1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
1LNWA 2P7VB 3RKYA 4YFXF 2M87A 4MQVA 4BYYA 1ZRFA 2DFIA 5CVRA 4EM0B 4KICA 3WTYC 1S7OA 4IJAA 4IRGA 4I7HA 3WTSC 3ZPLA 3O3KA 3C18A 2FOKA 3B73A 2L01A 1XGNA 4JBAA 2BYVE 4D0PA 2J5PA 5HVQC 1EH7A 3C7JA 4LG0A 1KQ9A 5LEKA 4M71A 2PN6A 5JI6A 4RGRA 1JE8A 3BPVA 2M30A 4OMYA 2ESNA 3FMSA 1FYMA 1YO5C 2A6EF 4ZYDA 1W7PD 1FLIA 3WGHA 1R23A 1SD4A 2E7XA 4LB6B 1K78A 4O5VA 4MHGA 1TW3A 1J59A 4M9XA 2J5OA 4LMYA 3F3XA 1BOAA 3CLOA 1IN8A 3MQ0A 3IKVA 4P9FA 3WU1B 2GA2A 2OA4A 1YFHA 2DW4A 3DP7A 3I71A 1J7KA 4XBFA 1J9IA 2DPUA 4R1HA 1ZGAA 2YSRA 1W5SA 2V6CA 4RS8A 2H6CA 3S2WA 1U2WA 1FSHA 3ABUA 5KVRA 5F64A 1Z6RA 2LDUA 2XROA 3VODA 5D4RA 3HSFA 4LJZF 2CYYA 4ETSA 4LFUA 3U9GA 2JTVA 2JPBA 2V79A 4BHPA 2BV6A 1O7LA 4M9SA 1MDMA 1TQIA 3OV8A 3M8FA 4S05A 4KMFA 2A3SA 4H0EA 1YS7A 2H27A 3WODF 3DFGA 2P5KA 1R1UA 4UV8A 2ZBKA 3JAMZ 1ZREA 3GZ5A 4HBLA 1S8NA 2NNNA 4IRIA 1IZ1A 3R60A 3TKYA 1KA8A 3ZN0A 2RQPA 4P55A 4A6EA 2K86A 3GYHX 2XAFA 2PMHA 2G7UA 4OOIA 5HS9A 5DCMB 2XAQA 3GWZA 2P4WA 4LLNA 3D0SA 2RN7A 2JPCA 1BIAA 2VODA 3EQLF 3RPUA 5A2QK 3O6BB 3FXUA 2HTJA 1XMKA 3HHHA 5AIQA 1T39A 2FNAA 1XCBA 1B9NA 2M45A 1SFUA 2QUFA 3HIFA 1OYYA 4GGGA 2OAZA 3EYIA 2LF7A 2RC4A 1K7AA 4G7OF 4M74A 3P9IA 5CYVA 2QQAA 1HKQA 3BROA 4AWXB 1W7PB 1T98A 4XSZF 1BIBA 1RUNA 4E70A 4I98B 4ZYHA 4S04A 1U5TB 1D5VA 1D8KA 1K6OA 1R1VA 5ICEA 3KCCA 3IKTA 3EETA 4ESBA 2A07F 3LQQA 3W6JB 5HOOA 1ZG1A 4A12A 1ONVA 2VBWA 1J0RA 2MLKA 1GHCA 4Y15A 3GEZA 1YS6A 5D5XB 1FYKA 3ZMUA 3DKWA 3L2CA 3Q9VA 3V7CA 2XASA 4A0ZA 4XLPF 2F5CA 1KGSA 3M8EA 4QWQA 2YU3A 4MQ9F 3KP4A 3QPHA 2L02A 5L3DA 2XGXA 1G6NA 1KU7A 2GIVA 3ROUA 1O7FA 2F2EA 4HOBA 1ZG3A 4PGHA 4XSXF 4B09A 2LF8A 2W24A 3E6MA 5ILVA 4PDKA 1F5TA 2EFNA 4UVAA 3QU3A 5F6FA 5J6XA 3RKXA 1T0FA 3K1MA 2GQQA 2QM3A 2VXZA 2TDXA 4EGYA 1P4WA 3HRMA 1OR7A 4A2UA 1MJAA 4IHSA 3HHGA 3ZP5A 4WWCA 1YG2A 5BS6A 4U7DA 3CUQC 4JK1X 4RB0A 5J8CA 5DCMA 3TGNA 2MA3A 1IW7F 2F5EA 1WQ2A 2FBIA 4HAMA 1B59A 3PQKA 3R6SA 4HLXA 3ECOA 3WTUC 2G7HA 4A6DA 5FLXZ 3HRSA 5FB2A 2FMYA 4EGZA 1WRJA 3BPXA 2IA0A 2HOEA 2IPQX 4HQMA 3HOSA 4DQ2A 4CDGA 2PI0A 4IF4A 4RAZA 3I59B 5JVTA 2HKXA 2FEZA 1G3YA 3V8JA 1SD6A 5FFXA 3TO9A 1JGSA 1W7PA 5D6FA 4WXHA 5JFRA 2LSOA 4L9TA 2EFOA 5D8LB 3W6KB 1U5TA 5D6EA 3V7RA 1IN6A 1ZG5A 2VT2A 3HTUA 4GCVA 2EK5A 3QRFF 3EUHA 4U7BA 4BQAA 3D5LA 4IVNA 4IRHA 3LA7A 5K5RA 1ZARA 3WGIA 3IHUA 3CJNA 3DV8A 1R22A 1UB9A 3FMRA 3P7NA 5L3CA 2MH9A 1Q1HA 1VTNC 5A2QZ 1FC3A 2HDCA 5DEQA 3BWGA 3V7SA 2A69F 4BAYA 3ABTA 5E18F 3RTRA 3PQJA 1T6SA 1TNTA 3I4PA 3MZYA 1RIOH 5TJJA 5HS7A 3KE2A 4B8XA 5E8GA 5K5QA 2K7LA 5FO5A 2RKHA 1XSVA 2KIMA 1U6GA 4XRFA 2EA4A 1ZRCA 2O03A 5BPIA 3TDUC 4UVCA 4HX4A 3EDPA 2IJLA 2CG4A 3DPTA 4KIGA 2MC3A 1FY7A 4FX0A 2Q0OA 3SFZA 3LWFA 3F21A 4R8HA 2HS5A 4WXDA 5LRRA 3KP3A 3E5QA 3L9FA 3TQNA 1YLFA 4HW0A 4U0YA 1BBYA 3RIRA 3WGGA 1XSXA 2RVCA 3FMQA 4OIQF 4RAYA 1G3TA 2UZKA 1B6AA 4HV6A 1BM9A 5HLHA 1TQPA 3KZYA 3BJ6A 2O6GE 2P6TA 1DPUA 4CHUA 2B0LA 1XGSA 2QWWA 3QP5A 4G94A 3J81K 3RDIA 3JSOA 4K2EA 1T2KA 3I59A 5HLGA 3IWFA 3RYRA 4LK0F 1BI1A 4ON0A 2VONA 1KU9A 2DU9A 3I5UA 1LEBA 4DNCA 1P6RA 2HQNA 5K1YA 4M73A 5BQTA 4RGXA 2KRFA 3H3UA 4BXUA 1STZA 4A5MA 3WTTC 2PG4A 1KQ8A 4EMSA 5JHUA 2WV0A 1Z7UA 1I1SA 5AONA 1XB4A 3E97A 1R1TA 2O0YA 3FWEA 1QO0D 1A04A 1HKSA 1O3SA 5IT9K 4HLYA 1HQCA 2VBZA 2Y0MA 2PBIA 2D2WA 1H0MA 3MWMA 1CF7B 5EEGA 5LHIA 1XCVA 3L09A 3ZQ7A 1HW5A 1DP7P 1ZRDA 2R3SA 4LK1F 4AIKA 2HQRA 4ENJA 3O2PE 2W57A 5AIPA 2A61A 3DQVC 2OZ6A 1U8RA 3C3WA 4BHCA 1QNTA 5ILSA 5CLSA 3F23A 3QAHA 4RB3C 2JT1A 2PLYA 3I64A 3FM3A 1I6XA 3TOAA 2JSCA 3VFZA 4EJTA 2HZTA 5CVUA 2YPRA 2QBYB 4LLGF 3PFIA 2DO7A 2O61A 2FMLA 1DPRA 1ODDA 2V1DA 1GXPA 3T1BA 2HYFA 1RNLA 2X0LA 3F8NA 2P8TA 4L18B 1XDUA 3C1DA 1MJBA 2ETHA 3RPQA 3I53A 2AS5F 3JSPA 1FBUA 2EFWA 3TDZC 2L4AA 2NYXA 1FT9A 2Y48A 2H94A 1YQAA 2EWNA 1C0WA 4HF1A 3K0LA 2L4MA 5DUIA 4O3MA 3E3VA 3MAJA 2BGCA 2W84A 1B4AA 2MH2A 1IN7A 2LNBA 2CWEA 1L0OC 3ISPA 5ED4A 2R7FA 2ACJA 1IUYA 2PFBA 1USSA 2DK8A 2JZYA 1QZYA 1OPCA 3KLOA 4Q4ZF 1BI2A 3QU6A 2F5DA 1HKTA 4FX4A 5LHHA 2ZNZA 2FBKA 1LEAA 1CGPA 5L3GA 3QPTA 4L9VA 1AWCA 2LKPA 4JQFA 1EV7A 1FOKA 1R00A 2CQKA 3LFKA 2K4JA 4CO8A 4L9JA 3IRQA 3FF5A 1BC7C 4OINF 3EYYA 1CF7A 4FT8A 2A5YB 3G73A 2RV8A 2EFQA 3F22A 5ILUA 2GXGA 3KLNA 4EJOA 2CW0F 3HOTA 1J75A 5E20A 3ZMVA 5JR3A 2V9VA 3J81Z 5ERIA 2IVMA 2STWA 3RJPA 3SZTA 2NNYA 1XN7A 2KKOA 1EH8A 1KYZA 4Y17A 1F9NA 3T8TA 5D5WB 5DDGA 4EM1A 1YIOA 5LLQA 2ZKZA 3BDDA 3H3ZA 3IWZA 2BE5F 1E2XA 4I0AA 4G9YA 1R7JA 2ZMEB 2YR2A 2QBYA 2H6BA 1RUOA 1ZGJA 2OZUA 4G7ZF 2Z5UA 4A0XA 2QZ8A 4UXNA 3V4GA 5IT9Z 2ZJ2A 1WWXA 4BH9A 4A0YA 2E1CA 3B02A 4HX8A 1YW8A 2ADUA 2DTRA 1R5HA 4L0YB 1TNSA 3F6OA 4GXOA 2VBYA 4CXFA 2MD5A 3U1DA 5L3FA 5E8IA 5KK1A 1F1ZA 1R58A 4AVPA 3GFIA 4YFNF 2PEXA 1LDJA 2FQ3A 1W4MA 4Y13A 3TO6A 3K1PA 2HTSA 1Z6TA 1BN5A 1S3JA 2O3FA 2WTEA 2A68F 4UNOA 2WWYA 3L00A 4CZZA 3HUGA 4NB5A 3ULQB 2IP2A 3F72A 2IT0A 1PP8F 4I2OA 3WTXC 2P5VA 3IRRA 2X4HA 4ZZLA 1WI9A 5CVJA 3ZMSA 2EV0A 4FHTA 1RI7A 1WSUA 1V3FA 4ENNA 3E5UA 1X3UA 4EJWA 1FSEA 1IXSB 