1WRJA

Crystal structure of o6-methylguanine methyltransferase from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
b'MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wrjA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1wrjA01
4A5MA 1U78A 2WV0A 3GLXA 4XSZF 1H9TA 1R23A 1QGPA 2DBBA 2PBIA 1Y0UA 2QBYB 2DLLA 3IWFA 2CYYA 4UV9A 3FHZA 4Q5SF 1FP1D 1T98A 3K2ZA 4B8XA 4M6YA 4U7DA 1RNLA 1BC8C 1I6XA 4UXNA 2XAHA 4KUMA 1ZLJA 3H3UA 2JPBA 1OKRA 5D5XB 5FD6A 1R7JA 2VONA 5BS6A 4O3MA 4MEYF 3I4PA 3V7RA 2VN2A 1S8NA 2YSRA 2YX7A 2V1XA 3Q9VA 2EFNA 4A12A 3RI4A 3BY6A 5CVRA 2FOKA 5BPDA 2HYFA 2AXLA 3KLOA 3I64A 5J8FA 4OIRF 3U1DA 4EJTA 3CUOA 1ON1A 2CW0F 4L9TA 3EQLF 3F8BA 4Y17A 2M87A 5ILUA 4OMZA 5DD8A 5J8CA 2ISZA 5JI6A 4OINF 4JQFA 5E20A 2RKHA 1ZGJA 2F5FA 4ZYHA 3F8MA 2XIGA 4HYEA 3ULQB 1MDMA 2ZMEA 5D8KB 3S2WA 4HQEA 2GIVA 1R22A 1G3YA 1S7AA 2ETHA 1RIOH 2ELHA 3LQQA 2A6HF 1MD0A 1WRJA 3F72A 2OA4A 4A0YA 5DDGA 4A2UA 1SFXA 3GFMA 1EH8A 1WI9A 1I27A 1Z6RA 2A5YB 2FSWA 1LDDA 4I01A 4M6XA 1OPCA 1U5TC 4GYIA 5HS8A 3K1NA 1YFHA 1XMAA 1FNNA 5FB2A 3E6CC 3P9IA 5ILVA 3E6MA 2HR3A 1HSTA 3E5QA 3K1MA 1FSHA 4HLXA 2O3FA 2MD5A 2O03A 4R1HA 1R1TA 1FY7A 2KRFA 4Y13A 3NRVA 3ELKA 3WG9A 3LA7A 3RKYA 1CF7A 3KP2A 1I1GA 3C7JA 5E1WA 5HLHA 2LNBA 3E6DA 1D8KA 1UFMA 1YIOA 1W5SA 3IRRA 3J81K 3ZPLA 5IT3A 5KK1A 1CF7B 2G7HA 1HBXG 3F8FA 2P5LC 2TDXA 4KIGA 3RYPA 1V3FA 3ERED 2MH2A 5AIQA 3V8JA 5DCMA 4MTDA 2RC4A 4FX4A 4HZFA 2L4AA 2HS5A 5HLGA 1ZRCA 1ZGAA 5DCMB 2KIMA 4QLCU 4HV5A 4M72A 1QQIA 1IAWA 3G3ZA 3WE2A 1LQ1A 1HSJA 2QENA 3JAMZ 3WGIA 1I1SA 5HDGA 4XLPF 4HX7A 3I54A 2MA3A 3RPQA 5EEHA 2QUFA 1MZBA 1RUOA 3M8FA 2ZKZA 2K4JA 3I53A 3BDDA 2DQLA 4OIOF 5H6QA 3IL2A 2GWRA 3TO7A 1T38A 1F4KA 1XGSA 1A04A 3K9TA 3M9AA 2OQRA 2DPDA 1HKSA 2C6YA 2F5CA 1UB9A 5L3BA 5E1ZB 4B09A 3V8KA 5FLXK 3TQNA 5D4RA 4R8HA 2YPRA 1OR7A 4ZZLA 1SFEA 2IP2A 5DEQA 2ESNA 2LDUA 3JSPA 4Q48A 2J5OA 2JZYA 2F5DA 2GQQA 3ABUA 3FM5A 3KEOA 1Q1HA 2CSOA 2PJPA 2JPCA 4LG0B 1XDUA 2COMA 2W25A 1MJ9A 2ZO4A 4YFXF 1SMYF 3ZP5A 1MKMA 1BI1A 4RGRA 3LFKA 5LGNA 4E70A 3MZYA 3MZHA 3MQ0A 3RIRA 3LA3A 1FX7A 2PFBA 3FF5A 3DQVC 2NNNA 3L9FA 1P4AA 1B4AA 3EUHA 2MBFA 2Q2EA 1BOAA 3V7SA 1W7PA 2ZFWA 4G7OF 3WTVC 1LJ9A 2FNPA 5E18F 4KFCA 3REOA 2EWNA 4EGZA 1ZHFA 4CDGA 2HTSA 1Z1DA 1STZA 4QWQA 2R3SA 2O0YA 4UHTA 2JRTA 1TQIA 1S3JA 4LMYA 3VODA 2E7XA 3HSFA 4L9JA 3QPHA 2PI0A 1J0RA 2V6CA 3F8NA 2DQRA 3BZ6A 4EJWA 2Y75A 3IWZA 4G6QA 2DO7A 4KN4X 2ESHA 3JAMK 1HKTA 5FO5A 3BROA 1IN6A 1R00A 1X3UA 5E8IA 4Z2YA 3ABTA 1DPUA 3FX3A 3H3ZA 2FE3A 1EH7A 4KDPA 4ZYDA 4GGGA 3I71A 2EK5A 1Z05A 1FYLA 1XGMA 2VE9A 1U3EM 1Z91A 3ZN1A 1AWCA 1K79A 2ZNZA 4KIBA 3QAHA 4L9VA 1XN7A 2W57A 2VOPA 4PGGA 2BGCA 4FHTA 4MEXF 2FRHA 1Z6TA 1QO0D 3M1EA 4IHTA 2RNJA 2XRNA 2P6TA 2JSCA 1R36A 5HOOA 2VBWA 3KP4A 2EV5A 1QBJA 2ADUA 1KYWA 2W84A 2LF7A 3HUGA 3C18A 4AIHA 1S7OA 5HS9A 1B1BA 3R60A 1WQ2A 4RAYA 1FOKA 5D8LB 3ZMUA 3F23A 3SZPA 3KLNA 2EJRA 3F8CA 3NEUA 2FNAA 3DV8A 2IRFG 4EM2A 2XVCA 5HDNA 2FBHA 3SFZA 1RI7A 4MGRA 5HDKA 2G9WA 3LSTA 3WGGA 4HF0A 5A2QZ 2L54A 1IRFA 2QBYA 1SD4A 1XSVA 3G73A 5FD5A 1MJBA 2HZTA 3E3VA 1FPQA 2UXNA 4P55A 3F3XA 2DK8A 3AAFA 3KZZA 4H0EA 4LB6B 4GYGA 4S04A 3J81Z 1R58A 2XASA 2OAZA 1G6NA 2FQ3A 3CUQA 1XCVA 3TO6A 2M8EA 4O6JA 4BYYA 4BHBA 3R0AA 4S05A 3E5XA 2OD5A 1XD7A 5CYVA 1SD5A 3QU6A 1BIBA 5LLQA 3OV8A 3CUQB 4PCQA 1W5TA 4CHUA 4L0YB 4WXDA 4PGHA 4BHPA 2E1NA 2P4WA 4FX0A 5BMZA 1J7KA 5JR3A 3PFIA 1SD6A 3GW2A 3ML6A 4KMUX 4UVBA 1JXSA 3P7NA 4YFKF 1P4XA 1KU3A 3D0SA 4IPAA 4YG2F 3VEPA 1KQ9A 3L00A 5HLIA 3WU1B 1USSA 2VE8A 2E1CA 3QOPA 1IXCA 1QPMA 4KN7X 4AIJA 1JHFA 2BEOA 3WGHA 2EA4A 3F6VA 3QRFF 5BOXA 4I09A 2M1BA 3CLOA 1DDNA 3HRUA 3DPTA 3J7AO 4CZZA 1KA8A 2OZUA 1YW7A 1XGOA 1YYVA 2XHKA 5TJJA 2QQAA 1T2KA 2VC1A 4ENMA 5K5OA 1XB4A 1F1ZA 5FLXZ 5IT9Z 5BPIA 1ZN2A 1UCRA 4N0BA 2QYOA 2X4HA 4MQ9F 1U8RA 3IRQA 1P4WA 2ZJ2A 4UUVA 3JTHA 4PDKA 2XAJA 3HTSB 4HOBA 1UHWA 1HW1A 2EFWA 1YS6A 2H6BA 1R1VA 3JW4A 3VFZA 1PUEE 5JVTA 3QP5A 3BOQA 5LEJA 1JE8A 2GXGA 4OU0A 4AD9A 1TNSA 5A2QK 3RKWA 4AWXB 4L5JA 3E6BA 4WCGA 4G6DA 3TO9A 4EQQA 5CVVA 3K69A 4G8XA 1XSDA 1E2XA 4U0VA 2OU2A 3SZTA 4RGXA 2K86A 5DUIA 3HRTA 2VBXA 3I5UA 3LWFA 2PMUA 2K27A 4JBAA 1ZARA 4ZYGA 2RQPA 3W6JB 1YO5C 4FT8A 1WWXA 4K2EA 4LK0F 5ICCA 2STWA 1J5YA 1WKMA 2VT3A 5D6FA 1TQMA 1MJAA 1SAXA 2P5VA 1BM9A 2EV0A 3P9KA 3C3WA 2P7VB 2HFHA 2X0LA 2CFXA 3K0LA 4A0ZA 4LJZF 3I0TA 3TDUC 4G94A 4HA8A 2KIUA 3FMRA 3GO5A 1ZH5A 1L3LA 4JK1X 3FWEA 3GZ6A 2GAUA 1WSUA 2L01A 4M9XA 5F1RA 3F22A 5D5WB 1ZG5A 1PP7U 5ED4A 1KGSA 5LGUA 1T6SA 4ZYEA 3KCCA 3RYRA 1QZYA 4OIPF 2VC0A 2FMLA 3HYIA 1UHMA 2VOOA 5AIPA 1KQ8A 2ISYA 4LLGF 2JTVA 3L2CA 1J2XA 2HQNA 4Q47A 3J80K 2A61A 2GA2A 2B0LA 1OYWA 4IHSA 3O6BB 2IW5A 5IT9K 5F6FA 3BJAA 1G3WA 4HBLA 2QQ9A 4WXHA 4N9IA 4A6DA 1ZLKA 3T5XA 4LG0A 3VOEA 2IA1A 3I58A 1GHCA 3ZMDA 4IJAA 4AIKA 3DF8A 4WWCA 3QP6A 3BJOA 1ZG3A 5LRRA 1J59A 5L3GA 2HEOA 1OYIA 2IT0A 4XRFA 4G7ZF 3U9GA 1FSEA 3WTSC 3ZN0A 4HDUA 3EDPA 2ZBKA 4EM0B 4CGZA 2NRAC 2QM3A 1XDSA 2HYGD 5DCFA 4KICA 2CWEA 4P96A 1LB2A 2L4MA 4KNYA 1KU7A 4EJOA 1U5TA 2QZ8A 1XSXA 