1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
2XIGA 2ACJA 3TQNA 1WI9A 3P7NA 4UVAA 2QQBA 4MGRA 4I02A 2GWRA 3CUQB 5F6FA 4ENNA 4GYIA 3C7JA 2EV6A 3V8JA 3WODF 4UVBA 2XKOA 3WTYC 1YW9A 2L3DA 5L3FA 1G6NA 2ZMEB 4EV0A 2CW0F 2A07F 1FX7A 1LVAA 1O3RA 2DW4A 1JHFA 2QENA 3M8EA 3CTAA 3BPVA 4HDVA 5HDNA 4KUMA 1F4KA 2QVOA 2BGCA 1P4WA 1SFXA 2A61A 2EA2A 2LKPA 1LDKB 1FZPB 2OD5A 3KZYA 3RYPA 3B02A 2DO7A 2ZFWA 3EQLF 4R1HA 5A2QZ 1QNTA 4G6QA 3WTUC 1U6GA 2VT2A 4KT5C 4FHTA 1KQ8A 3DPTA 3FXQA 1B9NA 4N9HA 5F1RA 1IRGA 3TO9A 2CO5A 2K86A 5J8CA 2DLLA 1QBJA 3NEUA 1Z9CA 1XMKA 5HOOA 4JK1X 4O3MA 3F8CA 2L54A 4G9YA 4LFUA 4PCQA 3JAMZ 1R7JA 4B8XA 4BNCA 4BYYA 2MA3A 5AIPA 3GLXA 2EB7A 3SZPA 2VODA 1K78B 5IT9Z 1GHCA 2OQRA 2B0LA 3MCZA 1T38A 2OAZA 1T39A 4KICA 1S8NA 3IRRA 4CYDA 2HKXA 4O5VA 4M9SA 2M5WA 3R0AA 3J81Z 1FBQA 1E2XA 4WWCA 5ICGA 2IPQX 1W5SA 2Y75A 4HLYA 3WU0A 2DPUA 3MWMA 3DQVC 4EMSA 3ZN0A 1ZG5A 1ZGAA 3ZMVA 2NAZA 1OR7A 2D1HA 3R4KA 3I5UA 2O03A 2J5OA 1FP1D 1YS7A 2BV6A 3HOTA 2ZO4A 1U5TC 4G7ZF 2QBYA 2H09A 2NS0A 2GXGA 3WU1B 2NYXA 2P5VA 2GAUA 1R1TA 3MFKA 1Q1HA 3SZTA 5DCMB 2QM3A 1I27A 2P5LC 1F1ZA 3R60A 2FXAA 3GXOA 1OMIA 3LA7A 2OZUA 3BPXA 3REOA 3J7AO 4A0YA 1HKQA 2EFPA 2YU3A 2RQPA 1PUEE 3E5QA 3TDZC 2XAQA 3WTWC 1V3FA 5E20A 1MJ9A 3H3UA 1W7PA 2FRHA 1BIBA 3VEPA 3AAFA 2HDCA 2HYFA 4L0ZB 1RI7A 2XV4S 1ZRCA 3U9GA 1OKRA 5AONA 2MH9A 4NB5A 2LF7A 3BWGA 4FX0A 2W57A 1Z6TA 1B9MA 4HW0A 1G3SA 5EEGA 1XGNA 1BC7C 3GEZA 1K6OA 1H9TA 4RGUA 4ZYDA 2UXNA 3E97A 4ZYEA 5BPDA 5H6QA 2A5YB 3O3KA 4M9ZA 4UNOA 4CO8A 2VT3A 3RDIA 1R22A 2XAHA 4R8HA 3V8LA 4EM1A 1RNLA 1FY7A 3ZMDA 3F8FA 3CO6C 4I7HA 4FX4A 4OIOF 4CICA 3ZQ7A 3GVAA 1W4MA 1FYMA 2YPRA 2FNPA 3F22A 1CGPA 3MAJA 5FGMA 5TJJA 2E7XA 1P92A 2CGPA 4RGXA 2O8XA 2J5PA 3PFIA 2XVCA 1IUYA 3WE3A 3ECOA 3GZ5A 1UHWA 3F6OA 5HS8A 3I0TA 2A69F 3NQOA 2Z9OA 2KIFA 3WTZA 4LLNA 5FD6A 4L9VA 3T1BA 4MNUA 3BY6A 1R1VA 1ON1A 1FYKA 2E1NA 1JXSA 3GUDA 1SD7A 4RB1A 4EM2A 1PDNC 4XSZF 2V79A 1O3SA 4OMYA 3U1DA 2HZTA 4CGZA 2E7WA 1F9NA 3WTXC 3RPQA 1XB4A 4U0YA 5A2QK 4UVCA 3ISPA 1OPCA 3M7GA 1ZN2A 1J7KA 2M8EA 1XSDA 3W6JB 1Z1DA 1SD6A 5HVQC 3FHZA 1B6AA 2G7UA 5HS7A 3V7RA 5HLGA 5JFRA 1TNTA 2RV8A 1D8JA 1FP2A 1ZG1A 1B4AA 3EUHA 1J59A 1HW1A 3CDHA 1SMTA 1MZBA 4I98B 5ICCA 5LHIA 1U3EM 2HTJA 1XDUA 1G4DA 1S7AA 3JAMK 3FZVA 4HLXA 2FBIA 3COAC 1R5HA 2WTEA 4PGHA 5IT9K 4G7OF 5HDGA 4IJAA 3DKWA 2M45A 2LSOA 4YFKF 3C18A 4KFCA 3J81K 2DI3A 5FD5A 1IXSB 1UFMA 3EYIA 3KLOA 1XSXA 3W6KB 3QAHA 5HS9A 4RB0A 1XD7A 1LEBA 3M8FA 2G7HA 1CF7A 5J6XA 5FFZA 4M9XA 4U0WA 1FYLA 2H94A 1BC8C 2FOKA 5BS6A 2RDPA 1W7PD 3LSTA 3KP5A 4OOIA 4KYWA 4WXHA 5JR3A 4HDUA 2ZCWA 2D2WA 2O0YA 3HTUA 4LMYA 1GVJA 2JT1A 3E6BA 2YR2A 2JPBA 2ESHA 1TTYA 4M74A 2LF8A 1Z7UA 3D0SA 3WE2A 3L9FA 1XDSA 4AVPA 5E1ZB 2OBPA 3HRSA 1Z91A 4HX8A 5ILSA 5K1YA 4WK8F 3F21A 2QZ8A 1S6LA 4LGWA 4MTDA 1SFUA 2V6CA 2K27A 4P96A 4UV8A 1IN7A 3KE2A 2STTA 2Y48A 3TOAA 4EJTA 2DTRA 1XSVA 3CUOA 3L09A 5E8GA 4U7BA 1ZARA 4U88A 4HF0A 3HHGA 1QZZA 1XCBA 1IN4A 2HGCA 2PN6A 3F23A 4Y17A 2V1UA 1OYWA 4IHTA 3CJNA 3E6DA 2YX7A 4EQQA 3BJOA 4M71A 4RB2C 1MJAA 2IA1A 3HUGA 1YQAA 3TGNA 5JI6A 4A5MA 1HSTA 2DPDA 5DD4A 2HQNA 2W24A 2DBBA 3ZMSA 1P4AA 3P9KA 5F64A 2F2EA 2L01A 2O61A 3WTVC 4UV9A 4TV7A 4UXNA 3JSPA 4OIQF 2KKOA 2X4HA 4I0AA 2QQ9A 4G94A 2O6GE 4Q48A 1KYZA 3JTGA 1Z05A 4ENKA 1FLIA 2IP2A 1BBYA 4Q5SF 2EV0A 4P9FA 1YG2A 1TQIA 5FLXK 5KVRA 2PG4A 2IT0A 4CHUA 5LHHA 2ZJ2A 1U5TA 1B59A 2XGXA 1FBSA 1ZLKA 5LLQA 4BAYA 2DQLA 3JTHA 5DV5A 1BI0A 2ZBKA 2MC3A 3RPUA 3K1PA 1GXQA 5TRDA 2HTSA 4HV5A 5IT3A 1DP7P 4HQMA 1O3QA 1R00A 4XBFA 4IXAA 3BP8A 1UCRA 3LAJA 2EFNA 2JPCA 4LD5A 4HF1A 2D1VA 3KCCA 3R6SA 5E8IA 4HF2A 4HA8A 4L9NA 2P6SA 2KJBA 1ULYA 4ASNA 4EJOA 1TW3A 2GA1A 1BI3A 1OYYA 3PQKA 1I1SA 3H3ZA 3KLNA 2K02A 1U78A 2P4WA 2QQAA 3BZ6A 1GXPA 5CVIA 1D8KA 5E1XA 4KDPA 3OOPA 1EH6A 3I59A 2P6TA 1KGSA 3GFMA 3WG9A 4MTEA 1LQ1A 5DDGA 3TO7A 2C6YA 4YFNF 1MDMA 3SFZA 1RZ4A 2L02A 4U0VA 2OU2A 3LA2A 4LG0B 2JTVA 1XN7A 5L3CA 2ISYA 2FA5A 4YG2F 1G3YA 3RKYA 5H20A 2IA2A 4P9UA 3E5UA 4G7HF 5DUIA 1H0MA 3QPTA 2CWEA 2FBKA 2IW5A 1XGOA 2PEXA 3ABTA 4Q47A 1LDJA 5J8FA 1SD4A 3WGGA 1JHHA 4ESJA 3KZZA 5K5OA 3RKWA 2HYGD 2V9VA 4NHJA 2P7CB 3KP2A 2MH2A 3I58A 4KN4X 1SMYF 3O6BB 2M1BA 1LJ9A 1SD5A 2VBXA 2YX4A 1MKMA 3FXUA 1RUOA 4ESBA 2COMA 2K4BA 3ERED 2XKPA 2R7FA 1BJAA 3ZP5A 2GZWA 2FF4A 3F6VA 3T8TA 3VB2A 4RAYA 5E1WA 1DPUA 4ZYGA 1ZYRF 4HAMA 3KP6A 5CYVA 3GW2A 4KIFA 4L9TA 5JHUA 1R36A 3GWZA 3JSOA 2RGVA 1IZ1A 2CSOA 3K0LA 4MQVA 2ZXJA 2M30A 4PGGA 1DDNA 1ZLJA 4U7DA 4L9JA 5ICFA 2UXXA 1WQ2A 2BE5F 4L18B 3KFWX 3Q9SA 4OIRF 3IKTA 3ROUA 3R61A 5ED4A 2FE3A 2DU9A 2YSRA 5DYMA 4KIBA 1B1BA 4I01A 2QYOA 1VTNC 3P9IA 1V4RA 2PJPA 3KP7A 1K79A 3SQNA 5BQTA 3QPHA 1HXDA 1IXCA 3RI4A 1ZREA 4HX7A 4EGYA 1TLHB 5L3GA 4HV6A 3CUQA 3FX3A 3QU6A 3HRMA 4KA4A 1HKSA 1DPRA 5CVVA 3F72A 2VC1A 4AWXB 3GFIA 4ESFA 1IW7F 4YFXF 2ZMEA 2QBYB 3L2CA 1ZRDA 1IXRC 2LDUA 5LGNA 5E18F 2EWNA 5ERIA 1REPC 2FEZA 2RC4A 4M6XA 2HS5A 2OZ6A 4KNYA 5HLIA 4AD9A 2F5CA 3TKYA 4EGZA 1ON2A 2WWYA 3C1DA 1LEAA 1ODDA 4I2OA 3G3ZA 2EK5A 