 5J3LA 5E1XA 4B48A 1VZ0A 4A3CJ 2D45A 4C9YA 1ZLKA 2CQXA 4XRSG 1HOMA 5K1YA 2NXNB 3S17J 4M3FA 1LDDA 4NZVA 4PJNA 2WAFA 2LD5A 1MNDA 3CDIA 3DEWA 1HSTA 1K78A 2EOQA 1O0WA 2AXLA 5FRNA 1RUOA 2E1NA 1GXQA 3HHHA 1HXDA 3S14J 3BDDA 3NRVA 2KLOA 1I3QJ 2LMDA 2MC5A 5BNGA 2ETHA 4JBAA 2LTRA 4DR6E 2LOOA 2R7OA 4R2AA 1BBOA 2CW0F 4S0HB 2L3CA 1A1FA 2E60A 1GLNA 3KPHA 4ESFA 2JOBA 1HA8A 2R5YB 4YIFA 3K1PA 3VOEA 3HXLA 3HJEA 2BB8A 5FLXC 1YQAA 5FJ8J 2ID3A 4F6MA 1STZA 2FQ3A 3S2WA 4BCAA 2NRAC 3HOYJ 1KJKA 2EMFA 2JPCA 2V9PA 3JRAA 1NK3P 2LH9A 2Y31A 3MD2A 3RJPA 2BZTA 3CCRI 4ENNA 1G6NA 3CCYA 3BCAA 1Z7LA 1EH8A 2IA2A 3IV5A 3A1YA 3ZPLA 4JI6E 4XIDA 4KZSA 4X6AJ 2LY1A 4ZC3A 2DK8A 2E1MC 1GZ6A 1W5CC 3E7LA 4L9JA 1LE8A 1F1ZA 4R2SA 2FEZA 3HGGA 5DYMA 1N3GA 1B72A 3KE2A 5FKNA 2V8QB 1RNLA 4HEA2 3DF6A 3BTLA 1S5LC 2Y2ZA 2NVQJ 1XGSA 4HX8A 4E6KG 1DU0A 3CDHA 1W5SA 3CCLI 1PJSA 1LKXA 4BBYA 4DV5E 2K85A 5E17F 2V1NA 1LE8B 3WTTC 2PJRB 4HQEA 2YTGA 4XR6A 2W7NA 1RI7A 4HZFA 4I98B 4PGHA 3R6SA 1AH5A 4CXFA 1UZCA 4KUMA 4NB5A 5ICCA 2B3TB 2YRMA 3A4CA 2KIQA 5B1BH 1R6RA 3KP5A 1Y56A 3ULQB 2IJLA 3KCCA 3V8KA 3CP2A 3IRRA 3G6EI 4G7OF 3DKYA 3F21A 1RUNA 2HDCA 2HS5A 4Q28A 4R03A 2E35A 4BEHA 2VONA 2CWEA 4S05A 2VQEE 3DP7A 3M07A 4Z2YA 2WA0A 3ESWB 2B0LA 1T0FA 1W4MA 4BKXA 4FQGA 2UUZA 4C3HJ 3OSGA 1T4NA 2M0CA 3F3XA 2Z3YA 3R0AA 4RH8A 4IHSA 4R2CA 5FO5A 4F52A 1B72B 4HSRA 2M7QA 2W82A 3GTGJ 1UILA 2ELKA 1IJWC 1ZRCA 1UHZA 4BQQA 3E6BA 1BW5A 2V4JC 1R1UA 2JA8J 5FKLA 1Z21A 1PYVA 3PIPF 2XAHA 3FHNA 1MMAA 2JPAA 5E1WA 2LKSA 1K6YA 4B47A 5LEJA 1GVDA 1AU7A 3NAUA 1JT0A 1PUFB 1U9OA 2O3FA 4KHPE 1X3ZB 1K6OA 3HSFA 2XSJC 5CFFE 3BR1A 1S29A 4B3XA 4L9NA 1JK2A 4DIQA 4M9VC 1ETQA 3ELKA 4DMIA 3GO5A 2R0QC 3MHSC 4DR3E 2L4AA 1GXPA 4BBSJ 3MSWA 3FK7A 3CCUI 1OCZH 2DXIA 4N4OB 1VQ7I 4C2UA 1SD5A 2JJ7A 3TW6A 2EOHA 1IN4A 1M1EB 5B5EC 5TGTA 4ZYHA 5IXMB 1JTYA 4YFNF 2QBYA 2Y30A 5DM6F 1Z9CA 3G3ZA 4E4HA 4OMZA 1SVLA 4HAMA 2EOZA 2DMTA 4IHTA 3BG7A 1HQCA 3TDZC 1QNTA 1Y8RB 1YW8A 2W25A 3SEQA 4ZYDA 3G71I 2MC3A 1SD7A 3OWTA 1WWXA 3CCVI 3ONQA 3ROUA 4IVNA 2XRLA 4FE4A 2QSHX 5C4XJ 3K1NA 2ECBA 1LQ1A 2DB2A 2V89A 3ZQGA 3T0YA 2XSDC 4G8XA 1LB2A 2VBWA 1BIBA 2F4OB 3CJNA 3KP2A 4Y7NJ 5D4RA 3A01A 1FYKA 2BE5F 3ERMA 1PUFA 2YTEA 1J7KA 2JXPA 5H2FC 2IPQX 3IP4B 2R5ZB 4U88A 4L5NC 