2K4BA 1K78B 3RPUA 4HF1A 1TBXA 1LNWA 1OYYA 4D0PA 3BP8A 4L18B 1RUNA 1IN5A 2BYVE 2IJLA 5J6XA 1DUXC 1U5TB 2EB7A 1W7PD 3T1BA 3ZQ7A 1JHHA 1ON2A 4ENJA 1BN5A 2Z9OA 3HSRA 2E7WA 3CO6C 5CVIA 5D5VB 3MFKA 3LAJA 1B9NA 2D1HA 1E17A 3GVAA 4GCVA 5L3FA 4KT5C 2NS0A 5CLSA 2PMHA 1TQPA 2W24A 3TOBA 4XSXF 4ETSA 3HSEA 1L0OC 2IA0A 2HDCA 1IRGA 1S6LA 2UWMA 2D2WA 2YR2A 4HLYA 3EYYA 4U0YA 1SMTA 1FLIA 1FBQA 1GVJA 4M73A 1O3SA 5FGMA 3KEQA 3M7GA 5ILSA 4A0XA 5L3CA 4I0BA 4OMYA 3BJ6A 1T0FA 2FEZA 1GXPA 1EH6A 2OBPA 2XKOA 2Y48A 5ICGA 3DEUA 1O3RA 1B59A 2HGCA 3CTAA 4KA4A 5L3DA 1FP2A 2QLZA 1H9GA 3MEXA 5LHIA 3KP6A 2H27A 1YG2A 3NQOA 4UNOA 2FXAA 4L5IA 2FA5A 3T8RA 4EV0A 4RB1A 2Z5UA 1T39A 3FXUA 1USTA 2EFQA 4GO1A 2OQGA 1P2FA 3GFLA 1R5GA 1J75A 3ZMSA 3B02A 3IC7A 4RGSA 1LDJA 2ZXJA 3GEZA 1HW5A 4M71A 2GZWA 4YIIA 4OIQF 4KMFA 3QPTA 4YIFA 4IRHA 4P9UA 2P5KA 2M45A 3FMSA 1ODDA 3I59A 5D4SA 1IN4A 1O7FA 4KIFA 5CVJA 4RGUA 1XCBA 2ACJA 3R61A 4CYDA 2BV6A 1O3TA 1YW9A 1FYKA 3I59B 1ONVA 1O3QA 2A6EF 4LB5A 2WWYA 1FWZA 3EYIA 2PN6A 1KYZA 3WTTC 4IF4A 5LGTA 2DW4A 4LD5A 1BI0A 1K6OA 2M30A 2RGVA 4RAZA 2F2EA 3DP7A 2CO5A 1PDNC 6PAXA 4IVNA 4UVCA 1LEBA 5LRSA 2XGXA 1HW2A 2HOEA 3FXQA 2EV6A 1FZPB 2Y0MA 4I2OA 1QZZA 3WTWC 1Z7UA 1LEAA 5FFXA 2D45A 2STTA 4LLNA 1R1UA 3V8LA 2M5WA 2DK5A 4RB2C 4I98B 4MNUA 5ERIA 4IRIA 5LHGA 2DTRA 3V7CA 4HDVA 1YS7A 3SXYA 4Q4ZF 3GUDA 2V1UA 1SD7A 2KJBA 5DUKA 1FBUA 3BPXA 2XAQA 1GXQA 1S29A 2V79A 2KJCA 4M74A 1IXRC 1G3SA 3PQJA 2A68F 2RVCA 5DV5A 1TLHB 1U6GA 1HQCA 4HQMA 3U2RA 4M9SA 5K1YA 4A6EA 4OOIA 2CG4A 3HOSA 1ZRFA 3ECHA 5ICFA 1G3TA 2H94A 1R5HA 4LFUA 2VBZA 3R4KA 2D1VA 3J80Z 2FBKA 2P8TA 4IXAA 3HOTA 2IVMA 2CQKA 4HV6A 3JSOA 3O3KA 2IA2A 3CJNA 4NB5A 1HXDA 2P7CB 3VB2A 2O6GE 4L9NA 5AONA 3KZYA 2Z33A 5LEKA 2EFPA 1V4RA 4HX4A 3WU0A 2QQBA 3IHUA 1OMIA 2KKOA 5HS7A 3V4GA 1ZREA 4BAYA 1F9NA 5L3EA 3FXRA 5K5RA 4BH9A 1P92A 2BE5F 3W6KB 2YX4A 1HKQA 2MH9A 3N4MA 4WF2A 2HWVA 4YFNF 3H92A 2FMYA 1YTYA 4MHGA 4U7BA 1MDMB 2HKOA 1ZG1A 2ZMEB 5D5UB 2IPQX 5DD4A 4BNCA 5D6EA 3Q9SA 4ASNA 3DFGA 3WTUC 4XBFA 1NHAA 2DPUA 4ESJA 1MGTA 5JFRA 3N97A 1TW3A 1TTYA 4ON0A 1XMKA 4HX8A 2R7DA 1G4DA 1FBSA 4EGYA 1FYMA 3GFIA 5FFZA 1Z9CA 3T8TA 2RV8A 4CO8A 4DQ2A 4I0AA 4TV7A 2O61A 2XKPA 4KYWA 2ZCWA 4HAMA 1F5TA 2PEXA 2Z3YA 3TKYA 2MC3A 3T0YA 1ZYRF 1BBYA 3RTRA 2UZKA 3MCZA 4EVIA 4EJUA 1I5ZA 5E8GA 2AS5F 1B6AA 2K02A 1BC7C 4RB3C 3HIFA 4N9HA 3DXJF 1IN8A 1FT9A 4UV8A 4P9FA 5KVRA 1REPC 2NNYA 1IN7A 5CVUA 3ZMVA 4HW0A 4NHJA 1LDKB 1BIAA 4M9ZA 3F6OA 2VT2A 3RDIA 2G7UA 2MLGA 4EM1A 1TW2A 1O57A 5ICEA 2HKXA 4ZH4F 1J9IA 1PP8F 2V9VA 3ROUA 1BJAA 5LHHA 1JGSA 2ZNYA 3TOAA 4CICA 3LQRA 2H6CA 1DPRA 2L02A 2BBYA 2Q0OA 4LGWA 5DYMA 2GA1A 4BHCA 2KIFA 3L7WA 3COAC 3M8EA 2A07F 4U88A 2CGPA 4HF2A 2JT1A 4RS8A 4CXFA 1FC3A 1EV7A 2PG4A 2LF8A 1D8JA 4I7HA 2FF4A 1LVAA 4O5VA 3EETA 1CGPA 2OZ6A 3B73A 3IKVA 1ZRDA 4IRGA 3R6SA 3WTXC 2VODA 1U2WA 2WTEA 2Z99A 1QNTA 3SHFA 3R0JA 1XGNA 1K78A 3GFJA 3FZVA 2V1DA 3D5LA 3LAPA 1SFUA 1KU2A 4WK8F 5E17F 3HRMA 2DI3A 2HTJA 1KQ0A 2XROA 1IF1A 4UVAA 3BWGA 4WX9A 4GXOA 3ZMTA 2W85A 3MWMA 1IXSB 4Y15A 2PQ8A 1W4MA 2A69F 4AVPA 2R7FA 5EEGA 3C1DA 4LLLA 4G7HF 4G9YA 5H20A 1D3YA 2DU9A 1KU9A 2LSOA 3ISPA 1W7PB 3GX4X 2NAZA 3CUQC 3GXOA 1AOYA 5BQTA 4LK1F 2QVOA 2XAFA 4BQAA 5K5QA 1RZ4A 5E1XA 2LKPA 3HHHA 3DPLC 5H6RA 3ZMZA 2FU4A 1B9MA 2DT5A 2K7LA 4P5OA 3GWZA 2NYXA 3O2PE 5HVQC 4EMSA 3GYHX 4F7ZA 1IW7F 3K1PA 3WE3A 2PLYA 1D5VA 1O7LA 3OOPA 4PZJA 3DKWA 3HHGA 2MLKA 2WC2A 4RB0A 3RJPA 2Q8KA 2VBYA 5TRDA 4ESBA 1DP7P 2QWWA 3Q5FA 3KFWX 3TDZC 4MQVA 4ENNA 3KE2A 3KP3A 3MAJA 3QU3A 4ZZDA 4I02A 2GXBA 3F21A 3BPVA 5CJ9A 2F5EA 1H0MA 4L0ZB 4EJVA 1K7AA 4DNCA 3GZ5A 3HTUA 3CDHA 1YQAA 3ECOA 1BI3A 3SQNA 3KETA 2YU3A 3CO7C 2XAGA 4MTEA 4R79A 4NQWA 4A5NA 1YLFA 2H09A 2RN7A 4ESFA 1IUYA 2P6SA 2A3SA 2RDPA 3IKTA 2DAOA 2EA2A 1P6RA 4U0WA 3E97A 1YW8A 2XV4S 1BI2A 2VXZA 2L3DA 3LA2A 2J5PA 5F64A 1C0WA 3L09A 3WTYC 3GF2A 2DFIA 3JTGA 2FBIA 2EFOA 3PQKA 3WODF 3KP7A 5JHUA 4XLNF 3RKXA 4BXUA 3FMQA 3E5UA 1IZ1A 4ENKA 5LBQA 1TNTA 2XUBA 4WXCA 1ZAOA 2UXXA 3TGNA 3P9CA 2O8XA 1ULYA 3FM3A 1VTNC 3HRSA 3WTZA 2HQRA 3KP5A
chains in the Genus database with same CATH superfamily
3IWBA 3JCUC 4A5MA 3I55I 1U78A 4KHPE 3SDGA 2WV0A 2EOEA 5IV8B 4JI3E 5GAHJ 3HZJA 4JV5E 3GLXA 1UBDC 4XSZF 1H9TA 1R23A 1ETOA 2LBSB 1QGPA 2R7OA 5IWAE 2DBBA 3BZCA 4LG3A 3SJMA 4IEJA 2PBIA 4PJJA 1DQUA 1Y0UA 2VL8A 1R49A 2QBYB 2DLLA 3IWFA 2ME0A 2XGCA 2CYYA 4XRSA 1A6QA 1WJ5A 4BE1A 4PJMA 4UV9A 3FHZA 4B3RE 4X66E 3MMYB 3ZQQA 1GDTA 4LTYA 1IC8A 1AU7A 1FP1D 4Q5SF 2YT4A 1T98A 3SYTA 1TZLA 2KHMA 2V7FA 2W1OA 3K2AA 1RESA 3K2ZA 4B8XA 4M6YA 3L2QA 2EL4A 2EMXA 4HTGA 4U7DA 2K9LA 2PX9A 1RNLA 2CH0A 2DA1A 5BNGA 1WVRA 1BC8C 1I6XA 1Z21A 4UXNA 2XAHA 4KITB 2ZJQF 4KUMA 1XNRE 1IV8A 1ZLJA 3H3UA 4X65E 1P7JA 2JPBA 1OKRA 1ZELA 5D5XB 5FD6A 1R7JA 2VONA 4HG2A 1MNEA 5BS6A 4LF4E 1O4XA 2X9DA 2F5VA 5E3LA 5DM7F 4O3MA 2E1OA 2WBMA 2BXYA 3PIOF 4MEYF 3I4PA 3HPSA 1DGCA 3V7RA 3BG7A 4FE7A 2M0CA 2TCTA 2VN2A 1OCCH 2WADA 2KISA 4U87A 5A6BD 1S8NA 3W2WA 2YSRA 2YX7A 2V1XA 3Q9VA 2EFNA 4A12A 1RMDA 3RI4A 2AHQA 