1MJBA 2PMUA 1HKTA 3LFKA 4BXUA 2VONA 2TDXA 1J2XA 1QQIA 3V4GA 2DQRA 2W25A 1W7PB 2X0LA 3N4MA 2BBYA 2LNBA 3EETA 4XLPF 2KIMA 1FSEA 3DEUA 3Q5FA 1TQPA 3BROA 4LLGF 5D6EA 1ONVA 3QOPA 3K1MA 2Q8KA 2CQKA 3BOQA 3V8KA 2BEOA 2CYYA 2ELHA 4GXOA 4MQ9F 1HW2A 2XASA 1FNNA 3EDPA 4ETSA 3NRVA 2DK8A 4DQ2A 3PQJA 2XAJA 3HSFA 5BOXA 2JRTA 4ZH4F 4LK1F 2K4JA 3CO7C 3ZMZA 3MQ0A 5H6RA 3LA3A 4WXDA 2DK5A 2FMYA 2DAOA 4RGRA 3VFZA 3RTRA 4M73A 2H6BA 4BHCA 3FMQA 3VOEA 3FF5A 5D5VB 2XUBA 4L0YB 1R23A 3DP7A 1KU2A 4RS8A 3WGIA 5KK1A 4IHSA 4OINF 2VC0A 1LB2A 1OYIA 1YIOA 1T2KA 4E70A 1I5ZA 2HKOA 1YFHA 4HYEA 3G73A 5DUKA 4S05A 2V1DA 3I64A 1J9IA 1JE8A 3U2RA 5ICEA 1J5YA 2NNYA 3KP3A 4LK0F 5D4SA 1BIAA 2QLZA 4HOBA 5LGTA 1WSUA 3K2ZA 2Q2EA 2FBHA 2HEOA 1O57A 5DCMA 4EVIA 2PLYA 2F5EA 4EJUA 4F7ZA 1FC3A 1SFEA 4L5IA 5CVJA 1A04A 5FFXA 1E17A 3QP5A 4EJWA 3WTTC 1HSJA 2IRFG 4M72A 4PZJA 3DPLC 4EM0B 4IPAA 4A2UA 4A0XA 2Y0MA 4KIGA 1KU3A 3DXJF 4M6YA 2F5DA 1YW7A 5FB2A 3TO6A 5LEKA 2QWWA 4L5JA 4AIJA 3SHFA 1ZGJA 3ELKA 4KMUX 1KQ9A 2A6EF 1QO0D 5CLSA 2FU4A 3DFGA 3M9AA 2MBFA 3B73A 3T5XA 1ZG3A 3FM3A 4I09A 1JGSA 4ENJA 4GO1A 1H9GA 3GFJA 5D8LB 2QUFA 3HSRA 5DD8A 5K5QA 1L0OC 3T8RA 4XRFA 1IRFA 2VN2A 1AOYA 3RKXA 1PP8F 3BDDA 3F8BA 4CZZA 4IRGA 2ZKZA 4XLNF 1P2FA 4HBLA 2PMHA 1J0RA 1KU7A 4Y15A 2FSWA 4A12A 1TBXA 1MGTA 2G9WA 1WRJA 1LDDA 1U2WA 4I0BA 5D4RA 1Z6RA 2R3SA 2KIUA 1S3JA 2A3SA 2FQ3A 1YW8A 1QZYA 1CF7B 2KJCA 1D5VA 2JSCA 1IN5A 4AIKA 4N0BA 4B09A 4HZFA 4JBAA 4GCVA 1R5GA 1EH8A 3RYRA 2L4AA 3GF2A 4Q4ZF 3FMRA 2DT5A 4KMFA 4LJZF 2ADUA 5DCFA 2HR3A 1KYWA 1O3TA 1FOKA 1WWXA 2HQRA 5CVUA 1BM9A 3GO5A 2PBIA 1XCVA 2MLKA 4MHGA 3IL2A 3R0JA 1P4XA 2VBZA 1K7AA 3E6MA 1G3TA 4OMZA 1FPQA 4LB6B 2W85A 2VXZA 4YIFA 4BH9A 3ULQB 3WGHA 4A6DA 3I4PA 1HQCA 4BHPA 4A5NA 2WC2A 1BI1A 2ZNZA 4P5OA 3F3XA 3IC7A 1UHMA 5LHGA 3KEOA 5L3DA 4CDGA 3HHHA 4AIHA 2CFXA 2IVMA 4GGGA 3V7SA 3DV8A 2GQQA 2H27A 5ILUA 4IRIA 3K9TA 4RAZA 1ZRFA 1HW5A 5D5UB 1USTA 3SXYA 2Z33A 3P9CA 3J80Z 1W5TA 2M87A 3MEXA 4DNCA 3T0YA 1RUNA 2IJLA 4GYGA 2P7VB 1YYVA 1IAWA 1DUXC 4HX4A 1G3WA 1X3UA 5FO5A 2EFOA 5HLHA 4UHTA 3KEQA 3ECHA 2JZYA 5BMZA 2UWMA 3GX4X 3Q9VA 1J75A 4IF4A 1HBXG 5LRRA 3E3VA 4JQFA 5D6FA 3IWZA 2RN7A 3WTSC 5L3BA 2GXBA 3D5LA 3BJ6A 1I6XA 3LQQA 4BQAA 2F5FA 2V1XA 2PFBA 3ZN1A 5E17F 2W84A 1YS6A 2K7LA 3L00A 2FNAA 2L4MA 2PQ8A 2R7DA 3S2WA 2UZKA 3MZYA 2ISZA 4RGSA 4O6JA 1P6RA 5HDKA 5LGUA 1U5TB 3QU3A 2ESNA 1S29A 5DEQA 3IRQA 2H6CA 4R79A 2ETHA 3ZMUA 2STWA 3OV8A 1WKMA 1IN6A 2EA4A 2GA2A 4A0ZA 4K2EA 1U8RA 1USSA 2A68F 1MD0A 2ZNYA 3BJAA 3KETA 1D3YA 4OU0A 4Z2YA 4G6DA 2AS5F 5JVTA 1EV7A 2DFIA 2NRAC 4IVNA 2MD5A 3HRTA 1XGMA 1YTYA 2HOEA 5FLXZ 3GFLA 1KU9A 1O7FA 5AIQA 5ILVA 1AWCA 2PI0A 2Z3YA 1YO5C 2XRNA 3TOBA 4YIIA 3I59B 1R58A 1FT9A 3ML6A 2AXLA 3KP4A 2Z99A 1R1UA 3DF8A 4ON0A 5LRSA 3K69A 1LNWA 1BI2A 3I54A 4WXCA 4EJVA 4PDKA 1MDMB 2XAGA 4ENMA 1T98A 4ZYHA 5LBQA 2OQGA 6PAXA 4UUVA 3IHUA 2MLGA 5D5WB 1TW2A 5BPIA 1F5TA 2O3FA 3IWFA 1QGPA 3HYIA 2XAFA 5D5XB 4Y13A 3GZ6A 3I53A 1KQ0A 5EEHA 4WF2A 3HIFA 3QP6A 3GYHX 1S7OA 1Y0UA 3N97A 2VOPA 1O7LA 1FSHA 4OIPF 3I71A 3JW4A 4WX9A 2GIVA 3E5XA 3HSEA 1C0WA 2EJRA 2BYVE 2RKHA 3LWFA 2P8TA 4QWQA 2EFWA 5CJ9A 5L3EA 4H0EA 4LB5A 1T6SA 1ZH5A 4G8XA 2HWVA 3FXRA 3HRUA 4D0PA 2XHKA 2VE9A 3MZHA 1L3LA 3L7WA 2VBYA 3QRFF 4N9IA 2WV0A 3FWEA 3K1NA 5CVRA 1EH7A 1RIOH 3LQRA 2VOOA 1ZHFA 3HTSB 1STZA 3M1EA 3FM5A 1SAXA 1K78A 1ZAOA 1XGSA 3CUQC 1XMAA 3RIRA 2EV5A 2Z5UA 1UB9A 2OA4A 5LEJA 1TNSA 2VE8A 3ZMTA 1IN8A 2P5KA 3VODA 2Q0OA 3HOSA 3TDUC 4P55A 4RB3C 2RVCA 1I1GA 2RNJA 4BHBA 4HQEA 2VBWA 4CXFA 4XSXF 3F8MA 4A6EA 1BOAA 2HFHA 3J80K 1IF1A 2CG4A 4MEXF 4QLCU 3EYYA 1FWZA 2EFQA 2KRFA 4S04A 3CLOA 3FMSA 4FT8A 4LLLA 3LAPA 5D8KB 4IRHA 4LG0A 3ZPLA 1PP7U 3ABUA 1NHAA 4NQWA 1BN5A 3E6CC 3O2PE 2D45A 1YLFA 1FBUA 4KN7X 4ZZLA 2A6HF 4ZZDA 5K5RA 2FMLA 3C3WA 1QPMA 4MEYF 2NNNA 2XROA 3F8NA 3H92A 1T0FA 3IKVA 3V7CA 3RJPA 2E1CA 4WCGA 1KA8A 2IA0A 1TQMA
chains in the Genus database with same CATH superfamily
3Q3SA 2YPNA 2AQFA 2XIGA 4C2MJ 2ACJA 1NK2P 5DTDA 3TQNA 1YE9A 1MBFA 3S3NA 4E7SA 1WI9A 3P7NA 2NVUB 4UUSB 1YRNA 4UVAA 2QQBA 4MGRA 4I02A 1XNRE 2GWRA 1V5FA 2RAEA 3EUAA 3CUQB 1IDZA 5JVGF 3CCYA 3DBRB 5F6FA 3DTKA 1LLMC 5GTIC 3S1NJ 2R76A 5E3OA 4ENNA 4I6ZA 4GYIA 2DB2A 2RREA 5KL4A 4A3GJ 2DOAA 1RPWA 3C7JA 1VQ9I 1TN9A 5K7HA 1OCCH 2EV6A 5M5WJ 3V8JA 2LVHA 1ZTRA 3WODF 3RMPA 4UVBA 4M3DA 3UK3C 1GV2A 2WADA 2XKOA 4KZSA 4IHVA 3WTYC 1YW9A 4IHXA 4B3AA 2L3DA 5L3FA 1G6NA 2EQRA 2ZMEB 3M8JA 4EV0A 1GV5A 1RKTA 2CW0F 2A07F 2EM2A 1FX7A 1LVAA 2XSJC 1O3RA 4DV6E 3B6CA 2DW4A 3OL4A 1JHFA 1AAYA 4FE4A 2PRTA 2QENA 3M8EA 3CTAA 3BPVA 2VQFE 4HDVA 5HDNA 4MLOA 3OYBA 4KUMA 1F4KA 2QVOA 3H9JA 2BGCA 3IH4A 1P4WA 2EZLA 3AG2H 2Q1ZB 2EMZA 1BOBA 1SFXA 1WVRA 2A61A 2EA2A 2LKPA 5J4YA 1LDKB 4U87A 1FZPB 2OD5A 1N32E 3KZYA 3RYPA 3B02A 3I56I 4IHYA 2DMTA 3J7Yp 2DO7A 2ZFWA 3EQLF 3PUBA 4R1HA 5A2QZ 1EF4A 2EN6A 1QNTA 2TCTA 2VASA 1U6GA 4G6QA 3WTUC 2LBFB 2R7VA 2LUQA 3FXOA 4BE0A 1OCZH 2YTNA 2VT2A 1QHHD 2HXOA 3GMEA 4KT5C 1HCRA 2IGKA 4FHTA 2NS8A 1Z67A 3HZJA 1KQ8A 1GQEA 1X2MA 