1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
1ZH5A 1HW5A 1S7OA 4BHPA 5DD4A 4Q5SF 1W7PA 4ON0A 2HDCA 3T5XA 1IXCA 2EWNA 2K4BA 2W84A 2VBWA 3K1PA 4EM2A 1V3FA 1S29A 1YFHA 2EFWA 1FX7A 3I59A 3KP6A 4ENJA 3GF2A 4YIFA 3GFIA 3G3ZA 5LHHA 1PP8F 4ZZDA 3L7WA 3JAMK 4M9ZA 2F5DA 3IC7A 1Z91A 1CF7B 1T98A 2OZ6A 4LK1F 1T2KA 4EQQA 4N9IA 2Z5UA 3FMSA 3Q5FA 1TNTA 4ZYGA 2J5PA 3HOSA 1CGPA 2CGPA 3WE2A 3BDDA 4MHGA 3EYYA 4I01A 1TQMA 4N0BA 2P4WA 1KA8A 3FXQA 2JZYA 1B1BA 3R0AA 2X4HA 4KIGA 2FEZA 5CVIA 5F1RA 4L18B 1O7FA 1P2FA 1O57A 3R61A 5IT9Z 4RAZA 2H6CA 2HOEA 2RC4A 2XAHA 1K78A 3F21A 5HLHA 2NNYA 5BMZA 4DQ2A 2P7CB 3CDHA 1Q1HA 1D3YA 4O3MA 5E8IA 1VTNC 4Y17A 1U2WA 1JE8A 1EH8A 2DAOA 1KQ8A 4H0EA 2KJBA 4KIFA 4EGZA 3MFKA 2HKXA 4KMFA 5ILVA 4OINF 4Q4ZF 1P4XA 4L9TA 2NAZA 4GGGA 1UFMA 3GWZA 3KP7A 4ZH4F 2MD5A 2MH2A 1U5TB 2M1BA 5K5RA 4MEYF 2DI3A 1H0MA 3DQVC 2RVCA 4I98B 3KZYA 3ZMVA 4E70A 1UB9A 1W5TA 2M30A 1KU9A 1GHCA 2W85A 5HS8A 3Q9SA 3BPVA 2UWMA 2EFPA 3J7AO 4ENKA 4MNUA 3E6BA 3WODF 3V7RA 2QQBA 4OIQF 1FPQA 1YW8A 2CW0F 3PQKA 4KUMA 3R60A 5L3CA 4G7HF 2HKOA 3K2ZA 3IRRA 5E1XA 4G6DA 2F5FA 2EJRA 3F6VA 1I6XA 2GXGA 5LRSA 1O3SA 2H94A 4KN7X 1SMTA 5J8CA 3PQJA 5EEHA 4TV7A 3MWMA 2P7VB 5K1YA 4ESFA 5L3GA 3CUQC 1XGOA 2BYVE 4OIPF 3U2RA 2CFXA 2H09A 4Y13A 5BPIA 1XMAA 3K0LA 4UV9A 4UUVA 2BEOA 3KLOA 2GZWA 4MTDA 1K79A 3QU6A 4RGRA 2Z33A 2QQAA 1GXQA 3DF8A 2K02A 3L00A 1UHMA 3WE3A 2HR3A 2PI0A 1DPRA 2E1CA 4FHTA 2QZ8A 3ZMTA 5LGUA 3S2WA 2M5WA 2HZTA 4BNCA 5HOOA 3RIRA 4LG0A 3VOEA 2ZCWA 5JVTA 4PZJA 4GO1A 1HW1A 3HUGA 3ABUA 4LB6B 4HA8A 2A07F 3LA3A 3U9GA 3NEUA 2PFBA 2BBYA 2WWYA 4KMUX 3FHZA 2Y75A 3PFIA 5LGNA 2JT1A 5E18F 5E20A 2R7FA 3VEPA 3HSFA 2F5EA 2EFQA 3MAJA 5IT3A 1D8JA 3I64A 5JFRA 3WTYC 2ZNZA 3I71A 1C0WA 2Q8KA 1ZG5A 4A0ZA 4EV0A 1QBJA 2R7DA 5DD8A 1JXSA 3D0SA 1T6SA 1G6NA 3RKXA 2A6EF 5ICFA 1STZA 1TQPA 2OQRA 2GA2A 1XDSA 3BJAA 3GO5A 2H6BA 3J81Z 5L3DA 3P9CA 5L3BA 4RS8A 3SQNA 5A2QK 1T39A 2V1DA 3RPQA 1FC3A 2QYOA 2QBYB 3LA7A 1FYMA 2IRFG 3JTGA 4L0YB 3I53A 1G3SA 4ETSA 2XIGA 3EUHA 5F64A 2UZKA 5CVUA 4RB1A 3FX3A 4PCQA 4Z2YA 2Q2EA 5CVRA 5FD6A 4UXNA 2V1UA 4ASNA 2XAJA 3ZMSA 1BBYA 4ESBA 1H9GA 3O2PE 1Z05A 1YW7A 2LSOA 1V4RA 3V7SA 3G73A 1R5GA 1BI0A 4JK1X 4YFXF 3QP6A 3CUQB 1PDNC 2VBXA 4NQWA 3I58A 4IRHA 5H20A 3OOPA 2QQ9A 1SD5A 2DW4A 4HF2A 3GZ5A 3ZMZA 4B09A 1RZ4A 3BPXA 1S3JA 2ETHA 3M8FA 1AWCA 3WTXC 3LAJA 5LGTA 4HQEA 1XDUA 5E17F 2K86A 5AIQA 1I1SA 2IW5A 2F2EA 2KIUA 4AD9A 1BI1A 1W7PB 2X0LA 3DP7A 4BXUA 3WTWC 2WC2A 1R22A 1B9MA 2STTA 2P5VA 2VE8A 5CVJA 2JRTA 4L5JA 2CQKA 4YFNF 1ZGAA 1JHFA 2DO7A 3BZ6A 2VXZA 3I59B 3NQOA 3U1DA 3K69A 3SXYA 1YQAA 2Y0MA 2MLKA 1ZAOA 3EQLF 2PMUA 1YS6A 4P96A 4JQFA 3HRTA 1U6GA 5DCMA 3TQNA 3RJPA 5F6FA 2VBZA 5HDKA 1IN4A 3R4KA 3GFLA 3HTUA 3I0TA 3FZVA 2RV8A 1HW2A 3ULQB 5ICCA 1KYZA 1YYVA 1KQ0A 4PGGA 2FRHA 3GXOA 2V6CA 5CVVA 3LSTA 4IVNA 5FFXA 4HZFA 3HSEA 3EETA 2GQQA 3QAHA 4WCGA 2O8XA 2GIVA 4I2OA 1IN6A 3ECOA 3C3WA 1HSTA 1SFUA 3ABTA 2RGVA 3KP4A 5D5XB 3BOQA 2HS5A 5LEKA 2EV6A 2JPCA 4OMYA 1K7AA 4DNCA 4BHBA 2QM3A 2OBPA 1U3EM 2AS5F 4GCVA 3REOA 3DEUA 2VODA 5AIPA 1FYKA 4G9YA 4L0ZB 2MLGA 3RKWA 1RNLA 4A12A 1U78A 3J80K 4D0PA 1IN5A 4LLLA 1OYWA 2CO5A 5JI6A 3BJOA 2YX4A 2XAGA 2XRNA 4EJVA 3F6OA 4XBFA 1BI3A 2XAFA 5D4RA 4BQAA 1J2XA 4O5VA 1QPMA 2XKPA 4M74A 2IA1A 2OQGA 1REPC 5D5UB 2Z3YA 3L9FA 3IWZA 2HGCA 3IKTA 4JBAA 2IT0A 1QZYA 3WGIA 3WTZA 1IW7F 2BV6A 2TDXA 3KP5A 4HX7A 1LB2A 5EEGA 3JW4A 4CXFA 4XSZF 2FBHA 3WGHA 3VODA 4OIOF 2KIMA 5CLSA 5HS9A 1DP7P 3F3XA 2KIFA 1WI9A 3F23A 1BC7C 1IRGA 1E17A 1BJAA 4U7DA 1F1ZA 2IP2A 5FLXZ 4LD5A 3WU0A 5IT9K 4HX8A 1ZG1A 3GLXA 1MDMB 1SD4A 4HOBA 4AIHA 2FF4A 1D5VA 2D1HA 1MKMA 5DEQA 1P92A 2P5LC 1R23A 2RQPA 1ON2A 2RN7A 3JTHA 3MEXA 2EA2A 2PLYA 1WWXA 5FGMA 4EGYA 2E1NA 2A61A 1Z1DA 3VB2A 4LLGF 6PAXA 4ZYDA 4RB2C 5AONA 5HLIA 2FMYA 1FY7A 3SHFA 3GFJA 4M72A 1XB4A 2E7WA 5BQTA 4GYIA 1YLFA 5FD5A 2DK5A 3GVAA 1USSA 3JSOA 2STWA 3F8CA 2VE9A 4EJWA 2FOKA 4HW0A 1QO0D 2DQRA 2IJLA 1IXSB 2JSCA 4G8XA 2FNPA 2V1XA 3CTAA 3F8NA 4HV6A 1MD0A 1U5TA 4M6YA 3D5LA 4IHTA 3B73A 3V8LA 2Y48A 3H92A 1EH7A 3RPUA 4I0AA 1XCBA 2A69F 3ML6A 4LG0B 1G4DA 2UXNA 4I0BA 1F9NA 3ZMDA 1ZG3A 2RDPA 2VC1A 3QU3A 1UCRA 2NNNA 2A6HF 3WGGA 1ZYRF 2A68F 2QENA 2DLLA 2W25A 2OA4A 1BN5A 5E8GA 1HBXG 1IXRC 1B9NA 4EJOA 2EB7A 3DKWA 1XGNA 4Y15A 4FX0A 3N97A 1F5TA 4A5MA 2L54A 3F22A 3FXUA 3FXRA 1AOYA 1QZZA 4BH9A 5LBQA 5HLGA 1J5YA 4HDUA 1J75A 1KQ9A 2GXBA 1PP7U 2YPRA 3N4MA 4LGWA 1WKMA 1MGTA 1IRFA 1T38A 4IJAA 5ICGA 3TGNA 1I5ZA 4GYGA 1U8RA 2O3FA 2ZMEA 4YG2F 3MQ0A 4CZZA 3HIFA 3GFMA 2NYXA 2ZXJA 2FBIA 3WTTC 2FMLA 4IRIA 1LNWA 2P8TA 2V9VA 5DUKA 3DXJF 1HQCA 1TW2A 2Z9OA 4K2EA 4XRFA 1LDKB 4ZZLA 2K27A 1FSEA 2M8EA 2VT3A 4S04A 4CICA 1TLHB 4HAMA 4UVBA 1YS7A 2ACJA 2E7XA 4OMZA 2D2WA 2ADUA 3GX4X 2PMHA 1L0OC 3CO6C 1ZN2A 3GEZA 3O6BB 3TO6A 1GXPA 4KIBA 3BY6A 1NHAA 2JTVA 3HSRA 2G7HA 4RGSA 3M1EA 2HQRA 2IVMA 5KK1A 1G3WA 1YO5C 3BJ6A 4M73A 1SMYF 3B02A 3Q9VA 1TBXA 2ESHA 2MH9A 4NHJA 3LFKA 4UV8A 1YW9A 5L3EA 3CLOA 3QOPA 1MJBA 4N9HA 1Y0UA 1BIBA 5DUIA 2CG4A 5JR3A 1FBQA 