3BY6A 5DS9A 5CVRA 4IOAF 1JUPA 2BY0A 2FOKA 2RREA 5BPDA 2HYFA 2AXLA 2ADRA 2R5YA 2PJRB 2HVSA 4BE0A 3KLOA 3I64A 4WSGA 1XNQE 3OYEA 2R0QC 2ODRD 4JX4A 5J8FA 2V85A 4OIRF 3U1DA 1QHGA 2E72A 2A25A 4EJTA 4WPYA 2YSOA 3CUOA 2E1MA 1MSEC 2AQEA 3PL8A 4GFBA 2DIXA 3S3OA 1ON1A 1VQ8I 2V9PA 2CW0F 4Q35B 4MLQA 2R5YB 3QOEA 1ACIA 4L9TA 3EQLF 3F8BA 4Y17A 1TN9A 5B5EC 1HF0A 3FXLA 2WY7Q 3S1MJ 1GLNA 3LSKA 2KRCA 3NWSA 1V5FA 2M87A 4GRIA 2ZXHA 3QYEA 1WJAA 5ILUA 4OMZA 2P81A 5DD8A 5J8CA 2EM4A 1WXRA 2ISZA 2HOAA 2V87A 4R2AA 2EMYA 1YJNI 4BU2A 5JI6A 3OL3A 4BEHA 4OINF 5E3NA 2FD5A 2W48A 4JQFA 5E20A 5JHFA 5FJ8J 2RKHA 3D1NI 2GM4A 2YRKA 1JJ6C 3MHHC 3LL7A 1ZGJA 2F5FA 3E7LA 3F8MA 4HYEA 2XIGA 1WFXA 2DMPA 4ZYHA 3S93A 3ULQB 4R2PA 2MG4A 2UU9E 2EOQA 1MMNA 1MDMA 2B7VA 2ZMEA 2F4OB 1UAAA 4DV0E 1VFCA 5D8KB 3S2WA 2BB8A 4HQEA 2GIVA 1JUMA 1TF6A 2EPZA 1R22A 2JA7J 1ETQA 1G3YA 2P0WA 5E3MA 3K70D 1S7AA 4C9YA 2ETHA 4F52A 5K7FA 2EN4A 2CQQA 5C4XJ 1RIOH 2KDZA 2ELHA 3LQQA 5C3EJ 2A6HF 3HPGA 2EOYA 1MD0A 1WRJA 1QPIA 3F72A 2OA4A 4RAGA 5GTHC 4A0YA 1CQTA 5DDGA 2FGGA 4A2UA 1SFXA 4ZC3A 3A0HC 1D1BA 4JI5E 3MSWA 1ETYA 3GFMA 2RS6A 1EH8A 1WI9A 3CJQB 1I27A 1Z6RA 2A5YB 2DGCA 2FSWA 1LDDA 3OS1A 4I01A 1YPNA 4M6XA 1OPCA 1T4NA 2MSYA 4CUGA 1ORKA 1U5TC 3K10A 3JRHA 2XF5A 2UUCE 4GYIA 5HS8A 1IO2A 2E19A 3K1NA 1W0UA 2QKLB 5M3FJ 4X0GA 1YFHA 1XMAA 1FNNA 2EOXA 5LL6R 5FB2A 2LFBA 3E6CC 4DYRA 3P9IA 5ILVA 3HKZA 2ME6A 1WHQA 3E6MA 2QEXI 3BR5A 2K3FA 3RSNA 2L8TA 2DOAA 2HR3A 1HSTA 3E5QA 2ZM6E 3K1MA 2QQ8A 2VJ5A 2XSJC 4IO9F 1FSHA 4HLXA 2O3FA 1W5CC 2MD5A 2O03A 4R1HA 1R1TA 1U8BA 4WYQB 1FY7A 2KRFA 1K4TA 5AC4A 4Y13A 3NRVA 4XONA 3ABLH 3ELKA 3WG9A 4YRVA 3QYFA 2IHR1 2VKDA 3LA7A 3RKYA 1CF7A 3KP2A 1I1GA 1HNZE 4FQGA 3C7JA 5E1WA 5HLHA 2LNBA 2V4JC 4DZJA 4DV1E 3E6DA 3J7ZI 2W4SA 5FKKA 1D8KA 1SAUA 4UUTA 1UFMA 1YIOA 1X49A 1W5SA 3L2VA 2IBDA 3IRRA 3CF2A 3J81K 4IQJA 1AHDP 3ZPLA 5IT3A 1FOYA 5KK1A 2CUJA 1CF7B 3VYTB 2G7HA 1HBXG 4CYCA 4HEA2 3F8FA 5FKNA 1X1BA 2P5LC 2V9KA 1I6HJ 2TDXA 2Y31A 4KIGA 2YU9J 3RYPA 2E5NA 1V3FA 3IAM2 3CCYA 3ERED 3RKQA 1RR8C 2LH9A 2MH2A 5AIQA 3V8JA 5DCMA 2EMKA 4MTDA 2RC4A 2GPIA 4E7KA 3FIGA 2B9DA 4CYCB 2FQ4A 4HNTA 3C4TA 3MZ8A 4Y4RA 4FX4A 4HZFA 2L4AA 1YYOA 2HS5A 2MC4A 4BDZA 5HLGA 1ZRCA 1ZGAA 2DA2A 2L7FP 2YPNA 4A3EJ 5DCMB 2EOZA 2KIMA 4QLCU 4IHYA 2EN2A 4PJNA 4HV5A 1IQSA 5GAEJ 4M72A 4CZCA 2X6OA 3JR9A 2JVAA 1QQIA 1IAWA 3J7AY 1WI3A 3G3ZA 1KJKA 3WE2A 1LQ1A 1HSJA 2QENA 3JAMZ 3WGIA 1DP3A 1UN6B 4RMNA 4HNUA 4FCYA 2YTNA 2EZKA 3FXKA 5J1YA 1I1SA 4PSWA 1A1IA 2LTRA 1BOBA 2OCEA 4I8OA 1T0FC 3G1OA 5HDGA 1HCRA 2EPXA 5M5XJ 2LREA 2LE2A 4A3GJ 3AG1H 4XLPF 4HX7A 3HOXJ 3I54A 3PM1A 2MA3A 3RPQA 1HDDC 1EA3A 1WJCA 5EEHA 2QUFA 5IOYA 2MYSA 1ZAAC 3UR3C 1MZBA 1K61A 4X6AJ 1RUOA 3M8FA 3UK3C 1RPWA 2ZJPF 3OYJA 1I50J 2O8KA 2ZKZA 3DF6A 2K4JA 3I53A 3WHCA 3G71I 4IS1C 1HC8A 3BT9A 3BDDA 2YRHA 2KDOA 3JTZA 2DQLA 2LT7A 4IOCF 4OIOF 5H6QA 3IL2A 2GWRA 3TO7A 4XK4A 4JI1E 1T38A 3VK6A 4CH7A 1F4KA 1XGSA 3OYBA 1A04A 5LMNE 4MFDA 4A3IJ 5A2QC 3K9TA 3M9AA 2OQRA 2DPDA 2PRTA 5TSEA 1HKSA 1E3PA 1R5ID 3LFUA 2L3JA 2C6YA 2F5CA 3KIOA 1UB9A 5L3BA 2VQHA 5E1ZB 3N05A 2L2OA 4B09A 3V8KA 1IMUA 4ZJZA 3OOUA 5FLXK 4BBRJ 4DIQA 2VQLA 3TQNA 2HI3A 3FHNA 3ZR8X 4BACA 1ZR2A 2L6MA 5D4RA 1POGA 1VZ0A 1HDPA 4AYBN 2A05A 3VPRA 4R8HA 2E5ZA 1FOWA 2DJNA 2HQ5A 2VKHA 1OR7A 2YPRA 4ZZLA 3SZGA 1SFEA 3H36A 2LJHA 3F9KA 5A6AA 2KFDA 5IP9J 3C2BA 5KNLA 3K7AJ 2IP2A 3CCUI 2L9RA 5DEQA 5EF6A 4W97A 2ESNA 2LDUA 4AQYE 3JSPA 1IDZA 1I3AA 4MLVA 4Q48A 1J09A 1OJLA 2F5DA 2GQQA 2J5OA 2JZYA 4F55A 1AKHA 3ABUA 3FM5A 3KEOA 4IHVA 1Q1HA 2CSOA 3OY9A 2PJPA 1LE8A 3VDXA 2JPCA 4LG0B 3S14J 1XDUA 3PNYA 4HNVA 2COMA 2W25A 5CQEA 1MJ9A 1Y56A 2ZO4A 2KT0A 3PUBA 4YFXF 2LG4A 3H0GJ 1SMYF 3CCJI 2DT6A 3ZP5A 2L3CA 1AH5A 1MKMA 1BI1A 4KZSA 2ZXIA 3HGGA 4RGRA 2HDDA 4AU7A 1D0ZA 3LFKA 4HRIA 1YOVB 5LGNA 3ZCOA 4E70A 4C2TA 1N77A 4JYAE 3MZYA 3MZHA 3MQ0A 3RIRA 2DXIA 1MMAA 3LA3A 1B8IB 2CV1A 1FX7A 4E7HA 1BA5A 2PFBA 2MC5A 3FF5A 3DQVC 2BOLA 3QYBA 4AM3A 2NNNA 4R2RA 2E36A 2KMUA 3L9FA 1P4AA 2EMAA 1B4AA 3EUHA 1IG7A 3OWTA 3LOCA 2MBFA 2Q2EA 2BY2A 3RPUD 2JQ7A 1BOAA 2WAFA 1W7PA 2ZFWA 3V7SA 3VSKA 3LSPA 4A3FJ 4G7OF 3WTVC 1LJ9A 2FNPA 2JN6A 1PUFA 5E18F 4KFCA 2YZTA 1HA8A 3CMEI 2MD0A 3REOA 2ELKA 4QSHA 2EWNA 4EGZA 3HM5A 3KX2A 2N3GA 1ZHFA 2Q2EB 3A02A 2HTSA 1Z1DA 1STZA 4CDGA 2EOMA 4QWQA 2JA2A 3LSHA 2KPMA 5IY5H 2R3SA 3OIPA 3P5JA 3OMYA 2O0YA 4UHTA 4IHWA 2JRTA 1TQIA 1S3JA 4X1EA 2EMGA 2LV2A 4B4CA 9ANTA 4LMYA 3VODA 2E7XA 3EUAA 4BS9A 5B1AH 3HSFA 4L9JA 1WHNA 4DV5E 1X3ZB 2DN0A 3QPHA 4J01A 1D5YA 5F3WA 3J80C 4HSTA 2PI0A 1J0RA 1GUUA 2V6CA 3F8NA 4C3IJ 2DQRA 2LRDA 4DR1E 3BZ6A 4D9JA 1EJ9A 5IT9C 1YJ9I 4EJWA 2UUZA 4X9JA 2JWTA 1X3WB 3NWTA 2Y75A 2EL5A 4R8OA 3IWZA 4FISA 4M3BA 1X6FA 2J7JA 3PJRA 2EIJH 4G6QA 1KYQA 2VI6A 2OJED 1TWAJ 2EMWA 3VYRB 1OCPA 2DO7A 4KN4X 2ESHA 3K4MA 3JAMK 3KZIC 1HKTA 3CLQA 2HYJA 5FO5A 2DOEA 2Y30A 3BROA 1IN6A 3QG5C 2EORA 1R00A 1X3UA 1LFPA 5E8IA 3DU6A 3C6MA 4DUZE 1JKQC 3VSLA 2BVLA 3DBHB 4Z2YA 1X6EA 1ZKGA 3Q3SA 2EILH 3ABTA 1MSFC 4YEJA 1DPUA 1OLTA 3CJRB 3FX3A 5JLXA 2M7QA 2XF7A 