2M1BA 4EV0A 2F5FA 4G6DA 4XLNF 1BI0A 2Z3YA 4KMUX 3VB2A 1Z91A 4ZYEA 2ZNYA 1BJAA 2Y75A 2CSOA 4KDPA 3J7AO 2QLZA 2L3DA 3T0YA 5ICCA 2D1HA 6PAXA 3KP2A 4LLLA 3L7WA 4BHBA 3LAPA 3K2ZA 3U2RA 4HQEA 1I27A 1XSDA 3DXJF 2E1NA 5LEJA 3GFMA 3WG9A 1E17A 1ULYA 3DEUA 2ZMEA 1QPMA 2QQBA 3FX3A 1LDDA 2JRTA 2FNPA 4KA4A 2ZO4A 1GVJA 4IXAA 5ICGA 3P9KA 1FWZA 4OIRF 5BPDA 3NQOA 2GA1A 4KNYA 2HYGD 3SHFA 2XUBA 3GZ6A 4ENKA 4I01A 2STTA 3HYIA 4WF2A 1I5ZA 1ZHFA 4RB2C 3JAMK 3ELKA 2K4BA 4KIFA 1REPC 4CYDA 1FZPB 2IW5A 3JTGA 2NS0A 1R5GA 4EQQA 2FSWA 2KIUA 4RB1A 3RYPA 2L54A 5D5UB 1FYLA 1ZLKA 2XIGA 3P9CA 5IT3A 5FGMA 2OU2A 1MD0A 1F4KA 5L3BA 2IA1A 3F8CA 5DYMA 4P5OA 1D3YA 3FXQA 2PMUA 4ZH4F 1SAXA 1IRGA 2EFPA 4N0BA 1LVAA 4G6QA 3G3ZA 4YFKF 2A6HF 5ICFA 2P5LC 1V4RA 4HDUA 3N97A 2IRFG 2VN2A 3QOPA 5H6RA 3M9AA 3CUOA 5DD8A 1RZ4A 1S29A 1SFEA 4HF0A 4RGUA 1KU2A 3R4KA 1H9GA 3LAJA 3MFKA 2XAJA 2Z33A 1SMTA 4RGSA 5LGNA 4MEXF 4I02A 1IAWA 4WXCA 1XGMA 2KJBA 2VE8A 1DDNA 2XKPA 3BZ6A 1YTYA 4EVIA 4I0BA 3E6DA 3GF2A 2OQGA 5E1ZB 4KUMA 3CUQB 2E7WA 3JTHA 1ON2A 2UWMA 4HV5A 1JHFA 1U5TC 3WE2A 2C6YA 4ASNA 4IPAA 1FX7A 4MTEA 2G9WA 2XKOA 1L3LA 4M9ZA 3HRTA 4L0ZB 4P9UA 3KFWX 3IL2A 1XMAA 1HW1A 3CDHA 4LD5A 4KFCA 1USTA 2COMA 3LQRA 4U0VA 2FU4A 2XVCA 1P4AA 1TBXA 3WTZA 5HDGA 3NRVA 3I0TA 1XDSA 2QENA 1AOYA 1Z05A 2OBPA 1KYWA 1DUXC 5HS8A 1IXRC 2ZXJA 5DUKA 1G3WA 2RGVA 3KZZA 2VC0A 1OYIA 1WKMA 4HZFA 3WE3A 2XRNA 4A5NA 2XAGA 1LB2A 1IN5A 2DAOA 2UXNA 3CO6C 2PJPA 1LQ1A 2D45A 3F8MA 4M72A 2Z99A 5CVVA 5LBQA 3ZMZA 3DPLC 2V1XA 1ZH5A 3N4MA 4EJVA 2BEOA 1HBXG 1IN4A 2VT3A 1O3QA 4OIOF 1PDNC 2DPDA 2PQ8A 4UHTA 1I1GA 3ECHA 5L3EA 1HSJA 2GXBA 4OU0A 1FPQA 5FLXK 1HW2A 3SXYA 3TO7A 4ESFA 2QYOA 4YG2F 2P7CB 3I54A 4P96A 4HF2A 2M5WA 1JXSA 3LA3A 4OIPF 4YIFA 2NAZA 3MZHA 1UHWA 1FBSA 3E6BA 1FP2A 1LDKB 1IRFA 4ESJA 5DD4A 4BNCA 1ZAOA 1BI3A 3LA2A 4GYIA 2MLGA 5DV5A 4KT5C 5E1WA 4CGZA 3COAC 2DI3A 2BBYA 1EH6A 1O57A 1YYVA 2VC1A 3CUQA 2HKOA 1U3EM 3RI4A 3QP6A 1MJ9A 1ZLJA 2KIFA 5H6QA 3Q9SA 4MTDA 3T8RA 1QGPA 4NHJA 4UVBA 3M7GA 3FM5A 2HEOA 3KEQA 2NRAC 1KQ0A 1R36A 3FXRA 3F6VA 4QLCU 3FHZA 1XD7A 3SQNA 1P4XA 2FA5A 3R61A 4Q5SF 4KN7X 1ZYRF 3V8KA 2HFHA 2O8XA 2EV5A 1ON1A 4GO1A 2P6SA 2D1VA 1OMIA 1OYWA 3M1EA 4HX7A 2EA2A 2HR3A 3J80K 2ZFWA 5FFZA 3TOBA 2XV4S 3BOQA 3KEOA 3ZMTA 1FNNA 1PP7U 3Q5FA 3MEXA 3GFJA 3HTSB 2R7DA 4UV9A 1J2XA 4YIIA 3GXOA 1G4DA 4PGGA 3BP8A 1MKMA 4OMZA 3HRUA 3AAFA 3F8FA 2QQ9A 4L5IA 2KJCA 1SFXA 3SZPA 3V8LA 4MEYF 3K69A 4N9IA 4R79A 3K1NA 2VOPA 1MZBA 1UCRA 1LJ9A 2WC2A 2YX7A 1G3SA 5DCFA 3KP6A 2YX4A 4I09A 4G8XA 1TQMA 2K02A 4AIHA 2XHKA 5H20A 4M6YA 4G7HF 3K9TA 1K79A 4HDVA 5E17F 1U78A 2EJRA 1O3TA 3RKWA 2ISYA 3GUDA 2OQRA 3MCZA 3ERED 4NQWA 5FD5A 4TV7A 2OD5A 4GYGA 3WTVC 3E5XA 1B1BA 4AIJA 4Q48A 4ENMA 4KYWA 2AXLA 1PUEE 1SD5A 1QQIA 3E6CC 3OOPA 5BOXA 3CO7C 3T5XA 2ZCWA 2DQLA 4ZZDA 4WCGA 4ZYGA 5F1RA 3NEUA 5TRDA 1YW9A 2ISZA 3GLXA 2W85A 1S7AA 5CJ9A 2DLLA 4LGWA 3VOEA 3R0JA 2K27A 3GO5A 2HGCA 3ZN1A 1B9MA 4KIBA 1FBQA 2ESHA 2FF4A 4PCQA 3WU0A 1J5YA 3GW2A 3GFLA 5D5VB 2Q2EA 4UUVA 4WK8F 1KU3A 3CTAA 5CVIA 1Y0UA 1S6LA 3LSTA 5BMZA 3DF8A 5LRSA 2DQRA 3WTWC 2CO5A 3KP5A 2W25A 5HDNA 4Q47A 2IA2A 1SMYF 4HA8A 2UXXA 3JW4A 5D4SA 5K5OA 2M8EA 1XGOA 1TLHB 1TW2A 3I58A 4LG0B 3R0AA 1QBJA 5EEHA 1HSTA 4EJUA 2CGPA 2RDPA 5LGUA 1BC8C 3BY6A 2GWRA 2ELHA 4EM2A 4L9NA 2FXAA 3GX4X 1O3RA 2GZWA 4Z2YA 3BJOA 4PZJA 1SD7A 1QZZA 1Z1DA 1P92A 3ML6A 3F8BA 4F7ZA 1K78B 1H9TA 5LHGA 2V1UA 3HSRA 2EB7A 4WX9A 4CICA 1D8JA 1P2FA 2RNJA 2HWVA 1W5TA 4LB5A 5HLIA 3J80Z 2FRHA 2DBBA 4MGRA 2EV6A 2GAUA 1TTYA 1UFMA 2DK5A 1T38A 3KP7A 1NHAA 1YW7A 2MBFA 4HYEA 4KN4X 1ZN2A 4O6JA 4U0WA 1JHHA 1IXCA 4MNUA 3ZMDA 1GXQA 5HDKA 5J8FA 3KETA 1FP1D 2XAHA 1Z9CA 3BJAA 4L5JA 3FZVA 1HXDA 3GVAA 1UHMA 5LGTA 1MDMB 4U88A 2VBXA 5E1XA 4N9HA 2FE3A 5D8KB 2DT5A 4AD9A 5FD6A 2H09A 2QVOA 2FBHA 3REOA 3VEPA 2CFXA 2VE9A 3H92A 3IC7A 3HSEA 1IF1A 2VOOA 4M6XA 2Q8KA 1OKRA 4IHTA 2Z9OA 1MGTA
chains in the Genus database with same CATH superfamily
4BQOA 1LNWA 4OAZA 2VUMJ 2GPIA 4GRIA 2P7VB 2LMDA 3FIWA 4PJMA 3RKYA 2FD5A 4YFXF 5DS9A 2EPLX 2M87A 2XPUA 4MQVA 4ZJZA 3BC8A 4BYYA 1BR1A 2QEXI 1ZRFA 2DFIA 2Y30A 5CVRA 4EM0B 1DGCA 4KISA 4KICA 2EOFA 3WTYC 1S7OA 4IJAA 3HPSA 4IRGA 4I7HA 4I99C 2X6YA 3WTSC 3ZPLA 3O3KA 1JI8A 3HXLA 1ETVA 3C18A 2FOKA 3B73A 2L01A 4B3AA 1XGNA 3G1LA 4JBAA 2BYVE 4D0PA 1RRJA 4A3GJ 2ZM6E 2ZSIB 2J5PA 4K0KE 1IQOA 5HVQC 1EH7A 1I3AA 3C7JA 4LG0A 4DYQA 4BC9A 2WBUA 1KQ9A 2RNGA 5LEKA 3BG9A 2EOIA 1VQ8I 2HVSA 1X49A 4IHVA 4M71A 1R6RA 2PN6A 1BA5A 3CCJI 5JI6A 4F93B 2EIKH 1PJQA 5M5YJ 4NC7A 4RGRA 3OS2A 3BPVA 1QHGA 5GAEJ 1JE8A 1A35A 4RHBB 2M30A 3FHNA 4OMYA 2ESNA 3FMSA 1FYMA 4HEIA 3BR5A 1FOYA 4M30A 1YO5C 3QG5C 2A6EF 4KZSA 2ZMEC 2OV7A 4ZYDA 2DXIA 2YU9J 2Y31A 1W7PD 2EM6A 2FTXB 1FLIA 2LOOA 3ZGKA 3U21A 1MMDA 1R23A 3WGHA 3BR2A 4CH7A 1SD4A 3SFIA 1R4MB 2E7XA 4LB6B 2HC5A 4XOTA 1K78A 2Y9ZA 4O5VA 4MHGA 3CCYA 1TW3A 1J59A 2XPVA 4M9XA 2J5OA 2RQQA 2VASA 1WPKA 4LMYA 4F52A 2Q8UA 3F3XA 1ETWA 3IAM2 1PUFA 1BOAA 3CLOA 4EEFG 1IN8A 3GMEA 3MQ0A 4RAFA 2DA6A 2HQAA 5IP9J 3IKVA 4P9FA 