3J81K 3CJNA 3ELKA 1H9TA 1FYLA 3LQRA 3TOAA 3ZQ7A 3FMQA 1XCVA 1UHWA 4AIJA 4UNOA 3FM5A 3WU1B 2COMA 5K5OA 1FSHA 1R36A 1TW3A 2HFHA 1D8KA 1ZLKA 2GWRA 1E2XA 3R6SA 4EVIA 4U7BA 2GA1A 3KZZA 4I09A 1O3QA 2ISZA 1W4MA 1FBSA 2HYGD 3C1DA 3KETA 1OKRA 3E5QA 3ROUA 3MCZA 1XGSA 3P9KA 4PDKA 1OPCA 5BOXA 1R58A 3DFGA 2QWWA 2FNAA 5DCMB 3QRFF 4KNYA 3T0YA 1Z6RA 2CSOA 4IRGA 2G9WA 2XAQA 4MTEA 2KJCA 1DUXC 1QGPA 2IPQX 3KEOA 2XASA 2FA5A 4QLCU 3P9IA 2Q0OA 1BM9A 2NS0A 2L01A 2XROA 1FNNA 4G7ZF 4QWQA 1LVAA 3F8FA 4MQVA 2YSRA 3GUDA 3E5UA 5HVQC 3RDIA 2PG4A 3IRQA 3FM3A 3TO9A 1YTYA 2L4AA 2M45A 2VONA 4KDPA 3C18A 1ZLJA 1XMKA 3RTRA 3TDUC 1LEAA 3F8BA 3HHHA 2OU2A 2LKPA 1FP1D 5E1ZB 2BE5F 4MEXF 1IAWA 1HKSA 4A5NA 2MA3A 4AIKA 2Z99A 1WRJA 2P6SA 1I1GA 3WTVC 1ZGJA 3GYHX 1SFEA 3LWFA 5J8FA 3V8KA 4L9NA 2LF7A 1BIAA 2DT5A 2MC3A 4P55A 3IL2A 3ZN1A 5TJJA 2GAUA 3JAMZ 4WK8F 2EK5A 3KE2A 1FZPB 1B6AA 1BC8C 2BGCA 2HQNA 2FE3A 1LDDA 4LFUA 5H6QA 3TOBA 3W6JB 3FWEA 5HDNA 1K78B 3WTSC 2A5YB 5HS7A 2O03A 3KP3A 2NRAC 3J80Z 5ERIA 4WX9A 3HOTA 4B8XA 5ED4A 2ISYA 1MJ9A 1YG2A 1TQIA 2H27A 1RIOH 1YIOA 4I02A 3AAFA 4EM0B 5D4SA 2KRFA 1QQIA 2G7UA 3K1NA 4HDVA 4BYYA 1FWZA 1BI2A 4BAYA 1R1TA 1OR7A 3JSPA 5DYMA 2OD5A 1IF1A 4U0VA 2O61A 1FOKA 4RGUA 4PGHA 2YR2A 4KA4A 4ENNA 4AVPA 3ISPA 2RKHA 4M9XA 3IWFA 3CUOA 2M87A 4LB5A 3BROA 3WG9A 2LDUA 1ZARA 3GZ6A 3GW2A 3LA2A 2DPDA 3HRUA 4Q48A 1SFXA 2HTJA 1MJAA 1FBUA 4ZYHA 1USTA 1S6LA 4GXOA 1B4AA 4LJZF 1ODDA 4RGXA 2QUFA 3WTUC 1CF7A 2HEOA 1Z9CA 2VC0A 1ULYA 1HKQA 2XV4S 4HLYA 2ZNYA 3HTSB 3RI4A 5HDGA 3T1BA 2XVCA 2HTSA 3M8EA 1IN8A 3KP2A 3F72A 3BP8A 3HHGA 3K1MA 1DDNA 5D5WB 2WTEA 3W6KB 2FSWA 2W57A 1SD6A 4HX4A 4YFKF 3ERED 1FP2A 2PJPA 3I5UA 4OOIA 5FLXK 3H3ZA 4HYEA 4LLNA 3MZYA 4OIRF 3DPTA 2D1VA 1XSDA 2DU9A 4EMSA 5H6RA 4UVAA 5D8LB 2XGXA 4CDGA 5ILUA 2L3DA 4I7HA 4L5IA 3M9AA 3P7NA 3SZPA 4CGZA 3KFWX 4IXAA 1I27A 5TRDA 4KFCA 4G7OF 5ILSA 1LJ9A 1MDMA 4OU0A 3CO7C 3HRMA 4HLXA 4EJUA 2UXXA 1G3YA 1XGMA 1O3TA 1R1UA 3IKVA 4O6JA 1Z6TA 3HRSA 4BHCA 1XSVA 2LNBA 5D6FA 2PN6A 2IA2A 5BS6A 1ZREA 1O7LA 4A6EA 2MBFA 2V79A 1HXDA 1G3TA 3TKYA 5K5QA 3DPLC 1OMIA 1ON1A 2ZMEB 1R5HA 2QLZA 5FFZA 3T8TA 1W5SA 4Q47A 2B0LA 4LK0F 4U88A 3BWGA 1LQ1A 5DDGA 5DV5A 2CWEA 2K4JA 3IHUA 1IZ1A 3F8MA 1QNTA 3K9TA 2DFIA 1JGSA 2EA4A 5E1WA 5FB2A 3LAPA 4ESJA 1XSXA 3MZHA 1T0FA 4U0WA 4U0YA 1WQ2A 1BOAA 3O3KA 2O0YA 3RKYA 1ZRDA 2DBBA 4YIIA 1LDJA 4F7ZA 4MGRA 4M6XA 2FQ3A 2QVOA 4NB5A 1O3RA 1P6RA 1S7AA 4IPAA 3DV8A 4HQMA 5L3FA 1PUEE 2IA0A 1KU2A 5ICEA 1A04A 1TTYA 3V7CA 4WXDA 3E6MA 1EV7A 3R0JA 2DPUA 2R3SA 5LLQA 4G6QA 2VOPA 2ZJ2A 4L9VA 3KCCA 3RYRA 4KICA 4A6DA 2F5CA 4RB0A 3SZTA 2VBYA 4ENMA 3I54A 3ZP5A 1S8NA 2XUBA 3C7JA 2C6YA 2OAZA 3VFZA 3RYPA 3ZN0A 3M7GA 4CO8A 2PEXA 2O6GE 1J0RA 5CYVA 2ZKZA 5A2QZ 2K7LA 2EV5A 2PQ8A 1SAXA 2LF8A 2YX7A 3E6DA 4IF4A 2A3SA 4WXHA 4UHTA 4G94A 2VT2A 1R7JA 3E5XA 2ZFWA 5D6EA 4EM1A 1J59A 1OYIA 1MZBA 3TO7A 3V8JA 2FBKA 1R00A 4WWCA 3TDZC 3COAC 1R1VA 4HF0A 4P5OA 1RI7A 5JHUA 1JHHA 1ONVA 3LQQA 3QPTA 1GVJA 5DCFA 2EV0A 4M9SA 5LHGA 1L3LA 3E3VA 4IHSA 1HKTA 4A2UA 3E6CC 2PBIA 2J5OA 4M71A 3OV8A 4XLNF 4WXCA 4A0XA 2P6TA 4XLPF 4KYWA 4R1HA 4HBLA 4FT8A 3QPHA 1X3UA 3EYIA 4P9FA 2KKOA 1P4AA 3L2CA 5LEJA 4A0YA 1KYWA 2RNJA 3HYIA 1Z7UA 4RB3C 2DQLA 4RAYA 5D5VB 4KT5C 3ZMUA 5J6XA 5D8KB 1KGSA 1B59A 3L09A 1RUOA 1FT9A 2WV0A 4KN4X 2D45A 3KLNA 2AXLA 3FMRA 4S05A 1TNSA 3ECHA 3EDPA 2HWVA 2ZBKA 3V4GA 2QBYA 1OYYA 2ESNA 2ZO4A 2OZUA 3ZPLA 1KU3A 2HYFA 4ZYEA 3E97A 2FU4A 4L9JA 2ELHA 2EFOA 1U5TC 1ZRCA 5BPDA 1EH6A 2CYYA 1K6OA 1SD7A 2P5KA 4LMYA 3I4PA 4XSXF 4CHUA 1ZRFA 4P9UA 1WSUA 2DTRA 4HV5A 5KVRA 2L02A 2VN2A 1KU7A 2FXAA 2XKOA 4CYDA 2EFNA 4WF2A 5CJ9A 4MQ9F 4R79A 4EJTA 1F4KA 1RUNA 3CUQA 4FX4A 1P4WA 1ZHFA 2W24A 1XN7A 2JPBA 5LRRA 4AWXB 3H3UA 1LEBA 5FO5A 2VOOA 4R8HA 4HF1A 1IN7A 1J9IA 2L4MA 1FLIA 2XHKA 3KEQA 1J7KA 2DK8A 3T8RA 1IUYA 1DPUA 3FF5A 1W7PD 3SFZA 4UVCA 5LHIA 2YU3A 3QP5A 1XD7A 3NRVA 1HSJA
chains in the Genus database with same CATH superfamily
3CCSI 3CMEI 2EMWA 1JUMA 1HW5A 1S7OA 1ZH5A 4BHPA 5IT9C 5CFFE 4RLFA 5DD4A 2ZSHB 4B48A 2WBUA 2R7QA 1W7PA 4XORA 4Q5SF 2BW3B 3FIWA 1SC7A 1D0ZA 1VNDA 4XRSA 4ON0A 3JR9A 2HDCA 4V2FA 1DP3A 3T5XA 1IXCA 2EWNA 4RA2A 3T1YE 2K4BA 3PNVA 2W84A 2BY1A 2VBWA 3CCEI 4C30A 3K1PA 3C4BA 4EM2A 1MMDA 3OIQA 1V3FA 1S29A 3OL4A 5FKMA 1YFHA 2BXYA 2EFWA 2LVHA 1Z3XA 1FX7A 3I59A 3OL3A 1VF9A 3KP6A 2NS8A 4ENJA 2M7BA 3GF2A 3BG7A 2R7XA 5KL7A 1G2FC 4YIFA 3GFIA 3G3ZA 5LHHA 2UUAE 1PP8F 4C2MJ 1OLTA 4ZZDA 3L7WA 1VQ4I 3JAMK 1J09A 4M9ZA 4CYCB 4B3RE 2F5DA 2GOXB 3DJWA 2X1CA 3IC7A 1Z91A 1CF7B 2CRGA 1T98A 4HPQA 1JKPC 2OZ6A 2DMTA 4LK1F 3K10A 1T2KA 4UUTA 4N9IA 4EQQA 2Z5UA 2JPAA 5AC5A 3FMSA 2LKXA 2H36X 2DB2A 1DGCA 3PNYA 1X4PA 3BCAA 3Q5FA 1TNTA 2QSGX 4ZYGA 2J5PA 3AL0C 5HNHA 4HSRA 2WB1A 4GKKE 4F9BB 3HOSA 5A69A 1CGPA 1A36A 2CMPA 1K4SA 2CGPA 3WE2A 4TUIA 3BDDA 2MGQA 5GTHC 1W36C 4R2QA 4HNUA 5IXMB 4MHGA 3EYYA 2HJJA 2YU5A 2HDWA 1TQMA 3DWLE 4I01A 3W2WA 4N0BA 3LSRA 3OYHA 2P4WA 1KA8A 3FXQA 2KRCA 3ASNH 2JZYA 2KT0A 3LSGA 1B1BA 3R0AA 1Z1BA 4YRVA 2X4HA 4KIGA 2FEZA 2ZB9A 