3H3ZA 1WH5A 2FE3A 1EH7A 2JJ7A 3ZQHA 1JI8A 3WHBA 4KDPA 1KZHA 4ZYDA 3GLLA 4GGGA 2JUCA 4GZNC 2K9QA 3EPJA 3I71A 1YITI 2JA5J 2IGNA 2EK5A 2VASA 1Z05A 2EH3A 1SVLA 1FYLA 2XGEA 1XGMA 1VQ6I 2VE9A 1U3EM 1Z91A 3ZN1A 1SVOA 5FROA 1AWCA 3BG6A 1K79A 2ZNZA 4FETA 4KIBA 1OQYA 4CCMA 3H9GA 5F1JA 3QAHA 4L9VA 1SR9A 1XN7A 4I99C 2BZTA 2H8RA 5F0CA 2R7TA 2W57A 2VOPA 3FXMA 2MDGA 4R03A 5KL4A 2DMQA 3PNVA 4DV3E 2HOSA 2M8GX 1K83J 4PGGA 2BGCA 2JOBA 2CPNA 3B6AA 3HDDA 2VF1A 4FHTA 3G1MA 1VQ5I 4MEXF 2FRHA 1Z6TA 5KAIC 1Y1VJ 1QO0D 1MH4A 3M1EA 4IHTA 4B3XA 4QIWN 2RNJA 2BHYA 2ECCA 2JSPA 3JRFA 5J4YA 2XRNA 2P6TA 3L2RA 2JA8J 3DU5A 4E7IA 4V19K 4PUSA 4DV2E 1YHQI 3BIDA 2ID6A 2JSCA 1R36A 3DWLE 5HOOA 2WV1A 2VBWA 1G8XA 1T08B 3KP4A 2EV5A 2M2EA 2M9HA 2ZMEC 1WJPA 1QBJA 2EMIA 3L2UA 2ADUA 1KYWA 5F27A 2W84A 3OSFA 1RRJA 2LF7A 1H88C 3HUGA 3FBIB 4HSRA 5C4JJ 2YTOA 2HOTA 3C18A 1TWGJ 4R2CA 4AIHA 1S7OA 5HS9A 1X47A 3OYLA 1Y6IA 1B1BA 4GDFA 4RM3A 3R60A 1WQ2A 2EMCA 4RAYA 2LK2A 2M0MA 1IBLE 4WFTA 3BC8A 5EEAA 1FOKA 5D8LB 2VKEA 4BC7A 4IHXA 3ZMUA 3F23A 2ENAA 3SZPA 4UY8I 2JXPA 3PO3J 2YU8A 3KLNA 2FV4B 2M3AA 2EJRA 3F8CA 2UXCE 2K40A 5GPCA 3NEUA 2FNAA 3AG3H 4XLHA 3DV8A 4Y3OA 1JKRC 2JWOA 2IRFG 3GTOJ 1MNMC 2Z2SB 3QPLA 3S32A 4RA2A 4E6KG 4EM2A 2XVCA 2EQ3A 1JK2A 4ANJA 5HDNA 2EOJA 2FBHA 3SFZA 1RI7A 5B66C 4MGRA 2IS2A 2I9IA 5HDKA 2G9WA 3LSTA 1K4SA 1B69A 1Z0XA 4V2FA 3WGGA 4HF0A 2K9SA 3KYCB 2EZHA 1VQOI 5A2QZ 4RLFA 3W2AA 2L54A 4A93J 1TT5B 2W82A 2IGMA 1IRFA 1MBJA 2QBYA 1VF9A 1MBEA 1SD4A 3PUFA 2LMZA 3K6QA 1XSVA 4ITVA 2QA4I 3G73A 2E35A 1OCZH 5FD5A 1MJBA 3L2WA 2HZTA 3LSGA 3E3VA 2XB0X 3DKXA 1FPQA 1T4OA 2UXNA 3O8GA 2ELJA 2DA6A 4P55A 3F3XA 2KRHA 3K4KA 2DK8A 1FKAE 3AAFA 3KZZA 2LUPB 4H0EA 2QSFX 2Y9ZA 4LB6B 2ZXWH 5A6JA 1MBFA 3DPUA 2N8XA 3ESWB 2XF6A 4GYGA 4S04A 3J81Z 3AV0A 1QRYA 1R58A 2NOJB 2XASA 2OAZA 1G6NA 2FQ3A 3CUQA 1XCVA 3K6GA 3TO6A 2CQXA 2M8EA 4O6JA 4BYYA 2HPIA 2VIXA 2IXSA 3R0AA 4BHBA 4CCNA 4S05A 1SEUA 3K4NA 2E2HJ 3BCBA 3E5XA 2GIZA 2OD5A 1XD7A 4XRMA 5EG0A 5CYVA 4KJZA 1SD5A 3QU6A 1BIBA 5LLQA 3OV8A 2QGUA 3CUQB 4R2QA 3KYLA 3CQZJ 4PCQA 1W5TA 1IQOA 2M34A 2M4KA 4CHUA 4L0YB 4WXDA 5C44J 2L9NA 4PGHA 5EG0B 1ZTRA 2PJRA 4BHPA 1JJ8C 3M4OJ 2E1NA 2P4WA 4FX0A 2EPKX 1BBOA 1N78A 3RMPA 4S0HB 3HB9A 5BMZA 3HC7A 1J7KA 5JR3A 3U21A 1N25A 5A6BA 3PFIA 1VQLI 1SD6A 3GW2A 3OYNA 3ML6A 4KMUX 2HGHA 4UVBA 2JYAA 2WBUA 4GKJE 3ZOQB 4XM3A 1JXSA 5KL7A 3P7NA 4YFKF 1P4XA 1KU3A 3D0SA 2VJJA 1DGRM 1Z77A 3CMAI 4IPAA 2EPNA 3ZQIA 1EF4A 3B6CA 3W2VA 3FKJA 4YG2F 1X5WA 3VEPA 2NA2A 1KQ9A 3FISA 3L00A 5HLIA 3WU1B 4II2A 1USSA 2VE8A 2E1CA 2PMZA 4M6VA 4M0VA 3QOPA 1IXCA 1QPMA 4KN7X 4M9VC 4AIJA 2E34A 2R7QA 4CCKA 1JHFA 2BEOA 3WGHA 2EA4A 1F36A 3F6VA 3SFIA 3QRFF 5BOXA 4BUPA 1DU6A 4I09A 2DJIA 2DCEA 2V83A 4IQ4A 2M1BA 3CLOA 1DDNA 2FUG2 3HRUA 3DPTA 3J7AO 3PSIA 4CZZA 4CA0A 2EN8A 2N8GA 2ENCA 3S16J 1KA8A 2OZUA 1YE9A 1YW7A 1XGOA 2M7AA 1YYVA 1ZBTA 2XHKA 4F9CB 3BZKA 4AYBA 3RQ4A 5TJJA 5IP6A 4TUGA 4NBQA 4N4RB 1V54H 2QQAA 4DR6E 1T2KA 5KL5A 2VC1A 4ENMA 5K5OA 2NUGA 2LUQA 3LSIA 1XB4A 1F1ZA 5FLXZ 3LSJA 5IT9Z 5BPIA 1Z7LA 5K7HA 4BDYA 1ZN2A 1UCRA 2DMTA 4N0BA 3CCMI 4FTHA 2QYOA 2X4HA 5CPRB 3EQ1A 5KL6A 3HG9A 1PJRA 3E0JB 4BY7J 1DU0A 2W00A 3QQAA 4MQ9F 1U8RA 3IRQA 4NUBA 5GP9A 5B1BH 4Y52J 1P4WA 1R6RA 2ZJ2A 4XICA 4UUVA 3JTHA 4PDKA 2XAJA 4F2JC 3HTSB 1ZK8A 1E3HA 4HOBA 2LJUA 2I5UA 1UHWA 5J3LA 4OAYA 4CSWA 1HNWE 4JX5A 1HW1A 1N32E 2EFWA 4WSPA 3C2HA 1A5JA 4G6TB 1IDYA 1YSAC 1X2MA 1YS6A 1SVMA 3QODA 3IAS2 2H6BA 1R1VA 5HODA 1G2HA 3JW4A 1SC7A 3VFZA 1PUEE 3ONQA 3QP5A 5JVTA 3ZQLA 4C2UA 3GMEA 2OPTA 3BOQA 2DODA 5LEJA 1JE8A 2JPAA 1R9TJ 3Q0WA 2GXGA 2EIMH 2L0KA 4OU0A 4AD9A 1TNSA 3MN2A 4ZDOA 2V89A 4LFAE 5A2QK 3RKWA 1Z3YA 2V1NA 4AWXB 3QWLA 2NS8A 2EM0A 4L5JA 3A1YA 4B43A 3CDIA 3E6BA 4WCGA 4G6DA 2WA0A 1A35A 3TO9A 2GHFA 4EQQA 2KONA 1U0JA 5CVVA 3K69A 2LRSA 4G8XA 1XSDA 5FRMA 1E2XA 3BTLA 4U0VA 4XOPA 3GTJJ 4F9BB 2OU2A 2VRDA 3CC7I 1A1LA 4DUYE 1YJWI 4MIMA 1YYWA 3ASNH 2YRMA 3SZTA 1K6YA 2JVHA 1ERDA 2EPUA 1S5LC 4RGXA 2K86A 5DUIA 3HRTA 1I94E 4LF5E 2VBXA 2FX0A 3HEFA 3I5UA 3LWFA 2PMUA 2R7ZJ 3GTMJ 1DQ3A 1ZU1A 2K85A 3BQYA 2CS3A 2EOFA 2K27A 4JBAA 4A3DJ 1MIJA 1ZARA 4XL9A 1VQPI 1X4OA 2JP9A 3DCFA 3PNTA 2LY2A 4ZYGA 5H2FC 2WB1N 1MMGA 1QA6A 3X2QH 3S1RJ 3HPZA 4V2GA 2RQPA 2GOXB 3W6JB 3V42A 4FT8A 1WWXA 1YO5C 1RQ0A 4O4KA 3GCMA 4K2EA 4LK0F 5ICCA 3RZOJ 2STWA 5K7ZA 1IRZA 1X48A 2YUSA 4XORA 3JRBA 1J5YA 3F6GA 4BBYA 2EPCA 1WKMA 2VT3A 5D6FA 1TQMA 1MJAA 3DLLF 2ZSIB 1SAXA 2P5VA 2M9AA 2RPCA 3H09A 1BM9A 2EV0A 3FDYA 3P9KA 5KCMA 2EMBA 2I8DA 4J8ZA 3C3WA 4M3DA 4BJ5C 2P7VB 4YY3E 3HPHA 1N3GA 3VHTB 1SFKA 2HFHA 2X0LA 5F0HA 4F6MA 2CFXA 3K0LA 4A0ZA 3BGHA 2WCC3 4F91B 4F92B 4LJZF 1V5GA 3JU0A 3BF2A 3I0TA 3TDUC 2WAQA 4G94A 4HA8A 3DTEA 2KIUA 3FMRA 2UUBE 3GO5A 1ZH5A 1A1KA 2RQQA 1L3LA 4JK1X 3FWEA 2EINH 4M3FA 3OSGA 4RH8A 3GZ6A 3S1NJ 3FK7A 5J1UA 2GAUA 1WSUA 2L01A 4NXNE 4M9XA 4J19A 5F1RA 3F22A 4RDUA 3F6HA 5CKTA 2LO3A 5D5WB 1ZG5A 2VJ4A 1PP7U 2AO9A 1XPXA 5ED4A 1KGSA 2DLKA 5LGUA 2M4GA 1T6SA 2X85A 3EUKL 4ZYEA 3KCCA 1N75A 2EPLX 3KPHA 2D5VA 3U1KA 2M7BA 