3WU1B 2GA2A 2OA4A 1N75A 1YFHA 1MBKA 2E36A 2DW4A 3DP7A 1H8AC 3F9KA 3I71A 3LFUA 1J7KA 1Y1VJ 4XBFA 1J9IA 2VL8A 5HLTA 3OYFA 2NUEA 4GKJE 2DPUA 1N36E 2LC2A 2L92A 4R1HA 4BEHB 3B6AA 1VNDA 1ZGAA 4B3TE 2YSRA 1Y6IA 3VYTB 1W5SA 1TL8A 2EH3A 2LLKA 2V6CA 4RS8A 2H6CA 2DMYA 3S2WA 2DT6A 1A36A 1U2WA 2EPRA 2EZKA 1ZU1A 1WJDA 1ZQ3P 1FSHA 2XB0X 3ABUA 2YTOA 5KVRA 1WCMJ 3FXOA 4HNTA 2W7NA 5AC4A 5F64A 4BU2A 1IUFA 3ESWB 1Z6RA 2DMNA 5GTHC 1YUIA 3IP4B 2EQ0A 2LDUA 4AVZA 2XROA 2CSHA 3JU0A 3VODA 3BR6A 1KZHA 3HOWJ 3VSKA 5D4RA 3HSFA 2GLOA 2BW3B 2H36X 4LJZF 2CYYA 4ETSA 2UUAE 3WHCA 5EEAA 1YIJI 4LFUA 2FUG2 2K9NA 2B7TA 3U9GA 2JTVA 2JPBA 1JKOC 2V79A 4BHPA 2BV6A 4NXNE 2W4SA 1RESA 2N8XA 1W36D 2GIZA 2M7AA 1O7LA 1R5ID 2DOAA 1TQIA 2M0MA 4M9SA 5F04A 3I56I 1MDMA 1BB8A 2GOMA 4MIMA 2NUFA 5CQEA 2EPOA 3DU5A 3LSJA 3RQ4A 4C30A 3OV8A 5GAHJ 3M8FA 4S05A 4KMFA 5GTIC 3BBGA 2K5CA 4LF4E 2A3SA 4H0EA 5LD2C 2EPUA 4BC7A 2EM2A 1PYVA 1YS7A 2BVLA 1YZ9A 2H27A 3WODF 4JV5E 2CV2A 2WCC3 3TBIA 3DFGA 3S2DJ 4AM3A 4R2DA 2P5KA 4DV6E 1R1UA 2EBIA 4UV8A 2ZBKA 1A1KA 2NOJB 3NAUA 3J7YJ 1BR2A 3UNGC 3JAMZ 3GZ5A 4HBLA 2EZHA 1ZREA 1S5LC 3BG3A 2LO3A 5AASA 1S8NA 2OPTA 5B5EC 1OLTA 2NNNA 3SDGA 2JA8J 4IRIA 2KDOA 1VQ7I 3K6QA 1IZ1A 1ETQA 1W1WE 3R60A 3TKYA 1Z0XA 1KA8A 2CUZA 1U9OA 3ZN0A 5IP6A 2RQPA 2GOXB 2JUCA 4P55A 4TUGA 4A6EA 2K86A 2K3FA 4HSRA 3GYHX 2XAFA 4A3EJ 2PMHA 5GPCA 1OJLA 2KL4A 3KX2A 2G7UA 4OOIA 5HS9A 5DCMB 2XAQA 3S2HJ 3FBIB 2XSDC 1QA6A 4IQ4A 1KYQA 3GWZA 2P4WA 1WI3A 4CYCB 4LLNA 3D0SA 3OR1C 2EM9A 1K61A 2RN7A 2JPCA 1BIAA 2EMBA 1JUPA 2VODA 3EQLF 5F0CA 3RPUA 4XL9A 5A2QK 2NXNB 5C44J 2JUGA 5F08A 2NVTJ 3O6BB 3FXUA 4RA2A 2M7BA 4W97A 2HTJA 5DNYA 2HDWA 2EOYA 1XMKA 2BY3A 2R7ZJ 1N34E 2Q2EB 3HHHA 3ZQHA 5AIQA 2LTRA 4HG2A 1T39A 1G2DC 5CPRB 3TQMA 2FNAA 1XCBA 1B9NA 1A1GA 3KWRA 3S1QJ 2M45A 1SFUA 2QUFA 2KZGA 2R7QA 3HIFA 1OYYA 2H8RA 2B9DA 4WYQB 4GGGA 4X64E 2EMFA 2OAZA 3OL4A 3EYIA 4BE2A 2LF7A 2RC4A 1A6IA 1K7AA 5KL2A 1D5YA 4G7OF 3QYBA 4M74A 3P9IA 1MNMC 1MMAA 4DR6E 3J7Yp 4RM3A 2VKDA 1MMGA 2V8QB 3FXJA 2WB1N 3A0BC 5LMNE 2DA3A 5CYVA 4M3BA 2QQAA 2F48A 1HKQA 3BROA 4AWXB 1HNXE 1W7PB 3K7AJ 3MMYB 4YRVA 2E1OA 2V87A 2ELYA 1T98A 4PSXA 3PNTA 5DM6F 1FOXA 4XSZF 1Y56A 1BIBA 2YTDA 1JJ6C 1RUNA 4E70A 4I98B 4ZYHA 4S04A 1XMQE 1U5TB 2B7EA 4JYAE 1D5VA 1D8KA 1AAYA 1K6OA 1R1VA 5ICEA 3KCCA 3IKTA 2NOGA 3EETA 2DRPA 5IY5H 4BEHA 4ESBA 3ZQCA 2A07F 3LQQA 3W6JB 5HOOA 3HC7A 1ZG1A 2DYSH 4A12A 1ONVA 3V42A 4DZPA 2VBWA 2A5WA 1ZBTA 1J0RA 2KISA 1X3CA 2MLKA 1GHCA 4XORA 4Y15A 3OYIA 3KYDB 3GEZA 1SFKA 1YS6A 5D5XB 1FYKA 1S72I 1UG2A 3ZMUA 5AC5A 2E19A 3DKWA 2X1CA 1Z67A 5EYRA 1LPQA 4HRIA 3L2CA 3Q9VA 3MKYB 3V7CA 2EINH 2QKLB 2XASA 4A0ZA 2LD5A 4XLPF 2F5CA 4CCKA 4BDYA 1KGSA 3M8EA 1DQ3A 4QWQA 3EUAA 4XNFA 2M4KA 2XF5A 2YU3A 1O4XA 4MQ9F 3G6EI 4IX7A 4UUSB 4G12A 3I4NJ 1A1HA 3KP4A 3FISA 3QPHA 2VJIA 2XGDA 2KDZA 1ERDA 2L02A 5LL6R 4XKVA 3CF2A 2BW3A 2YT4A 1R49A 2M7QA 5L3DA 2YSOA 2XGXA 4NDLA 2JRMA 2E2JJ 2JK3A 1OQYA 1G6NA 1KU7A 4F91B 4DV7E 1CQTA 2GIVA 3ROUA 1O7FA 2F2EA 5DM7F 4D1QA 1OCPA 4A69C 4HOBA 1PKPA 4J19A 1ZG3A 2HZDA 3IH2A 4FE4A 4PGHA 1AHDP 3JRHA 4XSXF 4B09A 2LF8A 1TT5B 3DWLE 2W24A 3E6MA 4ZTFA 5ILVA 4PDKA 1F5TA 2MC6A 4AQYE 3CF5F 2HI3A 2EFNA 4UVAA 3QU3A 5F6FA 5J6XA 1P7JA 3RKXA 2CQXA 1W0TA 1T0FA 4BJ5C 4X66E 3K1MA 1UN6B 2GQQA 3CDLA 2HDDA 2BY2A 3CESA 2ZC2A 2QM3A 2VXZA 2TDXA 4EGYA 1P4WA 4IL6C 3HRMA 2EOJA 1OR7A 4XN3A 1B69A 1A31A 4BXXJ 1V55H 4A2UA 5M5XJ 5HNFA 1MJAA 2CU7A 3EPKA 4IHSA 3HHGA 3QPSA 3ZP5A 4WWCA 5A69A 1YG2A 5BS6A 2VXDA 3PSFA 4KITB 2VPLA 4BJ6C 3BGHA 3HZJA 1MIJA 3OYCA 4U7DA 3CUQC 1WVRA 4JK1X 2HVRA 4RB0A 5J8CA 2VE7C 3J81C 1X4OA 1NK2P 5DCMA 3TGNA 1VQ4I 2MA3A 1IW7F 2F5EA 2MABA 2CJJA 3NWSA 4CYCA 4LFAE 4M0VA 1WQ2A 3H9GA 1UMQA 2FBIA 2CW7A 3PFYA 1GVDA 4HAMA 3JRFA 1FMVA 1B59A 3PQKA 3R6SA 4HLXA 2K9MA 3HDDA 3ECOA 3WTUC 2EWLA 2G7HA 4A6DA 5FLXZ 1GZ6A 3HRSA 5FB2A 3S8PA 4M3DA 2FMYA 4F2JC 2ENHA 3H9QA 4EGZA 1WRJA 1X2MA 3BPXA 4QIWN 2IA0A 2HOEA 2IPQX 4HQMA 4PJLA 3HOSA 5DTDA 4DQ2A 4CDGA 4BE0A 2IBDA 2COBA 3PJRA 1FTTA 2LV2A 2XGCA 2PI0A 4KHPE 1N33E 4JI4E 4IF4A 3S93A 4RAZA 2FGGA 4X65E 1DP3A 1A1IA 3T1YE 4C3IJ 4V19K 3QODA 1GQEA 3I59B 1X5WA 5JVTA 2DN0A 4UUTA 3RPUD 2HKXA 5EZGA 5BR8E 2FEZA 1G3YA 4CCNA 2M3AA 5FKNA 3V8JA 4I76A 1SD6A 2DFFA 3OL3A 5FFXA 3TO9A 4Z6YA 1JGSA 5IT9C 3LMMA 1W7PA 5D6FA 4WXHA 3EQ1A 4R2EA 5JFRA 2LSOA 4L9TA 2EFOA 2V9PA 5D8LB 3W6KB 1H89C 1U5TA 5D6EA 3SDBA 3V7RA 2D5VA 1IN6A 1ZG5A 2VT2A 3HTUA 4GCVA 4CUGA 2KHMA 2EK5A 1E0EA 1V5FA 2WAQA 3QRFF 1MBEA 3EUHA 1TWGJ 4U7BA 4BQAA 2EMGA 4F6NA 1W0UA 3D5LA 4IVNA 4IRHA 3LA7A 3C6MA 2E35A 1LVKA 3W2VA 5K5RA 2ENCA 1ZARA 2EN2A 1W5CC 4V2FA 3WGIA 2X51A 3IHUA 3GTJJ 3CJNA 3DV8A 1R22A 1UB9A 3FMRA 3P7NA 5L3CA 5IWAE 2MH9A 4XOPA 4IHWA 1XC5A 1IRZA 2E1MA 1Q1HA 1T33A 4UUSA 3HL2A 5A2QZ 1VTNC 2EPKX 1YHQI 2IHR1 2LUPB 1FC3A 3PIOF 2QCOA 2HDCA 5DEQA 1HOMA 1BR4A 5IV8B 3BWGA 3V7SA 1OCRH 1FIPA 2A69F 4PFOA 4BAYA 2LJHA 2X6XA 2FOWA 3ABTA 5E18F 1K4TA 3RTRA 5KL7A 3PIPF 3PQJA 5E3LA 2UXCE 3K70C 1T6SA 1X3WB 4ABZA 3DLAA 4XR6A 1TNTA 3I4PA 1DU0A 