5CVIA 4BS9A 5F1RA 1NH3A 1D5YA 1NK3P 4L18B 1O7FA 5IYBJ 1P2FA 4BC7A 1O57A 1NG6A 3R61A 4EEFG 5IT9Z 1BW5A 2V9PA 4RAZA 2G0EA 2H6CA 2HOEA 2RC4A 2XAHA 3CDLA 2NA2A 2EM0A 2LCEA 2R7OA 1K78A 2LV2A 1TN9A 3F21A 2F4OB 3H5NA 5HLHA 2NNYA 5BMZA 2E5LE 1RRJA 4E7ZA 4DQ2A 1CQTA 2EOXA 2P7CB 3CDHA 1Q1HA 1D3YA 1FJLA 4O3MA 1V5EA 2VQFE 5E8IA 1JKOC 1VTNC 4Y17A 2OTLI 2MKNA 3I4MJ 1PJSA 1U2WA 1JE8A 1EH8A 4BDZA 2K7IA 1JTXA 2CUJA 2HQAA 2DAOA 2HYJA 3GTKJ 1ETWA 2CJJA 4HNTA 3MKLA 1KQ8A 2R5ZB 1FOYA 4ZC3A 3MKZA 1RKWA 2OCCH 4H0EA 2YRKA 4IJDA 4DV4E 2KJBA 3CCYA 4KIFA 4BY7J 1SANA 2WADA 3HPHA 3NWTA 1RPWA 4ITVA 4EGZA 3PFYA 1IDZA 3HM5A 1MNDA 4GRIA 3HEFA 4KJZA 4V2GA 3HDDA 1B8IA 3MFKA 2A6TA 3DKXA 4ZYAA 2HKXA 4KMFA 5ILVA 1N32E 4DBQA 4OINF 4Q4ZF 1P4XA 4L9TA 2L3CA 2NS7A 2O9LA 1R49A 2EOIA 2NAZA 4GGGA 2YS9A 1UFMA 3GWZA 3ZRGA 4IEJA 3KP7A 4ZH4F 3BG5A 1G2DC 2MD5A 2MH2A 3PUBA 4LF6E 1U5TB 2M1BA 2KDZA 3EUAA 5K5RA 2V1NA 2M34A 2R7SA 4AVZA 3CDIA 4MEYF 2XF7A 2MYSA 2DI3A 1GLNA 2XB0X 5JHFA 1UG0A 5IP6A 2WZOA 2LTSA 4XR6A 1H0MA 1TWCJ 2OTJI 3DQVC 4NC7A 5FKKA 4LU9A 2RVCA 4I98B 1HDPA 4P1WA 3KZYA 2DXIA 1T56A 5EZHA 3ZMVA 4E70A 2DLKA 3OTOE 4JI1E 1UB9A 1W5TA 2M30A 1KU9A 1GHCA 1I94E 3RZOJ 3AG3H 1FMWA 2W85A 5HS8A 1U9NA 2LFBA 3CLQA 3MSWA 3Q9SA 2L2MA 2I8DA 3CF2A 2L7MP 3BPVA 3BR3A 4F52A 2BZTA 2EPXA 2UWMA 2EPOA 3N05A 3THOB 2EFPA 1MSEC 2Y9YA 1S72I 4IKFA 3J7AO 4ENKA 3CD6I 4MNUA 1ZBQA 3E6BA 3WODF 3V7RA 2QQBA 4ZDLA 3BQYA 4OAYA 4BL0B 4OIQF 3H3VK 1FPQA 3ONQA 3W6VA 3VK6A 1P9QC 2JVHA 1JK1A 2WAEA 4FK5C 3VYSB 2EN4A 3QYBA 4WPYA 1YW8A 1IV6A 1SVLA 2CW0F 3PQKA 2RS6A 3CQZJ 4KUMA 3R60A 2GLIA 1ZR4A 5L3CA 4G7HF 3CJTB 2HKOA 2R5YA 3K2ZA 5T6JA 3FKIJ 1GDTA 3IRRA 2HNHA 5E1XA 4G6DA 1YJ9I 4NHRA 2DIXA 1V54H 2F5FA 2EJRA 2E5ZA 3TBIA 3DU5A 1X3CA 4PK4A 3F6VA 2LLKA 2EM4A 1ETOA 1I6XA 2GXGA 2L3JA 5LRSA 3S16J 2EOQA 1O3SA 2BVMA 2K9SA 2H94A 4KN7X 4WFTA 4DZPA 4FETA 2HOSA 2EN7A 1SMTA 5J8CA 2K40A 4JI0E 2WB1N 3PQJA 5EEHA 1IG7A 2CQNA 4TV7A 2JN6A 2EWLA 1P7IA 1JUSA 3MWMA 2P7VB 5LL6R 3MHHC 1AU7A 2LY2A 1N3GA 1A1HA 1KJKA 1NCSA 1ERDA 5K1YA 2COBA 4ESFA 2JWOA 5E3MA 2IGKA 5L3GA 1A1FA 1RETA 3CUQC 1VQ9I 1XGOA 3JRCA 1JI8A 2BYVE 4I99C 4NDLA 3OYGA 1ZKGA 4OIPF 2EPCA 3U2RA 3KWRA 1FKAE 2CFXA 2H09A 1B69A 4CH7A 3MKWB 1YJWI 4XLCA 4Y13A 3GTMJ 1Y56A 2PJRA 3J7ZI 5BPIA 3ADJA 1XMAA 2OV7A 3K0LA 4UV9A 2DGCA 4S0HB 1Z77A 4UUVA 3FBNB 2BEOA 4M3GA 3KLOA 2UU9E 4AM3A 2ZJQF 2GZWA 4MTDA 2GM4A 4E7IA 1VQPI 1K79A 3GTJJ 1HA8A 5E3OA 2RREA 3KIOA 1H89C 3QU6A 4RGRA 2Z33A 2TRTA 1W5CC 2QQAA 1GXQA 4F3QA 2K5CA 2E2HJ 5A2QC 1J5EE 3DF8A 3L2RA 1IUFA 2K02A 3L00A 5LMNE 1UHMA 3WE3A 2V6EA 3H0DA 2YTFA 3B6AA 2HR3A 5EGOA 2PI0A 3BR5A 1DPRA 2VJJA 2E1CA 3AL0B 4JP0A 4RLQA 2DODA 3OYIA 4FHTA 2K3FA 3TL4X 2RNGA 2QZ8A 2IS1A 2JXPA 2M7QA 4MLOA 3ZMTA 1E3PA 4LOCA 3J7Yp 4Y33A 3ZQQA 5GAEJ 5LGUA 3QG5C 2EQ1A 1ETVA 3S2WA 3ADGA 3J81C 2M5WA 3LSMA 2EMIA 2VF1A 4O43A 2HZTA 1IRZA 4BNCA 5HOOA 3RIRA 1R5ID 4LG0A 5KNLA 1WHNA 2EPZA 4A3CJ 2UUCE 3S3OA 3VOEA 1N75A 2OF7A 3THNA 4A3DJ 2ZJPF 3PNTA 2CUZA 2K9MA 2ZCWA 5JVTA 2ME0A 2KQRA 3S93A 2EORA 4PZJA 3BF2A 3MHSC 4NBQA 3LLHA 2EM9A 3ADLA 4GO1A 1NTCA 1DU0A 3OYNA 1HW1A 3G1MA 1U9OA 3HUGA 2KPMA 3ABUA 5DTDA 4LB6B 2VUMJ 2JA7J 4HA8A 2A07F 4BGDA 4DV7E 2HZDA 3LA3A 3U9GA 3NEUA 3VWBA 2PFBA 2BBYA 2WWYA 4CCJA 3BTIA 1BA5A 2EIMH 4KMUX 3FHZA 4NC6A 4XKWA 3CMYA 5KAIC 4X6AJ 2Y75A 1FOWA 3PFIA 5LGNA 1ENHA 3LNQA 2JT1A 1D0XA 2LK2A 3H9QA 2LY9A 2CTDA 4JI8E 1WPKA 3SYTA 5E18F 3FIGA 5E20A 2R7FA 3VEPA 3LMLA 3HSFA 2F5EA 1TT5B 2EFQA 2XGEA 1FIAA 2FOWA 2EL6A 3MAJA 4C9YA 2MKDA 1A5JA 2HGHA 3A0BC 3HPZA 1MH3A 5IT3A 3BTLA 1D8JA 2N8GA 3I64A 4EATA 5JFRA 3WTYC 2LT7A 2ZNZA 4BCAA 3I71A 3KPHA 1C0WA 2L2OA 4IL6C 2Q8KA 2PMZA 3S32A 4D7NA 1ZG5A 2N8XA 3BR6A 4FE7A 4A0ZA 4EV0A 5HNFA 2F6CA 2XF5A 3L2WA 2WY7Q 1QBJA 3HQ1A 2R7DA 1WCMJ 5DD8A 1PUFA 1JXSA 1YITI 3D0SA 4L8NA 1WGXA 2Q1ZB 1T6SA 3ABKH 1G6NA 3OS2A 3RKXA 2V85A 3QQAA 5KHDA 2JA5J 4F93B 2A6EF 4XLHA 5H2FC 4C2UA 1I50J 5ICFA 1STZA 1L4SA 1TQPA 4IS1C 2OQRA 2GA2A 1XDSA 3BJAA 4G12A 5IP7J 2VLAA 3GO5A 2H6BA 3J81Z 2LUPB 5GAGJ 2L2NA 5L3DA 3P9CA 5J3LA 5L3BA 1X4OA 4RS8A 2EM3A 1OCCH 4MFEA 4CCNA 3L2UA 2R7ZJ 3SQNA 5A2QK 2NOJB 1B72A 4Y52J 3QPLA 1T39A 3DTKA 2V1DA 2DOEA 1N36E 4LF5E 4E6KG 4UUSA 2ODRC 3RPQA 3BR2A 2YTNA 4JYKA 1Z21A 2VQHA 1FC3A 2QYOA 3OYMA 2QBYB 3LA7A 1FYMA 1P7JA 2VE7C 2KIQA 5M5WJ 2L9NA 2IRFG 3JTGA 1AHDP 2P0WA 1T4NA 3M4OJ 5M3MJ 4XNFA 1DGRM 4L0YB 3M3YJ 1EKZA 1A1KA 3PSFA 3HOUJ 3I53A 5LD2C 1G3SA 4ETSA 2B3TB 2X6OA 2XIGA 1R4NB 3EUHA 4NZVA 2DMNA 2NVTJ 5F64A 1O4XA 4XLEA 2EPFA 5F0HA 2RSIA 3BIDA 2UZKA 5B66C 1YI2I 5CVUA 4IZZA 2V86A 4PJNA 4RB1A 1LUJB 3FX3A 4PCQA 1TZLA 4Z2YA 4IQJA 5DS9A 4XIDA 2Q2EA 5CVRA 1KZHA 2FJ1A 5FD6A 4UXNA 2V1UA 4ZDOA 4J19A 1ZAAC 4ASNA 1YRNB 2XAJA 2B9SA 4A3BJ 4F2JC 5BNGA 2CW7A 3ZMSA 1X6FA 1BBYA 2OUMA 4ESBA 2M9AA 1H9GA 1D0YA 2EMXA 5JLXA 3W3CA 2ENAA 3O2PE 1Z05A 3OSFA 1YZ9A 1YW7A 4JYAE 2LSOA 2QA4I 1A1LA 1V4RA 3V7SA 3G73A 3L1PA 1R5GA 2XPVA 1BI0A 2NXNB 3G6EI 2GLOA 3CCJI 2HC5A 2VB6A 4JK1X 4YFXF 1RKTA 3S1RJ 3QP6A 3DBHB 3CUQB 1PDNC 2EMZA 