3CMYA 3J81Z 4E70A 1R49A 2YX7A 4E7KA 1P9QC 2DCEA 4BDZA 3FISA 4EV0A 4A3GJ 2DA6A 2OC6A 1P4AA 5LRSA 4B43A 2ZBKA 1J9IA 2JMWA 1XN7A 2HJJA 2UU9E 1LJ9A 3KZIC 3OYIA 1BC7C 1B59A 4NC6A 3PQJA 4G6QA 1FMVA 5CVJA 5IV8B 4JI3E 1MIJA 2M2EA 3K4CA 1SAUA 4LK0F 2VJ5A 2NVYJ 3BQZA 2A07F 1ZYRF 2IXSA 4WXDA 3O3KA 3S1MJ 4P7DA 2WBTA 4RAZA 2L7KA 4I8OA 4JI8E 2BYVE 2KL4A 4DV6E 2K40A 2KOUA 3VK6A 3J7Yp 3EUKL 3GTPJ 3BROA 2KIMA 3JCUC 4WK8F 5EGOA 3HQ1A 3C2HA 1SMYF 3E3VA 3VODA 3ADIA 4I99C 2FA5A 3DKWA 3LA2A 4IRGA 4BQOA 4G7ZF 2EM8A 2EIMH 2M30A 2VASA 2R5ZA 2XPWA 2YUSA 3LA7A 2V6EA 2EWLA 4AIHA 2VXZA 1FSHA 3TP0A 3V7RA 3CC2I 1TTYA 3ZRGA 4D1QA 5GADJ 5EGOB 1W7PD 2P5KA 2B7EA 2TDXA 5GTIC 4RM3A 1WKMA 4UUSA 2CH0A 5ILUA 2L02A 2DOEA 5LBQA 5A2QC 1IGNA 1KQ8A 4KNYA 2P6TA 4UUTA 3QWLA 1MEYC 4XSXF 1F5TA 2W1OA 4LG0A 2CQ7A 1TQIA 2ZSIB 5E8GA 5E3LA 2HZTA 1IW7F 3ZN1A 2LFBA 2ZCWA 2VJIA 1WSUA 2MYSA 3IWCA 5A69A 2EE8A 4CZCA 1S9HA 2XAQA 2LLKA 4A3IJ 3OSFA 1BR1A 1ZR4A 4O5GA 4PUSA 2W00A 3LSMA 3MQ0A 1C0WA 1S7OA 5HLIA 3CCEI 4ZYAA 4XSZF 2LKXA 2Z2SB 2H6CA 1WI3A 2OCCH 2ME6A 2HQRA 3I0TA 1R71A 2YRKA 3DJWA 3BY6A 4DV0E 1XGMA 2FE3A 4MLVA 3P7NA 1I39A 4XBFA 2EOIA 2FOKA 2GIZA 2EPOA 3PNVA 1SVMA 2QYOA 1TW3A 1ZG5A 1DGWY 5AE1A 1MMSA 4XLPF 2N3HA 1B69A 1HW5A 2XAUA 4UHTA 1Z67A 1D1AA 2G0EA 1R23A 2MA3A 3E1SA 3LOCA 1MSFC 2JA5J 3GTOJ 2K9QA 1ITYA 4TUIA 3GFLA 4W1UA 4LGWA 3IAS2 3OYNA 3HUGA 2H94A 3KX2A 4YIIA 4FK5C 3ZP5A 2HPIA 4I0BA 2DDAA 3ABUA 3OYAA 2ZM6E 4DV3E 2ESNA 3V8JA 1OR7C 2ENAA 2JYAA 5HVQC 3GYHX 2DMQA 1S3JA 2A61A 5DEQA 1KU9A 2JRTA 3JRCA 1GHCA 2EPZA 2UUCE 1WPKA 5BPIA 1BA5A 2DDBA 2M3AA 5C4JJ 2P5LC 3L00A 3HIFA 2JR1A 2OA4A 3UK3C 3H9JA 3H1CA 3F9KA 4P9FA 3OYDA 1IN6A 2GQQA 1IUFA 5HDGA 2N8GA 3J81C 1I27A 3HYIA 2Z1DA 1X3UA 1KQ0A 2L9NA 3DU6A 3EPKA 5E18F 3Q0VA 1F4KA 3L09A 2A69F 2X48A 1TF3A 1FYLA 1YS7A 5HOOA 3CF5F 3LSTA 3SDBA 1JHHA 1T4OA 1FC3A 4M71A 4GXOA 2VXDA 3ZQQA 1Z3XA 1J26A 5D5WB 3SFIA 2K3PA 3GTLJ 2XUBA 2QQAA 2ODRD 2LV2A 3OIOA 2Z99A 1YHQI 3KETA 3H0GJ 3S1RJ 4UV9A 1Z3YA 3W2WA 4R2EA 1ZQ3P 4RGUA 2XF6A 2LREA 4Q4ZF 3D5SC 4UY8I 4MLQA 3MKYB 2K9NA 4HF2A 4QPQA 4JQFA 4RMNA 2IS6A 3IWBA 4XK4A 3H9GA 2DTZA 3HGYA 1OISA 1DP7P 4XLFA 1QQIA 2VKHA 1U0JA 1D8KA 5AONA 4XKCA 2DFHA 2V26A 3K9TA 4F93B 2DBBA 3WTSC 2ZMEC 1ZR9A 5FKOA 4ANJA 