3ADIA 3RYRA 1QZYA 2O5RA 2HC5A 4OIPF 1NG6A 2OF7A 2VC0A 2FMLA 3HYIA 4OAZA 1UHMA 2VOOA 3KEYA 1IBKE 3OYHA 5AIPA 3H0DA 2FJ1A 3PFYA 1LLMC 1KQ8A 4DR5E 1DI2A 2IGOA 2ISYA 4LLGF 2JTVA 3A01A 3L2CA 1J2XA 2KZVA 2HQNA 2CU7A 3DEWA 4ZDLA 1VI0A 4Q47A 1FJGE 2KZGA 3BTIA 4XQFA 2HQAA 2HPMA 3J80K 2A61A 2GA2A 5BR8E 5TISC 3VYYA 2B0LA 1NCSA 1OYWA 2DA7A 3IH4A 4IHSA 1XMOE 3O6BB 2IW5A 3A01B 5IT9K 5F6FA 3BJAA 1G3WA 5FLMJ 4XLCA 1PKPA 4HBLA 2QQ9A 3W3CA 4WXHA 1LFBA 4N9IA 4A6DA 4B3AA 1ZLKA 4F54A 3CCEI 1HOMA 5FKLA 3T5XA 4LG0A 3VOEA 3H3VK 2IA1A 4GEQB 1WJBA 1NG7A 1ENHA 4D5FA 2LR8A 3I58A 2RQLA 3HQ1A 1ETXA 5DNYA 3AL0C 4R2SA 1GHCA 4BJTA 2NOGA 3ABMH 3CZ6A 3ZMDA 3BR2A 4IJAA 4AIKA 3DF8A 2NVXJ 3J7AG 4X8WA 4WWCA 1JTXA 3QP6A 5FKOA 3BJOA 1UMQA 2K4VA 1ZG3A 5LRRA 3PSFA 5L3GA 1J59A 3ASOH 2HEOA 1G59A 1OYIA 2IT0A 3C6KA 2A5WA 4AVZA 1A36A 1B8IA 1T95A 2QSGX 4XRFA 2BBGA 2V26A 1V55H 4G7ZF 3U9GA 2VQFE 2LC2A 1FSEA 2K7IA 3WTSC 3ZN0A 4HDUA 1JKOC 4Y7NJ 3EDPA 2ZBKA 4NC6A 3OS0A 2R7RA 2ZSHB 3LLHA 4EM0B 4CGZA 2NRAC 2BW3A 2D9HA 2QM3A 2DA4A 1XDSA 2HYGD 2Y69H 3S1QJ 4LF7E 3MVPA 3K4JA 4JI8E 3H35A 5DCFA 4KICA 1MBHA 2CWEA 5A6KA 4BY1J 4P96A 1YZ9A 3M99B 1Y8QB 2MW8A 1LB2A 3DBRB 2L4MA 2IEKA 4BXFA 4KNYA 4NXME 2UXDE 5EYRA 1JKPC 3SEQA 3DJWA 2BW3B 4LU9A 3TBIA 3JRGA 1KU7A 4EJOA 1U5TA 2QZ8A 1XSXA 2K4BA 2VLAA 3RPUA 1K78B 4HF1A 1TBXA 1LNWA 3FXJA 1OYYA 3BR3A 1N33E 4D0PA 3BP8A 4L18B 1RUNA 3ADLA 1IN5A 2BYVE 4XMYA 1A6IA 2IJLA 2GOMA 3CP2A 5J6XA 2ZFUA 2L7ZA 1DUXC 4YELA 1U5TB 3HKZN 1WPKA 2EB7A 2L7KA 1W7PD 3T1BA 1OISA 3ZQ7A 1F2IG 1JHHA 2OTLI 1ON2A 2YTFA 1OCRH 4LFBE 1X3CA 2EM6A 4ENJA 4LIVA 3ECRA 3PIPF 5KL2A 4JI7E 1BN5A 4DYCA 2DOFA 2Y0SN 2Z9OA 3HSRA 2LYCA 4XNFA 4A3CJ 2E7WA 2EPOA 4B1RA 1J5EE 3A4CA 3CO6C 5CVIA 2X6WA 4CCJA 2I10A 5D5VB 3MFKA 2L5QA 2R7VA 3LAJA 1RC9A 2R5ZB 1B9NA 4A3MJ 2D1HA 1E17A 2DDAA 2DMIA 1PVEA 3GVAA 3DEEA 4GCVA 5L3FA 2HDWA 4KT5C 3JRIA 2NS0A 2HU9A 5CLSA 2PMHA 4FE4A 1IV6A 1X6HA 3GTKJ 2YU5A 1HR0E 1TQPA 4EEFG 4XIDA 1GVDA 2DYSH 2W24A 4PK4A 4MLOA 3TOBA 1BR1A 4QTRA 4XSXF 4ETSA 2EMLA 3HSEA 5GTIC 2EM8A 1L0OC 2IA0A 2HXIA 3WG7H 2HDCA 5FRNA 5AASA 1IRGA 1S6LA 4XOTA 2UWMA 2EN6A 2D2WA 3O8HA 4N4OB 3TW6A 4I76A 3ZXSA 3H5RA 2YR2A 2IAIA 4C30A 3KWRA 1IGNA 2NVYJ 4HLYA 4BQNA 3EYYA 4DOZA 1W1WE 5IYBJ 2DT7B 4U0YA 1SMTA 2YSPA 2ZC2A 1FLIA 1FBQA 1UELB 1W36C 2R7WA 2YTQA 3RZDJ 1GVJA 4M73A 4Z6YA 1O3SA 2F4VE 2N3HA 3IH3A 2YS9A 3MD2A 5FGMA 4XRSG 3KEQA 3M7GA 5ILSA 1X2NA 4A0XA 1APLC 4C3HJ 1O0WA 5L3CA 4I0BA 2RTXA 4EATA 4OMYA 3BR6A 3BJ6A 1T0FA 3IUOA 2E1MC 2EBIA 1VQ9I 3H9JA 3IH2A 3T1YE 3EPZA 2FEZA 1GXPA 2ICWG 1EH6A 2OBPA 2XKOA 2Z1DA 2Y48A 5HLTA 5ICGA 1GZ6A 3DEUA 4P78A 1O3RA 1B59A 2HGCA 2VQEE 4JOMA 3CTAA 3ZQCA 4KA4A 2BY1A 1FP2A 5L3DA 1A31A 2QLZA 1H9GA 3MEXA 1HLVA 2WZOA 1T33A 4BGDA 4C3JJ 3S15J 5LHIA 2E2IJ 4E7SA 3A0BC 2DTZA 2CSHA 2CMPA 2H1LA 3KP6A 2LKXA 2V86A 2H27A 1YG2A 2ECBA 2XRLA 3OYFA 1VQ7I 4LF6E 2DDBA 3NQOA 4UNOA 2YTPA 5AE1A 2LLKA 4DV7E 2FXAA 4AUXA 4L5IA 1BR2A 4DW6A 4DYQA 1UJ8A 2FA5A 3T8RA 4EV0A 3GTGJ 1TWFJ 4LF8E 2ID3A 2LCEA 3JRAA 4LFCE 4IX7A 2CW7A 2L7MP 4RB1A 2Z5UA 5FLVA 1T39A 3TP0A 3FXUA 3HOUJ 4L5EA 1USTA 2EFQA 4GO1A 2OQGA 1P2FA 1S72I 3GFLA 1R5GA 3ZOBA 1QU3A 1J75A 3ZMSA 3B02A 3IC7A 3LMMA 4RGSA 1LDJA 2ZXJA 3CCLI 3CC4I 2EMFA 3H5AA 2EZIA 3GEZA 5IYDJ 1HW5A 2JY9A 4M71A 4MO7A 2GZWA 4BJ6C 1TF3A 4YIIA 2F8BA 1LFUP 4KMFA 4OIQF 3QPTA 1SFOJ 4YIFA 4IRHA 4P9UA 2P5KA 2M45A 2OUMA 1X1CA 3ADJA 1AA7A 3FMSA 3CD6I 1ODDA 3I59A 5D4SA 1IN4A 1O7FA 4KIFA 5CVJA 4RGUA 1XCBA 4B3TE 2EIKH 2ACJA 3AL0B 3HXLA 1WGXA 3R61A 1MBKA 4BQOA 4CYDA 2CV0A 2NABA 4XN0A 1NK2P 2BV6A 1O3TA 4E4HA 1YW9A 2KP6A 1FYKA 3CC2I 3I59B 1ONVA 3BLYA 2CUEA 5E3OA 1O3QA 1XTAA 1KONA 5JLWA 2VUMJ 3JAMC 3PO2J 4ABZA 2QF7A 2A6EF 1Q1VA 2WWYA 1FWZA 4LB5A 1OCTC 2OCCH 2QSHX 3EYIA 3IWCA 2PN6A 4DKKA 1KYZA 5F04A 3WTTC 4IF4A 2YWQA 5LGTA 2MFZA 2DW4A 4LD5A 1BI0A 1K6OA 3W6VA 2M30A 2GXAA 2RGVA 4RAZA 2F2EA 2CUFA 4DBQA 1J26A 1OCOH 2Y9YA 2V88A 3DP7A 1MNDA 2CO5A 2KQRA 4C2MJ 1ETWA 1PDNC 3AG2H 6PAXA 4IVNA 4UVCA 3HJEA 3LSRA 1LEBA 1WHUA 5EZHA 4BL0B 5J40A 4B3SE 3CJTB 5LRSA 2XGXA 2BVMA 1HW2A 2HOEA 3OIQA 1FIAA 3FXQA 2MC6A 2EV6A 1FZPB 2Y0MA 2QCOA 3I4MJ 1XX5A 3EPHA 2IS1A 3VYSB 4I2OA 3OYGA 1FMWA 2DFHA 1VNDA 1QZZA 3WTWC 4BXXJ 1Z7UA 3MHSC 2JR1A 2A6TA 1LEAA 5FFXA 4F6NA 4KT6A 2D45A 2XGDA 2STTA 4BKXA 3OYKA 4LLNA 1R1UA 3V8LA 2DLQA 2M5WA 3TEDA 2DK5A 4RB2C 4N4NB 4MFEA 2DA5A 1H8AC 2GLOA 4I98B 5E79C 3CF5F 2XDVA 4MNUA 5ERIA 4IRIA 1X1DA 1UILA 5LHGA 2EL6A 2EM7A 2RSMA 2DTRA 1G2DC 4RBOA 3V7CA 5AE2A 4HDVA 1YS7A 3I56I 3H9QA 2NUFA 3SXYA 4Q4ZF 3GUDA 2V1UA 3EPKA 1SD7A 2KJBA 1GT0C 4F9AB 1FEXA 5FKMA 4PFPA 3BG3A 2EP3A 5DUKA 3AUZA 1FBUA 3BPXA 5LMUE 1A1HA 1HNXE 2XAQA 1GXQA 1S29A 2OTJI 2V79A 1FTZA 2KJCA 4XLAA 3S3NA 1WZ2A 2O7OA 4M74A 1IXRC 1G3SA 2WY8Q 2EM3A 1Z67A 4E7LA 3FKIJ 1XS9A 2E60A 1X1AA 1W36D 1H89C 1I39A 4O5GA 2YTIA 4BC9A 3PQJA 2A68F 5GAGJ 3OL4A 5EZGA 1TWHJ 2RVCA 3FIWA 5DV5A 1MEYC 1TLHB 3M07A 1BL0A 4A3KJ 1NK3P 2R93J 2OV7A 2EWLA 3TQMA 1U6GA 1HQCA 3OYDA 3K4CA 1W0TA 1WCMJ 4HQMA 3U2RA 2JK3A 4M9SA 5K1YA 2LBFA 4A6EA 4OOIA 