4BUPA 1PYVA 2YTOA 4M3DA 3OYJA 2AQFA 2BBGA 2VBXA 4QTRA 4BY1J 5BR8E 2WAQN 3I58A 4NQWA 4BQQA 1UILA 4IRHA 5H20A 3OOPA 4KHPE 5IOYA 4X66E 3CZ6A 2VJ5A 2QQ9A 4DR6E 1SD5A 3Q0WA 2EM5A 3LSPA 2DW4A 4HF2A 3GZ5A 3ZMZA 1FIPA 4B09A 1FJGE 2EBIA 5E3LA 1RZ4A 3BPXA 4JX5A 1S3JA 4UB6C 2ZC2A 3VYTB 2ETHA 3HKZA 3M8FA 2LY1A 3OYBA 1RR8C 1AWCA 4XOTA 3IH4A 3SEZA 2IBDA 2ZFUA 1OCOH 2LG4A 3WTXC 5F0FA 3LAJA 5LGTA 4HQEA 4HRIA 1XDUA 4M6VA 2VIXA 4NXME 1A6IA 5TGTA 2EN3A 1JK2A 3JRDA 2ZXWH 1XMXA 2EINH 5E17F 4DZJA 2HXIA 2H8WA 2K86A 4B44A 1Y6IA 1TWFJ 2YSOA 2RTXA 3VYUB 4BBSJ 1RR7A 1FOXA 1WHQA 2VQEE 5AIQA 4AQYE 2D5VA 2BY2A 2MDGA 1I1SA 2JOXA 2IW5A 2F2EA 2KIUA 4AD9A 2EOFA 2EQRA 1BI1A 2M7AA 1W7PB 4A69C 2X0LA 3DP7A 4BXUA 3WTWC 2EMKA 5AE2A 1QHGA 2WC2A 3QYEA 1R22A 2VQCA 1B9MA 1LPQA 5E3NA 2STTA 5IWAE 1F43A 2P5VA 3OYEA 2IHR1 4BMJA 1V55H 5GAHJ 1GT0C 1APLC 2E72A 4C3HJ 2VE8A 5CVJA 4YY3E 2JRTA 1S5LC 2CQQA 4L5JA 3K4NA 2CQKA 4YFNF 4U87A 4JX6A 1ZGAA 1JHFA 2DO7A 3BZ6A 5M5XJ 2VXZA 2JP9A 3I59B 1H8AC 3NQOA 3FXJA 4O5GA 3U1DA 2K85A 3K69A 3SXYA 4D5CA 3GLLA 2UUBE 3DKYA 1YQAA 4FQGA 2Y0MA 1SVOA 2MLKA 5GPCA 1ZAOA 3JRBA 1XPXA 3EQLF 4NUBA 1H88C 4JI2E 2PMUA 3QWLA 4B47A 1YS6A 1XTAA 1VQMI 4P96A 4JQFA 2Z2SB 3HRTA 4W1UA 3A02A 1U6GA 5DCMA 3TQNA 3RJPA 4P7DA 5F6FA 2VBZA 3A01A 5HDKA 1YYKA 2W1OA 4N4RB 1IN4A 2EILH 2JUGA 3R4KA 2R7WA 3S15J 2Y31A 2EPAA 1XMQE 3GFLA 4R2CA 4YIRX 1T95A 4DGWB 3HTUA 3I0TA 2YT4A 3FZVA 2DJIA 3DF6A 4R03A 2RV8A 4BE1A 3S1QJ 1QA6A 1HW2A 2B7TA 1SVMA 4JI7E 5GPAA 3ULQB 4DYRA 3S14J 5ICCA 4F6MA 1E3HA 1KYZA 1YYVA 1KQ0A 4PGGA 2L7ZA 1K61A 5JLWA 2OPTA 1MNMC 2FRHA 1NG7A 4A3JJ 5C44J 3GXOA 2V6CA 5CVVA 3LSTA 4IVNA 2BHZA 5FFXA 1SFOJ 2HOTA 4HZFA 1ZGWA 1A31A 2PX9A 3HSEA 3M07A 3EETA 2GQQA 3QAHA 1IBLE 2HOAA 2L6MA 4WCGA 2NUEA 2O8XA 2YTGA 1TC3C 2FUG2 1MMAA 3ZOBA 3K6GA 1WJCA 2GIVA 2HQ5A 5M3FJ 2DFEA 2EM2A 3LOCA 4I2OA 4DV2E 3HB9A 1IN6A 1WJDA 3ECOA 5C4XJ 4RH8A 3C3WA 1AKHB 1PKPA 1HSTA 1SFUA 3ABTA 3H9GA 4BJ6C 2RGVA 4PUSA 3KP4A 1HNWE 3OS1A 1XMOE 5D5XB 3CC2I 3OMLA 4I76A 3BOQA 1ETYA 2LKSA 3MN2A 3EUKL 2HS5A 5LEKA 4II3A 3BBGA 2EV6A 2JPCA 4OMYA 4DR2E 1K7AA 3M1CA 4HTGA 4DNCA 4A93J 2E1MA 2IGNA 2VJ4A 5KL3A 3P5JA 2DA6A 2QM3A 1D1BA 4BHBA 5EG0A 1N78A 2OBPA 1U3EM 2HDDA 2JVAA 4B43A 1GUUA 4NNJA 2AS5F 5FLXC 4GCVA 3IH2A 4RHBB 4YHHE 3REOA 3DEUA 2K9QA 3LMMA 2VODA 5AASA 5AIPA 2XDVA 2Y2ZA 1FYKA 1MBGA 4G9YA 3GBGA 1F2IG 3K4CA 3O8HA 4L0ZB 2MLGA 3RKWA 3G71I 1B8IB 3OYCA 1VQLI 1RNLA 2LYCA 2ZJRF 3AFHA 4XL9A 4A12A 1U78A 4L5NC 1RC7A 3AG1H 3J80K 2RQQA 4D0PA 1IN5A 4BBYA 3BZCA 4LLLA 1WJEA 3DLLF 1OYWA 2CO5A 5JI6A 3HKZN 3BJOA 5F3WA 2YX4A 2EMLA 2LBSB 2XAGA 4XQFA 2XRNA 4EJVA 2I10A 4PFPA 3F6OA 3GTQJ 2GPIA 1V5FA 4DUYE 4XBFA 4BEHB 1X2NA 1BI3A 4BJTA 3BTCA 2CUEA 2Y69H 2XAFA 5D4RA 3GZNB 5EYRA 5CQEA 2CV0A 4BQAA 2EOOA 1J2XA 2E35A 4O5VA 2H1LA 2WBTA 1UBDC 1MSFC 1QPMA 2XKPA 4M74A 2IA1A 2OQGA 1REPC 5D5UB 2Z3YA 3EPZA 3L9FA 3IWZA 2HGCA 3IKTA 3RSNA 4JBAA 2IT0A 2QCOA 1RMDA 4AYBN 1IQOA 2M4IA 2DMQA 1QZYA 2H8RA 3WGIA 4DKKA 3WTZA 4QPOA 3ADIA 2CV2A 1IW7F 2BV6A 2VI6A 2TDXA 3KP5A 4HX7A 3K6QA 3DBLB 1LB2A 3TEDA 5EEGA 4Q28A 3JW4A 4CXFA 4XSZF 2FBHA 3WGHA 1VFCA 2V7FA 2KHMA 4IQ4A 1TP4A 4PSXA 5HODA 2R4GA 4E4HA 3VODA 4OIOF 1OISA 2KIMA 3QYFA 4CYCA 5CLSA 3EUHC 5HS9A 1DP7P 3F3XA 2KIFA 3RZDJ 1WI9A 3FK7A 4HEA2 3IP4B 3S1MJ 2UUZA 3TW6A 4PJLA 3F23A 2ELZA 2EOSA 2N3HA 1WFXA 1BC7C 3VPRA 1IRGA 1E17A 1BJAA 1U8BA 2KONA 1YYWA 1YHQI 2YWQA 4U7DA 1WJAA 3OYDA 1F1ZA 2IP2A 5FKNA 5JVGF 1HDDC 5FLXZ 4LD5A 3WU0A 5IT9K 1G2HA 3OMYA 4HX8A 1ZBTA 1ZG1A 2DA1A 3GLXA 3OYLA 1IDYA 1R6RA 3SDBA 1MDMB 1SD4A 2ECBA 4Y7NJ 2R93J 4HOBA 4AIHA 2FF4A 4DR1E 1N77A 1D5VA 2D1HA 1MKMA 4FASD 5DEQA 4PSWA 1A6QA 1P92A 2EN1A 3F6GA 5IOZA 5FLMJ 1WJ5A 2B63J 4DBRA 1D1AA 1R23A 2XC7A 2P5LC 2RQPA 1ON2A 4XICA 4HG2A 2RN7A 3BGHA 1T4LB 4F6NA 1DQUA 3JTHA 3K2AA 2A5WA 3MEXA 2EA2A 2PLYA 1WWXA 3FKJA 5FGMA 2JWTA 4EGYA 4MLVA 4W97A 2MC6A 2E1NA 4XN3A 3CJRB 2F48A 2FD5A 1MBKA 3MKYB 1QZEA 1GV2A 4IOCF 2A61A 1Z1DA 3VB2A 4LLGF 6PAXA 5F0CA 4ZYDA 4RB2C 3QODA 3A2KA 1LFUP 5AONA 3VYYA 2EOMA 5HLIA 2Y0SA 2RS7A 2FMYA 1FY7A 1OQYA 3SHFA 2W4SA 3GFJA 4M72A 2W82A 1XB4A 3OWTA 5TISC 3TP3A 3RMPA 2E7WA 5BQTA 4GYIA 3EPHA 1YLFA 5FD5A 4DW6A 2R5ZA 2DK5A 1SEUA 1GTKA 4CA0A 3GVAA 3W2VA 1RQ0A 1USSA 3JSOA 3OS0A 2STWA 1OCZH 3F8CA 3TQMA 2VE9A 4EJWA 1OFCX 2FOKA 4HW0A 1LE8B 1QO0D 3GTOJ 3L2QA 2V9KA 1K4TA 2DQRA 1N34E 1X19A 2GIZA 2IJLA 2ICWG 1IXSB 2DSYA 2JSCA 4G8XA 5B1BH 2FNPA 2V1XA 3CTAA 4Y4RA 3RPUD 2O8KA 2EOHA 1SR9A 3UK3C 3F8NA 2L0KA 4HV6A 5IY5H 1S7EA 5EGOB 5FJ8J 2EMYA 1MD0A 3O8GA 1U5TA 3PSIA 4UY8I 4M6YA 2LMDA 3D5LA 4IHTA 2NVUB 3ZQHA 3U1KA 1IJWC 3B73A 3V8LA 2Y48A 5CKTA 2ADRA 1M1EB 1ZR9A 3H92A 3IWCA 1EH7A 3X2QH 2EL4A 4K0KE 1Q1VA 3RPUA 4I0AA 5F08A 2J7JA 1BR2A 1XCBA 2A69F 1TF6A 1EF4A 3ML6A 4LG0B 1G4DA 2UXNA 3HL2A 4I0BA 2BY0A 2EZKA 4OWRB 1Z3YA 2RSMA 3MZ8A 2IS4A 1RC9A 4Q35B 4OOGC 1F9NA 1X2MA 3ZMDA 1UMQA 3J7AY 2K9NA 1ZG3A 2RDPA 1JKRC 2VKEA 2VC1A 1YSAC 3QU3A 1BL0A 1YOVB 1UCRA 2NNNA 2A6HF 1JT6A 3DU6A 3WGGA 3L2VA 1ZYRF 4N4OB 2A68F 2QENA 5FRNA 2N3GA 