3DPTA 3M3YJ 3FXQA 3I3LA 5GPAA 4E7KA 1B9NA 2X6YA 4N9HA 4F55A 5F1RA 1AKHA 1IRGA 3LL7A 1APLC 3K6GA 3TO9A 2CO5A 2K86A 4XKVA 5J8CA 1ZU1A 2EMLA 2DLLA 4LF5E 1I3QJ 5AE1A 5IWAE 4DZPA 1QBJA 3NEUA 2JA6J 1ZK8A 1Z9CA 1NTCA 4M9VC 1YJNI 1XMKA 5HOOA 2IEKA 4JK1X 4O3MA 5F0HA 3F8CA 3W6VA 2DCEA 4MO7A 1LFPA 2L54A 3MMYB 4IKFA 2M3AA 1VQOI 4G9YA 3VYRB 4LFUA 3IAM2 4F2JC 3BZKA 2EN4A 4BU2A 2OTJI 1MW7A 4PCQA 3JAMZ 4R2CA 1R7JA 4B8XA 2YTPA 4BNCA 4BYYA 2MA3A 1IV6A 1FOXA 5AIPA 2EOXA 1YYOA 2HHHE 3GLXA 2EB7A 1XX5A 3SZPA 3GTGJ 2NUGA 4HG2A 1I6HJ 2VODA 1SFKA 5DM7F 1K78B 2VQHA 5IT9Z 1GHCA 1IQOA 4HSRA 2OQRA 2B0LA 3MCZA 1T38A 2OAZA 1T39A 4KICA 2ENHA 3K10A 2CW7A 2DOEA 4BJTA 4J01A 4DR4E 1YIJI 3AG3H 1S8NA 4XR6A 3ADIA 1TF6A 3IRRA 4CYDA 2JRMA 2HKXA 1DP3A 2ELKA 2IGOA 4O5VA 4M9SA 2M5WA 3R0AA 5IYBJ 1FBQA 3J81Z 1E2XA 4WWCA 5ICGA 2EOMA 2MGQA 2IPQX 1W5SA 2Y75A 3CMEI 2JA5J 4HLYA 4FTHA 2EOZA 2JXPA 3WU0A 1P9QC 1QA6A 2DPUA 3J7AG 2EOSA 2HVQA 1E3HA 3SZGA 3MWMA 2Q8UA 2EOOA 3JAMC 3DQVC 4EMSA 3ZN0A 3S1RJ 1RRJA 1E3OC 3ZOBA 1ZG5A 1ZGAA 3ZMVA 3HB9A 2NAZA 2HPMA 1OR7A 5K7FA 5C3EJ 1YJWI 2EMHA 2D1HA 3R4KA 3I5UA 1WJPA 2O03A 5FKLA 2J5OA 3JRAA 2VJ4A 2MYSA 4XRSA 1FP1D 1YS7A 1YITI 2QSHX 4DV1E 4LIUA 1ENHA 4BBRJ 2BV6A 2WAEA 2KOUA 4NC6A 3HOTA 4B3ME 3G1LA 5B3SH 3J81C 2ZO4A 4LITA 2N8GA 2K5CA 1U5TC 4G7ZF 2DFEA 4UY8I 1FTTA 2QBYA 2H09A 2NS0A 1WH5A 2GXGA 3WU1B 2X1DA 2YTOA 2NYXA 3HL2A 2P5VA 2GAUA 3W2VA 2Q2EB 1R1TA 3VYTB 3MFKA 2M7AA 1Q1HA 3SZTA 5DCMB 2QM3A 4ZDLA 2HZDA 4E7IA 1I27A 1YZ9A 2P5LC 1F1ZA 3R60A 3ZCOA 1RR7A 4XONA 3IV5A 2FXAA 2YU5A 4ZTJA 4CYCA 3AFHA 2OUMA 3GXOA 1OMIA 2PMZA 2VKVA 3LA7A 1B72B 2KISA 1J5EE 5HLTA 2EM9A 4JYAE 3CJQB 2OZUA 3BPXA 2KRCA 3REOA 3J7AO 3EPJA 4A0YA 3CCQI 1YJ9I 2A6TA 4NDLA 3MN2A 3S1MJ 3ZRGA 1HKQA 1N25A 2OPTA 4CCOA 1X2NA 2EFPA 2YU3A 2RQPA 4XQFA 4A3FJ 2KONA 1SVOA 3HDDA 4J19A 1PUEE 2EZ6A 3BR6A 3E5QA 3KEYA 3TDZC 3HOXJ 2XAQA 4ZTFA 3WTWC 1YRNB 4GDFA 1V3FA 2ODRC 4B1RA 4R2PA 2AHQA 4DV7E 1WJAA 5E20A 1JGGA 3EPHA 1R4MB 1MJ9A 1LE8A 4F54A 1FKAE 2RS6A 3H3UA 2V88A 1W7PA 2FRHA 4JI6E 1BIBA 4DGWB 3S2DJ 3VEPA 3AAFA 2HDCA 2HYFA 1ETOA 4L0ZB 1RI7A 2XV4S 4HNVA 1ZRCA 1PJQA 2EOEA 4Q35B 3U9GA 1OKRA 2R7UA 5AONA 2MH9A 1QZEA 2HQ5A 4NB5A 2W82A 2LF7A 3BWGA 1BR2A 1X48A 2NXNB 4A3KJ 1QVTA 1QVUA 4FX0A 1YYKA 2W57A 1Z6TA 2V87A 3S93A 2E5LE 3EUKL 4C9YA 1B9MA 4HW0A 3OYDA 3BC8A 1G3SA 1FJGE 2EPXA 1ETKA 4XKBA 2EQ1A 2V9KA 2VI6A 3F6GA 5EEGA 1WGXA 4W1UA 1XGNA 1BC7C 4D5CA 5E3MA 3SFIA 2A05A 3OS0A 2CSHA 2JA8J 1WH7A 3Q0WA 4P1WA 1JUPA 3GEZA 1K6OA 4G12A 4GKJE 1H9TA 3QWLA 4RGUA 4ZYDA 3FK7A 4R8OA 4RAFA 2DFHA 3H36A 1STUA 3L2UA 2L7KA 2LRSA 5KAIC 2UXNA 1IJWC 1V5EA 3E97A 4A3MJ 1IBME 4ZYEA 4D5FA 2EPCA 5BPDA 4E7ZA 5GAEJ 5H6QA 2A5YB 3O3KA 4M9ZA 2LVSA 2B9SA 4UNOA 5F3WA 4RLFA 4CO8A 2VT3A 2HU9A 3OS2A 3ZQFA 1UELB 3EPLA 2EORA 4ZDPA 2L7ZA 3RDIA 3OOUA 3MVPA 1DGRM 1VQLI 2BB8A 1R22A 2XAHA 2NVXJ 4R8HA 5F27A 1YSAC 3V8LA 4EM1A 1ZELA 1RNLA 2JPAA 1FY7A 3ZMDA 2DGCA 1MBGA 2KRHA 3F8FA 1OCRH 2LMZA 2EZIA 4DR5E 3CO6C 2FV4B 4I7HA 4FX4A 4OIOF 4HPQA 4CICA 3ZQ7A 2EMBA 1G2FC 3GVAA 2E72A 4C3HJ 2LBSB 1W4MA 2XGCA 1X1BA 1FYMA 2YPRA 4CCMA 1FMVA 1EKZA 1GT0C 3K4KA 4F9BB 1VQ8I 2ZSHB 2FNPA 2NVTJ 4NXNE 3F22A 2KZGA 1CGPA 2AXTC 3IUOA 3MAJA 5FGMA 5TJJA 2E7XA 1P92A 1IC8A 2CGPA 2O7OA 4RGXA 2O8XA 2J5PA 4YY3E 3PFIA 2XVCA 1IUYA 3JRHA 3BIDA 3OL3A 3WE3A 3ECOA 1BBOA 3GZ5A 1UHWA 3F6OA 1WHQA 5HS8A 5AE3A 2FGGA 5EG0A 2KLOA 3I0TA 2A69F 3NQOA 2YU8A 1T56A 2KIFA 3ABMH 2Z9OA 4CCNA 3WTZA 4LLNA 5FD6A 4L9VA 3T1BA 4MNUA 4B48A 4XLEA 2IS2A 3CDLA 3K4JA 1UBDC 4XK4A 5FRNA 3BY6A 3C6MA 2WB1A 5EZGA 4XN3A 2RSIA 1R4NB 3GLLA 3VWBA 2X6WA 4PFOA 1FEXA 5EGOB 1R1VA 1ON1A 1FYKA 2L3JA 2E1NA 1MH3A 3GUDA 5DM6F 1SD7A 4RB1A 1JXSA 2ENAA 3JTZA 4XIDA 2NABA 4EM2A 2LJHA 2LD5A 1PDNC 2I5UA 4PJLA 4PJ0C 4DW6A 4XSZF 5EF6A 2V79A 3KYLA 4IEJA 1O3SA 4OMYA 3U1DA 1OCOH 2HZTA 3CCEI 3HKZN 5E3LA 4CGZA 4X66E 2TRTA 3BTLA 2E7WA 2ZJQF 1BJZA 3J7YJ 4B3RE 1F9NA 3WTXC 4XLHA 2F6CA 3RPQA 3PO2J 4N4RB 5CFFE 1XB4A 4U0YA 3K70D 3T1YE 5A2QK 3JRCA 4UVCA 3ISPA 1OPCA 3FXJA 3HTXA 3DWLE 3RCOA 3M7GA 1VFCA 3GBGA 1ZN2A 2M8EA 1J7KA 2K9MA 1X3WB 4BXXJ 4RM3A 1XSDA 3W6JB 1X19A 1Z1DA 1DQUA 4E6KG 1SD6A 2F4VE 3LSGA 5HVQC 3FHZA 1TT5B 1B6AA 2EN1A 2G7UA 2ECBA 2A5WA 4GKKE 3ZQLA 2F4MB 5HS7A 3G71I 3V7RA 2PJRB 1F2IG 4R2QA 5KHDA 5JFRA 1TNTA 5HLGA 2EM3A 4JI5E 2JMWA 2JOBA 4NNJA 2RV8A 3L2QA 1D8JA 1FP2A 1ZG1A 1E3PA 2QKMB 1Z7LA 1B4AA 5FKNA 2FD5A 3VSLA 3EUHA 2V6EA 1BB8A 1J59A 1HNZE 1HW1A 3CDHA 1XPXA 3ZR8X 1SMTA 1MZBA 4I98B 5LD2C 1MMDA 1SR9A 3HPGA 3UR3C 5H2FC 5ICCA 1RMDA 2EM7A 4P7DA 4BCAA 4MLVA 1A35A 1YUJA 5LHIA 1U3EM 3H3VK 2HTJA 2MDGA 3I4NJ 4BEHA 3PNTA 5ADZA 1XDUA 3K4MA 3G1MA 2M0MA 2V85A 1G4DA 1S7AA 1TWFJ 2MD0A 3JAMK 2X9DA 3FZVA 4HLXA 2FBIA 1FIAA 3ZQQA 1B8IA 4F9CB 1N75A 3A01B 4E7JA 3DJWA 3EPKA 3COAC 1R5HA 4PK4A 2WTEA 2LH9A 2WAQN 4PGHA 5GAHJ 3S17J 2HVSA 4BBSJ 2L6MA 1MMGA 2AO9A 4CUGA 2JJ7A 5IT9K 1N33E 4G7OF 3AL0C 2L33A 3HBLA 5HDGA 5IV8B 4IJAA 1UMQA 4N4OB 1K61A 3DKWA 3S1QJ 2JQ7A 4BACA 1Z0XA 2M45A 5A6BD 1MBJA 2LSOA 2CQ7A 2FX0A 4OAZA 