2BY2A 1AHDP 5HDKA 2LRSA 3K10A 3BR5A 2Z16A 4HW0A 1BI1A 3HSEA 1WJCA 5HLGA 2HQAA 3DBHB 4RAGA 2ISYA 2DJIA 2ICWG 4HOBA 1ZRFA 4U0WA 2CYYA 1OYYA 1LUJB 1XMXA 2YSPA 1DPRA 4D7NA 1FY7A 4PCQA 1Z7UA 2EM5A 2IRFG 2LUQA 5L3BA 5BPDA 1TN9A 1UHMA 4DR4E 1PDNC 4N9HA 2DMUA 2LKPA 3VB2A 5IP6A 3EYYA 4NQWA 3BG3A 5CVRA 2VL8A 2XRNA 2D9HA 4LLLA 2E71A 3K4LA 2R3SA 3J81K 4BL0B 1YOVB 3EPZA 1SC7A 1B6AA 4LU9A 3DBLB 3GLXA 2GWRA 1UHSA 1YIJI 2XHKA 3EPLA 3CUQB 3HDDA 1ZARA 1SD4A 1R58A 5B3SH 5D6EA 4EJWA 2ZJQF 2COMA 2L0KA 3PNTA 2KISA 4CCMA 2E1MB 2EN2A 2VQLA 5CQGA 2V79A 2VE7C 4S04A 2NVXJ 1TNSA 4IJDA 1FSEA 3K4NA 1A35A 1WJ5A 1IG7A 3L2CA 3MKWB 3OV8A 2DJNA 1UG2A 4YHHE 4BACA 4DZPA 2GLOA 5DD8A 1NEIA 2PEXA 4L9TA 5FLVA 2FOWA 2DA5A 2ZXWH 2IGMA 1A1KA 4J8ZA 2LP0A 4HEIA 4BHCA 2GXGA 1T2KA 4KICA 2MD5A 4L5JA 3MMYB 2FBIA 2MLGA 3TO6A 1N32E 4LD5A 1YJWI 1J0RA 2EQRA 1N33E 4F6NA 2PX9A 3LSIA 4FTHA 2L2NA 4EMSA 2VF1A 2MFZA 2KHXA 2YU5A 1QVTA 3T1HE 1K61A 4MFDA 2UUAE 3M7GA 1JKOC 2VT3A 2L3DA 3R0JA 1ZELA 4ENKA 3CC7I 3NARA 3ABKH 2EFQA 2VJJA 1VF9A 2XGCA 5FLXZ 3WTUC 4QIWN 3TW7A 5LEKA 3HOWJ 2VI6A 1GTKA 4ENJA 2DQLA 4XL9A 5IPAA 2EFOA 1T98A 1U2WA 1Y8QB 4M72A 4C30A 3GTKJ 2HHHE 2MG4A 1LDKB 3QOPA 2FTXB 3IUOA 3KWRA 2QZ8A 5AC5A 3AKZA 2QLZA 2M8GX 2CMPA 5F08A 1AKHB 3OYJA 4LG0B 1O7LA 3OL3A 3RPQA 1X6FA 2LUPB 5D6FA 3QU6A 3S2HJ 2Y0MA 2CTDA 3GF2A 4YELA 4LFCE 1HF0A 5LMNE 2NUGA 3V7CA 4KN7X 2L9RA 2NABA 2HGHA 2UXCE 4KJZA 3F8MA 5LFAA 3HTUA 4AC0A 2XGEA 2RVCA 2EOMA 5J1UA 1AKHA 5FROA 1SFXA 2O6GE 3C4BA 3L7WA 4JI0E 5AE3A 1B8IB 3F8BA 5IP7J 4FASD 2XF7A 2KDZA 1SANA 2ZNZA 1V5GA 2DOAA 3J7AY 1BL0A 3BR6A 3UNGC 3LQQA 4CCOA 2ADUA 4XNFA 1BR2A 2QENA 3VSKA 3J80K 2XPUA 3A01B 1MNEA 2BXZA 1HLVA 3KLOA 3U1KA 4BQAA 2VOOA 2HTSA 2H1KA 4Q35B 1MH4A 4G9YA 2EWNA 3VHTB 3ASNH 2JN6A 3OYFA 1FP2A 2EM2A 4UB6C 2F6CA 2DT7B 2DYRH 2QKMB 3ZMZA 4A12A 2EN8A 2RV8A 5DCMB 5DUKA 4B3TE 2OQRA 4FCYA 4E7JA 1FIPA 3RCOA 2E19A 5EZHA 2YU3A 5L3GA 1SFUA 1OCPA 1Z91A 3K7AJ 3V8LA 3P1XA 1FOYA 4BC7A 2OTLI 3IWFA 2MW8A 3PFIA 5HLTA 1BJZA 1HKQA 4N9IA 1JJ6C 3WU1B 2R7UA 2M9AA 1A1IA 1SFOJ 2LYCA 3JREA 2D1VA 4IJAA 4BMJA 1HNZE 1UELB 4MQVA 4KA4A 1X4OA 1TL8A 3C2GA 3CCQI 2QEXI 1B8IA 2EPMX 1A1JA 1JGSA 2DA4A 2JQ7A 1G2FC 1MJ9A 1DQUA 2W57A 2OBPA 2G7HA 1KYZA 1QO0D 3BP8A 1R22A 3GZNB 4YEJA 