2ZSIB 1Y1VJ 2DLLA 2W25A 4O4KA 3LFUA 4J00A 2HXOA 2OA4A 1BN5A 5E8GA 1HBXG 5EF6A 1IXRC 3Q0VA 1B9NA 1PJRA 1BOBA 1BBGA 4EJOA 2EB7A 1FEXA 3DKWA 2EPKX 4ANJA 4XONA 1XGNA 4Y15A 4IHWA 3GTGJ 4FX0A 3N97A 5AE1A 1F5TA 4CCKA 1WZ2A 1K83J 2DN0A 1JTYA 2L54A 3A0HC 4A5MA 3F22A 2H1KA 3FXUA 2UXBE 2IEKA 2FQ4A 3FXRA 3Q3SA 1AOYA 4BACA 1QZZA 4X1EA 4BH9A 5LBQA 2GOMA 2L5QA 2LBFB 3ZQIA 5HLGA 2VRDA 2JRMA 1OCPA 4LF8E 2B7EA 4BE2A 3A1YA 1HLVA 1R71A 2BVLA 1J5YA 1SFKA 1PUFB 1ZR2A 3BLYA 3CC7I 1MBFA 2ZM6E 3DBRB 5J47A 4HDUA 4D5FA 1J75A 1KQ9A 2GXBA 4Z6YA 1PP7U 2YPRA 4MO7A 1HCRA 4IHYA 3N4MA 5F04A 4MIMA 4LGWA 2WBMA 2VQGA 1WKMA 3WU2C 1MGTA 2ELYA 1IRFA 4YELA 2L9VA 1T38A 4IJAA 2JUCA 5ICGA 3TGNA 2ZXIA 3I56I 1I5ZA 2FX0A 4UB8C 4GYGA 4ZTFA 1U8RA 2O3FA 1G8XA 2ZMEA 4CZCA 1I3QJ 1MBJA 4YG2F 3WHBA 3HOZJ 3MQ0A 2DMIA 2YTQA 4F54A 1TF3A 4CZZA 3ZQCA 3HIFA 3GFMA 2NYXA 4R2PA 2ZXJA 2GXAA 2ELJA 3CCQI 1IO2A 2FBIA 3WTTC 1B72B 2CQ7A 5B1AH 2FMLA 1HC8A 2YTJA 4RM3A 4IRIA 2KMUA 2Y0SN 1LNWA 2P8TA 3I9V2 2V9VA 3FK6A 5DUKA 3DXJF 1HQCA 2R92J 3NWSA 1ITYA 1TW2A 2Z9OA 5C4JJ 2R1FA 4K2EA 4XRFA 2L2KB 1LDKB 2W7NA 2EP3A 3TP0A 1IQSA 4ZZLA 5B3SH 4AUXA 5DNYA 2K27A 3GMEA 1FSEA 2M8EA 3JRIA 4HSTA 1Y8QB 3D5RC 2VT3A 4S04A 1W36D 4CICA 1LLMC 4JI4E 1TLHB 3BT9A 4HAMA 4UVBA 3S8PA 1YS7A 1FMVA 2ACJA 2E7XA 4OMZA 2D2WA 2Q2EB 2ADUA 2DYSH 2MG4A 2VASA 4KZSA 3GX4X 2LOOA 2PMHA 1L0OC 1ZN2A 3GEZA 5E79C 3O6BB 3TO6A 3CO6C 4A3GJ 3F9KA 1GXPA 4KIBA 3BY6A 4YEJA 2DFFA 1GQEA 2X9DA 1NHAA 2JTVA 4XRMA 3HSRA 2G7HA 4HNVA 4RGSA 1ZTRA 3BTJA 1X3ZB 3JU0A 4E7LA 3KYDB 1FTTA 4JI5E 1VQNI 4R2SA 2D9HA 3KZIC 2M9HA 2LR8A 3M1EA 2HQRA 2IVMA 2FV4B 4M3BA 5KK1A 1G3WA 3D1NI 1YO5C 3PJRA 2F8BA 2LO3A 2L8TA 2LD5A 4M30A 3OIPA 2MABA 3BJ6A 1U0JA 2LVSA 4M73A 4B3AA 2EJ4A 1SMYF 4X64E 3C2GA 4B1RA 1Z67A 2CUFA 3B02A 4F9CB 2A05A 3Q9VA 2DRPA 1TBXA 4NQWB 2JVGA 2IGOA 2ESHA 5K7FA 2X48A 2MH9A 1D1CA 1MEYC 4NHJA 2EOJA 1JJ8C 2M0CA 3LFKA 4IOAF 2HPIA 3BZKA 3HJEA 1PDAA 4UV8A 1YW9A 3UKGA 5L3EA 3CLOA 3QOPA 1MJBA 4N9HA 5DM7F 1HF0A 2F4IA 2MC5A 1TWGJ 3H36A 4BDYA 4R2AA 1Y0UA 1BIBA 5DUIA 1ZQ3P 2CG4A 5J1UA 1FBQA 5JR3A 1ACIA 3J81K 3H5AA 2NABA 3CJNA 3ELKA 5EJCA 1V5GA 2DA2A 2X6WA 1H9TA 1FYLA 3LQRA 3VHTB 3TOAA 2CSHA 3ZQ7A 5IYCJ 2L7FP 3OOUA 3FMQA 1XCVA 1UHWA 4AIJA 4UNOA 3FM5A 3WU1B 2COMA 5K5OA 4LF9E 3A4CA 2OC6A 1FSHA 1R36A 1TW3A 2HFHA 1D8KA 2X51A 4LF4E 4QIWN 1ZLKA 2EIKH 2GWRA 3ABLH 3CCVI 4A3MJ 2LUQA 4V19K 1E2XA 3R6SA 4EVIA 4U7BA 2EE8A 3HC7A 2GA1A 3KZZA 2X1EA 5LFAA 3LSKA 4RAGA 4I09A 3CMAI 1NK2P 1AH5A 1YJNI 1O3QA 2ISZA 1W4MA 4M3FA 2B7VA 2YTPA 2V4JC 1UG2A 4LIUA 3M8JA 5AC4A 3ZQFA 1FBSA 4OAZA 4DR4E 2HYGD 3C1DA 2YRHA 3KETA 1LVKA 4R2DA 3RCOA 1OKRA 2QF7A 3E5QA 4BJ5C 4XN0A 3ROUA 3MCZA 1UELB 1XGSA 3P9KA 3OSGA 1MMNA 2M4GA 4PDKA 3S2HJ 4OX9E 2R7TA 3MVPA 1MMGA 1OCTC 1YX3A 1OPCA 2VL8A 5BOXA 1R58A 4RM2A 3DFGA 3K4JA 2QWWA 2FNAA 1BR1A 5DCMB 3QRFF 3CJQB 2KLOA 4KNYA 3T0YA 4CUGA 1Z6RA 4D1QA 2CSOA 4IRGA 2G9WA 2JK3A 4BU2A 2XAQA 4MTEA 3JAMC 2KJCA 3BG6A 1PJQA 1A1JA 4CCMA 1A1GA 1DUXC 1QGPA 1HNZE 3HOVJ 2IPQX 3KEOA 1X47A 2XASA 2EIJH 2FA5A 4QLCU 2ENCA 3BR0A 4JV5E 3P9IA 4HEIA 4DV5E 2Q0OA 1DU6A 1BM9A 2NS0A 2YZTA 2L01A 1AAYA 2FTXB 2XROA 1FNNA 2PMZN 4LFBE 3NAUA 4QWQA 4G7ZF 2EQ0A 1LVAA 4B3ME 3G4SI 3T1HE 1X49A 3F8FA 1YRNA 1FTZA 4MQVA 4DR5E 2YSRA 2CQXA 1QPIA 3F0CA 3J80C 3GUDA 4XK4A 3E5UA 5HVQC 3OYAA 3RDIA 2YTIA 2O5RA 4BXFA 2P81A 2K4VA 2XSDC 2PG4A 4XKBA 2EN2A 3IRQA 3IUOA 1VQ7I 1TL8A 1TT0A 1K6YA 2MW8A 3FM3A 4MFDA 1VQ8I 1MBEA 2WCC3 3TO9A 2NOGA 1YTYA 2M4KA 2M8GX 2DTZA 2L4AA 2L7KA 1RESA 2EZHA 2RAEA 4DV3E 2M45A 2VONA 4KDPA 4DMIA 5J40A 3C18A 1ZLJA 1XMKA 1X1PA 3BCBA 3RTRA 3VSLA 1IGNA 3TDUC 1LEAA 3PUFA 3F8BA 3HHHA 2OU2A 2MC4A 2LKPA 4MLQA 2YRMA 1FP1D 2EMHA 5E1ZB 2BE5F 4MEXF 1XX5A 1HKSA 4A5NA 1IAWA 5EG0B 2MA3A 3ERMA 2DA7A 4AIKA 3IAS2 2Z99A 2M2EA 4ZTJA 1WRJA 3CCMI 2P6SA 1I1GA 3WTVC 3K4BA 1ZGJA 2QGUA 3GYHX 1SFEA 3LWFA 1O0WA 5EDNA 2V87A 3GTLJ 4CSWA 5J8FA 3WHCA 3V8KA 1HOMA 4L9NA 1W0TA 2LF7A 1BIAA 2DT5A 2MC3A 4P55A 3IL2A 3ZN1A 2E19A 2UV1A 5TJJA 2GAUA 3EPKA 3SEQA 3HOWJ 3JAMZ 1R9TJ 3TMOA 5F1JA 3KYLA 4WK8F 2EK5A 3KE2A 1FZPB 4FCYA 1B6AA 4CCLA 1BC8C 2BGCA 1HR0E 2HQNA 3S1NJ 2FE3A 1LDDA 4LFUA 4RAFA 2JOBA 5H6QA 3OR2C 3CP2A 3HZJA 3HOYJ 1PJTA 3TOBA 2ZMEC 1VQKI 2IAIA 3DCFA 3W6JB 2LMZA 3FWEA 2EH3A 5HDNA 4E7JA 1K78B 3WTSC 5FRMA 3CP8A 5GADJ 4GDFA 2A5YB 5HS7A 2O03A 3KP3A 1WJBA 2NRAC 1ETXA 3J80Z 4R2RA 4G6TB 5ERIA 4DYQA 4WX9A 3K70D 4RBOA 3H09A 3HOTA 4WSPA 2NVYJ 2VKHA 4B8XA 4H4KC 1VQ6I 3F6HA 1BBOA 5ED4A 2ISYA 2Q8UA 1MJ9A 4QSHA 1YG2A 1TQIA 2H27A 2IGMA 1T33A 3ASOH 1UAAA 1RIOH 1YIOA 3Q0UA 3AG2H 4I02A 3AAFA 3RQIA 1Y8RB 2X6XA 4L5EA 4EM0B 1BJZA 5D4SA 3VYXA 4RMNA 2KRFA 4A3LJ 1QQIA 2M0MA 4GFBA 2G7UA 2IS2A 2LRDA 2WY8Q 3K1NA 4HDVA 1W0UA 1VI0A 4A3FJ 4DR7E 2V26A 4BYYA 1FWZA 3MD2A 1BI2A 4GZNC 2EZLA 1BR4A 3ECRA 4BAYA 1R1TA 4BKXA 2NUFA 2EPUA 1WXRA 1OR7A 2XSJC 3JSPA 5DYMA 2OD5A 1IF1A 1E3OC 5B5EC 2KL4A 4U0VA 5F27A 2O61A 5GP9A 1FOKA 1ZU1A 4RGUA 1W1WE 1QRYA 4PGHA 2YR2A 4KA4A 3IH3A 2E2JJ 4ENNA 4AVPA 2VPLA 3JRAA 3ISPA 1ZK8A 1F36A 2BW3A 