3MZYA 1RIOH 2CPNA 1TWCJ 3BCAA 3K4NA 5TJJA 3LMLA 3DKYA 5FROA 5HS7A 2LK2A 2QSFX 1DQUA 3KE2A 1RMDA 1X47A 4B8XA 5E8GA 5K5QA 2K7LA 5FO5A 4DKKA 2WBSA 3MHSC 2RKHA 1YPNA 3OOUA 1XSVA 2KIMA 4DV2E 1U6GA 5FJ8J 4XRFA 1YE9A 2EA4A 2EN7A 4L5EA 1HCRA 1ZRCA 2O03A 5BPIA 3F6HA 3TDUC 4UVCA 1QRYA 1Q1VA 4HX4A 3EDPA 3W2AA 2IJLA 1VQLI 4LF5E 2RSIA 3QQAA 2L2NA 4FK5C 3Q3SA 2KONA 2CG4A 1TP4A 2DA4A 2F5VA 2EPPA 3DPTA 4KIGA 2MC3A 1SC7A 1FY7A 1FJGE 2YTEA 4FX0A 1EA3A 2Q0OA 3SFZA 2ADRA 1TWHJ 3AV0A 1QVTA 2IGKA 3G1OA 3LWFA 1WHUA 3F21A 2L33A 3ONQA 1Y1WJ 4R8HA 3PL8A 4JI5E 4O24A 2EPZA 2UV1A 2Z1DA 3AUZA 2HS5A 4WXDA 1I50J 5GP9A 3CMYA 4B44A 5LRRA 1GUUA 3KP3A 2HXOA 3E5QA 1IBME 3L2WA 3L9FA 2EIMH 1MH4A 3TQNA 3CD6I 2X85A 2IGOA 1YLFA 1BBOA 4HW0A 1XTAA 4U0YA 3H36A 1RPWA 1BBYA 3HKZA 2OF7A 4RDUA 3RIRA 3L2UA 1YJNI 3WGGA 2VJJA 2EN8A 3S1NJ 1RC9A 4UY8I 1XSXA 2K9SA 3L2QA 2V89A 2RVCA 1YI2I 3FMQA 4OIQF 4RAYA 3S3OA 2QSHX 2EQ3A 2EPFA 1G3TA 3JR9A 3OY9A 4ZTJA 1SEUA 2ELJA 1IV6A 3IV5A 2UZKA 2X6OA 1B6AA 3CMEI 2DDBA 4HV6A 1BM9A 5HLHA 4P78A 3ZXSA 1TQPA 2HPIA 3A01B 5HODA 3KZYA 1ZR4A 3BJ6A 2O6GE 2P6TA 1QPIA 1DPUA 1QZEA 4CHUA 3HOVJ 5F0HA 4PUSA 2B0LA 1XGSA 2QWWA 2BVMA 2XF7A 1GT0C 3QP5A 2EMKA 2B63J 4G94A 2DFEA 3J81K 1I94E 3RDIA 4J01A 4BKXA 4O43A 3ZR8X 2M9AA 4RLQA 5EG0B 3S16J 5H2FC 3JSOA 4K2EA 1T2KA 1DGRM 3I59A 5HLGA 2K9LA 5GPAA 2DJNA 4C9YA 2M1SA 3IWFA 3RYRA 2R7VA 4B3ME 4LK0F 1BI1A 4ON0A 1JKPC 4A3DJ 2VONA 1KU9A 3RSNA 2DU9A 3CP2A 2HQ5A 1ZAAC 3I5UA 2K40A 2M4GA 3CJTB 1FTZA 2WBTA 2BY0A 1N78A 1LEBA 1SVMA 2DMPA 3OS1A 1K83J 1N25A 2LE2A 3M07A 4DNCA 2MKNA 1Z3XA 4BJTA 1P6RA 2HQNA 5K1YA 4YELA 3P1XA 3H1CA 3M1CA 1ITYA 1MNDA 4M73A 5BQTA 4RGXA 1RKWA 2KRFA 5B66C 3MKLA 3H3UA 2LVHA 4BXUA 1STZA 4A5MA 3WTTC 1X6HA 2PG4A 3Q0UA 4EMSA 2W1OA 4A3JJ 5JHUA 3OSFA 1KQ8A 4DV0E 2WV0A 1Z7UA 2O5RA 4XONA 1KJKA 1XPXA 1VFCA 1I1SA 5AONA 1XB4A 3E97A 1HLVA 2JOBA 1WHNA 1ETOA 1R1TA 2O0YA 3FWEA 3D5SC 1QO0D 3QWLA 4AYBN 1L4SA 1A04A 1HKSA 1O3SA 4MFEA 2E71A 5IT9K 4YY3E 5EJCA 4HLYA 4DMIA 2OTJI 1HQCA 2A05A 2VBZA 4FCYA 2Y0MA 3BG7A 2PBIA 4XLEA 1VQNI 2D2WA 3OYAA 4JI1E 3DBHB 1H0MA 3MWMA 1CF7B 5EEGA 2H8WA 5CKTA 4C3JJ 1EKZA 1YITI 5LHIA 1WJCA 1XCVA 1WJPA 3L09A 2KQRA 3ZQ7A 1HW5A 1DP7P 1ZRDA 1U0JA 2VLAA 1SFOJ 1RETA 2R93J 2CT1A 2R3SA 4LK1F 2ELKA 4AIKA 4Y3OA 3L2RA 2HQRA 4F55A 4ENJA 3S1MJ 1X48A 3O2PE 2W57A 5AIPA 2EM5A 2A61A 3DQVC 2OZ6A 3LSIA 1U8RA 3C3WA 4BHCA 4N4RB 4BBSJ 5JVGF 4UB6C 1D1CA 1QNTA 3OSGA 3ABMH 5ILSA 4X62E 2V6EA 5CLSA 4E4HA 3F23A 3H5AA 3BTIA 3QAHA 1XX5A 4RB3C 4XLCA 2JT1A 3BR1A 2PLYA 3I64A 4XKBA 4D9JA 3FM3A 4JI0E 4OOGC 1S7EA 3S14J 4BBYA 4MO7A 1YOVB 1I6XA 3TOAA 4CA0A 2JSCA 2CH0A 2JA2A 4V2GA 3ZQLA 1U9NA 1YSAC 3MD2A 2ZXHA 4IOAF 2CMPA 2L7ZA 2ODRC 2M4IA 3VFZA 4EJTA 4R2SA 1UILA 1X2NA 2HZTA 3VPRA 5CVUA 1IDZA 2VQEE 2YPRA 2QBYB 4LLGF 2JVGA 2M0CA 3PFIA 2DO7A 2O61A 1IBKE 2FMLA 3ADIA 3Q0VA 1DPRA 1ODDA 2K3PA 2V1DA 3CDIA 4DIQA 1MEYC 1J26A 1GXPA 3T1BA 2CS3A 2E72A 2HYFA 2B9SA 5KAIC 1RNLA 1ZR9A 2UXBE 2X0LA 3F8NA 2P8TA 1ZELA 2BOLA 3ZOBA 3J7AG 4L18B 1TF3A 1XDUA 3C1DA 1MJBA 5J1UA 4BQNA 2ETHA 5KAFC 3RPQA 5FRNA 1NG6A 3I53A 2AS5F 1E3PA 3DKXA 4DUZE 3JSPA 1FBUA 3LNQA 2F4MB 2EFWA 1ETYA 4O5GA 3VK6A 3TDZC 1X1PA 3A01A 2L4AA 4B47A 3WG7H 2L9NA 3C4BA 2NYXA 1FT9A 2Y48A 2LBFB 3UK3C 2VKVA 1NK3P 4II3A 2H94A 1BW6A 1YQAA 5F1JA 2EWNA 2KIQA 2MGQA 1FEXA 3OYKA 1C0WA 1VQ9I 4A3FJ 4HF1A 5EG0A 2OUMA 1D0ZA 1P7IA 2L4MA 3K0LA 5DUIA 4O3MA 1P47A 1UG0A 5K7HA 2L0KA 3E3VA 3MAJA 2BGCA 5KL3A 3I4MJ 2NVQJ 3A4CA 3CCEI 2W84A 1B4AA 2MH2A 1IN7A 2LNBA 4F9BB 3CMMA 2CWEA 2EZ6A 4IQJA 1L0OC 1EKEA 3ISPA 5ED4A 2R7FA 2ACJA 1IUYA 1IQSA 1YUJA 2PFBA 1USSA 3DBLB 5IOYA 3SEQA 2IS2A 2DK8A 2JZYA 1QZYA 1OPCA 3KLOA 3AL0C 2HNHA 5HNHA 1N77A 2EMHA 2DCEA 4Q4ZF 4CSWA 1BI2A 2CUJA 3QU6A 5FKOA 3OTOE 2L3CA 3CCSI 2DDAA 5KL5A 2F5DA 3HUGB 1HKTA 3TP3A 4FX4A 2L7MP 5LHHA 2ZNZA 2BZTA 2FBKA 2WBMA 1LEAA 1CGPA 2R7SA 5L3GA 2L8TA 3QPTA 2M2EA 4XLFA 4HPQA 4L9VA 1AWCA 5TSEA 2R5YB 2LKPA 1UHZA 4JQFA 2LP0A 1EV7A 1FOKA 1R00A 2CQKA 2WB1A 4JI2E 3LFKA 1MBGA 4X8WA 3ZQIA 2K4JA 2ID3A 2TCTA 4CO8A 2IS6A 2YTFA 5EDNA 4L9JA 3IRQA 3K4MA 2DLKA 3FF5A 3KPHA 3JRCA 4ZYAA 2EPMX 2VI6A 3ASOH 3QYFA 1BC7C 1RC7A 3LSPA 4FTHA 2LJUA 4OINF 4HNVA 5J1RA 3EYYA 1WZ2A 1CF7A 4R2QA 4FT8A 2A5YB 3RZOJ 3IUOA 3G73A 2RV8A 3B6CA 2RSMA 2EFQA 2QGUA 3F22A 2EOHA 5ILUA 2GXGA 3KLNA 3OS0A 2R0QC 5FLVA 4J00A 4EJOA 2CW0F 3HOTA 9ANTA 4B4CA 1J75A 2A25A 2ZFUA 5E20A 4QPQA 3CJQB 4U87A 3ZMVA 5JR3A 5K7FA 2JA6J 3JRAA 2V9VA 3J81Z 5ERIA 2KLOA 4FE7A 2L9SA 1F36A 2BY1A 2YUSA 3UKGA 2HJJA 2IVMA 3BR3A 2STWA 1IRXA 3RJPA 3SZTA 1IC8A 2EPXA 3HPGA 2NNYA 1XN7A 2KKOA 2N8GA 4MFDA 1EH8A 1KYZA 2EE8A 1RKTA 1F9NA 2ME0A 4Y17A 3T8TA 1PJTA 4LTYA 2L9VA 5D5WB 2RQLA 1YYKA 5DDGA 1GV2A 4EM1A 3VYYA 1YIOA 3CMAI 5LLQA 2ZKZA 3BDDA 3H3ZA 3IWZA 2BE5F 1E2XA 4E7IA 4IO9F 2E5NA 4I0AA 5CFFE 2E1MB 4LIVA 4G9YA 2KOUA 2X48A 4XICA 1R7JA 4J8ZA 3JTZA 2ZMEB 3DBRB 4XKCA 4W1UA 3JAMC 2YR2A 3Q0WA 2QBYA 2D9HA 3OYEA 2EP3A 2YSPA 5A6JA 5J1YA 1Y8RB 4LFCE 5LFAA 3BTJA 3HPHA 2H6BA 1RUOA 2P81A 1ZGJA 4A3MJ 2OZUA 2NS7A 