2FU4A 2XASA 4DBQA 2PJPA 4ESJA 1TZLA 1APLC 3RIRA 2EH3A 4LB6B 1G59A 2EZHA 4ESBA 3ZQ7A 1WXRA 2CQQA 3ERED 5M5XJ 3FKIJ 4A5NA 2GOMA 1I3AA 2ADRA 5D5UB 4LOCA 1L3LA 4IS1C 4A0ZA 2VB6A 3P5JA 2ELJA 3FMSA 4JK1X 2V1DA 4M6VA 3C2BA 3E0JB 3BPXA 2GA1A 1W1WE 3LAJA 4ZYGA 4X66E 1G3TA 2VIXA 1P2FA 4MTEA 3RDIA 2Y0SA 4WCGA 3QG5C 4DJAA 5L3CA 2K4BA 3OMLA 2EZKA 3HOTA 2B63J 4L9VA 2P8TA 4PZJA 3AG3H 1H88C 2KZGA 3U2RA 2C6YA 1MJAA 2WBMA 2CFOA 3QPLA 4BU2A 5EG0B 2YRHA 1GV2A 3B73A 3TO9A 2L33A 1IBLE 4N4RB 4XN0A 3LSHA 1MBHA 2NA2A 1LVKA 4XLEA 2IS4A 1AWCA 4BXUA 4DZJA 1YTYA 1YUIA 2ZXHA 4A0YA 1FP1D 1V55H 1XG1A 1TQPA 1RETA 3C6KA 1ONVA 2Q2EA 1Z6TA 3PSIA 2DPDA 1S6LA 5AIQA 3FZVA 3GMEA 3ZOBA 2HYJA 2HDDA 1TP4A 2DYSH 3LSRA 2ZJRF 1D1CA 3S8PA 2EN6A 4I09A 1VTNC 5BMZA 1G4DA 1F43A 2WWYA 2QUFA 2F5EA 2COBA 4Y4RA 1UFMA 2YS9A 2PFBA 4RLQA 1CF7A 2VRDA 3QYEA 5JLWA 2HKXA 4GGGA 1IN8A 5IYBJ 1K78B 3C1DA 3OR2C 4AM3A 1TWFJ 4B1RA 2FBKA 4N4NB 3JRHA 2ELZA 3M4OJ 2MLKA 4Q47A 2VQFE 2ZKZA 3HRTA 1WH7A 2XB5A 2VJ4A 4U7DA 1WHUA 1R9TJ 2D5VA 4ASNA 3OIQA 1TWHJ 1YYVA 3G1OA 4JI4E 4OAYA 1BR4A 2JPBA 1JUSA 2E1OA 1YYKA 2HYGD 1QVUA 5LHHA 3I64A 3VYRB 3FK6A 4BC9A 3UR3C 1T95A 1YJ9I 2L7MP 3FXRA 1VQ5I 2CW8A 1ETVA 3WU2C 1WCMJ 1WJDA 3MWMA 4XLAA 3U9GA 3BJOA 4R2PA 2Y0SN 3H5RA 1B4AA 2KHMA 1JKRC 2K86A 2DT6A 5BR8E 1WQ2A 5JHFA 5AC4A 3AG4H 3DLAA 1FBSA 1UBDC 2E5NA 1G3SA 1AA7A 3I5UA 2ENCA 2PN6A 3TBIA 1IUYA 5FLMJ 4NXNE 2VC0A 5E1ZB 1OMIA 5F27A 5AE2A 1IMUA 1LPQA 5A2QZ 1OCCH 2IA0A 2EFPA 4OINF 1OCRH 2EMYA 1MD0A 1Y6IA 4CICA 4EJVA 3C18A 1PJRA 1ZAAC 1UHWA 2V85A 2WB1A 4OIQF 1FOWA 4II2A 2JA2A 4FX4A 2DGCA 2H09A 1KGSA 4A93J 3HBLA 3EDPA 3HTXA 2R7SA 2PJRA 2R76A 1MDMA 2L5QA 4HTGA 2WV1A 3KEQA 2VC1A 2VKVA 4MFEA 3JRFA 3HL2A 5E20A 2YTNA 2K4VA 5TSEA 3LA3A 2CRGA 2F4VE 4E7LA 3MAJA 2L01A 3OL4A 3Q0WA 3RKYA 4D7MA 2EM0A 4BJTA 5KL7A 2NS0A 2YPNA 3H35A 3NWSA 3BTJA 1MGTA 4ZDOA 1WJEA 1HW1A 4M9SA 5B1AH 1USTA 1WJAA 2R7DA 3F8FA 3CMEI 2PMZN 4IL6C 2HZDA 4OIRF 2PQ8A 4MEXF 5L3DA 3THNA 1PDAA 5L3EA 1Z05A 2KQRA 4XRFA 4AYBN 2R7FA 3I56I 2X6OA 3ZQLA 1E0EA 4LFBE 1HKSA 1U3EM 4TUGA 4I0AA 3ECHA 4ZTJA 4ABZA 3QU3A 3WTZA 3FBNB 1HSJA 4AU7A 1I6XA 3WGHA 2O8XA 3QAHA 4X1EA 4HDUA 2DA7A 3HZJA 2EMCA 2RS6A 3REOA 1T08B 2HKOA 1RQ0A 4CYCB 1WRJA 2YSOA 4LMYA 3GTJJ 4Q48A 4IQJA 