2RKHA 4M9XA 1I3AA 3J7AG 3IWFA 3W2AA 3CUOA 1MMSA 3SDGA 2M87A 2HVSA 5KL4A 2YPNA 4X62E 4LB5A 2L9RA 3SFIA 3WG7H 2AQEA 4F92B 2R7UA 2CS3A 3BROA 3WG9A 2BY3A 2LDUA 1N25A 2NVQJ 1ZARA 1LFPA 3FDYA 3K4LA 3GZ6A 4QPQA 3GW2A 2CH0A 1GV5A 2JYAA 2L92A 2YTDA 3LA2A 2DPDA 3HRUA 2E34A 4Q48A 4LITA 4I6ZA 1SFXA 2HTJA 4PFOA 1MJAA 1FBUA 3SZGA 1USTA 1TWAJ 4ZYHA 1AKHA 1S6LA 2AHQA 3PO2J 1WJFA 4GXOA 4BQNA 1B4AA 4LJZF 1ODDA 1VQ5I 4RGXA 2QUFA 2EM6A 2LREA 2ODRD 2EM8A 3D5SC 3WTUC 3PL8A 2VKDA 1CF7A 1X6EA 2V88A 4FISA 2HEOA 1Z9CA 2LJHA 3G1LA 5LMUE 1ORKA 2XF6A 2R5YB 2VC0A 1ULYA 1HKQA 2LC2A 1J26A 2HPMA 1WH7A 2XV4S 4CCOA 2HVRA 1WH5A 1X58A 4BBRJ 1UN6B 1EJ9A 4KISA 1R4MB 4AU7A 4HLYA 2ZNYA 3HTSB 3RI4A 3FISA 4B3XA 2DJNA 2KOUA 4LFCE 4F91B 5HDGA 3AKZA 1IC8A 2EMFA 3T1BA 2LP0A 1I39A 2XGDA 1IV8A 3ZXSA 4LTYA 2XVCA 5IPAA 4B4CA 1VZ0A 4I8OA 2HTSA 3M8EA 1A1IA 1IN8A 3KP2A 3LSJA 3F72A 1UHZA 3BP8A 2LTPA 2MDRA 3PM1A 3DEEA 3HHGA 3K1MA 1KYQA 3JCUC 1DDNA 3IWDA 4BEHA 5D5WB 2WTEA 3W6KB 2FSWA 2HU9A 2L33A 1HNXE 2CU7A 2W57A 2DA4A 3P1XA 1SD6A 1X6HA 2MD0A 4HX4A 4YFKF 2EOYA 2DLQA 3QPSA 2PJRB 3ERED 1IBME 1FP2A 2PJPA 3I5UA 4OOIA 5FLXK 3H3ZA 2E36A 1X5WA 4B3TE 4HYEA 5J4YA 4LLNA 1Y1WJ 3MZYA 3OR1C 3HG9A 4C3IJ 2KISA 3C4TA 4OIRF 1QU3A 2EZIA 3DPTA 2D1VA 1XSDA 2DU9A 2WV1A 1JT0A 4EMSA 4KITB 3GCMA 2JA2A 5AE3A 2CPNA 5H6RA 5CPRB 4UVAA 2XPUA 5D8LB 1WJPA 3UR3C 2XGXA 2BXZA 2MSYA 5A6BD 4CDGA 5ILUA 2L3DA 2XGCA 4I7HA 4L5IA 3M9AA 3I3LA 2EPLX 3P7NA 4JOMA 2DMUA 2RPCA 2OCEA 3SZPA 2NUGA 3IWBA 2EMCA 4CGZA 3KFWX 3FXOA 1AA7A 4IXAA 1I27A 5TRDA 4KFCA 2LRSA 2TCTA 2XRLA 3LSIA 4G7OF 5ILSA 2KDOA 1LJ9A 1MDMA 4OU0A 1T08B 2WA0A 3CO7C 5A6BA 2EOZA 3HRMA 3DTEA 4X65E 4HLXA 4EJUA 2UXXA 1G3YA 2DA3A 1XGMA 1O3TA 1R1UA 1IMUA 2Z16A 3IKVA 3CCLI 4X8WA 4O6JA 1I6HJ 2K9LA 1JKQC 1UJ8A 1Z6TA 2W48A 3HRSA 2X1DA 4BHCA 1XSVA 2LNBA 5D6FA 3G1OA 2PN6A 2IA2A 5BS6A 2E1OA 1ZREA 4E7HA 3HOXJ 1O7LA 4A6EA 4B3SE 5A6AA 1S9HA 2MBFA 2V79A 1HXDA 1G3TA 3IV5A 2DOFA 4R8OA 4R2EA 3ZCOA 3OYFA 2JQ7A 3EPLA 1BB8A 1T8IA 3TKYA 5K5QA 3DPLC 3HUGB 1OMIA 1EA3A 1ON1A 2BOLA 4IO9F 2ZMEB 1N33E 1R5HA 2E60A 2KFDA 2QLZA 5FFZA 5GTIC 1P47A 2KZVA 3T8TA 3EQ1A 1W5SA 4DIQA 3BR1A 2LH9A 2B0LA 4Q47A 2VKVA 4LK0F 2CFOA 3CMMA 1WVRA 3BWGA 4U88A 3VDXA 1LQ1A 2EZ6A 3RKQA 5DDGA 4WSGA 2R0QC 5DV5A 3PO3J 2CWEA 2K4JA 3IHUA 3ZR8X 1IZ1A 3F8MA 1QNTA 5M5YJ 3PIPF 2EN8A 2PRTA 2DMPA 3LL7A 3K4KA 1IRXA 2DFIA 3E7LA 3HGGA 1JGSA 1X1AA 3K4MA 3K9TA 2EA4A 5E1WA 5FB2A 3LAPA 3JRFA 2QEXI 2EPMX 3JTZA 4ESJA 2Y9ZA 1YX5A 4LIVA 1XSXA 3MZHA 1T0FA 4U0WA 4U0YA 2CT1A 1XNQE 3A03A 5HLTA 4AC0A 2YUSA 1WQ2A 2CW8A 2KP6A 4DUZE 1BOAA 1DQ3A 1LE8A 3O3KA 4GKJE 1T4OA 2O0YA 1JUPA 3BC8A 3RKYA 4IX7A 2GBYA 1ZRDA 2YU8A 2DBBA 4YIIA 1LDJA 4F7ZA 4FE4A 4MGRA 5J4VA 2JA6J 3HGYA 2JR1A 3OIOA 4M6XA 2FQ3A 2QVOA 4M0VA 3S17J 4NB5A 1YPNA 3HTXA 1O3RA 4GEQB 4M2ZA 1P6RA 3BG3A 2ECCA 1S7AA 4IPAA 3S2DJ 3EPJA 5KL6A 1GZ6A 3DV8A 3H9JA 4HQMA 2I13A 4JI6E 5L3FA 3RQ4A 3C6MA 1PUEE 3U21A 2IA0A 3I55I 3E1SA 4PJJA 1KU2A 2DYRH 3KEYA 3J7YJ 2DOAA 5ICEA 1ETKA 2VXDA 1A04A 2E1MC 1QHHD 2LJUA 3V42A 4XLFA 5EEAA 2JMWA 3HPSA 2E5NA 3S3NA 2EN6A 2I9IA 1TTYA 3V7CA 4WXDA 1XNRE 1YUIA 3JREA 3E6MA 2UXCE 1UHSA 2ME6A 1LFBA 1EV7A 3R0JA 2DPUA 2WAQA 1G59A 2R3SA 2W00A 5LLQA 5IP9J 4G6QA 4KT6A 3KYCB 3QOEA 2ZJ2A 4L9VA 3IAM2 4UUSB 3TW7A 3JRGA 2VOPA 1LKXA 2EMAA 3K70C 3KCCA 3RYRA 1JJ6C 4KICA 4ABZA 4KWYA 1WHUA 4A6DA 2F5CA 3NARA 2V83A 4RB0A 3SZTA 2VBYA 3BG9A 4BC9A 4ENMA 2K3PA 2DCEA 4XRSG 2IXSA 3I54A 3ZP5A 1XS9A 1S8NA 2XUBA 1X1BA 3C7JA 2OAZA 3VFZA 1YIJI 2C6YA 2ZXHA 4Y3OA 5FKOA 3M7GA 3RYPA 3ZN0A 4CO8A 2EPRA 2PEXA 4XKVA 2ENHA 2O6GE 1OR7C 2MFZA 1J0RA 2E2IJ 2DT7B 5CYVA 2ZKZA 2JSPA 1Z0XA 1X1CA 3ESWB 1X1DA 5A2QZ 2ELKA 2K7LA 4A3EJ 2EV5A 2PQ8A 4J01A 3H35A 5EZGA 1SAXA 2LF8A 2EQ3A 2YX7A 3E6DA 4LG3A 3ZGKA 3CCRI 1DI2A 2VJIA 2A3SA 4IF4A 1JGGA 4WXHA 4UHTA 2JA8J 4G94A 1Y0NA 2DMYA 2VT2A 3C6KA 3CESA 3DPUA 1R7JA 2LBFA 3E5XA 2ZFWA 2KRHA 5D6EA 3HBLA 2LTRA 4EM1A 2R76A 4DV1E 3JRHA 1J59A 1OYIA 1MZBA 3TO7A 3V8JA 2FBKA 1R00A 2AXTC 3TDZC 4WWCA 3COAC 2M3AA 1YYOA 1R1VA 2KZGA 4D9JA 1OCRH 4HF0A 4A3KJ 3DTIA 4P5OA 4XLAA 1STUA 1XC5A 4LF7E 2Z1DA 1RI7A 2CV1A 3E0JB 5JHUA 2GHFA 1JHHA 2WBSA 1ONVA 3M99B 3LQQA 2EPNA 3QPTA 1GVJA 5DM6F 3PIOF 4M9VC 5DCFA 3SJMA 2EV0A 4M9SA 4P78A 5LHGA 1L3LA 3E3VA 3OYKA 1Y39A 5KL5A 4IHSA 4X9JA 3K7AJ 3H1CA 3C2HA 3OY9A 4A2UA 1HKTA 1POGA 3MMYB 2E71A 3E6CC 2PBIA 2J5OA 1DGWY 4M71A 4XM3A 3OV8A 3C2BA 4XLNF 4WXCA 4A0XA 4O24A 2P6TA 1PVEA 4XLPF 2V8QB 4KYWA 2I5UA 4DV6E 4R1HA 4F55A 1A35A 4E7KA 4HBLA 4FT8A 2DDAA 3FXKA 3ABMH 2QKLB 3QPHA 2DFHA 2QSFX 1X3UA 4PJ0C 3EYIA 3GTPJ 4P9FA 2OJED 2KKOA 1P4AA 3L2CA 2HVQA 5LEJA 1TWHJ 1ZELA 4X0GA 4C3JJ 4A0YA 1KYWA 2RNJA 3HYIA 1Z7UA 4RB3C 4FTHA 2DQLA 2L9SA 4RAYA 2QSHX 2EMBA 3BQZA 2VPRA 4WYQB 2DDBA 2B9DA 2HI3A 5D5VB 2V89A 1QU6A 5FKLA 3HXLA 3CCUI 2BB8A 4IHVA 4J8ZA 2F4VE 2EM7A 4DR3E 4KT5C 3FXMA 1BW6A 2QKMB 4F9AB 2A25A 2EPPA 5J1RA 3ZMUA 3UNGC 5J6XA 5D8KB 2BHYA 1KGSA 1B59A 1SAUA 3L09A 1RUOA 2FGGA 1UZCA 1FT9A 3LSHA 1NEIA 2WV0A 2F4MB 4KN4X 3ZQGA 2D45A 3CC4I 