3K4LA 3BQYA 2Q1ZB 4Y33A 3TW7A 3ZQGA 1FJLA 4BY1J 4G7ZF 2MC5A 2Z5UA 2LTSA 4A0XA 2QZ8A 4E7LA 5E3NA 4UXNA 4YHHE 3V4GA 4F3QA 5E3OA 5IT9Z 1K6YA 2ZJ2A 3WHBA 2NVUB 1WWXA 4BH9A 4EATA 2BXYA 4A0YA 2E1CA 1ENHA 2N3HA 2EM7A 3B02A 4HX8A 4Y4RA 1YW8A 3IH4A 4P7DA 2ADUA 2DTRA 1R5HA 4L0YB 1X3ZB 1TNSA 1YJWI 3ADJA 2ID6A 3F6OA 3S32A 2LBFA 4PJNA 4BBRJ 4GXOA 2EM3A 1QHHD 2V26A 2VBYA 4PJ0C 4CXFA 2KT0A 1T56A 2MD5A 4OWRB 3DTEA 4KJZA 2KHXA 3HBLA 5EF6A 1Z21A 2IS1A 3U1DA 2ICWG 2JA7J 2YRMA 4R2CA 5L3FA 2R7TA 5E8IA 5KK1A 2NA2A 1F1ZA 1R58A 1APLC 5J4YA 3VYSB 4AVPA 3S1RJ 4B43A 3GFIA 4YFNF 3IH3A 2PEXA 1LDJA 2IS4A 3THOB 2FQ3A 1WH5A 3W3CA 2V88A 4JX4A 1W4MA 2PJRB 1T4OA 2EN3A 4Y13A 3CLQA 2EMIA 3TO6A 4NXME 2VJ5A 3K1PA 3LSRA 2MYSA 2HTSA 2VQLA 4MLOA 1Z6TA 2YTIA 4F92B 1F2IG 3G71I 3SJMA 1BN5A 2R1FA 1S3JA 2O3FA 3MSWA 2WTEA 5B3SH 2A68F 4WSGA 4UNOA 1SVLA 4F9CB 2GLIA 2WWYA 3L00A 2ENAA 3EUKL 4CZZA 2CUEA 3HUGA 4NB5A 1IMUA 2DT7B 1D1AA 3ULQB 2IP2A 3F72A 3LSHA 3OWTA 2IT0A 1YX5A 2YZTA 1PP8F 4I2OA 2K4VA 3WTXC 2E34A 2P5VA 3TMOA 3IRRA 2X4HA 4ZZLA 2JA5J 2LY1A 1WI9A 5CVJA 1UBDC 2HU9A 2R5YA 3ZMSA 3ZQFA 1IV8A 5J4VA 2PX9A 2XSJC 3VYRB 2EV0A 4B1RA 3T1HE 2Y2ZA 4FHTA 2RTXA 1RI7A 4E7JA 1WSUA 2L6MA 1V3FA 4ENNA 3E5UA 4ZDLA 2E5LE 4AUXA 2L9RA 1X3UA 4BS9A 4EJWA 4X9JA 4DV5E 1VI0A 1FSEA 4MLQA 4XLAA 4N4NB 1R9TJ 4JP0A 1IXSB 3SZGA 1WJAA 3BZCA 1J09A 3H35A 2M1BA 5A6AA 1U8BA 4DJAA 2GM4A 1AKHB 1IGNA 2O7OA 4EV0A 2F5FA 3OYBA 2G0EA 3PSIA 4G6DA 4XLNF 2EOQA 2NVYJ 1BI0A 4DYCA 2Z3YA 4KMUX 3VB2A 1Z91A 4ZYEA 1HR0E 2ZNYA 2X1DA 4HNUA 1BJAA 1IDYA 2CSOA 2Y75A 4A3IJ 2CRGA 4KDPA 4QPOA 1T8IA 2FJ1A 5T6JA 3AG1H 3J7AO 1J5EE 2QLZA 2L3DA 2E2HJ 3NARA 3T0YA 5ICCA 2LKSA 4E7SA 2D1HA 2NABA 6PAXA 2HOTA 3KP2A 2DA1A 3BT9A 3DTKA 4LLLA 3L7WA 1JT0A 4BHBA 3LAPA 4KWYA 3OIOA 3W6VA 3K2ZA 3U2RA 2H1LA 2M9HA 2X1EA 2Y0SN 4HQEA 1M1EB 4A93J 3H5NA 5J3LA 2EL5A 3RCOA 1I27A 2PMZN 1XSDA 3DXJF 4NC6A 2YTPA 1DGWY 2E1NA 5LEJA 1YYOA 3ADLA 3GFMA 4HEA2 3WG9A 1E17A 2JMWA 1JT6A 2FX0A 3HOXJ 4O4KA 5LMUE 1ULYA 5F27A 4DV4E 1Z7LA 2UUZA 3HB9A 3DEUA 3PM1A 2ZMEA 1QPMA 1A5JA 2V9KA 2QQBA 3HOUJ 2HGHA 3FX3A 1LDDA 2JRTA 3H3VK 4R2PA 2FNPA 3M4OJ 2NUGA 4KA4A 2UUCE 4AU7A 3MHHC 4X6AJ 2ZO4A 1GVJA 2L2MA 4IXAA 3M3YJ 4CCJA 3MVPA 1E3HA 5ICGA 3HGYA 3P9KA 1PJRA 1ZKGA 2CTDA 2EOXA 1FWZA 4OIRF 4E7ZA 5BPDA 4GZNC 3NQOA 2VF1A 2GA1A 4KNYA 4II2A 2HYGD 4ITVA 4NHRA 1D0YA 3PNVA 3SHFA 2AHQA 2M34A 2EPCA 1GV5A 2LY2A 2XUBA 3GZ6A 4ENKA 4I01A 2JY9A 2STTA 2YTQA 1JUSA 3HYIA 2VQCA 4WF2A 2W48A 1I5ZA 3JREA 5IOZA 1ZHFA 3E1SA 4M3EA 4RB2C 4A3KJ 2EQ1A 2XAUA 3JAMK 1MBHA 2KP6A 1VQMI 1WJ5A 2HXIA 2WAFA 2LREA 3GLLA 1T0FC 3ELKA 5FLXC 2K4BA 4KIFA 1NH3A 3ZOQB 3ABKH 1REPC 2Z16A 4CYDA 1FZPB 2IW5A 3JTGA 1T4LB 3LLHA 2NS0A 2LMZA 1R5GA 1JTXA 4EQQA 1XNQE 2ME6A 2OCEA 1OCZH 1OR7C 2FSWA 2R4GA 2KIUA 4RB1A 1HC8A 2LFBA 1ZBQA 1LFPA 1OCCH 4LU9A 3RYPA 2L54A 4IS1C 2LVSA 1BW5A 5D5UB 1FYLA 1ZLKA 3K70D 1FKAE 3MKWB 2I8DA 2XIGA 2PJRA 5A6BD 3K4KA 1ETKA 2KFDA 3P9CA 2R7XA 5IT3A 3THNA 5FGMA 2OU2A 1MD0A 4JYKA 2IA1A 4DOZA 5L3BA 1F4KA 3F8CA 2EMCA 5DYMA 4FASD 4LOCA 4P5OA 1D3YA 2EM0A 2EZIA 1WJEA 5J40A 1ZK8A 3FXQA 4XRSA 3J7AY 3HPZA 2PMUA 4ZH4F 1K4SA 1B72B 1SAXA 3I3LA 2L2KB 4G6TB 1IRGA 2EFPA 3IWBA 4N0BA 1LVAA 2YPNA 3MKZA 2YRHA 2V7FA 4G6QA 3S3NA 2UXDE 3G3ZA 1BBGA 4BXFA 4YFKF 2EN4A 3OMLA 3DLLF 1ZGWA 5KNLA 3AG4H 5IXMB 2JJ7A 2A6HF 5ICFA 3LSMA 2F6CA 3FXKA 2P5LC 1V4RA 4HDUA 3N97A 2IRFG 2VN2A 3QOPA 1R4NB 5H6RA 3H0DA 3M9AA 4F9AB 3CUOA 3GCMA 4PFPA 5DD8A 1RZ4A 1S29A 1SFEA 3D5RC 1WH7A 5KHDA 1TWFJ 2DMQA 1HNWE 5E79C 4HF0A 4F6MA 3HOZJ 2VJ4A 4DR3E 1NEIA 4BY7J 4RGUA 1KU2A 3R4KA 2XC7A 1H9GA 3I55I 3LAJA 1X6FA 3MFKA 4Q28A 2XAJA 2Z33A 3EPZA 4GFBA 2V83A 2IAIA 1SMTA 4RGSA 5LGNA 1VQPI 2OC6A 3CZ6A 4MEXF 4I02A 2JR1A 3DTIA 1A6QA 3CC7I 1IAWA 4WXCA 2WY8Q 3CJRB 4LF8E 4C3HJ 3QPLA 1LE8B 3CCRI 1XGMA 1AKHA 2KJBA 2E2IJ 3OYGA 1HF0A 2FV4B 3AG2H 4XQFA 2VE8A 3BZKA 1DDNA 2WV1A 1WFXA 3ZCOA 2XKPA 3BZ6A 1YTYA 4EVIA 4I0BA 2X9DA 3E6DA 3GF2A 1Z77A 3BTLA 4X0GA 5B1BH 4BCAA 2OQGA 5E1ZB 4KUMA 4M9VC 2RREA 1G59A 1V54H 2DGCA 1GLNA 3CUQB 3HOYJ 2E7WA 3JTHA 1O0WA 2UUBE 1X1CA 1EJ9A 3HTXA 4FETA 3LSGA 2EMYA 3PNYA 1ON2A 1UELB 4AYBA 2UWMA 4HV5A 1JHFA 4IOCF 1Y8QB 1MW7A 2DLQA 3RMPA 4WSPA 1U5TC 3WE2A 2EN6A 2C6YA 4IPAA 4ASNA 1FX7A 4MTEA 2DA5A 2G9WA 3OYHA 2XKOA 4IEJA 2CQNA 4X1EA 4A3BJ 4DR5E 1L3LA 2CQQA 4M9ZA 1A1LA 3HRTA 1T4NA 4DR4E 2K7IA 1OFCX 1PDAA 3J80C 3FK7A 4L0ZB 1IJWC 2GHFA 2ZXWH 3EUHC 2YRKA 4A3LJ 3K6GA 2HVQA 4P9UA 3KFWX 3L1PA 2CUFA 3U1KA 3IL2A 1XMAA 4PK4A 3UR3C 4Q35B 1HW1A 3CDHA 4LD5A 1LUJB 4KFCA 1USTA 2COMA 1GTKA 3LQRA 4U0VA 1JKRC 2WZOA 2JPAA 4IZZA 2FU4A 2XVCA 1P4AA 1OCOH 4S0HB 2E1MC 4ZC3A 4UB8C 3CCVI 1TBXA 2JWOA 3G1MA 3WTZA 2GBYA 4GDFA 5HDGA 4XM3A 3NRVA 3H5RA 1ACIA 3FIGA 3I0TA 1XDSA 2QENA 1AOYA 4LF6E 2HYJA 1B8IB 1Z05A 2OBPA 1KYWA 4BMJA 1DUXC 5HS8A 1IXRC 5C3EJ 2DFHA 2EMWA 2ZXJA 5DUKA 2FQ4A 1G3WA 2L2OA 2P0WA 2RGVA 3KZZA 5FRMA 3TEDA 5FLMJ 1Y0NA 5C4XJ 3WU2C 2VC0A 2LCEA 3VHTB 2DTZA 3IWCA 1OYIA 2EPAA 4N4OB 1WKMA 4HZFA 2XB5A 3WE3A 5E3MA 2XRNA 4A5NA 1TT0A 2DB2A 1F43A 