2E1MA 3KZZA 3JTGA 3K6GA 5BQTA 1LVAA 5IOZA 2MH9A 2OZ6A 4HNUA 4M2ZA 3DWLE 2VQCA 2YTFA 4W97A 4KMUX 2LF8A 3W6KB 2EOJA 5E3MA 1OLTA 1X4PA 2AQEA 5LHIA 2MC6A 3CLOA 1X48A 4IPAA 3HOUJ 1NHAA 1TC3C 4P1WA 3L9FA 4BY1J 1MKMA 1SD6A 2EFNA 3F6VA 3FXLA 3H3UA 2LMZA 2WY8Q 1VQ9I 5D4SA 1VQPI 1STUA 2DN0A 4Y33A 2DQRA 2BW3B 4UXNA 1E3OC 4HX7A 4XKBA 2Y9ZA 5IYCJ 2WTEA 2EV6A 3V42A 3J7AO 3W2VA 5CQEA 3K4MA 4HLXA
chains in the Genus database with same CATH topology
3FXUA 3FX3A 4YFKF 1ZH5A 2Z5UA 4ETSA 1E17A 1ZGJA 5JVTA 2DPUA 1BM9A 4OIPF 5J8CA 1O3TA 2ZJ2A 2ZNYA 3LFKA 5CVIA 4AD9A 5CJ9A 3AAFA 3I58A 5J8FA 1JHFA 3EUHA 2A5YB 1G3YA 2YR2A 2FXAA 2XKOA 4B8XA 2O0YA 1U5TB 1IF1A 1ODDA 4GCVA 4CO8A 3LQRA 4TV7A 5CVUA 1IXCA 2F5DA 1QZYA 3BZ6A 5J6XA 4I7HA 2GA2A 3I59A 4PGGA 1P4WA 5LRRA 1IZ1A 2QBYB 1EH7A 1BOAA 1E2XA 3COAC 3ZMUA 3T5XA 4HBLA 4HF0A 3DXJF 5DUIA 3I59B 3LWFA 2UXNA 3BWGA 1MZBA 3KEOA 1BI0A 2ZMEB 1Z1DA 2YX4A 1U78A 2KKOA 4G94A 1R36A 3CTAA 1TW2A 2HGCA 1WI9A 4B09A 1IN7A 1YS6A 3M8FA 1MJBA 2M45A 4EM0B 5DDGA 2CGPA 3HRSA 3CO7C 3GWZA 3GZ5A 3GXOA 5DCFA 1FOKA 4UVCA 3WTYC 3QP6A 3JAMK 4M73A 3ABTA 2LDUA 4D0PA 1SAXA 2J5OA 4KDPA 4IF4A 5H20A 1V3FA 2NNNA 2PMUA 3M8EA 2CFXA 2HTJA 2FRHA 3Q9SA 1IN5A 4Y15A 1BI2A 2XVCA 3GFMA 1J59A 3P9KA 1IXRC 4EM2A 5EEGA 1P92A 5D5VB 5FFXA 5DV5A 2EA4A 2ZFWA 4KIBA 1OYIA 3QP5A 1KU2A 3V7SA 2EV5A 2DAOA 2HWVA 3N4MA 1XCVA 4UNOA 5LGTA 5F6FA 2Y48A 4U0YA 3JW4A 4RB2C 2QQ9A 1S7AA 1YW9A 4WXHA 4BYYA 3HOSA 4M9ZA 1XB4A 4U0VA 1G3WA 2XGXA 3KP7A 2VBZA 4RB0A 1BC8C 4UV8A 4L18B 4HA8A 4BH9A 3IHUA 4L0YB 4LLNA 2IA1A 3U1DA 2Q0OA 2DU9A 1QGPA 4I02A 2F5CA 1FT9A 3KP4A 3MZYA 4LK1F 2MH2A 3DPLC 2DK5A 1FZPB 2HOEA 2HR3A 2PI0A 2CG4A 1K7AA 6PAXA 2EV0A 2EK5A 5TRDA 2XV4S 5HS9A 4P96A 3TQNA 2O61A 2ELHA 3RKWA 4BAYA 1R5GA 5CVVA 4CYDA 4K2EA 4R8HA 3HRUA 3F8NA 2E7WA 1AOYA 1H9GA 2L4MA 1P6RA 2FMYA 1B1BA 4MEYF 1KU3A 2ESHA 4AIJA 3HSRA 2DT5A 2L54A 3N97A 4Q5SF 1OKRA 3F6OA 3JAMZ 2GXBA 1I1SA 1QZZA 2FMLA 4KIGA 3HHGA 2HEOA 1ON2A 1I1GA 3GFJA 2UZKA 2X4HA 2VE9A 2J5PA 5FFZA 2LF7A 5ICGA 5HS7A 3RKXA 4BNCA 2RDPA 4FHTA 4AVPA 3WGIA 3F72A 2V6CA 2IT0A 2RKHA 4I01A 5KVRA 2Z33A 1ULYA 4GYIA 4L0ZB 1YO5C 2JT1A 1USSA 1ZREA 1I5ZA 2P5VA 3RYRA 1J75A 5D8LB 4A5MA 4A0XA 2IP2A 1EV7A 4KYWA 1R1TA 4OIOF 2G7UA 2QVOA 2EJRA 4WWCA 