4YFKF 3C18A 2IS1A 1JTXA 3FBNB 4YRVA 4KFCA 3J81K 2DI3A 4HRIA 3FXMA 5FD5A 5M3FJ 1IXSB 1A1HA 3PIOF 2I8DA 1UFMA 3A0HC 3EYIA 3KLOA 1LE8B 2X51A 4AVZA 1GZ6A 3DEEA 4Z6YA 2GOXB 5LMNE 1XSXA 4IO9F 2LO3A 3W6KB 3QAHA 1DGCA 5BNGA 5HS9A 2EL5A 2EZKA 1JUSA 4RB0A 5KL5A 3H1CA 2L9NA 4DOZA 2XGEA 1XD7A 1LEBA 1EA3A 2OTLI 3OSGA 2EN7A 3M8FA 3JU0A 2G7HA 3HXLA 1NG7A 1CF7A 5J6XA 1BW6A 3W2WA 1POGA 5FFZA 3FXKA 1KJKA 4M9XA 4U0WA 2GBYA 1FYLA 2EOQA 2H94A 1BC8C 4IX7A 1R6RA 2FOKA 3QYFA 3DPUA 4BDYA 5BS6A 4RBOA 1Y1WJ 3VPRA 2E2IJ 2RDPA 4XLCA 1VI0A 1W0TA 1W7PD 3LSTA 2ELYA 3KP5A 4OOIA 2VKDA 4KYWA 4WXHA 3TL4X 2EM0A 5JR3A 4HDUA 2VRDA 1NK3P 4N4NB 4X65E 2H1LA 2ZCWA 2JYAA 3S32A 2Z2SB 2IXSA 4F6NA 2D2WA 2RPCA 4DYCA 5IYCJ 2O0YA 2ZMEC 2R1FA 2ZXWH 3HTUA 4LMYA 2EPPA 1TWCJ 4UB8C 3OMLA 2K85A 1GVJA 9ANTA 2CRGA 4FE7A 2EPUA 4YELA 5AE2A 4B4CA 2XPUA 4ZDOA 2E1MB 2VE7C 3NAUA 4C3JJ 4IZZA 2JT1A 1YX3A 1G2HA 3I9V2 1FOYA 3E6BA 3VK6A 2YR2A 2JPBA 2DIXA 2JVGA 2ESHA 2ME0A 4DMIA 2L8TA 2LOOA 2QSFX 1TTYA 2LYCA 5M5XJ 4M74A 2LF8A 3OYCA 3OS1A 5J1RA 1Z7UA 4FK5C 2YRHA 2L92A 4JX6A 4QPQA 2QSGX 3D0SA 2UXCE 3WE2A 3L9FA 1XDSA 4AVPA 5E1ZB 1NH3A 2OBPA 3CDIA 3HRSA 3OYHA 1Z91A 1ZR2A 3DLAA 4HX8A 2HGHA 3BR3A 3OYMA 1ETWA 5ILSA 5K1YA 4Y4RA 2ZJPF 4WK8F 3F21A 2QZ8A 3ZOQB 3ZXSA 1S6LA 4LGWA 4MTDA 3GTMJ 1SFUA 3BQZA 4C2TA 3VYUB 4BDZA 2V6CA 2YTIA 2K27A 3BZCA 4GFBA 4P96A 4UV8A 2B63J 1IN7A 2VIXA 4XOPA 3KE2A 5EG0B 1DU0A 2STTA 2Y48A 1GUUA 5KL3A 3TOAA 4EJTA 3W2AA 2DTRA 2LK2A 1XSVA 3CUOA 2BW3B 3L09A 2DA5A 5E8GA 4U7BA 1ZARA 2EMAA 4U88A 1JT0A 3OYNA 2EMXA 4HF0A 3HHGA 3C2BA 4Y7NJ 3OIOA 4LF6E 1QZZA 3S3MA 4BC9A 1XCBA 1IN4A 2HGCA 2PN6A 2BXYA 3AG4H 1OJLA 4Y17A 3F23A 2W48A 2JA2A 4ZYAA 5KCMA 3N05A 4AC0A 1AA7A 3IH3A 2V1UA 3L2VA 4ANJA 1XTAA 1OYWA 4IHTA 3CJNA 3E6DA 2YX7A 2I10A 4EQQA 2LRDA 1BW5A 4X64E 2I9IA 2WV1A 3BJOA 4RDUA 4M71A 4RB2C 4HF2A 1YYWA 1MJAA 5IYDJ 1YHQI 3BT9A 3BG5A 2E2HJ 2IA1A 2ICWG 2JR1A 1UG2A 4DV2E 3HUGA 2ENCA 1YQAA 3CJRB 3TGNA 5JI6A 4A5MA 1HSTA 3F0CA 2DPDA 4E7LA 5DD4A 2HQNA 2K3PA 2ID3A 4HTGA 2G0EA 2E71A 2W24A 3RZOJ 1IDYA 2DBBA 2VJ5A 2P0WA 3ZMSA 1P4AA 3P9KA 5F64A 2F2EA 2L01A 2O61A 3WTVC 3AUZA 4UV9A 4KHPE 4TV7A 3QPLA 3LNQA 4IOCF 3LFUA 2DMUA 4UXNA 2EBIA 3JSPA 4OIQF 2EOFA 4GRIA 2KKOA 4R2EA 2X4HA 2M7BA 2JUGA 5DS9A 4IQJA 1AHDP 4I0AA 2M1SA 2QQ9A 1NG6A 4G94A 3HGYA 4Q48A 1KYZA 2O6GE 3JTGA 1Z05A 4ENKA 1QHGA 4A3BJ 1FLIA 2IP2A 1BBYA 3SEQA 2R7OA 4DV5E 5C4JJ 4Q5SF 2EV0A 2DTZA 4P9FA 2YWQA 1YG2A 3BCAA 1TQIA 5FLXK 4WFTA 5KVRA 1JTYA 2L2OA 3KPHA 2PG4A 2IT0A 4FISA 2X1EA 2R5ZA 2F4IA 4CHUA 5LHHA 2ZJ2A 2RQLA 3LOCA 1VQNI 2DA4A 2ZJRF 1U5TA 1B59A 2E35A 2XGXA 1FBSA 1ZLKA 5LLQA 4QPOA 4BAYA 3H9QA 2DQLA 3FXLA 3ESWB 4X1EA 3ZQHA 4XORA 1DU6A 5KNLA 3JTHA 1D1BA 5DV5A 3HG9A 1S9HA 1BI0A 2ZBKA 1VQ5I 1WJDA 2MC3A 3K1PA 3RPUA 1GXQA 5E3NA 5TRDA 2HTSA 4HV5A 4BJ6C 5IT3A 3FIWA 4QTRA 1DP7P 4HQMA 1O3QA 1D0XA 1T8IA 3LMLA 5AASA 5TISC 1R00A 2LJUA 3OIPA 4IS1C 5LL6R 4XBFA 2XB5A 2RNGA 4OAYA 4IXAA 3ZGKA 2CQXA 3BP8A 1UCRA 3LAJA 1AH5A 2EMIA 1PYVA 2ECCA 2EFNA 2JPCA 4LD5A 4HF1A 2D1VA 2EPFA 3KCCA 5F04A 3R6SA 5E8IA 4FASD 3BR1A 3ABLH 4HA8A 2EOJA 1K83J 3P1XA 2W7NA 1X3CA 4L9NA 2Y30A 3IWCA 2P6SA 2KJBA 1ULYA 4ASNA 4EJOA 3GTLJ 2H1KA 3VYXA 2KDZA 1TW3A 1A36A 4JX5A 2GA1A 5FKKA 3DLLF 1BI3A 1OYYA 1I94E 2MC4A 3PQKA 1I1SA 3H3ZA 1K4SA 3KLNA 2K02A 1U78A 2P4WA 4JI8E 4D7NA 3M4OJ 2QQAA 4AYBA 2Y2ZA 4NBQA 2LMDA 1PJRA 3BZ6A 3J7ZI 1GXPA 4BE2A 2X6XA 3NARA 4ZC3A 5CVIA 1D8KA 3S16J 5E1XA 1N34E 2CW8A 3MD2A 2EJ4A 4KDPA 3OOPA 1EH6A 1YI2I 3I59A 5BR8E 2LREA 2P6TA 2ME6A 1KGSA 2YU9J 3CC2I 2YTFA 4DR3E 3GFMA 4NXME 3BR5A 1ZAAC 4WYQB 3WG9A 3MKZA 4MTEA 1S5LC 1JI8A 1LQ1A 2D9HA 3K7AJ 4RH8A 5DDGA 2R92J 2NVYJ 1X1CA 2PMZN 5J40A 3TO7A 5K7ZA 3ERMA 4P78A 3KYCB 2C6YA 4YFNF 1MDMA 3SFZA 4E7HA 1MSEC 4F9AB 2E19A 4BY7J 2NA2A 3BTIA 1IMUA 4I8OA 4L8NA 3A0BC 1RZ4A 2HNHA 2L02A 1G8XA 4U0VA 2HOAA 2CS3A 2OU2A 1HOMA 3LA2A 2FTXB 1W1WE 1V5GA 1D0ZA 2LY9A 1MNMC 1VQPI 4DYQA 2VQEE 1KYQA 1U0JA 4E4HA 1OQYA 3LLHA 4CH7A 3CCMI 1YUIA 5A6BA 4LG0B 2JTVA 1XN7A 4NC8A 5L3CA 2ISYA 1PUFA 2UU9E 2FA5A 4YG2F 1H89C 4NQWB 4CSWA 2LY1A 1G3YA 1MSFC 4M3BA 1JK2A 4XKCA 1YOVB 2Z1DA 3ASOH 3RKYA 5H20A 2KP6A 1IQSA 5CKTA 2IA2A 4P9UA 2YTQA 5TGTA 4DKKA 3E5UA 4G7HF 4D9JA 2BHZA 2CUEA 5DUIA 2L3CA 1H0MA 3QPTA 4BUPA 2QA4I 4XRMA 2CWEA 2FBKA 2R7ZJ 1JK1A 2HJJA 2YSOA 2R5YA 4DUYE 1X6HA 3KWRA 3CF2A 4CCJA 2IW5A 1XGOA 2PEXA 4UUTA 2ZFUA 3ABTA 1LDJA 4Q47A 4FETA 3JCUC 5J8FA 1SD4A 4DYRA 1XS9A 5EZHA 1FMWA 3WGGA 2JOXA 1DGWY 1JHHA 4XRSG 4PUSA 4MIMA 3I4MJ 4ESJA 4BQNA 3CP8A 3KZZA 5IOYA 1RR8C 5K5OA 1WFXA 2COBA 3K4BA 4I76A 2DDBA 3KIOA 3RKWA 5EJCA 2HYGD 3HM5A 2V9VA 4NHJA 2EN2A 5LFAA 3G6EI 2P7CB 1ETVA 3KP2A 2MH2A 2ZM6E 2R4GA 3I58A 2BOLA 2MKDA 1WJ5A 1SMYF 4KN4X 2KHXA 3O6BB 2M1BA 4XOTA 1LJ9A 3D1NI 1Y1VJ 1XMQE 3H5AA 1SD5A 5IOZA 2GHFA 2J7JA 2IHR1 1W36C 2L7MP 2UUZA 2EMYA 4DIQA 1H88C 2VBXA 1ETXA 1Z3YA 2YX4A 3OSFA 2N3GA 3DEWA 1JKRC 1MKMA 2WAFA 3FXUA 1TL8A 1RUOA 4ESBA 2COMA 2HI3A 2K4BA 3D5SC 4M3GA 3ERED 1VF9A 2BY2A 2CU7A 3M99B 2DA7A 2XKPA 2R7FA 1BJAA 3ZP5A 2WY8Q 