2XAGA 1VZ0A 1IBLE 5AE2A 3X2QH 1LB2A 1IN5A 2DAOA 2UXNA 3DCFA 2F4VE 3CO6C 2PJPA 4NC8A 1YX3A 1TN9A 4HSTA 3LSKA 1IO2A 3ASNH 3CCMI 1LQ1A 2L5QA 2EILH 5JHFA 2D45A 1ZR2A 3F8MA 4M72A 4ANJA 3GTPJ 2Z99A 2EPNA 2I13A 3CC4I 1W36C 3TL4X 3I9V2 1G2FC 2I10A 1EF4A 1SVOA 5CVVA 4Y52J 5K7ZA 5LBQA 3ZMZA 1LLMC 4BGDA 1WJBA 2V1XA 3DPLC 5F3WA 4FQGA 1ZH5A 5F0FA 3N4MA 4DGWB 4EJVA 2BEOA 3DEWA 1JGGA 3ZRGA 1HBXG 1ETXA 1UHSA 2XRLA 1IN4A 2DA2A 1RR7A 2VT3A 1O3QA 3E0JB 1XS9A 4OIOF 1X58A 1PDNC 2EIJH 2DPDA 1I6HJ 2PQ8A 4UHTA 4B3XA 4DUYE 1XNRE 1I1GA 2DOEA 1NCSA 2KRCA 1N32E 1B72A 3ECHA 5L3EA 1HSJA 4BACA 2JQ7A 2GXBA 1IG7A 4OU0A 5EGOB 1FPQA 5FLXK 2XDVA 4CCOA 1JUMA 1HW2A 3KYLA 3BTCA 3SXYA 2AQEA 3TO7A 4JI8E 4D5CA 3BQZA 4ESFA 1TWAJ 2QYOA 4BE1A 4NQWB 2EMZA 4YG2F 5IPAA 1NG7A 3AFHA 4DZJA 1LFUP 2P7CB 4DR2E 3I54A 5B1AH 4I8OA 1MSEC 2GXAA 4JX6A 4P96A 4HF2A 3PO2J 2M5WA 1S9HA 4RLFA 1JXSA 3OIPA 3E7LA 3LA3A 1TZLA 4OIPF 2ODRD 2ECBA 4YIFA 2KZVA 2NAZA 3MZHA 1LFBA 4GEQB 3DEEA 1UHWA 1FBSA 1E3OC 2EMXA 3E6BA 4B48A 2I9IA 3DPUA 2QA4I 3BF2A 1FP2A 1NTCA 2EL4A 5AE1A 1LDKB 2EQRA 1IRFA 4ESJA 1SANA 5DD4A 3VWBA 4BNCA 2BB8A 1DI2A 2YWQA 2LRSA 2L7FP 1LE8A 1ZAOA 1BI3A 2CV0A 3LA2A 4GYIA 4LF7E 4C2TA 1BOBA 1MMNA 2MLGA 5DV5A 4KT5C 2F4OB 5E1WA 4CGZA 4BUPA 2ZXIA 3CCLI 3C2BA 4CCMA 4M2ZA 4ZDPA 2DI3A 2I5UA 2MC4A 3COAC 1SR9A 2BBYA 2DMUA 1EH6A 1O57A 1YYVA 1D1BA 2VC1A 3CUQA 2MKDA 2HKOA 1U3EM 3RI4A 2ZJPF 3QP6A 2E5ZA 3W2WA 2YTGA 3J7ZI 1MJ9A 2QKMB 1ZLJA 2KIFA 4CZCA 5H6QA 2DSYA 1X1DA 3KEYA 1Y39A 3S15J 3Q9SA 4MTDA 3T8RA 3F0CA 4XKWA 2IGNA 3HGGA 3D1NI 1QGPA 4NHJA 5TISC 4UVBA 4XRSG 3MZ8A 2IGMA 1I3QJ 2R5ZB 3KZIC 3FM5A 3M7GA 4RAGA 4M3FA 1JKQC 2HEOA 3KEQA 3OYNA 2NRAC 2B7VA 4JI7E 4OAYA 2HHHE 1KQ0A 1POGA 1JK2A 1WJFA 1GDTA 1R36A 2VKEA 3C2GA 3PO3J 3FXRA 3F6VA 4QLCU 1G8XA 3FHZA 1XD7A 1VQ5I 1YRNB 4ZDOA 2YTNA 3SQNA 1YJ9I 2RS6A 1P4XA 2FA5A 3R61A 3A03A 4Q5SF 4KN7X 1QU6A 3RKQA 3SYTA 1ZYRF 2XPWA 3V8KA 2MW8A 2Z2SB 2HFHA 4IJDA 4AC0A 5KCMA 2O8XA 2JYAA 2EV5A 1ON1A 4GO1A 2P6SA 2CW8A 2EOSA 2XF6A 3ABLH 2D1VA 1OMIA 3SEZA 2E60A 1OYWA 1B8IA 2DOFA 2LG4A 2Y9YA 3O8GA 2EN1A 3GTLJ 2BBGA 4L8NA 3M1EA 4BQQA 4HX7A 4QTRA 2VRDA 3GBGA 2VPRA 2EA2A 2HR3A 4DBQA 2CV1A 3GTQJ 3J80K 3IWDA 2LRDA 3GTGJ 2ZFWA 2LR8A 2VKHA 3PUFA 5FFZA 1WHQA 4F54A 3TOBA 2XV4S 3BOQA 3KEOA 3ZMTA 1FNNA 4JOMA 4TUIA 3F6GA 2R76A 1PP7U 3Q5FA 4NUBA 1PJSA 2OJED 3MEXA 3GFJA 3HTSB 5GADJ 2VIXA 2R7DA 3LL7A 1H88C 4UV9A 4LG3A 4IHXA 1J2XA 4YIIA 3OYDA 3GXOA 1G4DA 4PGGA 3BP8A 4E7KA 1MKMA 5A6KA 4YIRX 4OMZA 3HRUA 1JK1A 4L5NC 3AAFA 3F8FA 4XMYA 4E6KG 3RZDJ 3HJEA 2QQ9A 4L5IA 5IYCJ 5ADZA 2LT7A 2KJCA 3A1YA 3S3MA 1SFXA 3SZPA 2MDGA 3V8LA 2EOMA 4MEYF 3K69A 2YU5A 3HQ1A 2JWTA 5JLXA 2LUQA 4R8OA 4N9IA 4R79A 3K1NA 2VOPA 1MZBA 1VF9A 1KONA 2JN6A 1UCRA 2F4IA 1LJ9A 2YX7A 2WC2A 4C2UA 2JVAA 1G3SA 5DCFA 1JJ8C 3KP6A 2XGEA 3BIDA 2YX4A 2TRTA 3QOEA 4I09A 1RQ0A 1XMOE 4XN0A 1FMWA 1TF6A 2KPMA 4G8XA 4BDZA 2R7RA 2HOSA 2KRHA 1TQMA 1A1FA 4LF9E 2MDRA 2K02A 4AIHA 2N3GA 4DV3E 2WADA 2XHKA 5H20A 4M6YA 2UU9E 3PUBA 2VQGA 4G7HF 4NBQA 3BG6A 3K9TA 1K79A 4HDVA 2JVHA 5E17F 1U78A 5EGOA 2V86A 3FBNB 1HDPA 2EJRA 1O3TA 3RKWA 1G2HA 2ISYA 3GUDA 2OQRA 3MCZA 3ERED 2L7KA 5A6BA 3H0GJ 1WGXA 2DMTA 4NQWA 1VQKI 2YTJA 2CQ7A 1X6EA 1X1AA 2V4JC 3EPLA 2WA0A 4LFBE 4FISA 4R2RA 5M3FJ 5FD5A 4TV7A 3FK6A 2OD5A 3CQZJ 3FDYA 3FKIJ 4GYGA 3VSLA 5EZHA 3WTVC 2VQFE 3E5XA 2X6WA 4PSWA 1B1BA 4AIJA 2JSPA 1MSFC 4Q48A 4RBOA 4ENMA 4KYWA 2AXLA 1PUEE 1D0XA 2QQ8A 4XLHA 1SD5A 2K85A 1ORKA 1QQIA 5BNGA 3E6CC 4KT6A 2EM8A 3OOPA 3DF6A 1HNZE 5BOXA 3CO7C 5JLWA 3T5XA 2ZCWA 2DQLA 1XMXA 4XK4A 2R7UA 1VQOI 4ZZDA 2OTLI 4WCGA 1X1BA 2Y69H 2BXZA 3A02A 3BLYA 4ZYGA 5F1RA 5FKKA 4BL0B 2EMLA 3NEUA 4XRMA 5TRDA 1LKXA 1R71A 1YW9A 3VYUB 3K2AA 2ISZA 3GLXA 1FOWA 2A6TA 2OCCH 2W85A 3L2VA 3OYLA 1S7AA 5FKMA 2JP9A 5CJ9A 2DLLA 4LGWA 3EPJA 4E7HA 2MG4A 4IHYA 3BR0A 3VOEA 3R0JA 3OYMA 3JRBA 3JRDA 2K27A 3GO5A 2HGCA 3GZNB 3ZN1A 2R92J 2ZJQF 2ZJRF 4P1WA 3K4JA 2R5ZA 3ADGA 2LY9A 1B9MA 4NNJA 4KIBA 4R03A 1FBQA 4D7NA 2ESHA 1MBFA 2FF4A 1Z1BA 1XG1A 4PCQA 3WU0A 4Y7NJ 1P9QC 1YRNA 4B3SE 1N3GA 1J5YA 3K10A 3GW2A 3GFLA 4DR7E 5D5VB 4GKKE 3G4SI 2Q2EA 3LOCA 4UUVA 3C2HA 4WK8F 1KU3A 5M3MJ 2V1NA 3IAS2 3CTAA 5CVIA 4XIDA 1Y0UA 1S6LA 3LSTA 5BMZA 3K4BA 1FIAA 1MBJA 3DF8A 4LITA 2AXTC 1MH3A 1VQ6I 3GTOJ 2EOZA 1V5GA 5LRSA 3A0HC 2DQRA 2ECCA 3WTWC 3JRIA 1BL0A 4WFTA 3JRGA 1A1JA 3CP8A 2CO5A 3KP5A 2Y0SA 2W25A 4DR1E 4DW6A 5KL6A 5HDNA 3HG9A 4Q47A 2IA2A 2PMZA 3AKZA 1SMYF 4HA8A 5CQGA 3CCUI 3A2KA 4DV1E 3BCBA 2UXXA 1AH5A 3JW4A 2MD0A 2B3TB 2K9QA 3AL0B 3CC2I 2DA7A 2LYCA 2R7OA 2LBSB 5D4SA 1T08B 5K5OA 3EPHA 1Z3YA 2M8EA 2WAEA 1XGOA 3H9JA 4LIUA 1TLHB 5IP7J 5AE3A 1PVEA 1TW2A 3I58A 2NVXJ 4JX5A 4B3RE 4LG0B 1DU6A 2PRTA 2IXSA 3R0AA 1QBJA 5EEHA 1HSTA 4EJUA 2CGPA 1UJ8A 3C4TA 2RDPA 5LGUA 1STUA 1BC8C 1V5EA 2ZB9A 2EJ4A 4RM2A 3BY6A 3CCQI 2GWRA 2O9LA 2ELHA 3C6KA 4EM2A 4L9NA 2FXAA 2EM4A 3GX4X 1O3RA 2GZWA 1T95A 1HDDC 2NS8A 4Z2YA 3M99B 3BJOA 4PZJA 1SD7A 5J47A 2MFZA 1QZZA 2WAQN 3HM5A 1OCTC 4H4KC 3VYXA 1Z1DA 3QYEA 3M8JA 3O8HA 1AA7A 1P92A 