3BJAA 3WE3A 4U7BA 2W84A 2RGVA 1XDSA 1LEBA 2FBHA 1BI3A 3C7JA 4MQ9F 3G73A 3EQLF 2VT2A 3MFKA 4H0EA 4LB5A 5K5OA 3QPTA 5FD6A 5D8KB 1JE8A 3R61A 1KA8A 1ZG3A 2XKPA 2Y75A 4RGSA 1BBYA 1B9NA 5A2QK 5EEHA 1ZG1A 4XLNF 1S8NA 5DD4A 1XGOA 3TO7A 2E7XA 4HYEA 4KFCA 4EJTA 2IW5A 1R7JA 3M1EA 5LLQA 4CZZA 1CF7B 4MGRA 2ISZA 4KT5C 3J80Z 2K27A 1KYWA 2KIUA 3FM5A 4WX9A 2V1XA 1TLHB 2XAFA 3OOPA 5CLSA 3IL2A 1XD7A 5DCMA 3FMRA 4ZH4F 1UB9A 2X0LA 2OZUA 3MZHA 2M8EA 4MNUA 1HKTA 3DEUA 3BPVA 3NQOA 1OPCA 4CDGA 2RN7A 1P4XA 4LFUA 1J2XA 1CGPA 2M1BA 1IAWA 2KIFA 1SFEA 1RIOH 1ZLJA 1R5HA 3K0LA 3GFIA 3H3ZA 1D3YA 2DFIA 1Z6RA 1A04A 3CUQA 4RS8A 3SXYA 1HW2A 2RNJA 4OU0A 4ZZLA 2FF4A 1H9TA 4YG2F 3P9CA 4A6DA 2IVMA 2AS5F 1KQ9A 1FBQA 5LHGA 2P7VB 2VBXA 3WODF 1ZHFA 1W5TA 3V4GA 1FPQA 3F8CA 1ZGAA 2XAGA 2VBYA 2PMHA 2KRFA 2CSOA 3QRFF 5F1RA 1LDJA 3KZYA 2KJBA 3VFZA 4CGZA 4M6YA 4HV6A 3WGGA 2E1CA 1W7PB 1K79A 1QBJA 2P4WA 4YFXF 3Q9VA 3TDUC 1REPC 1XMKA 3ZN0A 3O2PE 1DDNA 2VN2A 2BV6A 3WTVC 1H0MA 5F64A 4FT8A 1DUXC 1ZAOA 2GIVA 3FXQA 2A3SA 2CO5A 2STWA 3I54A 3TKYA 1GVJA 2H27A 3GW2A 4HLYA 3T1BA 4ENMA 4QWQA 2W24A 1R1VA 1LEAA 2A6EF 2JSCA 5FB2A 3F22A 2PLYA 5ED4A 2M5WA 1V4RA 1JXSA 1R00A 2JTVA 2QM3A 2JZYA 5KK1A 3K2ZA 1U6GA 2ZMEA 4EVIA 1O3SA 3GEZA 4M6XA 3MEXA 4AIKA 4LLGF 3LAPA 2QWWA 3DQVC 2P7CB 2HQNA 3BJ6A 3FF5A 3WE2A 1J5YA 3JTHA 2M87A 2BBYA 4WXCA 1YLFA 3CUOA 3T8TA 2D1HA 2ZO4A 4KIFA 4LJZF 5TJJA 3BOQA 3DF8A 2EFWA 1BIAA 2HFHA 4EGZA 4EGYA 1XSVA 4RGXA 4RB1A 1U5TA 1T38A 1Q1HA 2VOPA 3HTSB 2WC2A 3KFWX 2BGCA 3E6DA 3P9IA 5ICEA 1XGNA 1KU7A 4G7HF 2NYXA 4AWXB 4M9XA 3GVAA 4ZYEA 4R79A 2V9VA 4RGRA 4UUVA 1IRFA 3RTRA 1ZN2A 2YSRA 4MHGA 2DW4A 3RI4A 3EETA 4HDVA 1FNNA 3IRQA 2FSWA 5ERIA 3TGNA 1HBXG 2VE8A 3FM3A 1DPUA 1L0OC 3KP3A 3TOAA 2LSOA 1ZRDA 4MTDA 4HX4A 5LGNA 2NNYA 1T39A 1F9NA 5HLHA 5D5XB 3H92A 3MCZA 2FNPA 1FX7A 3R60A 5LGUA 4EM1A 5BOXA 3I4PA 4CHUA 3DPTA 2O03A 3ZMSA 3CO6C 2VODA 3K69A 4P9UA 2F5FA 1FWZA 5BS6A 2XAJA 2XIGA 5IT3A 4G6DA 4OOIA 3RYPA 3RPUA 5IT9Z 3DV8A 1RZ4A 2GZWA 1BN5A 4NHJA 5JHUA 3ZMDA 3SZTA 1SMTA 3NEUA 3SQNA 1TNTA 5FD5A 4WF2A 4IRHA 1W7PA 3WU0A 4R1HA 4N0BA 1FBUA 2XROA 4L5IA 1BJAA 1ON1A 1PP8F 4FX0A 3GX4X 2OD5A 3E5UA 3ECOA 3WTWC 1IXSB 3C3WA 2QQBA 1XSDA 1YW7A 2Q8KA 4P5OA 2W85A 2PG4A 3O6BB 1Y0UA 4QLCU 3IC7A 