1IJWC 1A1GA 4IKFA 2CG4A 5CFFE 4P7DA 3HOSA 4XKWA 4B44A 5M3MJ 1E0EA 2LTSA 1ZRFA 2UXBE 3ECHA 1QVTA 4PFOA 3S8PA 3A2KA 5ICFA 1G3TA 2CQ7A 1JT6A 1R5HA 2H94A 4LFUA 2VBZA 1R4NB 3R4KA 1N34E 3H5NA 2LBFB 1R4MB 4BE2A 5T6JA 2D1VA 4JYKA 2VKVA 1D1AA 3ERMA 3CCQI 3J80Z 2FBKA 2P8TA 3THNA 2CQNA 4IXAA 1Y39A 2E1MB 3HOTA 2IVMA 3CCSI 3OYCA 1NTCA 1OR7C 2CQKA 4HV6A 3JSOA 3HOVJ 3O3KA 3CMYA 4XLEA 2IA2A 3CJNA 4NB5A 2X1EA 1HXDA 2P7CB 3VB2A 2O6GE 4L9NA 3THOB 5AONA 3KZYA 2Z33A 2EN7A 5LEKA 2EFPA 2X1DA 1V4RA 4HX4A 3WU0A 2QQBA 2MDRA 2VE7C 3ABKH 4M3EA 3HOZJ 3IHUA 1UHSA 3BG5A 1Y0NA 1OMIA 1S9HA 2R7SA 2ENHA 4BCAA 3J7Yp 2XPWA 2KKOA 2WBSA 5HS7A 3V4GA 4QPQA 1ZREA 4BAYA 1F9NA 1DGWY 2FOWA 3G2BA 4X62E 4ZYAA 5L3EA 1G2FC 3FXRA 2HVQA 4BEHB 5K5RA 4BH9A 4DGWB 2B7EA 3HOWJ 1P92A 4KWYA 1NH3A 2EN1A 1RC7A 1BJZA 2BE5F 3W6KB 4ZTFA 4A3LJ 1SANA 2DRPA 2LVHA 2F4IA 2YX4A 1ZBQA 4JX6A 1HKQA 2MH9A 3N4MA 4FK5C 2DSYA 4WF2A 3NAUA 4NZVA 2HWVA 4YFNF 3H92A 2FMYA 1YTYA 4MHGA 4LITA 4U7BA 1MDMB 2HKOA 1ZG1A 2ZMEB 5D5UB 2IPQX 4IL6C 5GADJ 1MBGA 3D5RC 5DD4A 4BNCA 5D6EA 3ZRGA 2LTPA 3Q9SA 4ASNA 2V8QB 5KAFC 2HVRA 5LFAA 3LSMA 1IRXA 3G6EI 2B7TA 3UKGA 2VQGA 4LOCA 3EUHC 3DFGA 3WTUC 1Z3XA 5TGTA 4FASD 4XBFA 1NHAA 2IGKA 2DPUA 2CW8A 4UB8C 2X51A 1MGTA 5JFRA 4ESJA 3P1XA 2YTJA 3N97A 1TW3A 4M2ZA 2EM2A 1TTYA 4DR4E 4ON0A 1XMKA 1T8IA 2B63J 3ZQGA 1ZGWA 4HX8A 3IWDA 2R7DA 1G4DA 1FBSA 1YX3A 2LKSA 3ZQFA 3CESA 1JUSA 4EGYA 2NVQJ 1IUFA 1FYMA 3GFIA 5FFZA 1Z9CA 3T8TA 2Y0SA 2RV8A 3A03A 2LD5A 1NEIA 1QU6A 3HTXA 4E7ZA 4CO8A 2EZ6A 4DQ2A 2BHZA 4I0AA 4TV7A 2O61A 3DTKA 2XKPA 4KYWA 1YX5A 2ZCWA 4HAMA 1S7EA 4KISA 1FJLA 3KYDB 3DBLB 2YTDA 1F5TA 1VQMI 3BG9A 2VQCA 2PEXA 2Z3YA 3TMOA 3TKYA 2MC3A 3T0YA 2I13A 2F4MB 1ZYRF 3TW7A 2M4IA 2R4GA 1BB8A 5J4VA 1BBYA 2WAEA 3RTRA 2KLOA 2UZKA 3MCZA 2O9LA 5EGOA 1WJFA 1YUIA 4LIUA 4EVIA 4EJUA 4RAFA 2YTEA 3DTIA 1I5ZA 5E8GA 3MKLA 1T56A 3ADGA 2AS5F 2CRGA 1B6AA 1PJSA 5EDNA 2K02A 2EPFA 2L2KB 3AG4H 4RB3C 1BC7C 3HIFA 2EMHA 1QHHD 4N9HA 2CT1A 3DXJF 2VB6A 5EGOB 1IN8A 2X6XA 1FT9A 4UV8A 1STUA 4P9FA 1TL8A 3VYUB 4A69C 5KVRA 1REPC 1GQEA 2YTGA 3OIOA 1X1PA 4DR7E 4G12A 2NNYA 1IN7A 1GV2A 4O24A 3OYMA 1TWCJ 2K9MA 5CVUA 3ZMVA 3FXOA 1MMSA 3Q0VA 1RKWA 4OOGC 4HW0A 4NHJA 1LDKB 2H8WA 3BTCA 4O43A 1BIAA 2R7UA 4M9ZA 2DFEA 2L92A 3F6OA 2VT2A 1PDAA 5M5YJ 3RDIA 2G7UA 2MLGA 4EM1A 1TW2A 2XPVA 4CCOA 1JK1A 1O57A 4OWRB 4JI6E 5ICEA 2HKXA 4Y33A 4ZH4F 1J9IA 2JVGA 5HNFA 5IYCJ 3AKZA 1PP8F 1VQNI 2V9VA 2XSDC 3ROUA 2HJJA 1BJAA 3G4SI 2UUAE 1FIPA 4NNJA 5LHHA 1PJTA 1JGSA 2ZNYA 3TOAA 4OX9E 4CICA 2M1SA 3LQRA 2H6CA 2H1KA 1ZR9A 3JRDA 1F43A 1DPRA 4ZDPA 2CTDA 4TUIA 2L02A 2BBYA 2R1FA 2Q0OA 3I4NJ 4DMIA 4LGWA 1UZCA 4K0KE 5DYMA 2GA1A 2W7NA 2L33A 2MGQA 3EPLA 3J7YJ 4AIDA 2K5CA 2DA3A 4BHCA 2EZLA 2KIFA 4XKCA 4E7JA 3OYIA 2NXNB 3L7WA 3M1CA 2PMZN 4HPQA 4R2DA 5DTDA 3M8EA 3COAC 2A07F 2L9VA 1LPQA 4NHRA 4U88A 2CGPA 4HF2A 2JT1A 4RS8A 1TT0A 4CXFA 1FC3A 1EV7A 2EPPA 1T4LB 4B3ME 1ETKA 2V6EA 3BR1A 2PG4A 1MW7A 2E5LE 3CCRI 1FTTA 3L1PA 2LF8A 4ZTJA 1D8JA 4I7HA 2FF4A 2AXTC 1XG1A 2F6CA 3S2HJ 1E3OC 1YRNA 2EQ1A 1LVAA 1GTKA 4O5VA 3EETA 1CGPA 4DR2E 2OZ6A 4DV4E 3B73A 2EOHA 4P1WA 3IKVA 1ZRDA 4IRGA 3R6SA 1VQ4I 4DV6E 2CFOA 1FMVA 3WTXC 2EMZA 2COBA 3J81C 1D1CA 4QPOA 1V5EA 2DMUA 1YRNB 1BW6A 2VODA 1QZEA 2CV2A 4LF9E 2VJIA 1U2WA 5M5WJ 3BCAA 4D7NA 2WTEA 3I9V2 2EOSA 2Z99A 3OR1C 2HXOA 1QNTA 2F48A 1YUJA 3M8JA 3CDLA 3SHFA 2L2MA 2EOOA 3SDBA 2E2JJ 3R0JA 1XGNA 1K78A 3GFJA 3CMMA 3FZVA 2HNHA 3OR2C 3UNGC 3CP8A 2V1DA 1AKHB 3K4LA 3D5LA 4A3JJ 1YI2I 3LAPA 2KOUA 1TP4A 2Q8UA 4B47A 1LE8B 1SFUA 1KU2A 2LVSA 4WK8F 5E17F 2X1CA 3IP4B 2DMYA 3HRMA 3JREA 2LP0A 2DI3A 2HTJA 1KQ0A 2XROA 2XB5A 1IF1A 1N36E 4UVAA 1WJDA 1ZQ3P 4DBRA 1JT0A 5KL3A 4AC0A 2H36X 4M3GA 1RKTA 3BTJA 3BWGA 2MKDA 4WX9A 1X19A 3S2DJ 4GXOA 5B3SH 3ZMTA 5HNHA 2W85A 1MH3A 1VQKI 2GLIA 3MWMA 1IXSB 4Y15A 2PQ8A 1W4MA 2OC6A 5GPAA 2R5ZA 2EOIA 2EM9A 2A69F 1WH7A 4AVPA 4UB6C 2R7FA 5EEGA 3GZNB 3C1DA 3F0CA 2EQRA 2LY9A 2X48A 3LMLA 4LLLA 5IXMB 4G7HF 2L9SA 1LVKA 2BY3A 4X64E 2KHXA 1UG0A 4G9YA 5H20A 1D3YA 2DU9A 4D1QA 1KU9A 1Y1WJ 2VPLA 2LSOA 3ISPA 3HGYA 1W7PB 3GX4X 2NAZA 3CUQC 5IPAA 3GXOA 1PUFB 1AOYA 5BQTA 1U9NA 1Z1BA 2CJJA 4LK1F 3HOYJ 2QVOA 2XAFA 1TC3C 4BQAA 5K5QA 1ETVA 1RZ4A 3OTOE 3DKYA 1YIJI 5E1XA 2LKPA 3HHHA 3DPLC 1OFCX 5H6RA 3ZMZA 3H1CA 2FU4A 3DLAA 1L4SA 1XMXA 2G0EA 1BR4A 1XC5A 3I3LA 1M1EB 3JRCA 1B72A 4XR6A 4BBSJ 1B9MA 3CCVI 2DT5A 5F0FA 2K7LA 1BW5A 5AC5A 4P5OA 5CQGA 5FLXC 2AQFA 1R71A 4A3BJ 3GWZA 2NYXA 3O2PE 4M30A 1LUJB 5HVQC 4EMSA 1FOXA 2K3PA 4D7MA 3GYHX 4Q28A 4F7ZA 1IW7F 2LY1A 3K1PA 2Q1ZB 1PYVA 1B72B 3WE3A 2PLYA 5EJCA 2E71A 3D5SC 4HEIA 2NUEA 4BQQA 1D5VA 1O7LA 3OOPA 4PZJA 3TL4X 4IZZA 1ZR4A 2CUZA 4F3QA 1UHZA 3DKWA 2RSIA 3C4BA 5ADZA 3AFHA 3HHGA 1ITYA 2ELZA 2WAQN 2DFFA 2MLKA 2WC2A 1XMQE 4RB0A 1X58A 3RQIA 3RJPA 3C2GA 2Q8KA 2ODRC 2JRMA 2VBYA 5TRDA 4DZPA 3VWBA 2LMDA 4ESBA 2RAEA 2JMWA 1DP7P 4DR3E 2QWWA 4IJDA 3Q5FA 4NC7A 3KFWX 3K4BA 2NVTJ 4RLQA 3TDZC 5KHDA 2ZJRF 5AE3A 4MQVA 4PSXA 4CCLA 1JTYA 5A69A 2HZDA 4ENNA 4JI2E 3GTPJ 3M3YJ 3KE2A 3KP3A 1AAYA 3MAJA 1EKEA 