2KHXA 4NC8A 3KLNA 2AXLA 2O7OA 3FMRA 1KONA 4S05A 2LE2A 5KAFC 4C2TA 2DA5A 4IHXA 1TNSA 3ECHA 3EDPA 2HWVA 2R7VA 2ZBKA 3V4GA 2F5VA 2WAFA 5A6KA 2EL5A 5C3EJ 4DYCA 4BXXJ 5ADZA 2QBYA 4XOPA 1OYYA 2ESNA 2ZO4A 5CQGA 3CF5F 4BE0A 2OZUA 5IV8B 3A01B 3ZPLA 1KU3A 2HYFA 4RDUA 4ZYEA 3HPGA 3E97A 2FU4A 4L9JA 5K7ZA 4JI3E 4XMYA 3S3MA 2ELHA 2EFOA 2ID3A 2RQLA 1U5TC 3VYRB 1ZRCA 5J1YA 1YUJA 1MH4A 5BPDA 1EH6A 1MBHA 2JY9A 2CYYA 2YSPA 1Z7LA 2ID6A 1K6OA 4BQOA 2R7RA 1SD7A 2P5KA 4LMYA 1X3WB 5FROA 5IYDJ 1GVDA 3VSKA 3I4PA 4XSXF 1XG1A 4JX4A 4E7SA 1QVTA 1WI3A 1OJLA 4CHUA 5K7HA 4LFAE 1ZRFA 2HHHE 4P9UA 1E0EA 5A6JA 1WSUA 2IS6A 2DTRA 4II2A 4HV5A 1X48A 5KVRA 2L02A 2VN2A 1MW7A 2XB5A 2EMGA 1KU7A 4A3IJ 3KX2A 4PJMA 2FXAA 2XKOA 1ETQA 4CYDA 2EFNA 5KCMA 3ZOQB 3FBIB 4WF2A 3ZQLA 5CJ9A 4MQ9F 4AYBA 2XAUA 4R79A 3AV0A 4EJTA 4TUGA 3DLAA 2UXDE 1F4KA 3FXLA 4ZJZA 5KL2A 1RUNA 5TSEA 3CUQA 4FX4A 1P4WA 4AIDA 1QVUA 1ZHFA 4DJAA 1VQOI 3AUZA 2W24A 2E1MB 1XN7A 2JPBA 2Y30A 5LRRA 4AWXB 2X85A 4M3EA 1MNEA 2YTEA 1YE9A 3H0GJ 3H3UA 3DEWA 1LEBA 2M1SA 5FO5A 2AO9A 4DV0E 4D7MA 2VOOA 4R8HA 4HF1A 1IN7A 1T0FC 3I4NJ 1J9IA 4ZDPA 1MIJA 2L4MA 1FLIA 3H5RA 2DT6A 2XHKA 4N4NB 5FLVA 3KEQA 1J7KA 2EOEA 9ANTA 2DK8A 3T8RA 4XKCA 2NVXJ 1IUYA 2JJ7A 2VQLA 1DPUA 3FF5A 1W7PD 3SFZA 3FHNA 4UVCA 5LHIA 2XPWA 4NXNE 2YU3A 4DOZA 3QP5A 3AG4H 2YU9J 3G2BA 3B6CA 2QQ8A 1XD7A 2X6YA 1EKEA 3NRVA 1HSJA 1IBKE
chains in the Genus database with same CATH topology
1ZH5A 1HW5A 1S7OA 4BHPA 5DD4A 4Q5SF 1W7PA 4ON0A 2HDCA 3T5XA 1IXCA 2EWNA 2K4BA 2W84A 2VBWA 3K1PA 4EM2A 1V3FA 1S29A 1YFHA 2EFWA 1FX7A 3I59A 3KP6A 4ENJA 3GF2A 4YIFA 3GFIA 3G3ZA 5LHHA 1PP8F 4ZZDA 3L7WA 3JAMK 4M9ZA 2F5DA 3IC7A 1Z91A 1CF7B 1T98A 2OZ6A 4LK1F 1T2KA 4EQQA 4N9IA 2Z5UA 3FMSA 3Q5FA 1TNTA 4ZYGA 2J5PA 3HOSA 1CGPA 2CGPA 3WE2A 3BDDA 4MHGA 3EYYA 4I01A 1TQMA 4N0BA 2P4WA 1KA8A 3FXQA 2JZYA 1B1BA 3R0AA 2X4HA 4KIGA 2FEZA 5CVIA 5F1RA 4L18B 1O7FA 1P2FA 1O57A 3R61A 5IT9Z 4RAZA 2H6CA 2HOEA 2RC4A 2XAHA 1K78A 3F21A 5HLHA 2NNYA 5BMZA 4DQ2A 2P7CB 3CDHA 1Q1HA 1D3YA 4O3MA 5E8IA 1VTNC 4Y17A 1U2WA 1JE8A 1EH8A 2DAOA 1KQ8A 4H0EA 2KJBA 4KIFA 4EGZA 3MFKA 2HKXA 4KMFA 5ILVA 4OINF 4Q4ZF 1P4XA 4L9TA 2NAZA 4GGGA 1UFMA 3GWZA 3KP7A 4ZH4F 2MD5A 2MH2A 1U5TB 2M1BA 5K5RA 4MEYF 2DI3A 1H0MA 3DQVC 2RVCA 4I98B 3KZYA 3ZMVA 4E70A 1UB9A 1W5TA 2M30A 1KU9A 1GHCA 2W85A 5HS8A 3Q9SA 3BPVA 2UWMA 2EFPA 3J7AO 4ENKA 4MNUA 3E6BA 3WODF 3V7RA 2QQBA 4OIQF 1FPQA 1YW8A 2CW0F 3PQKA 4KUMA 3R60A 5L3CA 4G7HF 2HKOA 3K2ZA 3IRRA 5E1XA 4G6DA 2F5FA 2EJRA 3F6VA 1I6XA 2GXGA 5LRSA 1O3SA 2H94A 4KN7X 1SMTA 5J8CA 3PQJA 5EEHA 4TV7A 3MWMA 2P7VB 5K1YA 4ESFA 5L3GA 3CUQC 1XGOA 2BYVE 4OIPF 3U2RA 2CFXA 2H09A 4Y13A 5BPIA 1XMAA 3K0LA 4UV9A 4UUVA 2BEOA 3KLOA 2GZWA 4MTDA 1K79A 3QU6A 4RGRA 2Z33A 2QQAA 1GXQA 3DF8A 2K02A 3L00A 1UHMA 3WE3A 2HR3A 2PI0A 1DPRA 2E1CA 4FHTA 2QZ8A 3ZMTA 5LGUA 3S2WA 2M5WA 2HZTA 4BNCA 5HOOA 3RIRA 4LG0A 3VOEA 2ZCWA 5JVTA 4PZJA 4GO1A 1HW1A 3HUGA 3ABUA 4LB6B 4HA8A 2A07F 3LA3A 3U9GA 3NEUA 2PFBA 2BBYA 2WWYA 4KMUX 3FHZA 2Y75A 3PFIA 5LGNA 2JT1A 5E18F 5E20A 2R7FA 3VEPA 3HSFA 2F5EA 2EFQA 3MAJA 5IT3A 1D8JA 3I64A 5JFRA 3WTYC 2ZNZA 3I71A 1C0WA 2Q8KA 1ZG5A 4A0ZA 4EV0A 1QBJA 2R7DA 5DD8A 1JXSA 3D0SA 1T6SA 1G6NA 3RKXA 2A6EF 5ICFA 1STZA 1TQPA 2OQRA 2GA2A 1XDSA 3BJAA 3GO5A 2H6BA 3J81Z 5L3DA 3P9CA 5L3BA 4RS8A 3SQNA 5A2QK 1T39A 2V1DA 3RPQA 1FC3A 2QYOA 2QBYB 3LA7A 1FYMA 2IRFG 3JTGA 4L0YB 3I53A 1G3SA 4ETSA 2XIGA 3EUHA 5F64A 2UZKA 5CVUA 4RB1A 3FX3A 4PCQA 4Z2YA 2Q2EA 5CVRA 5FD6A 4UXNA 2V1UA 4ASNA 2XAJA 3ZMSA 1BBYA 4ESBA 1H9GA 3O2PE 1Z05A 1YW7A 2LSOA 1V4RA 3V7SA 3G73A 1R5GA 1BI0A 4JK1X 4YFXF 3QP6A 3CUQB 1PDNC 2VBXA 4NQWA 3I58A 4IRHA 5H20A 3OOPA 2QQ9A 1SD5A 2DW4A 4HF2A 3GZ5A 3ZMZA 4B09A 1RZ4A 3BPXA 1S3JA 2ETHA 3M8FA 1AWCA 3WTXC 3LAJA 5LGTA 4HQEA 1XDUA 5E17F 2K86A 5AIQA 1I1SA 2IW5A 2F2EA 2KIUA 4AD9A 1BI1A 1W7PB 2X0LA 3DP7A 4BXUA 3WTWC 2WC2A 1R22A 1B9MA 2STTA 2P5VA 2VE8A 5CVJA 2JRTA 4L5JA 2CQKA 4YFNF 1ZGAA 1JHFA 2DO7A 3BZ6A 2VXZA 3I59B 3NQOA 3U1DA 3K69A 3SXYA 1YQAA 2Y0MA 2MLKA 1ZAOA 3EQLF 2PMUA 1YS6A 4P96A 4JQFA 3HRTA 1U6GA 5DCMA 3TQNA 3RJPA 5F6FA 2VBZA 5HDKA 1IN4A 3R4KA 3GFLA 3HTUA 3I0TA 3FZVA 2RV8A 1HW2A 3ULQB 5ICCA 1KYZA 1YYVA 1KQ0A 4PGGA 2FRHA 3GXOA 2V6CA 5CVVA 3LSTA 4IVNA 5FFXA 4HZFA 3HSEA 3EETA 2GQQA 3QAHA 4WCGA 2O8XA 2GIVA 4I2OA 1IN6A 3ECOA 3C3WA 1HSTA 1SFUA 3ABTA 2RGVA 3KP4A 5D5XB 3BOQA 2HS5A 5LEKA 2EV6A 2JPCA 4OMYA 1K7AA 4DNCA 4BHBA 2QM3A 2OBPA 1U3EM 2AS5F 4GCVA 3REOA 3DEUA 2VODA 5AIPA 1FYKA 4G9YA 4L0ZB 2MLGA 3RKWA 1RNLA 4A12A 1U78A 3J80K 4D0PA 1IN5A 4LLLA 1OYWA 2CO5A 5JI6A 3BJOA 2YX4A 2XAGA 2XRNA 4EJVA 3F6OA 4XBFA 1BI3A 2XAFA 5D4RA 4BQAA 1J2XA 4O5VA 1QPMA 2XKPA 4M74A 2IA1A 2OQGA 1REPC 5D5UB 2Z3YA 3L9FA 3IWZA 2HGCA 3IKTA 4JBAA 2IT0A 1QZYA 3WGIA 3WTZA 1IW7F 2BV6A 2TDXA 3KP5A 4HX7A 1LB2A 5EEGA 3JW4A 4CXFA 4XSZF 2FBHA 3WGHA 3VODA 4OIOF 2KIMA 5CLSA 5HS9A 1DP7P 3F3XA 2KIFA 1WI9A 3F23A 1BC7C 1IRGA 1E17A 1BJAA 4U7DA 1F1ZA 2IP2A 5FLXZ 4LD5A 3WU0A 5IT9K 4HX8A 1ZG1A 3GLXA 1MDMB 1SD4A 4HOBA 4AIHA 2FF4A 1D5VA 2D1HA 1MKMA 