3ML6A 4DYRA 3OMYA 3P5JA 2O8KA 3AG3H 3F8BA 4F7ZA 2QF7A 1WXRA 3S17J 1K78B 1H9TA 5LHGA 2V1UA 2V85A 3HSRA 1TC3C 2RAEA 3H09A 2EB7A 2YS9A 5GAGJ 3FKJA 2M8GX 2MSYA 3FXMA 3KYCB 3KIOA 2DIXA 2EL6A 4DBRA 4WX9A 1PUFB 2BHYA 4HTGA 2BHZA 5KL4A 2DODA 3JCUC 1MNEA 4CICA 2CFOA 1D8JA 2LKXA 3OIQA 1P2FA 1I39A 2F8BA 3N05A 2RNJA 2W00A 2HWVA 4AIDA 1W5TA 4LB5A 5HLIA 3J80Z 2FRHA 4CCLA 3ZQQA 1JTYA 2DBBA 1RR8C 4MGRA 5C4JJ 4R2AA 3ECRA 2VQHA 2EOOA 1UAAA 2RPCA 2EV6A 3BG5A 2GAUA 2HOAA 3ERMA 1QU3A 1TTYA 1UFMA 4RH8A 2DK5A 2JXPA 3G2BA 3TP0A 5IYBJ 1T38A 2VB6A 4D7MA 3KP7A 1NHAA 1YW7A 4IKFA 4C2MJ 2ELZA 5TGTA 2DMIA 2MBFA 4HYEA 3HEFA 4PJJA 2DJIA 4KN4X 1ZN2A 4O6JA 2LTPA 1MMSA 3DJWA 2DYRH 4JI3E 1QVUA 2KMUA 3TW6A 4MLVA 3VDXA 4I6ZA 4U0WA 1JHHA 1IXCA 2QSGX 2EMAA 4MNUA 4YEJA 1X19A 3RQIA 4OX9E 4QSHA 4WPYA 3OR2C 2YU8A 3ZMDA 2EZLA 1GXQA 3MN2A 5HDKA 2WY7Q 4A3CJ 5J8FA 3FXLA 2LH9A 3KETA 2EORA 2IEKA 1FP1D 2XAHA 3OYJA 1Z9CA 3BJAA 1X4PA 4L5JA 3FZVA 1HXDA 3GVAA 2L3JA 1YYWA 1UHMA 5M5WJ 5LGTA 2RS7A 1MDMB 4U88A 4RMNA 2VBXA 5E1XA 1ZTRA 4N9HA 2FE3A 5D8KB 1HA8A 1OISA 4NZVA 2ZSHB 2DT5A 4AD9A 4M3GA 1SAUA 5FD6A 3HKZN 5FKLA 2H09A 5IYDJ 2W82A 3NWTA 2AO9A 2QVOA 2FBHA 3REOA 3VEPA 2R7WA 2H1KA 2CFXA 2EOEA 2VE9A 3H92A 3IC7A 3HSEA 1IF1A 3DU6A 2VOOA 4M6XA 2Q8KA 2JOXA 4D5FA 3GTMJ 2AQFA 2HPMA 1OKRA 5A2QC 4IHTA 4M6VA 4JI6E 1BJZA 2J7JA 3K4CA 3GTKJ 1UZCA 2Z9OA 1MGTA 1AU7A
chains in the Genus database with same CATH topology
1LNWA 2P7VB 3RKYA 4YFXF 2M87A 4MQVA 4BYYA 1ZRFA 2DFIA 5CVRA 4EM0B 4KICA 3WTYC 1S7OA 4IJAA 4IRGA 4I7HA 3WTSC 3ZPLA 3O3KA 3C18A 2FOKA 3B73A 2L01A 1XGNA 4JBAA 2BYVE 4D0PA 2J5PA 5HVQC 1EH7A 3C7JA 4LG0A 1KQ9A 5LEKA 4M71A 2PN6A 5JI6A 4RGRA 1JE8A 3BPVA 2M30A 4OMYA 2ESNA 3FMSA 1FYMA 1YO5C 2A6EF 4ZYDA 1W7PD 1FLIA 3WGHA 1R23A 1SD4A 2E7XA 4LB6B 1K78A 4O5VA 4MHGA 1TW3A 1J59A 4M9XA 2J5OA 4LMYA 3F3XA 1BOAA 3CLOA 1IN8A 3MQ0A 3IKVA 4P9FA 3WU1B 2GA2A 2OA4A 1YFHA 2DW4A 3DP7A 3I71A 1J7KA 4XBFA 1J9IA 2DPUA 4R1HA 1ZGAA 2YSRA 1W5SA 2V6CA 4RS8A 2H6CA 3S2WA 1U2WA 1FSHA 3ABUA 5KVRA 5F64A 1Z6RA 2LDUA 2XROA 3VODA 5D4RA 3HSFA 4LJZF 2CYYA 4ETSA 4LFUA 3U9GA 2JTVA 2JPBA 2V79A 4BHPA 2BV6A 1O7LA 4M9SA 1MDMA 1TQIA 3OV8A 3M8FA 4S05A 4KMFA 2A3SA 4H0EA 1YS7A 2H27A 3WODF 3DFGA 2P5KA 1R1UA 4UV8A 2ZBKA 3JAMZ 1ZREA 3GZ5A 4HBLA 1S8NA 2NNNA 4IRIA 1IZ1A 3R60A 3TKYA 1KA8A 3ZN0A 2RQPA 4P55A 4A6EA 2K86A 3GYHX 2XAFA 2PMHA 2G7UA 4OOIA 5HS9A 5DCMB 2XAQA 3GWZA 2P4WA 4LLNA 3D0SA 2RN7A 2JPCA 1BIAA 2VODA 3EQLF 3RPUA 5A2QK 3O6BB 3FXUA 2HTJA 1XMKA 3HHHA 5AIQA 1T39A 2FNAA 1XCBA 1B9NA 2M45A 1SFUA 2QUFA 3HIFA 1OYYA 4GGGA 2OAZA 3EYIA 2LF7A 2RC4A 1K7AA 4G7OF 4M74A 3P9IA 5CYVA 2QQAA 1HKQA 3BROA 4AWXB 1W7PB 1T98A 4XSZF 1BIBA 1RUNA 4E70A 4I98B 4ZYHA 4S04A 1U5TB 1D5VA 1D8KA 1K6OA 1R1VA 5ICEA 3KCCA 3IKTA 3EETA 4ESBA 2A07F 3LQQA 3W6JB 5HOOA 1ZG1A 4A12A 1ONVA 2VBWA 1J0RA 2MLKA 1GHCA 4Y15A 3GEZA 1YS6A 5D5XB 1FYKA 3ZMUA 3DKWA 3L2CA 3Q9VA 3V7CA 2XASA 4A0ZA 4XLPF 2F5CA 1KGSA 3M8EA 4QWQA 2YU3A 4MQ9F 3KP4A 3QPHA 2L02A 5L3DA 2XGXA 1G6NA 1KU7A 2GIVA 3ROUA 1O7FA 2F2EA 4HOBA 1ZG3A 4PGHA 4XSXF 4B09A 2LF8A 2W24A 3E6MA 5ILVA 4PDKA 1F5TA 2EFNA 4UVAA 3QU3A 5F6FA 5J6XA 3RKXA 1T0FA 3K1MA 2GQQA 2QM3A 2VXZA 2TDXA 4EGYA 1P4WA 3HRMA 1OR7A 4A2UA 1MJAA 4IHSA 3HHGA 3ZP5A 4WWCA 1YG2A 5BS6A 4U7DA 3CUQC 4JK1X 4RB0A 5J8CA 5DCMA 3TGNA 2MA3A 1IW7F 2F5EA 1WQ2A 2FBIA 4HAMA 1B59A 3PQKA 3R6SA 4HLXA 3ECOA 3WTUC 2G7HA 4A6DA 5FLXZ 3HRSA 5FB2A 2FMYA 4EGZA 1WRJA 3BPXA 2IA0A 2HOEA 2IPQX 4HQMA 3HOSA 4DQ2A 4CDGA 2PI0A 4IF4A 4RAZA 3I59B 5JVTA 2HKXA 2FEZA 1G3YA 3V8JA 1SD6A 5FFXA 3TO9A 1JGSA 1W7PA 5D6FA 4WXHA 5JFRA 2LSOA 4L9TA 2EFOA 5D8LB 3W6KB 1U5TA 5D6EA 3V7RA 1IN6A 1ZG5A 2VT2A 3HTUA 4GCVA 2EK5A 3QRFF 3EUHA 4U7BA 4BQAA 3D5LA 4IVNA 4IRHA 3LA7A 5K5RA 1ZARA 3WGIA 3IHUA 3CJNA 3DV8A 1R22A 1UB9A 3FMRA 3P7NA 5L3CA 2MH9A 1Q1HA 1VTNC 5A2QZ 1FC3A 2HDCA 5DEQA 3BWGA 3V7SA 2A69F 4BAYA 3ABTA 5E18F 3RTRA 3PQJA 1T6SA 1TNTA 3I4PA 3MZYA 1RIOH 5TJJA 5HS7A 3KE2A 4B8XA 5E8GA 5K5QA 2K7LA 5FO5A 2RKHA 1XSVA 2KIMA 1U6GA 4XRFA 2EA4A 1ZRCA 2O03A 5BPIA 3TDUC 4UVCA 4HX4A 3EDPA 2IJLA 2CG4A 3DPTA 4KIGA 2MC3A 1FY7A 4FX0A 2Q0OA 3SFZA 3LWFA 3F21A 4R8HA 2HS5A 4WXDA 5LRRA 3KP3A 3E5QA 3L9FA 3TQNA 1YLFA 4HW0A 4U0YA 1BBYA 3RIRA 3WGGA 1XSXA 2RVCA 3FMQA 4OIQF 4RAYA 1G3TA 2UZKA 1B6AA 4HV6A 1BM9A 5HLHA 1TQPA 3KZYA 3BJ6A 2O6GE 2P6TA 1DPUA 4CHUA 2B0LA 1XGSA 2QWWA 3QP5A 4G94A 3J81K 3RDIA 3JSOA 4K2EA 1T2KA 3I59A 5HLGA 3IWFA 3RYRA 4LK0F 1BI1A 4ON0A 2VONA 1KU9A 2DU9A 3I5UA 1LEBA 4DNCA 1P6RA 2HQNA 5K1YA 4M73A 5BQTA 4RGXA 2KRFA 3H3UA 4BXUA 1STZA 4A5MA 3WTTC 2PG4A 1KQ8A 4EMSA 5JHUA 2WV0A 1Z7UA 1I1SA 5AONA 1XB4A 3E97A 1R1TA 2O0YA 3FWEA 1QO0D 1A04A 1HKSA 1O3SA 5IT9K 4HLYA 1HQCA 2VBZA 2Y0MA 2PBIA 2D2WA 1H0MA 3MWMA 1CF7B 5EEGA 5LHIA 1XCVA 3L09A 3ZQ7A 1HW5A 1DP7P 1ZRDA 2R3SA 4LK1F 4AIKA 2HQRA 4ENJA 3O2PE 2W57A 5AIPA 2A61A 3DQVC 2OZ6A 1U8RA 3C3WA 4BHCA 1QNTA 5ILSA 5CLSA 3F23A 3QAHA 4RB3C 2JT1A 2PLYA 3I64A 3FM3A 1I6XA 3TOAA 2JSCA 3VFZA 4EJTA 2HZTA 5CVUA 2YPRA 2QBYB 4LLGF 3PFIA 2DO7A 2O61A 2FMLA 1DPRA 