2XRLA 1T4NA 3H5NA 3DBHB 2GZWA 3O8GA 2FF4A 1YPNA 3F6VA 3T8TA 3VB2A 5EEAA 4RAYA 3NWSA 1ACIA 1A1KA 3PM1A 5E1WA 4F93B 1DPUA 4ZYGA 2LTPA 2UV1A 1OFCX 5JLXA 1ZYRF 2L9VA 3C4TA 4HAMA 3KP6A 5CYVA 2RS7A 1UHZA 3GW2A 1ZR9A 2VQGA 2DXIA 2YRMA 2E2JJ 4II3A 2M9AA 4KIFA 2LLKA 2X1CA 1BBGA 2UUBE 2WCC3 3A03A 5HODA 2EN8A 2DLKA 3LMMA 1PJTA 4L9TA 5JHUA 1R36A 2LKXA 2HVRA 3OYEA 1HLVA 3GWZA 3JSOA 1WJCA 1VZ0A 1IZ1A 2RGVA 4M3FA 3OYGA 2O9LA 2EMWA 2LKSA 2CSOA 3K0LA 4MQVA 4BC7A 2V26A 2R5ZB 1A6QA 2YS9A 2ZXJA 4CA0A 2WB1N 2M30A 3A4CA 4PGGA 3CMAI 1TWGJ 1ZLJA 1AKHB 1DDNA 1W5CC 4U7DA 3JRFA 3F6HA 2BY0A 2WZOA 4L9JA 5ICFA 2UXXA 2XGDA 3CMYA 3L2WA 3TP3A 4C3IJ 1NCSA 4NUBA 3IWDA 4BQOA 3K6QA 2M34A 3ABKH 3S8PA 5F1JA 1WQ2A 2BE5F 4L18B 3KFWX 3Q9SA 3PJRA 3IAS2 3HC7A 1GTKA 3U21A 3GTQJ 4BE1A 2EH3A 1EKEA 4JI2E 4OIRF 3FHNA 2VJIA 2KDOA 1A1FA 4F6MA 5CQEA 3IKTA 2KQRA 4M6VA 4NC7A 3ROUA 2EM6A 2M4GA 2LR8A 3B6AA 5J3LA 3R61A 3QYEA 5ED4A 1IRZA 2FE3A 2DU9A 4B3SE 1WJFA 3HQ1A 2YSRA 5DYMA 4KIBA 3RPUD 1B1BA 5A6AA 3QOEA 4I01A 2QYOA 3LSKA 3RQ4A 2R7TA 2OCEA 2Y0SA 1VTNC 3P9IA 1V4RA 2PJPA 2K9QA 3KP7A 2WY7Q 1K79A 2EIJH 3SQNA 4DZJA 1ZBQA 5BQTA 2EPLX 2XB0X 2EIMH 3QPHA 5KL7A 1HXDA 2V4JC 1IXCA 3RI4A 1ZREA 3LSIA 5CQGA 4HX7A 5EYRA 4EGYA 4UUSA 1P7IA 1FIPA 1X1AA 1TLHB 2KL4A 2K7IA 2DDAA 4RA2A 5L3GA 4CCLA 4HV6A 3CUQA 1N3GA 2M2EA 3H5RA 3RKQA 3QODA 3FX3A 4RLQA 2ODRD 1BR1A 3QU6A 2H8RA 1IUFA 1ETYA 4Y33A 3CCRI 3HRMA 4KA4A 3OY9A 1RKWA 1Y0NA 4BS9A 1ZR4A 5FRMA 1ZBTA 2JWTA 3GTJJ 1HKSA 5GP9A 2YTDA 1P7JA 2E5ZA 4V2FA 4X6AJ 2R93J 1DPRA 5TSEA 5CVVA 3OTOE 3F72A 2WBTA 4KWYA 2VC1A 1FTZA 3G4SI 3VYSB 4AWXB 3GFIA 4ESFA 1IW7F 4YFXF 2EPRA 3KX2A 2JWOA 2ZMEA 3BQYA 2QBYB 5M3MJ 3K2AA 2L9SA 5IP7J 3L2CA 1F43A 1TP4A 1ZRDA 2LTRA 3DTEA 2DMPA 3UNGC 4PJNA 1IXRC 2EE8A 2E1MC 1ORKA 1PUFB 3PO3J 3AV0A 1PDAA 2LDUA 5LGNA 1WPKA 1RESA 2LY2A 5E18F 4AUXA 2DYSH 1ITYA 2EWNA 5ERIA 1REPC 2R7QA 2FEZA 2RC4A 4CYCB 4M6XA 3EPZA 2HS5A 2OZ6A 4KNYA 2X6OA 5HLIA 4AD9A 3J7AY 2F5CA 4A3JJ 1Z3XA 3TKYA 2M0CA 4PJMA 2N8XA 4EGZA 5DNYA 3CJTB 1ON2A 2LV2A 4LTYA 4QSHA 2CJJA 2WWYA 5GAGJ 3C1DA 4HEIA 1MIJA 1LEAA 2LBFA 2GXAA 1A1IA 1ODDA 4I2OA 3G3ZA 4DR2E 1IRXA 2BZTA 3NWTA 1HF0A 4BBYA 2EK5A 1I50J 4B3XA 1MJBA 4YHHE 4LOCA 3JREA 2PMUA 3BR2A 1HKTA 2IS6A 3LFKA 4BXUA 4QIWN 2VONA 2TDXA 2VB6A 1J2XA 1QQIA 1T08B 2K9NA 2VL8A 3V4GA 4TUIA 2JP9A 1PJSA 2DQRA 2QKLB 2W25A 1W7PB 3RZDJ 3MHHC 4M30A 2X0LA 3N4MA 3OYAA 2BBYA 2LNBA 3EETA 4XLPF 3L1PA 3E0JB 2KIMA 1FSEA 3DEUA 4B43A 3U1KA 3Q5FA 1TQPA 2DMYA 3BROA 4LLGF 5D6EA 1NEIA 3HPSA 2IS4A 3H09A 1ONVA 3QOPA 3H9GA 3I55I 3K1MA 2Q8KA 2CQKA 3BOQA 2PX9A 2E60A 3V8KA 3TW7A 2BEOA 2CYYA 2ELHA 4GXOA 1X5WA 1X1PA 4MQ9F 1HW2A 2H36X 1P47A 4JYKA 2XASA 3TP0A 2EL4A 1FNNA 1MBKA 3EDPA 3CQZJ 4ETSA 1IGNA 3NRVA 1IO2A 2DK8A 4DQ2A 3PQJA 3Q0UA 2LUPB 1QU6A 2XAJA 3HSFA 5BOXA 3A1YA 3CF5F 5FLVA 1PKPA 2JRTA 4ZH4F 4LK1F 2K4JA 2KZVA 3CO7C 3ZMZA 3MQ0A 5H6RA 3LA3A 4WXDA 5IXMB 2DK5A 3G2BA 2FMYA 2HC5A 2DAOA 4DUZE 1G59A 1LKXA 4RGRA 2O5RA 5F08A 3E7LA 3RTRA 3VFZA 2ZXHA 4M73A 2GLOA 2H6BA 4BHCA 3FMQA 3VOEA 3FF5A 5D5VB 2XUBA 3H0GJ 4L0YB 2GPIA 1LFBA 1R23A 3DP7A 3PUFA 1KU2A 2LTSA 1SC7A 3SYTA 4RS8A 3WGIA 5KK1A 3BGHA 1A1GA 4IHSA 4OINF 2VC0A 3BG9A 5KL6A 1LB2A 4BY1J 2W1OA 5IP9J 1OYIA 2NUFA 4OWRB 1YIOA 1T2KA 4E70A 1B69A 2Y9ZA 2EMCA 1I5ZA 2HKOA 2WA0A 5GPCA 2LFBA 1YFHA 2V7FA 4HYEA 4HNTA 3G73A 1T4OA 2UXBE 2BY3A 4KT6A 3ADJA 5DUKA 4S05A 2V1DA 3I64A 4J8ZA 5GADJ 1J9IA 1JE8A 3U2RA 4LF7E 2E36A 4F91B 5ICEA 4HSTA 1LFUP 1J5YA 2R7RA 2NNYA 3DKXA 3KP3A 4LK0F 4DR7E 2CV2A 5FJ8J 5D4SA 4JI0E 2EPMX 1BIAA 2QLZA 2DOFA 3MKLA 4B44A 1HNWE 4XLAA 3GTPJ 2YTJA 4HOBA 5LGTA 2NOJB 5AC4A 3SEZA 1WSUA 3K2ZA 2KMUA 2Q2EA 5A69A 4XKWA 2FBHA 2HEOA 1O57A 2FOWA 1N77A 5DCMA 4H4KC 4JI1E 3WG7H 4EVIA 1BL0A 2PLYA 1D1CA 2F8BA 3HOWJ 2M4KA 2F5EA 2EM8A 3QPSA 4EJUA 5M5YJ 5LMUE 4F7ZA 4L5EA 1FC3A 1SFEA 4L5IA 2DJIA 1A04A 5CVJA 1HDDC 1UN6B 3S2HJ 2E34A 2LCEA 2L0KA 2ZB9A 1K6YA 5FROA 1K4TA 4B3TE 3LSRA 5FFXA 1E17A 3IWBA 3QP5A 4EJWA 5IY5H 3WTTC 1HSJA 2M8GX 2IRFG 3GZNB 3H35A 3HOYJ 3W3CA 4M72A 1I3AA 1U9NA 3BG6A 4PZJA 4A3LJ 4RHBB 1SVMA 3DPLC 2EZHA 1A6IA 2EPNA 2B3TB 4EM0B 1SFOJ 5HNHA 2HPIA 4IPAA 2EPAA 3HPZA 4A2UA 4CCKA 2VKEA 2BY1A 4A0XA 3WHCA 2Y0MA 3V42A 4KIGA 2CQQA 1GVDA 1MBEA 4ZJZA 4BGDA 4V2GA 1GDTA 1KU3A 3TW6A 4A3IJ 1SEUA 1Y56A 3PNYA 3DXJF 2MW8A 4M6YA 3S15J 2GM4A 3WHBA 3ZQIA 2F5DA 4J00A 1YW7A 2MFZA 1W0UA 2R7XA 5J4VA 5FB2A 3TO6A 5J1YA 3MZ8A 5LEKA 4FCYA 3RQIA 2QWWA 4L5JA 1Y39A 5HNFA 3AG1H 4AIJA 2DT6A 3SHFA 2A25A 1ZGJA 3ELKA 4KMUX 4DV0E 1KQ9A 2A6EF 1QO0D 5CLSA 2D5VA 4OOGC 2FU4A 4PSXA 3DFGA 3M9AA 2MBFA 3B73A 1X4PA 3T5XA 1MBHA 1ZG3A 3FM3A 4I09A 2LG4A 4PFPA 4RAGA 1JGSA 4ENJA 2GOMA 3TMOA 4GO1A 2ID6A 4BEHB 1H9GA 3GFJA 2R7SA 5D8LB 1MMNA 2AQEA 2CH0A 2QUFA 3HSRA 3LSJA 5DD8A 5K5QA 1L0OC 1XMXA 3T8RA 3F9KA 3OYKA 3DU6A 4XRFA 1B8IB 1IRFA 2VN2A 2LE2A 1AOYA 1UJ8A 3RKXA 4PJJA 4F92B 4XICA 1PP8F 3BDDA 2Y69H 3F8BA 4CZZA 4IRGA 2F4OB 2ZKZA 2DJNA 2FUG2 4XLNF 1VQKI 1Y8RB 2VPLA 4B47A 1QU3A 2XF7A 3JRIA 4AYBN 3OR2C 2M7QA 1P2FA 4HBLA 2PMHA 1J0RA 