5DEQA 1P92A 2P5LC 1R23A 2RQPA 1ON2A 2RN7A 3JTHA 3MEXA 2EA2A 2PLYA 1WWXA 5FGMA 4EGYA 2E1NA 2A61A 1Z1DA 3VB2A 4LLGF 6PAXA 4ZYDA 4RB2C 5AONA 5HLIA 2FMYA 1FY7A 3SHFA 3GFJA 4M72A 1XB4A 2E7WA 5BQTA 4GYIA 1YLFA 5FD5A 2DK5A 3GVAA 1USSA 3JSOA 2STWA 3F8CA 2VE9A 4EJWA 2FOKA 4HW0A 1QO0D 2DQRA 2IJLA 1IXSB 2JSCA 4G8XA 2FNPA 2V1XA 3CTAA 3F8NA 4HV6A 1MD0A 1U5TA 4M6YA 3D5LA 4IHTA 3B73A 3V8LA 2Y48A 3H92A 1EH7A 3RPUA 4I0AA 1XCBA 2A69F 3ML6A 4LG0B 1G4DA 2UXNA 4I0BA 1F9NA 3ZMDA 1ZG3A 2RDPA 2VC1A 3QU3A 1UCRA 2NNNA 2A6HF 3WGGA 1ZYRF 2A68F 2QENA 2DLLA 2W25A 2OA4A 1BN5A 5E8GA 1HBXG 1IXRC 1B9NA 4EJOA 2EB7A 3DKWA 1XGNA 4Y15A 4FX0A 3N97A 1F5TA 4A5MA 2L54A 3F22A 3FXUA 3FXRA 1AOYA 1QZZA 4BH9A 5LBQA 5HLGA 1J5YA 4HDUA 1J75A 1KQ9A 2GXBA 1PP7U 2YPRA 3N4MA 4LGWA 1WKMA 1MGTA 1IRFA 1T38A 4IJAA 5ICGA 3TGNA 1I5ZA 4GYGA 1U8RA 2O3FA 2ZMEA 4YG2F 3MQ0A 4CZZA 3HIFA 3GFMA 2NYXA 2ZXJA 2FBIA 3WTTC 2FMLA 4IRIA 1LNWA 2P8TA 2V9VA 5DUKA 3DXJF 1HQCA 1TW2A 2Z9OA 4K2EA 4XRFA 1LDKB 4ZZLA 2K27A 1FSEA 2M8EA 2VT3A 4S04A 4CICA 1TLHB 4HAMA 4UVBA 1YS7A 2ACJA 2E7XA 4OMZA 2D2WA 2ADUA 3GX4X 2PMHA 1L0OC 3CO6C 1ZN2A 3GEZA 3O6BB 3TO6A 1GXPA 4KIBA 3BY6A 1NHAA 2JTVA 3HSRA 2G7HA 4RGSA 3M1EA 2HQRA 2IVMA 5KK1A 1G3WA 1YO5C 3BJ6A 4M73A 1SMYF 3B02A 3Q9VA 1TBXA 2ESHA 2MH9A 4NHJA 3LFKA 4UV8A 1YW9A 5L3EA 3CLOA 3QOPA 1MJBA 4N9HA 1Y0UA 1BIBA 5DUIA 2CG4A 5JR3A 1FBQA 3J81K 3CJNA 3ELKA 1H9TA 1FYLA 3LQRA 3TOAA 3ZQ7A 3FMQA 1XCVA 1UHWA 4AIJA 4UNOA 3FM5A 3WU1B 2COMA 5K5OA 1FSHA 1R36A 1TW3A 2HFHA 1D8KA 1ZLKA 2GWRA 1E2XA 3R6SA 4EVIA 4U7BA 2GA1A 3KZZA 4I09A 1O3QA 2ISZA 1W4MA 1FBSA 2HYGD 3C1DA 3KETA 1OKRA 3E5QA 3ROUA 3MCZA 1XGSA 3P9KA 4PDKA 1OPCA 5BOXA 1R58A 3DFGA 2QWWA 2FNAA 5DCMB 3QRFF 4KNYA 3T0YA 1Z6RA 2CSOA 4IRGA 2G9WA 2XAQA 4MTEA 2KJCA 1DUXC 1QGPA 2IPQX 3KEOA 2XASA 2FA5A 4QLCU 3P9IA 2Q0OA 1BM9A 2NS0A 2L01A 2XROA 1FNNA 4G7ZF 4QWQA 1LVAA 3F8FA 4MQVA 2YSRA 3GUDA 3E5UA 5HVQC 3RDIA 2PG4A 3IRQA 3FM3A 3TO9A 1YTYA 2L4AA 2M45A 2VONA 4KDPA 3C18A 1ZLJA 1XMKA 3RTRA 3TDUC 1LEAA 3F8BA 3HHHA 2OU2A 2LKPA 1FP1D 5E1ZB 2BE5F 4MEXF 1IAWA 1HKSA 4A5NA 2MA3A 4AIKA 2Z99A 1WRJA 2P6SA 1I1GA 3WTVC 1ZGJA 3GYHX 1SFEA 3LWFA 5J8FA 3V8KA 4L9NA 2LF7A 1BIAA 2DT5A 2MC3A 4P55A 3IL2A 3ZN1A 5TJJA 2GAUA 3JAMZ 4WK8F 2EK5A 3KE2A 1FZPB 1B6AA 1BC8C 2BGCA 2HQNA 2FE3A 1LDDA 4LFUA 5H6QA 3TOBA 3W6JB 3FWEA 5HDNA 1K78B 3WTSC 2A5YB 5HS7A 2O03A 3KP3A 2NRAC 3J80Z 5ERIA 4WX9A 3HOTA 4B8XA 5ED4A 2ISYA 1MJ9A 1YG2A 1TQIA 2H27A 1RIOH 1YIOA 4I02A 3AAFA 4EM0B 5D4SA 2KRFA 1QQIA 2G7UA 3K1NA 4HDVA 4BYYA 1FWZA 1BI2A 4BAYA 1R1TA 1OR7A 3JSPA 5DYMA 2OD5A 1IF1A 4U0VA 2O61A 1FOKA 4RGUA 4PGHA 2YR2A 4KA4A 4ENNA 4AVPA 3ISPA 2RKHA 4M9XA 3IWFA 3CUOA 2M87A 4LB5A 3BROA 3WG9A 2LDUA 1ZARA 3GZ6A 3GW2A 3LA2A 2DPDA 3HRUA 4Q48A 1SFXA 2HTJA 1MJAA 1FBUA 4ZYHA 1USTA 1S6LA 4GXOA 1B4AA 4LJZF 1ODDA 4RGXA 2QUFA 3WTUC 1CF7A 2HEOA 1Z9CA 2VC0A 1ULYA 1HKQA 2XV4S 4HLYA 2ZNYA 3HTSB 3RI4A 5HDGA 3T1BA 2XVCA 2HTSA 3M8EA 1IN8A 3KP2A 3F72A 3BP8A 3HHGA 3K1MA 1DDNA 5D5WB 2WTEA 3W6KB 2FSWA 2W57A 1SD6A 4HX4A 4YFKF 3ERED 1FP2A 2PJPA 3I5UA 4OOIA 5FLXK 3H3ZA 4HYEA 4LLNA 3MZYA 4OIRF 3DPTA 2D1VA 1XSDA 2DU9A 4EMSA 5H6RA 4UVAA 5D8LB 2XGXA 4CDGA 5ILUA 2L3DA 4I7HA 4L5IA 3M9AA 3P7NA 3SZPA 4CGZA 3KFWX 4IXAA 1I27A 5TRDA 4KFCA 4G7OF 5ILSA 1LJ9A 1MDMA 4OU0A 3CO7C 3HRMA 4HLXA 4EJUA 2UXXA 1G3YA 1XGMA 1O3TA 1R1UA 3IKVA 4O6JA 1Z6TA 3HRSA 4BHCA 1XSVA 2LNBA 5D6FA 2PN6A 2IA2A 5BS6A 1ZREA 1O7LA 4A6EA 2MBFA 2V79A 1HXDA 1G3TA 3TKYA 5K5QA 3DPLC 1OMIA 1ON1A 2ZMEB 1R5HA 2QLZA 5FFZA 3T8TA 1W5SA 4Q47A 2B0LA 4LK0F 4U88A 3BWGA 1LQ1A 5DDGA 5DV5A 2CWEA 2K4JA 3IHUA 1IZ1A 3F8MA 1QNTA 3K9TA 2DFIA 1JGSA 2EA4A 5E1WA 5FB2A 3LAPA 4ESJA 1XSXA 3MZHA 1T0FA 4U0WA 4U0YA 1WQ2A 1BOAA 3O3KA 2O0YA 3RKYA 1ZRDA 2DBBA 4YIIA 1LDJA 4F7ZA 4MGRA 4M6XA 2FQ3A 2QVOA 4NB5A 1O3RA 1P6RA 1S7AA 4IPAA 3DV8A 4HQMA 5L3FA 1PUEE 2IA0A 1KU2A 5ICEA 1A04A 1TTYA 3V7CA 4WXDA 3E6MA 1EV7A 3R0JA 2DPUA 2R3SA 5LLQA 4G6QA 2VOPA 2ZJ2A 4L9VA 3KCCA 3RYRA 4KICA 4A6DA 2F5CA 4RB0A 3SZTA 2VBYA 4ENMA 3I54A 3ZP5A 1S8NA 2XUBA 3C7JA 2C6YA 2OAZA 3VFZA 3RYPA 3ZN0A 3M7GA 4CO8A 2PEXA 2O6GE 1J0RA 5CYVA 2ZKZA 5A2QZ 2K7LA 2EV5A 2PQ8A 1SAXA 2LF8A 2YX7A 3E6DA 4IF4A 2A3SA 4WXHA 4UHTA 4G94A 2VT2A 1R7JA 3E5XA 2ZFWA 5D6EA 4EM1A 1J59A 1OYIA 1MZBA 3TO7A 3V8JA 2FBKA 1R00A 4WWCA 3TDZC 3COAC 1R1VA 4HF0A 4P5OA 1RI7A 5JHUA 1JHHA 1ONVA 3LQQA 3QPTA 1GVJA 5DCFA 2EV0A 4M9SA 5LHGA 1L3LA 3E3VA 4IHSA 1HKTA 4A2UA 3E6CC 2PBIA 2J5OA 4M71A 3OV8A 4XLNF 4WXCA 4A0XA 2P6TA 4XLPF 4KYWA 4R1HA 4HBLA 4FT8A 3QPHA 1X3UA 3EYIA 4P9FA 2KKOA 1P4AA 3L2CA 5LEJA 4A0YA 1KYWA 2RNJA 3HYIA 1Z7UA 4RB3C 2DQLA 4RAYA 5D5VB 4KT5C 3ZMUA 5J6XA 5D8KB 1KGSA 1B59A 3L09A 1RUOA 1FT9A 2WV0A 4KN4X 2D45A 3KLNA 2AXLA 3FMRA 4S05A 1TNSA 3ECHA 3EDPA 2HWVA 2ZBKA 3V4GA 2QBYA 1OYYA 2ESNA 2ZO4A 2OZUA 3ZPLA 1KU3A 2HYFA 4ZYEA 3E97A 2FU4A 4L9JA 2ELHA 2EFOA 1U5TC 1ZRCA 5BPDA 1EH6A 2CYYA 1K6OA 1SD7A 2P5KA 4LMYA 3I4PA 4XSXF 4CHUA 1ZRFA 4P9UA 1WSUA 2DTRA 4HV5A 5KVRA 2L02A 2VN2A 1KU7A 2FXAA 2XKOA 4CYDA 2EFNA 4WF2A 5CJ9A 4MQ9F 4R79A