3QU3A 2EN3A 4ZZDA 4L8NA 4PJLA 4I02A 1A1FA 2GXBA 2WBTA 4XLFA 3F21A 3BPVA 5CJ9A 5IOZA 1PJQA 2TRTA 2ELYA 2F5EA 1H0MA 1A1JA 4L0ZB 4PJ0C 4EJVA 1K7AA 5F08A 2GBYA 3MKWB 2RS7A 4DNCA 2LOOA 3GZ5A 2XC7A 2B3TB 3HTUA 1U9OA 3Q0UA 3CDHA 1YQAA 4J00A 3ECOA 3GTQJ 2KIQA 3MKZA 4JP0A 4JI4E 2EPRA 2NS7A 1BI3A 3BQZA 3SQNA 4RM2A 3KETA 2YU3A 3OS2A 2HHHE 4YHHE 3CO7C 2UV1A 4YIRX 2B9SA 3T1HE 2XAGA 2EM5A 2EPMX 3QPSA 4MTEA 4R79A 4L5NC 3MKYB 1I3QJ 3FK6A 3FBNB 2Y2ZA 4NQWA 3ZGKA 4A5NA 2MKNA 1YLFA 3IV5A 2H09A 2X6YA 2IS4A 2RN7A 5J1RA 4ESFA 3K70C 2NVUB 5IP7J 2VPRA 1IUYA 4RHBB 1P47A 3S17J 3OYAA 4XKVA 1MMDA 1IBME 2P6SA 4W1UA 2A3SA 5J47A 1P7IA 4DJAA 3GBGA 4D5CA 2RDPA 3TP3A 3IKTA 2DAOA 4H4KC 2XPUA 4NC8A 4NQWB 2EA2A 3G1LA 1P6RA 1UG2A 4I6ZA 2DMNA 3BBGA 1RR7A 2VXDA 2JUGA 4U0WA 3HBLA 2L2NA 3E97A 4JI0E 1YW8A 1EKZA 2XV4S 3WU2C 1D0YA 2EJ4A 1BI2A 1X4PA 2VXZA 3NARA 2L3DA 3LA2A 2RNGA 2J5PA 5F64A 3S3MA 2FTXB 4GKKE 3BR0A 1C0WA 2R7XA 3L09A 3WTYC 3GF2A 2DFIA 3HUGB 2FBIA 3JTGA 1LKXA 3GTLJ 1JGGA 2EFOA 3PQKA 2EE8A 5DM6F 3WODF 2R76A 2ZB9A 1RETA 2QKMB 2EPAA 3SEZA 4B48A 3KP7A 4UUSA 5JHUA 1WJEA 2MABA 2BXZA 4XLNF 5JVGF 2EQ0A 1D0XA 3RKXA 4BXUA 3HL2A 3VYXA 1QVUA 2Z16A 3FMQA 3E1SA 1YYKA 3E5UA 1IZ1A 2R92J 4ENKA 4BMJA 5LBQA 2XAUA 1TNTA 2K9NA 2XUBA 4II3A 4WXCA 5LD2C 1BBGA 2DB2A 2JOXA 1GV5A 1ZAOA 4F93B 2UXXA 3LNQA 4UUSB 2IS6A 3TGNA 2DYRH 3P9CA 4XKBA 2O8XA 3OMLA 4R2EA 2WB1A 1P9QC 1ULYA 3FM3A 1VTNC 2JA6J 4NDLA 2KL4A 4XN3A 3HRSA 3WTZA 1Y8RB 3RCOA 2HQRA 3KP5A
chains in the Genus database with same CATH topology
4A5MA 1U78A 2WV0A 3GLXA 4XSZF 1H9TA 1R23A 1QGPA 2DBBA 2PBIA 1Y0UA 2QBYB 2DLLA 3IWFA 2CYYA 4UV9A 3FHZA 4Q5SF 1FP1D 1T98A 3K2ZA 4B8XA 4M6YA 4U7DA 1RNLA 1BC8C 1I6XA 4UXNA 2XAHA 4KUMA 1ZLJA 3H3UA 2JPBA 1OKRA 5D5XB 5FD6A 1R7JA 2VONA 5BS6A 4O3MA 4MEYF 3I4PA 3V7RA 2VN2A 1S8NA 2YSRA 2YX7A 2V1XA 3Q9VA 2EFNA 4A12A 3RI4A 3BY6A 5CVRA 2FOKA 5BPDA 2HYFA 2AXLA 3KLOA 3I64A 5J8FA 4OIRF 3U1DA 4EJTA 3CUOA 1ON1A 2CW0F 4L9TA 3EQLF 3F8BA 4Y17A 2M87A 5ILUA 4OMZA 5DD8A 5J8CA 2ISZA 5JI6A 4OINF 4JQFA 5E20A 2RKHA 1ZGJA 2F5FA 4ZYHA 3F8MA 2XIGA 4HYEA 3ULQB 1MDMA 2ZMEA 5D8KB 3S2WA 4HQEA 2GIVA 1R22A 1G3YA 1S7AA 2ETHA 1RIOH 2ELHA 3LQQA 2A6HF 1MD0A 1WRJA 3F72A 2OA4A 4A0YA 5DDGA 4A2UA 1SFXA 3GFMA 1EH8A 1WI9A 1I27A 1Z6RA 2A5YB 2FSWA 1LDDA 4I01A 4M6XA 1OPCA 1U5TC 4GYIA 5HS8A 3K1NA 1YFHA 1XMAA 1FNNA 5FB2A 3E6CC 3P9IA 5ILVA 3E6MA 2HR3A 1HSTA 3E5QA 3K1MA 1FSHA 4HLXA 2O3FA 2MD5A 2O03A 4R1HA 1R1TA 1FY7A 2KRFA 4Y13A 3NRVA 3ELKA 3WG9A 3LA7A 3RKYA 1CF7A 3KP2A 1I1GA 3C7JA 5E1WA 5HLHA 2LNBA 3E6DA 1D8KA 1UFMA 1YIOA 1W5SA 3IRRA 3J81K 3ZPLA 5IT3A 5KK1A 1CF7B 2G7HA 1HBXG 3F8FA 2P5LC 2TDXA 4KIGA 3RYPA 1V3FA 3ERED 2MH2A 5AIQA 3V8JA 5DCMA 4MTDA 2RC4A 4FX4A 4HZFA 2L4AA 2HS5A 5HLGA 1ZRCA 1ZGAA 5DCMB 2KIMA 4QLCU 4HV5A 4M72A 1QQIA 1IAWA 3G3ZA 3WE2A 1LQ1A 1HSJA 2QENA 3JAMZ 3WGIA 1I1SA 5HDGA 4XLPF 4HX7A 3I54A 2MA3A 3RPQA 5EEHA 2QUFA 1MZBA 1RUOA 3M8FA 2ZKZA 2K4JA 3I53A 3BDDA 2DQLA 4OIOF 5H6QA 3IL2A 2GWRA 3TO7A 1T38A 1F4KA 1XGSA 1A04A 3K9TA 3M9AA 2OQRA 2DPDA 1HKSA 2C6YA 2F5CA 1UB9A 5L3BA 5E1ZB 4B09A 3V8KA 5FLXK 3TQNA 5D4RA 4R8HA 2YPRA 1OR7A 4ZZLA 1SFEA 2IP2A 5DEQA 2ESNA 2LDUA 3JSPA 4Q48A 2J5OA 2JZYA 2F5DA 2GQQA 3ABUA 3FM5A 3KEOA 1Q1HA 2CSOA 2PJPA 2JPCA 4LG0B 1XDUA 2COMA 2W25A 1MJ9A 2ZO4A 4YFXF 1SMYF 3ZP5A 1MKMA 1BI1A 4RGRA 3LFKA 5LGNA 4E70A 3MZYA 3MZHA 3MQ0A 3RIRA 3LA3A 1FX7A 2PFBA 3FF5A 3DQVC 2NNNA 3L9FA 1P4AA 1B4AA 3EUHA 2MBFA 2Q2EA 1BOAA 3V7SA 1W7PA 2ZFWA 4G7OF 3WTVC 1LJ9A 2FNPA 5E18F 4KFCA 3REOA 2EWNA 4EGZA 1ZHFA 4CDGA 2HTSA 1Z1DA 1STZA 4QWQA 2R3SA 2O0YA 4UHTA 2JRTA 1TQIA 1S3JA 4LMYA 3VODA 2E7XA 3HSFA 4L9JA 3QPHA 2PI0A 1J0RA 2V6CA 3F8NA 2DQRA 3BZ6A 4EJWA 2Y75A 3IWZA 4G6QA 2DO7A 4KN4X 2ESHA 3JAMK 1HKTA 5FO5A 3BROA 1IN6A 1R00A 1X3UA 5E8IA 4Z2YA 3ABTA 1DPUA 3FX3A 3H3ZA 2FE3A 1EH7A 4KDPA 4ZYDA 4GGGA 3I71A 2EK5A 1Z05A 1FYLA 1XGMA 2VE9A 1U3EM 1Z91A 3ZN1A 1AWCA 1K79A 2ZNZA 4KIBA 3QAHA 4L9VA 1XN7A 2W57A 2VOPA 4PGGA 2BGCA 4FHTA 4MEXF 2FRHA 1Z6TA 1QO0D 3M1EA 4IHTA 2RNJA 2XRNA 2P6TA 2JSCA 1R36A 5HOOA 2VBWA 3KP4A 2EV5A 1QBJA 2ADUA 1KYWA 2W84A 2LF7A 3HUGA 3C18A 4AIHA 1S7OA 5HS9A 1B1BA 3R60A 1WQ2A 4RAYA 1FOKA 5D8LB 3ZMUA 3F23A 3SZPA 3KLNA 2EJRA 3F8CA 3NEUA 2FNAA 3DV8A 2IRFG 4EM2A 2XVCA 5HDNA 2FBHA 3SFZA 1RI7A 4MGRA 5HDKA 2G9WA 3LSTA 3WGGA 4HF0A 5A2QZ 2L54A 1IRFA 2QBYA 1SD4A 1XSVA 3G73A 5FD5A 1MJBA 2HZTA 3E3VA 1FPQA 2UXNA 4P55A 3F3XA 2DK8A 3AAFA 3KZZA 4H0EA 4LB6B 4GYGA 4S04A 3J81Z 1R58A 2XASA 2OAZA 1G6NA 2FQ3A 3CUQA 1XCVA 3TO6A 2M8EA 4O6JA 4BYYA 4BHBA 3R0AA 4S05A 3E5XA 2OD5A 1XD7A 5CYVA 1SD5A 3QU6A 1BIBA 5LLQA 3OV8A 3CUQB 4PCQA 1W5TA 4CHUA 4L0YB 4WXDA 4PGHA 4BHPA 2E1NA 2P4WA 4FX0A 5BMZA 1J7KA 5JR3A 3PFIA 1SD6A 3GW2A 3ML6A 4KMUX 4UVBA 1JXSA 3P7NA 4YFKF 1P4XA 1KU3A 3D0SA 4IPAA 4YG2F 3VEPA 1KQ9A 3L00A 5HLIA 3WU1B 1USSA 2VE8A 2E1CA 3QOPA 1IXCA 1QPMA 4KN7X 4AIJA 1JHFA 2BEOA 3WGHA 2EA4A 3F6VA 3QRFF 5BOXA 4I09A 2M1BA 3CLOA 1DDNA 3HRUA 3DPTA 3J7AO 4CZZA 1KA8A 2OZUA 1YW7A 1XGOA 1YYVA 2XHKA 5TJJA 2QQAA 1T2KA 2VC1A 4ENMA 5K5OA 1XB4A 