1KU7A 4Y15A 2DMIA 4M2ZA 3FKIJ 1X49A 2FSWA 1SAUA 4IL6C 4A12A 1T0FC 1TBXA 1MGTA 2G9WA 1WRJA 3CLQA 3JRGA 3D5RC 1LDDA 2CUZA 4EATA 1U2WA 3C2HA 5T6JA 4I0BA 5D4RA 1Z6RA 3PNVA 2K9SA 2KIUA 2R3SA 1T4LB 2ZC2A 1S3JA 3LSHA 4C2UA 1HA8A 2MSYA 2A3SA 4JOMA 4Y52J 3QG5C 2FQ3A 4LFAE 1OCTC 1YW8A 2ZSIB 1QZYA 1CF7B 2HOSA 5A2QC 4F3QA 4LFCE 2KJCA 1D5VA 2HDWA 1IN5A 2JSCA 2XDVA 4AIKA 2EOHA 4N0BA 4B09A 2B7TA 4JI4E 4HZFA 1XG1A 1V54H 1X3ZB 4JBAA 1FJLA 2DA3A 4BXFA 4GCVA 1R5GA 4Q28A 1EH8A 2DA6A 3RYRA 4A3EJ 1WHNA 2L4AA 2K40A 3GF2A 4Q4ZF 2WBSA 3JRBA 3FMRA 2F48A 3OYFA 2DT5A 5EGOA 4IJDA 4KMFA 3FDYA 4LJZF 2VUMJ 4PSWA 4WPYA 2ADUA 1N36E 2EOYA 2EWLA 2CTDA 5DCFA 2K9LA 2YZTA 1OLTA 2HR3A 3BTCA 3ZQCA 1KYWA 3GTOJ 2DMNA 4I99C 1O3TA 1FOKA 5B1AH 1WWXA 2HQRA 5CVUA 4DBRA 2EP3A 2KIQA 1BM9A 3GO5A 2PBIA 5B5EC 1XCVA 2MLKA 3ONQA 2JK3A 1MH4A 2L7FP 4MHGA 1ETQA 2CUJA 5GTHC 3IL2A 2DSYA 3R0JA 2M4IA 1P4XA 2VBZA 1K7AA 3E6MA 2Y31A 1G3TA 2H8WA 1S7EA 3ASNH 4A69C 4OMZA 1FPQA 1Y8QB 2VKHA 2ZXIA 3MHSC 2L5QA 4LU9A 4LB6B 2W85A 3QYBA 2W4SA 2VXZA 3AKZA 2EMGA 1EJ9A 2I13A 4YIFA 4BH9A 2RQQA 1X6EA 3ULQB 3WGHA 5IT9C 4A6DA 2BHYA 3I4PA 1N78A 3BF2A 2QQ8A 4IQ4A 3S3OA 1HQCA 5A6JA 4BHPA 4A5NA 2L2MA 2WC2A 3E1SA 2BBGA 1BI1A 2ZNZA 2PJRA 2DRPA 1LPQA 4P5OA 3CCVI 3F3XA 3IC7A 1T33A 3HOZJ 3CZ6A 3C2GA 1UHMA 1IBLE 5LHGA 2DA1A 3KEOA 5L3DA 2EQ0A 1FOWA 4CDGA 3HHHA 2CV0A 2CV1A 4AIHA 4A3DJ 2CFXA 2IVMA 4GGGA 3V7SA 5CPRB 2M9HA 3DV8A 2GQQA 2H27A 5ILUA 2HDDA 4IRIA 3K9TA 3A02A 4BKXA 2HQAA 3CESA 4RAZA 4W97A 2JSPA 2QCOA 1H8AC 4WSGA 1ZRFA 4WSPA 1HW5A 5D5UB 2K4VA 3GTKJ 3OMYA 4D7MA 1USTA 2XC7A 3A01A 3SXYA 2Z33A 1LUJB 3P9CA 3HPHA 1VQ6I 5IP6A 3J80Z 1W5TA 2M87A 3MEXA 4DNCA 4HEA2 1R49A 3T0YA 1RUNA 4LF8E 5F0FA 2LP0A 3L2RA 1A31A 3BR0A 5C4XJ 2IJLA 1A1LA 3K70C 4DR6E 4GYGA 2YTGA 2P7VB 2W00A 3EQ1A 1YYVA 1IAWA 1DUXC 3MSWA 3FKJA 3BLYA 2IGNA 4HX4A 4XM3A 1G3WA 1X3UA 3IP4B 5FO5A 4O43A 2EFOA 1WHUA 5HLHA 1WJEA 1RC9A 2L9RA 4KISA 4UHTA 3KEQA 3ECHA 2JY9A 2JZYA 3HOUJ 5BMZA 2UWMA 3HUGB 3GX4X 3Q9VA 1J75A 4IF4A 2OF7A 3QQAA 4RMNA 1HBXG 2EOIA 2EN3A 2OCCH 5LRRA 1UILA 5KL2A 1TF3A 1TZLA 2LT7A 2YSPA 3E3VA 1KZHA 4JQFA 5D6FA 1HR0E 3IWZA 1ZGWA 2RN7A 2JVAA 3J80C 3WTSC 2L2NA 5L3BA 2GXBA 3D5LA 4YEJA 2VQCA 1JKPC 1TC3C 1YX5A 3BJ6A 3HOVJ 1I6XA 3LQQA 3VDXA 3H0DA 3HJEA 1D1AA 2VPRA 4BQAA 4JI3E 3DKYA 1OISA 1OR7C 4XLFA 4S0HB 2F5FA 2V1XA 2YUSA 4ABZA 1JJ6C 2PFBA 3ZN1A 5J47A 5E17F 2W84A 1YS6A 3C6KA 1R9TJ 1VQ4I 2NOGA 2UUAE 2K7LA 3L00A 3CCJI 2FNAA 2L4MA 1XMOE 3IH2A 3HEFA 2PQ8A 2R7DA 2DYRH 3S2WA 5J1UA 1BA5A 2UZKA 4R2AA 3MZYA 2V8QB 4YIRX 2R7WA 4RGSA 3LSPA 2ISZA 2ADRA 4O6JA 1WJBA 1P6RA 4FQGA 5HDKA 2YTEA 5LGUA 3TBIA 2R0QC 1U5TB 3GCMA 2QGUA 3QU3A 1X58A 2ESNA 3BTJA 2KT0A 1S29A 1VQMI 3OIQA 3KZIC 5DEQA 3BG7A 2XSDC 3IRQA 2E1MA 2EPOA 4MLQA 1AU7A 2UUCE 2H6CA 4R79A 1CQTA 1UHSA 4DV4E 2Y0SN 4HNUA 2ETHA 3ZMUA 2STWA 2HYJA 3OV8A 1WKMA 2OC6A 1IN6A 2KHMA 1I39A 1Z77A 3PSIA 2EA4A 2B7VA 1JUMA 2GA2A 2GIZA 4A0ZA 3PFYA 4K2EA 1U8RA 1USSA 1X4OA 1MD0A 2A68F 2ZNYA 3SDBA 1DQ3A 3ADLA 3BG3A 3BJAA 2OV7A 3KETA 3KYDB 1D3YA 2DN0A 1TWAJ 2DT7B 1X1DA 4OU0A 4MFDA 4Z2YA 4G6DA 2AS5F 5JVTA 1D0YA 2VJJA 1EV7A 1Z1BA 4R03A 4NHRA 3HGGA 2DFIA 1V55H 2BVLA 2NRAC 4LF4E 3DU5A 4X8WA 5KAFC 2XF6A 5IPAA 4IVNA 2MD5A 2X85A 3JRDA 3HRTA 1HC8A 1XGMA 3THOB 3VYYA 1M1EB 2V9PA 4R2SA 4UB6C 1YTYA 2K3FA 2MKNA 1TWHJ 2HOEA 5JLWA 5FLXZ 3GFLA 1KU9A 1MMAA 1O7FA 5AIQA 5ILVA 1AWCA 3K4NA 4X9JA 4RM2A 2ELJA 3ADGA 4DBQA 2BW3A 2PI0A 4GEQB 2VF1A 3P5JA 2Z3YA 4II2A 1YO5C 2CPNA 1S72I 2XRNA 3TOBA 2BXZA 4YIIA 3I59B 1RETA 1R58A 4AU7A 4K0KE 1FT9A 3DBLB 2B7EA 3ML6A 4G6TB 5JHFA 1GLNA 2AXLA 3KP4A 3THNA 2Z16A 2DLQA 2V89A 2Z99A 1R1UA 3DF8A 4BQQA 4ON0A 2XAUA 3JR9A 5LRSA 3K69A 2N3HA 1LNWA 2EPKX 1XNQE 1BI2A 4JI7E 3I54A 3PL8A 4WXCA 4EJVA 3CCSI 4PDKA 2UXDE 1MDMB 2XAGA 2E1OA 1X47A 1J26A 3A2KA 5FLXC 4ENMA 1T98A 4IHWA 4A3CJ 4ZYHA 2O8KA 5E79C 4O4KA 5LBQA 2OQGA 1G2DC 1U8BA 4XNFA 6PAXA 4XMYA 4UUVA 4DV3E 3IHUA 2MLGA 5D5WB 1TW2A 1W36D 1SANA 5BPIA 4BMJA 1JKQC 4D1QA 3FK6A 1F5TA 2O3FA 3O8HA 3IWFA 1QGPA 4TUGA 3VSKA 4R2DA 3HYIA 2XAFA 5D5XB 4Y13A 4XL9A 1VQ7I 3GZ6A 3I53A 1KQ0A 2FJ1A 2LC2A 2EM5A 3TQMA 4M3EA 5EEHA 2X48A 2EMKA 2GLIA 1IG7A 4WF2A 5EDNA 2DA2A 3HIFA 4AIDA 3QP6A 3FISA 3CMMA 3HKZA 1JT6A 3GYHX 1S7OA 2EPZA 1Y0UA 3X2QH 2HOTA 1VNDA 4XN0A 3N97A 3TEDA 2VOPA 3PIPF 4LIVA 4O24A 1O7LA 1FSHA 1Y6IA 2BVMA 2CFOA 3I71A 3OYIA 2R5YB 3JW4A 4OIPF 4WX9A 2MDRA 1MNEA 2GIVA 3E5XA 3HSEA 2EIKH 1C0WA 2RSMA 2EJRA 2V1NA 2BYVE 4NZVA 2RKHA 2FQ4A 1ZKGA 3MKWB 5FKMA 2EM4A 1MNDA 3LWFA 2P8TA 4QWQA 2YRKA 3K4LA 2EFWA 4JX4A 2EINH 1QPIA 5CJ9A 5L3EA 5AC5A 4JV5E 4H0EA 1SVLA 3CC4I 2EL6A 2YT4A 4OX9E 4L5NC 4LB5A 1T6SA 1QRYA 4DJAA 1RQ0A 3SDGA 2RTXA 1ZH5A 2E5NA 4G8XA 2HWVA 3FXRA 3FIGA 1IV8A 3HRUA 2NVQJ 5F0CA 4D0PA 1MEYC 1XC5A 2XHKA 2VE9A 5FLMJ 2XF5A 3DTIA 3MZHA 4Y3OA 3L7WA 1L3LA 4LFBE 2VBYA 3QRFF 1J09A 2QEXI 4N9IA 2WV0A 5C44J 1F36A 4MFEA 3FWEA 4X62E 1ERDA 2CUFA 3K1NA 3PSFA 5CVRA 1BR4A 4LF9E 3SJMA 3ZQGA 1EH7A 1RIOH 2DMQA 3LQRA 2VOOA 1WI3A 1KONA 1ZHFA 3HTSB 2B9DA 1STZA 3CP2A 