1ODDA 2V1DA 1GXPA 3T1BA 2HYFA 1RNLA 2X0LA 3F8NA 2P8TA 4L18B 1XDUA 3C1DA 1MJBA 2ETHA 3RPQA 3I53A 2AS5F 3JSPA 1FBUA 2EFWA 3TDZC 2L4AA 2NYXA 1FT9A 2Y48A 2H94A 1YQAA 2EWNA 1C0WA 4HF1A 3K0LA 2L4MA 5DUIA 4O3MA 3E3VA 3MAJA 2BGCA 2W84A 1B4AA 2MH2A 1IN7A 2LNBA 2CWEA 1L0OC 3ISPA 5ED4A 2R7FA 2ACJA 1IUYA 2PFBA 1USSA 2DK8A 2JZYA 1QZYA 1OPCA 3KLOA 4Q4ZF 1BI2A 3QU6A 2F5DA 1HKTA 4FX4A 5LHHA 2ZNZA 2FBKA 1LEAA 1CGPA 5L3GA 3QPTA 4L9VA 1AWCA 2LKPA 4JQFA 1EV7A 1FOKA 1R00A 2CQKA 3LFKA 2K4JA 4CO8A 4L9JA 3IRQA 3FF5A 1BC7C 4OINF 3EYYA 1CF7A 4FT8A 2A5YB 3G73A 2RV8A 2EFQA 3F22A 5ILUA 2GXGA 3KLNA 4EJOA 2CW0F 3HOTA 1J75A 5E20A 3ZMVA 5JR3A 2V9VA 3J81Z 5ERIA 2IVMA 2STWA 3RJPA 3SZTA 2NNYA 1XN7A 2KKOA 1EH8A 1KYZA 4Y17A 1F9NA 3T8TA 5D5WB 5DDGA 4EM1A 1YIOA 5LLQA 2ZKZA 3BDDA 3H3ZA 3IWZA 2BE5F 1E2XA 4I0AA 4G9YA 1R7JA 2ZMEB 2YR2A 2QBYA 2H6BA 1RUOA 1ZGJA 2OZUA 4G7ZF 2Z5UA 4A0XA 2QZ8A 4UXNA 3V4GA 5IT9Z 2ZJ2A 1WWXA 4BH9A 4A0YA 2E1CA 3B02A 4HX8A 1YW8A 2ADUA 2DTRA 1R5HA 4L0YB 1TNSA 3F6OA 4GXOA 2VBYA 4CXFA 2MD5A 3U1DA 5L3FA 5E8IA 5KK1A 1F1ZA 1R58A 4AVPA 3GFIA 4YFNF 2PEXA 1LDJA 2FQ3A 1W4MA 4Y13A 3TO6A 3K1PA 2HTSA 1Z6TA 1BN5A 1S3JA 2O3FA 2WTEA 2A68F 4UNOA 2WWYA 3L00A 4CZZA 3HUGA 4NB5A 3ULQB 2IP2A 3F72A 2IT0A 1PP8F 4I2OA 3WTXC 2P5VA 3IRRA 2X4HA 4ZZLA 1WI9A 5CVJA 3ZMSA 2EV0A 4FHTA 1RI7A 1WSUA 1V3FA 4ENNA 3E5UA 1X3UA 4EJWA 1FSEA 1IXSB 2M1BA 4EV0A 2F5FA 4G6DA 4XLNF 1BI0A 2Z3YA 4KMUX 3VB2A 1Z91A 4ZYEA 2ZNYA 1BJAA 2Y75A 2CSOA 4KDPA 3J7AO 2QLZA 2L3DA 3T0YA 5ICCA 2D1HA 6PAXA 3KP2A 4LLLA 3L7WA 4BHBA 3LAPA 3K2ZA 3U2RA 4HQEA 1I27A 1XSDA 3DXJF 2E1NA 5LEJA 3GFMA 3WG9A 1E17A 1ULYA 3DEUA 2ZMEA 1QPMA 2QQBA 3FX3A 1LDDA 2JRTA 2FNPA 4KA4A 2ZO4A 1GVJA 4IXAA 5ICGA 3P9KA 1FWZA 4OIRF 5BPDA 3NQOA 2GA1A 4KNYA 2HYGD 3SHFA 2XUBA 3GZ6A 4ENKA 4I01A 2STTA 3HYIA 4WF2A 1I5ZA 1ZHFA 4RB2C 3JAMK 3ELKA 2K4BA 4KIFA 1REPC 4CYDA 1FZPB 2IW5A 3JTGA 2NS0A 1R5GA 4EQQA 2FSWA 2KIUA 4RB1A 3RYPA 2L54A 5D5UB 1FYLA 1ZLKA 2XIGA 3P9CA 5IT3A 5FGMA 2OU2A 1MD0A 1F4KA 5L3BA 2IA1A 3F8CA 5DYMA 4P5OA 1D3YA 3FXQA 2PMUA 4ZH4F 1SAXA 1IRGA 2EFPA 4N0BA 1LVAA 4G6QA 3G3ZA 4YFKF 2A6HF 5ICFA 2P5LC 1V4RA 4HDUA 3N97A 2IRFG 2VN2A 3QOPA 5H6RA 3M9AA 3CUOA 5DD8A 1RZ4A 1S29A 1SFEA 4HF0A 4RGUA 1KU2A 3R4KA 1H9GA 3LAJA 3MFKA 2XAJA 2Z33A 1SMTA 4RGSA 5LGNA 4MEXF 4I02A 1IAWA 4WXCA 1XGMA 2KJBA 2VE8A 1DDNA 2XKPA 3BZ6A 1YTYA 4EVIA 4I0BA 3E6DA 3GF2A 2OQGA 5E1ZB 4KUMA 3CUQB 2E7WA 3JTHA 1ON2A 2UWMA 4HV5A 1JHFA 1U5TC 3WE2A 2C6YA 4ASNA 4IPAA 1FX7A 4MTEA 2G9WA 2XKOA 1L3LA 4M9ZA 3HRTA 4L0ZB 4P9UA 3KFWX 3IL2A 1XMAA 1HW1A 3CDHA 4LD5A 4KFCA 1USTA 2COMA 3LQRA 4U0VA 2FU4A 2XVCA 1P4AA 1TBXA 3WTZA 5HDGA 3NRVA 3I0TA 1XDSA 2QENA 1AOYA 1Z05A 2OBPA 1KYWA 1DUXC 5HS8A 1IXRC 2ZXJA 5DUKA 1G3WA 2RGVA 3KZZA 2VC0A 1OYIA 1WKMA 4HZFA 3WE3A 2XRNA 4A5NA 2XAGA 1LB2A 1IN5A 2DAOA 2UXNA 3CO6C 2PJPA 1LQ1A 2D45A 3F8MA 4M72A 2Z99A 5CVVA 5LBQA 3ZMZA 3DPLC 2V1XA 1ZH5A 3N4MA 4EJVA 2BEOA 1HBXG 1IN4A 2VT3A 1O3QA 4OIOF 1PDNC 2DPDA 2PQ8A 4UHTA 1I1GA 3ECHA 5L3EA 1HSJA 2GXBA 4OU0A 1FPQA 5FLXK 1HW2A 3SXYA 3TO7A 4ESFA 2QYOA 4YG2F 2P7CB 3I54A 4P96A 4HF2A 2M5WA 1JXSA 3LA3A 4OIPF 4YIFA 2NAZA 3MZHA 1UHWA 1FBSA 3E6BA 1FP2A 1LDKB 1IRFA 4ESJA 5DD4A 4BNCA 1ZAOA 1BI3A 3LA2A 4GYIA 2MLGA 5DV5A 4KT5C 5E1WA 4CGZA 3COAC 2DI3A 2BBYA 1EH6A 1O57A 1YYVA 2VC1A 3CUQA 2HKOA 1U3EM 3RI4A 3QP6A 1MJ9A 1ZLJA 2KIFA 5H6QA 3Q9SA 4MTDA 3T8RA 1QGPA 4NHJA 4UVBA 3M7GA 3FM5A 2HEOA 3KEQA 2NRAC 1KQ0A 1R36A 3FXRA 3F6VA 4QLCU 3FHZA 1XD7A 3SQNA 1P4XA 2FA5A 3R61A 4Q5SF 4KN7X 1ZYRF 3V8KA 2HFHA 2O8XA 2EV5A 1ON1A 4GO1A 2P6SA 2D1VA 1OMIA 1OYWA 3M1EA 4HX7A 2EA2A 2HR3A 3J80K 2ZFWA 5FFZA 3TOBA 2XV4S 3BOQA 3KEOA 3ZMTA 1FNNA 1PP7U 3Q5FA 3MEXA 3GFJA 3HTSB 2R7DA 4UV9A 1J2XA 4YIIA 3GXOA 1G4DA 4PGGA 3BP8A 1MKMA 4OMZA 3HRUA 3AAFA 3F8FA 2QQ9A 4L5IA 2KJCA 1SFXA 3SZPA 3V8LA 4MEYF 3K69A 4N9IA 4R79A 3K1NA 2VOPA 1MZBA 1UCRA 1LJ9A 2WC2A 2YX7A 1G3SA 5DCFA 3KP6A 2YX4A 4I09A 4G8XA 1TQMA 2K02A 4AIHA 2XHKA 5H20A 4M6YA 4G7HF 3K9TA 1K79A 4HDVA 5E17F 1U78A 2EJRA 1O3TA 3RKWA 2ISYA 3GUDA 2OQRA 3MCZA 3ERED 4NQWA 5FD5A 4TV7A 2OD5A 4GYGA 3WTVC 3E5XA 1B1BA 4AIJA 4Q48A 4ENMA 4KYWA 2AXLA 1PUEE 1SD5A 1QQIA 3E6CC 3OOPA 5BOXA 3CO7C 3T5XA 2ZCWA 2DQLA 4ZZDA 4WCGA 4ZYGA 5F1RA 3NEUA 5TRDA 1YW9A 2ISZA 3GLXA 2W85A 1S7AA 5CJ9A 2DLLA 4LGWA 3VOEA 3R0JA 2K27A 3GO5A 2HGCA 3ZN1A 1B9MA 4KIBA 1FBQA 2ESHA 2FF4A 4PCQA 3WU0A 1J5YA 3GW2A 3GFLA 5D5VB 2Q2EA 4UUVA 4WK8F 1KU3A 3CTAA 5CVIA 1Y0UA 1S6LA 3LSTA 5BMZA 3DF8A 5LRSA 2DQRA 3WTWC 2CO5A 3KP5A 2W25A 5HDNA 4Q47A 2IA2A 1SMYF 4HA8A 2UXXA 3JW4A 5D4SA 5K5OA 2M8EA 1XGOA 1TLHB 1TW2A 3I58A 4LG0B 3R0AA 1QBJA 5EEHA 1HSTA 4EJUA 2CGPA 2RDPA 5LGUA 1BC8C 3BY6A 2GWRA 2ELHA 4EM2A 4L9NA 2FXAA 3GX4X 1O3RA 2GZWA 4Z2YA 3BJOA 4PZJA 1SD7A 1QZZA 1Z1DA 1P92A 3ML6A 3F8BA 4F7ZA 1K78B 1H9TA 5LHGA 2V1UA 3HSRA 2EB7A 4WX9A 4CICA 1D8JA 1P2FA 2RNJA 2HWVA 1W5TA 4LB5A 5HLIA 3J80Z 2FRHA 2DBBA 4MGRA 2EV6A 2GAUA 1TTYA 1UFMA 2DK5A 1T38A 3KP7A 1NHAA 1YW7A 2MBFA 4HYEA 4KN4X 1ZN2A 4O6JA 4U0WA 1JHHA 1IXCA 4MNUA 3ZMDA 1GXQA 5HDKA 5J8FA