2ZXJA 5E8IA 3WG9A 3QPHA 5IT9K 2WV0A 3Q5FA 1B9MA 3E5XA 3HRMA 4O3MA 2BEOA 4OMYA 5H6QA 3E5QA 1YFHA 3IKVA 1U5TC 2A68F 1FLIA 4GO1A 1FYMA 2UWMA 3I71A 5JR3A 1U8RA 2OQGA 5JFRA 3IWZA 3E6MA 1D5VA 5L3FA 3ZMVA 3F23A 4EJOA 4RB3C 4BHBA 2DO7A 4EJUA 3E6CC 1O3QA 4A2UA 1O3RA 3JSPA 3D5LA 1XSXA 2A6HF 2NAZA 2PBIA 4KN4X 1PUEE 1O7FA 2OAZA 2CQKA 3R4KA 3KP6A 4M74A 1PP7U 2D2WA 1QPMA 5ILSA 2F2EA 3SHFA 2RC4A 3VEPA 2EA2A 4Y17A 3SFZA 3ZMTA 5JI6A 1T6SA 5H6RA 2LNBA 2DTRA 5K5QA 5CYVA 1TQMA 2G9WA 2V1UA 3DFGA 2DLLA 4UVBA 3E97A 2KJCA 2DI3A 4HV5A 1XDUA 4ZZDA 3KLNA 3FMQA 3PQKA 2P6SA 3CUQC 1XCBA 4HQMA 3K1MA 4UVAA 2ACJA 3I53A 3GUDA 3WTXC 4P55A 4DNCA 3W6JB 2H6BA 3SZPA 3FWEA 4A6EA 4F7ZA 2UXXA 2K7LA 3FHZA 2RQPA 3T8RA 2K02A 2STTA 1O57A 1OYWA 3TOBA 4RAYA 1D8JA 5AIPA 1TBXA 4IXAA 4KMFA 4Y13A 3M9AA 1EH6A 5K5RA 2OU2A 4IRIA 2FNAA 4HF1A 3ISPA 1YG2A 4BHPA 3GZ6A 3JSOA 2Z9OA 5FGMA 4O5VA 4I2OA 1IRGA 1LNWA 1OR7A 5ICFA 1UCRA 3EYIA 2HYFA 3ML6A 1XMAA 4GYGA 1YIOA 4EQQA 3IKTA 5FLXK 3D0SA 4ON0A 4O6JA 5HDNA 4PDKA 2MBFA 5HS8A 2YPRA 2K4JA 4DQ2A 5ILVA 1MDMB 2EB7A 2GAUA 3B02A 5E1XA 2D45A 1ZLKA 5K1YA 1LDDA 1HSTA 1K78A 2AXLA 1RUOA 2E1NA 1GXQA 3HHHA 1HXDA 3BDDA 3NRVA 2ETHA 4JBAA 2CW0F 4ESFA 4YIFA 3K1PA 3VOEA 1YQAA 1STZA 2FQ3A 3S2WA 2NRAC 2JPCA 3RJPA 4ENNA 1G6NA 1EH8A 2IA2A 3ZPLA 2DK8A 4L9JA 1F1ZA 2FEZA 5DYMA 3KE2A 1RNLA 1XGSA 4HX8A 3CDHA 1W5SA 5E17F 3WTTC 4HQEA 1RI7A 4HZFA 4I98B 4PGHA 3R6SA 4CXFA 4KUMA 4NB5A 5ICCA 3KP5A 3ULQB 3V8KA 2IJLA 3KCCA 3IRRA 4G7OF 3F21A 1RUNA 2HDCA 2HS5A 2VONA 2CWEA 4S05A 3DP7A 4Z2YA 2B0LA 1T0FA 1W4MA 3F3XA 2Z3YA 3R0AA 4IHSA 5FO5A 1ZRCA 3E6BA 1R1UA 2XAHA 5E1WA 5LEJA 2O3FA 1K6OA 3HSFA 1S29A 4L9NA 3ELKA 3GO5A 2L4AA 1GXPA 1SD5A 1IN4A 4ZYHA 4YFNF 2QBYA 1Z9CA 3G3ZA 4OMZA 4HAMA 4IHTA 1HQCA 3TDZC 1QNTA 1YW8A 2W25A 4ZYDA 2MC3A 1SD7A 1WWXA 3ROUA 4IVNA 3K1NA 1LQ1A 3T0YA 1LB2A 4G8XA 2VBWA 1BIBA 3CJNA 3KP2A 1FYKA 5D4RA 2BE5F 1J7KA 2IPQX 4U88A 3J81Z 4E70A 2YX7A 4EV0A 1P4AA 5LRSA 2ZBKA 1J9IA 1XN7A 1LJ9A 1BC7C 1B59A 3PQJA 4G6QA 5CVJA 4LK0F 2A07F 1ZYRF 4WXDA 3O3KA 4RAZA 2BYVE 3BROA 2KIMA 4WK8F 1SMYF 3E3VA 3VODA 2FA5A 3DKWA 3LA2A 4IRGA 4G7ZF 2M30A 3LA7A 4AIHA 2VXZA 1FSHA 3V7RA 1TTYA 1W7PD 2P5KA 2TDXA 1WKMA 5ILUA 2L02A 5LBQA 1KQ8A 4KNYA 2P6TA 4XSXF 1F5TA 4LG0A 1TQIA 5E8GA 2HZTA 