3M1EA 3FM5A 3DF6A 2EMFA 1X6FA 1SAXA 2WAQA 1K78A 1WZ2A 2JN6A 4M0VA 1ZAOA 5B66C 1XGSA 3CUQC 4EEFG 1XMAA 2P81A 2EILH 2EV5A 2Z5UA 3K4CA 3RIRA 2JVHA 3M1CA 1UB9A 2CMPA 3Q0VA 1IBKE 2OJED 1A5JA 2L2KB 4LG3A 2OA4A 3T1HE 5LEJA 3OYLA 2MABA 1HNXE 3CCUI 1TNSA 2IAIA 2VE8A 3VHTB 2DODA 3ZMTA 4BJ5C 4CZCA 1IN8A 4AM3A 2P5KA 3VODA 1OCPA 4O5GA 2Q0OA 3CCLI 4KJZA 4V19K 3HOSA 2ELZA 3TDUC 4A93J 2JA7J 3C4BA 4P55A 3M07A 4BL0B 4RB3C 5FKOA 2RVCA 2QF7A 2MC6A 1I1GA 2RNJA 3OWTA 1UG0A 3EUHC 4BHBA 4HQEA 1JKOC 2VBWA 1DI2A 4C30A 4F52A 4CXFA 4XSXF 3F8MA 1R5ID 4X0GA 3DCFA 2IGMA 2V83A 1Q1VA 1U9OA 2NS7A 4A6EA 1WCMJ 4IOAF 2EQ3A 1BOAA 3ECRA 2HFHA 3J80K 3G1OA 1R71A 1IF1A 1O0WA 2CG4A 3RSNA 4MEXF 3BBGA 4QLCU 3WU2C 1T95A 1LVKA 3EYYA 2HXIA 4KITB 2Y9YA 1D5YA 1FWZA 2EFQA 4DR1E 1E0EA 2KFDA 2KRFA 2XPVA 3CLOA 4S04A 4AQYE 3UKGA 2JUCA 3FMSA 3BCBA 4FT8A 4LLLA 2VQLA 3LAPA 1UZCA 2V86A 1PVEA 4ITVA 5D8KB 4IRHA 2IBDA 4LG0A 3ZPLA 3S14J 5B1BH 1PP7U 3ABUA 3AL0B 1NHAA 1ZQ3P 2VXDA 1MMSA 2NUEA 1Z21A 4NQWA 1BN5A 3FBIB 3O2PE 3E6CC 2D45A 1YLFA 1HDPA 2DFFA 1FBUA 1TT0A 1L4SA 4JP0A 4KN7X 3OR1C 2F5VA 4ZZLA 2CT1A 1RC7A 3CD6I 3LSMA 2A6HF 4ZZDA 2MG4A 1B72A 5K5RA 2FMLA 3C3WA 1QPMA 2CQNA 4MEYF 1UAAA 2NNNA 2XROA 3F8NA 3H92A 3CC7I 1T0FA 2MC5A 2KPMA 4GZNC 1O4XA 2WBUA 3IKVA 2XPWA 1A1JA 3OYJA 3V7CA 2WBMA 3RJPA 1JJ8C 4WCGA 2VLAA 2E1CA 5A6KA 1KA8A 2IA0A 3MKYB 1TQMA 1WXRA 4R2RA
chains in the Genus database with same CATH topology
2XIGA 2ACJA 3TQNA 1WI9A 3P7NA 4UVAA 2QQBA 4MGRA 4I02A 2GWRA 3CUQB 5F6FA 4ENNA 4GYIA 3C7JA 2EV6A 3V8JA 3WODF 4UVBA 2XKOA 3WTYC 1YW9A 2L3DA 5L3FA 1G6NA 2ZMEB 4EV0A 2CW0F 2A07F 1FX7A 1LVAA 1O3RA 2DW4A 1JHFA 2QENA 3M8EA 3CTAA 3BPVA 4HDVA 5HDNA 4KUMA 1F4KA 2QVOA 2BGCA 1P4WA 1SFXA 2A61A 2EA2A 2LKPA 1LDKB 1FZPB 2OD5A 3KZYA 3RYPA 3B02A 2DO7A 2ZFWA 3EQLF 4R1HA 5A2QZ 1QNTA 4G6QA 3WTUC 1U6GA 2VT2A 4KT5C 4FHTA 1KQ8A 3DPTA 3FXQA 1B9NA 4N9HA 5F1RA 1IRGA 3TO9A 2CO5A 2K86A 5J8CA 2DLLA 1QBJA 3NEUA 1Z9CA 1XMKA 5HOOA 4JK1X 4O3MA 3F8CA 2L54A 4G9YA 4LFUA 4PCQA 3JAMZ 1R7JA 4B8XA 4BNCA 4BYYA 2MA3A 5AIPA 3GLXA 2EB7A 3SZPA 2VODA 1K78B 5IT9Z 1GHCA 2OQRA 2B0LA 3MCZA 1T38A 2OAZA 1T39A 4KICA 1S8NA 3IRRA 4CYDA 2HKXA 4O5VA 4M9SA 2M5WA 3R0AA 3J81Z 1FBQA 1E2XA 4WWCA 5ICGA 2IPQX 1W5SA 2Y75A 4HLYA 3WU0A 2DPUA 3MWMA 3DQVC 4EMSA 3ZN0A 1ZG5A 1ZGAA 3ZMVA 2NAZA 1OR7A 2D1HA 3R4KA 3I5UA 2O03A 2J5OA 1FP1D 1YS7A 2BV6A 3HOTA 2ZO4A 1U5TC 4G7ZF 2QBYA 2H09A 2NS0A 2GXGA 3WU1B 2NYXA 2P5VA 2GAUA 1R1TA 3MFKA 1Q1HA 3SZTA 5DCMB 2QM3A 1I27A 2P5LC 1F1ZA 3R60A 2FXAA 3GXOA 1OMIA 3LA7A 2OZUA 3BPXA 3REOA 3J7AO 4A0YA 1HKQA 2EFPA 2YU3A 2RQPA 1PUEE 3E5QA 3TDZC 2XAQA 3WTWC 1V3FA 5E20A 1MJ9A 3H3UA 1W7PA 2FRHA 1BIBA 3VEPA 3AAFA 2HDCA 2HYFA 4L0ZB 1RI7A 2XV4S 1ZRCA 3U9GA 1OKRA 5AONA 2MH9A 4NB5A 2LF7A 3BWGA 4FX0A 2W57A 1Z6TA 1B9MA 4HW0A 1G3SA 5EEGA 1XGNA 1BC7C 3GEZA 1K6OA 1H9TA 4RGUA 4ZYDA 2UXNA 3E97A 4ZYEA 5BPDA 5H6QA 2A5YB 3O3KA 4M9ZA 4UNOA 4CO8A 2VT3A 3RDIA 1R22A 2XAHA 4R8HA 3V8LA 4EM1A 1RNLA 1FY7A 3ZMDA 3F8FA 3CO6C 4I7HA 4FX4A 4OIOF 4CICA 3ZQ7A 3GVAA 1W4MA 1FYMA 2YPRA 2FNPA 3F22A 1CGPA 3MAJA 5FGMA 5TJJA 2E7XA 1P92A 2CGPA 4RGXA 2O8XA 2J5PA 3PFIA 2XVCA 1IUYA 3WE3A 3ECOA 3GZ5A 1UHWA 3F6OA 5HS8A 3I0TA 2A69F 3NQOA 2Z9OA 2KIFA 3WTZA 4LLNA 5FD6A 4L9VA 3T1BA 4MNUA 3BY6A 1R1VA 1ON1A 1FYKA 2E1NA 1JXSA 3GUDA 1SD7A 4RB1A 4EM2A 1PDNC 4XSZF 2V79A 1O3SA 4OMYA 3U1DA 2HZTA 4CGZA 2E7WA 1F9NA 3WTXC 3RPQA 1XB4A 4U0YA 5A2QK 4UVCA 3ISPA 1OPCA 3M7GA 1ZN2A 1J7KA 2M8EA 1XSDA 3W6JB 1Z1DA 1SD6A 5HVQC 3FHZA 1B6AA 2G7UA 5HS7A 3V7RA 5HLGA 5JFRA 1TNTA 2RV8A 1D8JA 1FP2A 1ZG1A 1B4AA 3EUHA 1J59A 1HW1A 3CDHA 1SMTA 1MZBA 4I98B 5ICCA 5LHIA 1U3EM 2HTJA 1XDUA 1G4DA 1S7AA 3JAMK 3FZVA 4HLXA 2FBIA 3COAC 1R5HA 2WTEA 4PGHA 5IT9K 4G7OF 5HDGA 4IJAA 3DKWA 2M45A 2LSOA 4YFKF 3C18A 4KFCA 3J81K 2DI3A 5FD5A 1IXSB 1UFMA 3EYIA 3KLOA 1XSXA 3W6KB 3QAHA 5HS9A 4RB0A 1XD7A 1LEBA 3M8FA 2G7HA 1CF7A 5J6XA 5FFZA 4M9XA 4U0WA 1FYLA 2H94A 1BC8C 2FOKA 5BS6A 2RDPA 1W7PD 3LSTA 3KP5A 4OOIA 4KYWA 4WXHA 5JR3A 4HDUA 2ZCWA 2D2WA 2O0YA 3HTUA 4LMYA 1GVJA 2JT1A 3E6BA 2YR2A 2JPBA 2ESHA 1TTYA 4M74A 2LF8A 1Z7UA 3D0SA 3WE2A 3L9FA 1XDSA 4AVPA 5E1ZB 2OBPA 3HRSA 1Z91A 4HX8A 5ILSA 5K1YA 4WK8F 3F21A 2QZ8A 1S6LA 4LGWA 4MTDA 1SFUA 2V6CA 2K27A 4P96A 4UV8A 1IN7A 3KE2A 2STTA 2Y48A 3TOAA 4EJTA 2DTRA 1XSVA 3CUOA 3L09A 5E8GA 4U7BA 1ZARA 4U88A 4HF0A 3HHGA 1QZZA 1XCBA 1IN4A 2HGCA 2PN6A 3F23A 4Y17A 2V1UA 1OYWA 4IHTA 3CJNA 3E6DA 2YX7A 4EQQA 3BJOA 4M71A 4RB2C 1MJAA 2IA1A 3HUGA 1YQAA 3TGNA 5JI6A 4A5MA 1HSTA 2DPDA 5DD4A 2HQNA 2W24A 2DBBA 3ZMSA 1P4AA 3P9KA 5F64A 2F2EA 2L01A 2O61A 3WTVC 4UV9A 4TV7A 4UXNA 3JSPA 4OIQF 2KKOA 2X4HA 4I0AA 2QQ9A 4G94A 2O6GE 4Q48A 1KYZA 3JTGA 1Z05A 4ENKA 1FLIA 2IP2A 1BBYA 4Q5SF 2EV0A 4P9FA 1YG2A 1TQIA 5FLXK 5KVRA 2PG4A 2IT0A 4CHUA 5LHHA 2ZJ2A 1U5TA 1B59A 2XGXA 1FBSA 1ZLKA 5LLQA 4BAYA 2DQLA 3JTHA 5DV5A 1BI0A 2ZBKA 2MC3A 3RPUA 3K1PA 1GXQA 5TRDA 2HTSA 4HV5A 5IT3A 1DP7P 4HQMA 1O3QA 1R00A 4XBFA 4IXAA 3BP8A 1UCRA 3LAJA 2EFNA 2JPCA 4LD5A 4HF1A 2D1VA 3KCCA 3R6SA 5E8IA 4HF2A 4HA8A 4L9NA 2P6SA 2KJBA 1ULYA 4ASNA 4EJOA 1TW3A 2GA1A 1BI3A 1OYYA 3PQKA 1I1SA 3H3ZA 3KLNA 2K02A 1U78A 2P4WA 2QQAA 3BZ6A 1GXPA 5CVIA 1D8KA 5E1XA 4KDPA 3OOPA 1EH6A 3I59A 2P6TA 1KGSA 3GFMA 3WG9A 4MTEA 1LQ1A 5DDGA 3TO7A 2C6YA 4YFNF 1MDMA 3SFZA 1RZ4A 2L02A 4U0VA 2OU2A 3LA2A 4LG0B 2JTVA 1XN7A 5L3CA 2ISYA 2FA5A 4YG2F 1G3YA 3RKYA 5H20A 2IA2A 4P9UA 3E5UA 4G7HF 5DUIA 1H0MA 3QPTA 2CWEA 2FBKA 2IW5A 1XGOA 2PEXA 3ABTA 4Q47A 1LDJA 5J8FA 1SD4A 3WGGA 1JHHA 4ESJA 3KZZA 5K5OA 3RKWA 2HYGD 2V9VA 4NHJA 2P7CB 3KP2A 2MH2A 3I58A 4KN4X 1SMYF 3O6BB 2M1BA 1LJ9A 1SD5A 2VBXA 2YX4A 1MKMA 3FXUA 1RUOA 4ESBA 2COMA 2K4BA 3ERED 2XKPA 2R7FA 1BJAA 3ZP5A 2GZWA 2FF4A 3F6VA 3T8TA 3VB2A 4RAYA 5E1WA 1DPUA 4ZYGA 1ZYRF 4HAMA 3KP6A 5CYVA 3GW2A 4KIFA 4L9TA 5JHUA 1R36A 3GWZA 3JSOA 2RGVA 1IZ1A 2CSOA 3K0LA 4MQVA 2ZXJA 2M30A 4PGGA 1DDNA 1ZLJA 4U7DA 4L9JA 5ICFA 2UXXA 1WQ2A 2BE5F 4L18B 3KFWX 3Q9SA 4OIRF 3IKTA 3ROUA 3R61A 5ED4A 2FE3A 2DU9A 2YSRA 5DYMA 4KIBA 1B1BA 4I01A 2QYOA 1VTNC 3P9IA 1V4RA 2PJPA 3KP7A 1K79A 3SQNA 5BQTA 3QPHA 1HXDA 1IXCA 3RI4A 1ZREA 4HX7A 4EGYA 1TLHB 5L3GA 4HV6A 3CUQA 3FX3A 3QU6A 3HRMA 4KA4A 1HKSA 1DPRA 5CVVA 3F72A 2VC1A 4AWXB 3GFIA 4ESFA 1IW7F 4YFXF 2ZMEA 2QBYB 3L2CA 1ZRDA 1IXRC 2LDUA 5LGNA 5E18F 2EWNA 5ERIA 1REPC 2FEZA 2RC4A 4M6XA 2HS5A 2OZ6A 4KNYA 5HLIA 4AD9A 2F5CA 3TKYA 4EGZA 1ON2A 2WWYA 3C1DA 1LEAA 1ODDA 4I2OA 3G3ZA 2EK5A 1MJBA 2PMUA 1HKTA 3LFKA 4BXUA 2VONA 2TDXA 1J2XA 1QQIA 3V4GA 2DQRA 2W25A 1W7PB 2X0LA 3N4MA 2BBYA 2LNBA 3EETA 4XLPF 2KIMA 1FSEA 3DEUA 3Q5FA 1TQPA 3BROA 4LLGF 5D6EA 1ONVA 3QOPA 3K1MA 2Q8KA 2CQKA 3BOQA 3V8KA 2BEOA 2CYYA 2ELHA 4GXOA 4MQ9F 1HW2A 2XASA 1FNNA 3EDPA 4ETSA 3NRVA 2DK8A 4DQ2A 3PQJA 2XAJA 3HSFA 5BOXA 2JRTA 4ZH4F 4LK1F 2K4JA 3CO7C 3ZMZA 3MQ0A 5H6RA 3LA3A 4WXDA 2DK5A 2FMYA 2DAOA 4RGRA 3VFZA 3RTRA 4M73A 2H6BA 4BHCA 3FMQA 3VOEA 3FF5A 5D5VB 2XUBA 4L0YB 1R23A 3DP7A 1KU2A 4RS8A 3WGIA 5KK1A 4IHSA 4OINF 2VC0A 1LB2A 1OYIA 1YIOA 1T2KA 4E70A 1I5ZA 2HKOA 1YFHA 4HYEA 3G73A 5DUKA 4S05A 2V1DA 3I64A 1J9IA 1JE8A 3U2RA 5ICEA 1J5YA 2NNYA 3KP3A 4LK0F 5D4SA 1BIAA 2QLZA 4HOBA 5LGTA 1WSUA 3K2ZA 2Q2EA 2FBHA 2HEOA 1O57A 5DCMA 4EVIA 2PLYA 2F5EA 4EJUA 4F7ZA 1FC3A 1SFEA 4L5IA 5CVJA 1A04A 5FFXA 1E17A 3QP5A 4EJWA 3WTTC 1HSJA 2IRFG 4M72A 4PZJA 3DPLC 4EM0B 4IPAA 4A2UA 4A0XA 2Y0MA 4KIGA 1KU3A 3DXJF 4M6YA 2F5DA 1YW7A 5FB2A 3TO6A 5LEKA 2QWWA 4L5JA 4AIJA 3SHFA 1ZGJA 3ELKA 4KMUX 1KQ9A 2A6EF 1QO0D 5CLSA 2FU4A 3DFGA 3M9AA 2MBFA 3B73A 3T5XA 1ZG3A 3FM3A 4I09A 1JGSA 4ENJA 4GO1A 1H9GA 3GFJA 5D8LB 2QUFA 3HSRA 5DD8A 5K5QA 1L0OC 3T8RA 4XRFA 1IRFA 2VN2A 1AOYA 3RKXA 1PP8F 3BDDA 3F8BA 4CZZA 4IRGA 2ZKZA 4XLNF 1P2FA 4HBLA 2PMHA 1J0RA 1KU7A 4Y15A 2FSWA 4A12A 1TBXA 1MGTA 2G9WA 1WRJA 1LDDA 1U2WA 4I0BA 5D4RA 1Z6RA 2R3SA 2KIUA 1S3JA 2A3SA 2FQ3A 1YW8A 1QZYA 1CF7B 2KJCA 1D5VA 2JSCA 1IN5A 4AIKA 4N0BA 4B09A 4HZFA 4JBAA 4GCVA 1R5GA 1EH8A 3RYRA 2L4AA 3GF2A 4Q4ZF 3FMRA 2DT5A 4KMFA 4LJZF 2ADUA 5DCFA 2HR3A 1KYWA 1O3TA 1FOKA 1WWXA 2HQRA 5CVUA 1BM9A 3GO5A 2PBIA 1XCVA 2MLKA 4MHGA 3IL2A 3R0JA 1P4XA 2VBZA 1K7AA 3E6MA 1G3TA 4OMZA 1FPQA 4LB6B 2W85A 2VXZA 4YIFA 4BH9A 3ULQB 3WGHA 4A6DA 3I4PA 1HQCA 4BHPA 4A5NA 2WC2A 1BI1A 2ZNZA 4P5OA 3F3XA 3IC7A 1UHMA 5LHGA 3KEOA 5L3DA 4CDGA 3HHHA 4AIHA 2CFXA 2IVMA 4GGGA 3V7SA 3DV8A 2GQQA 2H27A 5ILUA 4IRIA 3K9TA 4RAZA 1ZRFA 1HW5A 5D5UB 1USTA 3SXYA 2Z33A 3P9CA 3J80Z 1W5TA 2M87A 3MEXA 4DNCA 3T0YA 1RUNA 2IJLA 4GYGA 2P7VB 1YYVA 1IAWA 1DUXC 4HX4A 1G3WA 1X3UA 5FO5A 2EFOA 5HLHA 4UHTA 3KEQA 3ECHA 2JZYA 5BMZA 2UWMA 3GX4X 3Q9VA 1J75A 4IF4A 1HBXG 5LRRA 3E3VA 4JQFA 5D6FA 3IWZA 2RN7A 3WTSC 5L3BA 2GXBA 3D5LA 3BJ6A 1I6XA 3LQQA 4BQAA 2F5FA 2V1XA 2PFBA 3ZN1A 5E17F 2W84A 1YS6A 2K7LA 3L00A 2FNAA 2L4MA 2PQ8A 2R7DA 3S2WA 2UZKA 3MZYA 2ISZA 4RGSA 4O6JA 1P6RA 5HDKA 5LGUA 1U5TB 3QU3A 2ESNA 1S29A 5DEQA 3IRQA 2H6CA 4R79A 2ETHA 3ZMUA 2STWA 3OV8A 1WKMA 1IN6A 2EA4A 2GA2A 4A0ZA 4K2EA 1U8RA 1USSA 2A68F 1MD0A 2ZNYA 3BJAA 3KETA 1D3YA 4OU0A 4Z2YA 4G6DA 2AS5F 5JVTA 1EV7A 2DFIA 2NRAC 4IVNA 2MD5A 3HRTA 1XGMA 1YTYA 2HOEA 5FLXZ 3GFLA 1KU9A 1O7FA 5AIQA 5ILVA 1AWCA 2PI0A 2Z3YA 1YO5C 2XRNA 3TOBA 4YIIA 3I59B 1R58A 1FT9A 3ML6A 2AXLA 3KP4A 2Z99A 1R1UA 3DF8A 4ON0A 5LRSA 3K69A 1LNWA 1BI2A 3I54A 4WXCA 4EJVA 4PDKA 1MDMB 2XAGA 4ENMA 1T98A 4ZYHA 5LBQA 2OQGA 6PAXA 4UUVA 3IHUA 2MLGA 5D5WB 1TW2A 5BPIA 1F5TA 2O3FA 3IWFA 1QGPA 3HYIA 2XAFA 5D5XB 4Y13A 3GZ6A 3I53A 1KQ0A 5EEHA 4WF2A 3HIFA 3QP6A 3GYHX 1S7OA 1Y0UA 3N97A 2VOPA 1O7LA 1FSHA 4OIPF 3I71A 3JW4A 4WX9A 2GIVA 3E5XA 3HSEA 1C0WA 2EJRA 2BYVE 2RKHA 3LWFA 2P8TA 4QWQA 2EFWA 5CJ9A 5L3EA 4H0EA 4LB5A 1T6SA 1ZH5A 4G8XA 2HWVA 3FXRA 3HRUA 4D0PA 2XHKA 2VE9A 3MZHA 1L3LA 3L7WA 2VBYA 3QRFF 4N9IA 2WV0A 3FWEA 3K1NA 5CVRA 1EH7A 1RIOH 3LQRA 2VOOA 1ZHFA 3HTSB 1STZA 3M1EA 3FM5A 1SAXA 1K78A 1ZAOA 1XGSA 3CUQC 1XMAA 3RIRA 2EV5A 2Z5UA 1UB9A 2OA4A 5LEJA 1TNSA 2VE8A 3ZMTA 1IN8A 2P5KA 3VODA 2Q0OA 3HOSA 3TDUC 4P55A 4RB3C 2RVCA 1I1GA 2RNJA 4BHBA 4HQEA 2VBWA 4CXFA 4XSXF 3F8MA 4A6EA 1BOAA 2HFHA 3J80K 1IF1A 2CG4A 4MEXF 4QLCU 3EYYA 1FWZA 2EFQA 2KRFA 4S04A 3CLOA 3FMSA