1IW7F 3ZN1A 2ZCWA 1WSUA 2XAQA 3MQ0A 1C0WA 1S7OA 5HLIA 4XSZF 2H6CA 2HQRA 3I0TA 3BY6A 1XGMA 2FE3A 3P7NA 4XBFA 2FOKA 2QYOA 1TW3A 1ZG5A 4XLPF 1HW5A 4UHTA 2MA3A 1R23A 3GFLA 4LGWA 3HUGA 2H94A 4YIIA 3ZP5A 4I0BA 3ABUA 2ESNA 3V8JA 5HVQC 3GYHX 1S3JA 5DEQA 2A61A 1KU9A 2JRTA 1GHCA 5BPIA 2P5LC 3L00A 3HIFA 2OA4A 4P9FA 1IN6A 2GQQA 5HDGA 1I27A 3HYIA 1X3UA 1KQ0A 5E18F 1F4KA 3L09A 2A69F 1FYLA 1YS7A 5HOOA 3LSTA 1JHHA 1FC3A 4M71A 4GXOA 5D5WB 2XUBA 2QQAA 2Z99A 3KETA 4UV9A 4RGUA 4Q4ZF 4HF2A 4JQFA 1DP7P 1QQIA 1D8KA 5AONA 3K9TA 2DBBA 3WTSC 5HDKA 4HW0A 1BI1A 3HSEA 5HLGA 2ISYA 4HOBA 1ZRFA 4U0WA 2CYYA 1OYYA 1DPRA 1FY7A 4PCQA 1Z7UA 2IRFG 5L3BA 5BPDA 1UHMA 1PDNC 4N9HA 2LKPA 3VB2A 3EYYA 4NQWA 5CVRA 2XRNA 4LLLA 2R3SA 3J81K 1B6AA 3GLXA 2GWRA 2XHKA 3CUQB 1ZARA 1SD4A 1R58A 5D6EA 4EJWA 2COMA 2V79A 4S04A 1TNSA 1FSEA 3L2CA 3OV8A 5DD8A 2PEXA 4L9TA 4BHCA 2GXGA 1T2KA 4KICA 2MD5A 4L5JA 2FBIA 2MLGA 3TO6A 4LD5A 1J0RA 4EMSA 3M7GA 2VT3A 2L3DA 3R0JA 4ENKA 2EFQA 5FLXZ 3WTUC 5LEKA 4ENJA 2DQLA 2EFOA 1T98A 1U2WA 4M72A 1LDKB 3QOPA 2QZ8A 2QLZA 4LG0B 1O7LA 3RPQA 5D6FA 3QU6A 2Y0MA 3GF2A 3V7CA 4KN7X 3F8MA 3HTUA 2RVCA 1SFXA 2O6GE 3L7WA 3F8BA 2ZNZA 3LQQA 2ADUA 3J80K 2QENA 4BQAA 2VOOA 3KLOA 2HTSA 4G9YA 2EWNA 1FP2A 4A12A 3ZMZA 2RV8A 5DCMB 5DUKA 2OQRA 5L3GA 2YU3A 1SFUA 1Z91A 3V8LA 3IWFA 3PFIA 1HKQA 4N9IA 3WU1B 2D1VA 4IJAA 4MQVA 4KA4A 1JGSA 1MJ9A 2W57A 2OBPA 2G7HA 1KYZA 1QO0D 3BP8A 1R22A 2FU4A 2XASA 2PJPA 4ESJA 3RIRA 4LB6B 4ESBA 3ZQ7A 3ERED 4A5NA 5D5UB 1L3LA 4A0ZA 4JK1X 3FMSA 2V1DA 3BPXA 2GA1A 3LAJA 4ZYGA 1G3TA 1P2FA 4MTEA 3RDIA 4WCGA 5L3CA 2K4BA 3HOTA 4L9VA 2P8TA 4PZJA 3U2RA 2C6YA 1MJAA 3B73A 3TO9A 1AWCA 4BXUA 1YTYA 4A0YA 1FP1D 1TQPA 1ONVA 2Q2EA 1Z6TA 2DPDA 1S6LA 5AIQA 3FZVA 4I09A 1VTNC 5BMZA 1G4DA 2WWYA 2QUFA 2F5EA 1UFMA 2PFBA 1CF7A 2HKXA 4GGGA 1IN8A 1K78B 3C1DA 2FBKA 2MLKA 4Q47A 2ZKZA 3HRTA 4U7DA 4ASNA 1YYVA 2JPBA 2HYGD 5LHHA 3I64A 3FXRA 3U9GA 3MWMA 3BJOA 1B4AA 2K86A 1WQ2A 1FBSA 1G3SA 3I5UA 2PN6A 1IUYA 2VC0A 5E1ZB 1OMIA 5A2QZ 2IA0A 2EFPA 4OINF 1MD0A 4EJVA 4CICA 3C18A 1UHWA 4OIQF 4FX4A 2H09A 1KGSA 3EDPA 1MDMA 3KEQA 2VC1A 5E20A 3LA3A 3MAJA 2L01A 3RKYA 2NS0A 1MGTA 4M9SA 1HW1A 1USTA 2R7DA 3F8FA 4MEXF 4OIRF 2PQ8A 5L3DA 5L3EA 1Z05A 4XRFA 2R7FA 1HKSA 1U3EM 4I0AA 3ECHA 3QU3A