1F1ZA 5FLXZ 5IT9Z 5BPIA 1ZN2A 1UCRA 4N0BA 2QYOA 2X4HA 4MQ9F 1U8RA 3IRQA 1P4WA 2ZJ2A 4UUVA 3JTHA 4PDKA 2XAJA 3HTSB 4HOBA 1UHWA 1HW1A 2EFWA 1YS6A 2H6BA 1R1VA 3JW4A 3VFZA 1PUEE 5JVTA 3QP5A 3BOQA 5LEJA 1JE8A 2GXGA 4OU0A 4AD9A 1TNSA 5A2QK 3RKWA 4AWXB 4L5JA 3E6BA 4WCGA 4G6DA 3TO9A 4EQQA 5CVVA 3K69A 4G8XA 1XSDA 1E2XA 4U0VA 2OU2A 3SZTA 4RGXA 2K86A 5DUIA 3HRTA 2VBXA 3I5UA 3LWFA 2PMUA 2K27A 4JBAA 1ZARA 4ZYGA 2RQPA 3W6JB 1YO5C 4FT8A 1WWXA 4K2EA 4LK0F 5ICCA 2STWA 1J5YA 1WKMA 2VT3A 5D6FA 1TQMA 1MJAA 1SAXA 2P5VA 1BM9A 2EV0A 3P9KA 3C3WA 2P7VB 2HFHA 2X0LA 2CFXA 3K0LA 4A0ZA 4LJZF 3I0TA 3TDUC 4G94A 4HA8A 2KIUA 3FMRA 3GO5A 1ZH5A 1L3LA 4JK1X 3FWEA 3GZ6A 2GAUA 1WSUA 2L01A 4M9XA 5F1RA 3F22A 5D5WB 1ZG5A 1PP7U 5ED4A 1KGSA 5LGUA 1T6SA 4ZYEA 3KCCA 3RYRA 1QZYA 4OIPF 2VC0A 2FMLA 3HYIA 1UHMA 2VOOA 5AIPA 1KQ8A 2ISYA 4LLGF 2JTVA 3L2CA 1J2XA 2HQNA 4Q47A 3J80K 2A61A 2GA2A 2B0LA 1OYWA 4IHSA 3O6BB 2IW5A 5IT9K 5F6FA 3BJAA 1G3WA 4HBLA 2QQ9A 4WXHA 4N9IA 4A6DA 1ZLKA 3T5XA 4LG0A 3VOEA 2IA1A 3I58A 1GHCA 3ZMDA 4IJAA 4AIKA 3DF8A 4WWCA 3QP6A 3BJOA 1ZG3A 5LRRA 1J59A 5L3GA 2HEOA 1OYIA 2IT0A 4XRFA 4G7ZF 3U9GA 1FSEA 3WTSC 3ZN0A 4HDUA 3EDPA 2ZBKA 4EM0B 4CGZA 2NRAC 2QM3A 1XDSA 2HYGD 5DCFA 4KICA 2CWEA 4P96A 1LB2A 2L4MA 4KNYA 1KU7A 4EJOA 1U5TA 2QZ8A 1XSXA 2K4BA 1K78B 3RPUA 4HF1A 1TBXA 1LNWA 1OYYA 4D0PA 3BP8A 4L18B 1RUNA 1IN5A 2BYVE 2IJLA 5J6XA 1DUXC 1U5TB 2EB7A 1W7PD 3T1BA 3ZQ7A 1JHHA 1ON2A 4ENJA 1BN5A 2Z9OA 3HSRA 2E7WA 3CO6C 5CVIA 5D5VB 3MFKA 3LAJA 1B9NA 2D1HA 1E17A 3GVAA 4GCVA 5L3FA 4KT5C 2NS0A 5CLSA 2PMHA 1TQPA 2W24A 3TOBA 4XSXF 4ETSA 3HSEA 1L0OC 2IA0A 2HDCA 1IRGA 1S6LA 2UWMA 2D2WA 2YR2A 4HLYA 3EYYA 4U0YA 1SMTA 1FLIA 1FBQA 1GVJA 4M73A 1O3SA 5FGMA 3KEQA 3M7GA 5ILSA 4A0XA 5L3CA 4I0BA 4OMYA 3BJ6A 1T0FA 2FEZA 1GXPA 1EH6A 2OBPA 2XKOA 2Y48A 5ICGA 3DEUA 1O3RA 1B59A 2HGCA 3CTAA 4KA4A 5L3DA 1FP2A 2QLZA 1H9GA 3MEXA 5LHIA 3KP6A 2H27A 1YG2A 3NQOA 4UNOA 2FXAA 4L5IA 2FA5A 3T8RA 4EV0A 4RB1A 2Z5UA 1T39A 3FXUA 1USTA 2EFQA 4GO1A 2OQGA 1P2FA 3GFLA 1R5GA 1J75A 3ZMSA 3B02A 3IC7A 4RGSA 1LDJA 2ZXJA 3GEZA 1HW5A 4M71A 2GZWA 4YIIA 4OIQF 4KMFA 3QPTA 4YIFA 4IRHA 4P9UA 2P5KA 2M45A 3FMSA 1ODDA 3I59A 5D4SA 1IN4A 1O7FA 4KIFA 5CVJA 4RGUA 1XCBA 2ACJA 3R61A 4CYDA 2BV6A 1O3TA 1YW9A 1FYKA 3I59B 1ONVA 1O3QA 2A6EF 4LB5A 2WWYA 1FWZA 3EYIA 2PN6A 1KYZA 3WTTC 4IF4A 5LGTA 2DW4A 4LD5A 1BI0A 1K6OA 2M30A 2RGVA 4RAZA 2F2EA 3DP7A 2CO5A 1PDNC 6PAXA 4IVNA 4UVCA 1LEBA 5LRSA 2XGXA 1HW2A 2HOEA 3FXQA 2EV6A 1FZPB 2Y0MA 4I2OA 1QZZA 3WTWC 1Z7UA 1LEAA 5FFXA 2D45A 2STTA 4LLNA 1R1UA 3V8LA 2M5WA 2DK5A 4RB2C 4I98B 4MNUA 5ERIA 4IRIA 5LHGA 2DTRA 3V7CA 4HDVA 1YS7A 3SXYA 4Q4ZF 3GUDA 2V1UA 1SD7A 2KJBA 5DUKA 1FBUA 3BPXA 2XAQA 1GXQA 1S29A 2V79A 2KJCA 4M74A 1IXRC 1G3SA 3PQJA 2A68F 2RVCA 5DV5A 1TLHB 1U6GA 1HQCA 4HQMA 3U2RA 4M9SA 5K1YA 4A6EA 4OOIA 2CG4A 3HOSA 1ZRFA 3ECHA 5ICFA 1G3TA 2H94A 1R5HA 4LFUA 2VBZA 3R4KA 2D1VA 3J80Z 2FBKA 2P8TA 4IXAA 3HOTA 2IVMA 2CQKA 4HV6A 3JSOA 3O3KA 2IA2A 3CJNA 4NB5A 1HXDA 2P7CB 3VB2A 2O6GE 4L9NA 5AONA 3KZYA 2Z33A 5LEKA 2EFPA 1V4RA 4HX4A 3WU0A 2QQBA 3IHUA 1OMIA 2KKOA 5HS7A 3V4GA 1ZREA 4BAYA 1F9NA 5L3EA 3FXRA 5K5RA 4BH9A 1P92A 2BE5F 3W6KB 2YX4A 1HKQA 2MH9A 3N4MA 4WF2A 2HWVA 4YFNF 3H92A 2FMYA 1YTYA 4MHGA 4U7BA 1MDMB 2HKOA 1ZG1A 2ZMEB 5D5UB 2IPQX 5DD4A 4BNCA 5D6EA 3Q9SA 4ASNA 3DFGA 3WTUC 4XBFA 1NHAA 2DPUA 4ESJA 1MGTA 5JFRA 3N97A 1TW3A 1TTYA 4ON0A 1XMKA 4HX8A 2R7DA 1G4DA 1FBSA 4EGYA 1FYMA 3GFIA 5FFZA 1Z9CA 3T8TA 2RV8A 4CO8A 4DQ2A 4I0AA 4TV7A 2O61A 2XKPA 4KYWA 2ZCWA 4HAMA 1F5TA 2PEXA 2Z3YA 3TKYA 2MC3A 3T0YA 1ZYRF 1BBYA 3RTRA 2UZKA 3MCZA 4EVIA 4EJUA 1I5ZA 5E8GA 2AS5F 1B6AA 2K02A 1BC7C 4RB3C 3HIFA 4N9HA 3DXJF 1IN8A 1FT9A 4UV8A 4P9FA 5KVRA 1REPC 2NNYA 1IN7A 5CVUA 3ZMVA 4HW0A 4NHJA 1LDKB 1BIAA 4M9ZA 3F6OA 2VT2A 3RDIA 2G7UA 2MLGA 4EM1A 1TW2A 1O57A 5ICEA 2HKXA 4ZH4F 1J9IA 1PP8F 2V9VA 3ROUA 1BJAA 5LHHA 1JGSA 2ZNYA 3TOAA 4CICA 3LQRA 2H6CA 1DPRA 2L02A 2BBYA 2Q0OA 4LGWA 5DYMA 2GA1A 4BHCA 2KIFA 3L7WA 3COAC 3M8EA 2A07F 4U88A 2CGPA 4HF2A 2JT1A 4RS8A 4CXFA 1FC3A 1EV7A 2PG4A 2LF8A 1D8JA 4I7HA 2FF4A 1LVAA 4O5VA 3EETA 1CGPA 2OZ6A 3B73A 3IKVA 1ZRDA 4IRGA 3R6SA 3WTXC 2VODA 1U2WA 2WTEA 2Z99A 1QNTA 3SHFA 3R0JA 1XGNA 1K78A 3GFJA 3FZVA 2V1DA 3D5LA 3LAPA 1SFUA 1KU2A 4WK8F 5E17F 3HRMA 2DI3A 2HTJA 1KQ0A 2XROA 1IF1A 4UVAA 3BWGA 4WX9A 4GXOA 3ZMTA 2W85A 3MWMA 1IXSB 4Y15A 2PQ8A 1W4MA 2A69F 4AVPA 2R7FA 5EEGA 3C1DA 4LLLA 4G7HF 4G9YA 5H20A 1D3YA 2DU9A 1KU9A 2LSOA 3ISPA 1W7PB 3GX4X 2NAZA 3CUQC 3GXOA 1AOYA 5BQTA 4LK1F 2QVOA 2XAFA 4BQAA 5K5QA 1RZ4A 5E1XA 2LKPA 3HHHA 3DPLC 5H6RA 3ZMZA 2FU4A 1B9MA 2DT5A 2K7LA 4P5OA 3GWZA 2NYXA 3O2PE 5HVQC 4EMSA 3GYHX 4F7ZA 1IW7F 3K1PA 3WE3A 2PLYA 1D5VA 1O7LA 3OOPA 4PZJA 3DKWA 3HHGA 2MLKA 2WC2A 4RB0A 3RJPA 2Q8KA 2VBYA 5TRDA 4ESBA 1DP7P 2QWWA 3Q5FA 3KFWX 3TDZC 4MQVA 4ENNA 3KE2A 3KP3A 3MAJA 3QU3A 4ZZDA 4I02A 2GXBA 3F21A 3BPVA 5CJ9A 2F5EA 1H0MA 4L0ZB 4EJVA 1K7AA 4DNCA 3GZ5A 3HTUA 3CDHA 1YQAA 3ECOA 1BI3A 3SQNA 3KETA 2YU3A 3CO7C 2XAGA 4MTEA 4R79A 4NQWA 4A5NA 1YLFA 2H09A 2RN7A 4ESFA 1IUYA 2P6SA 2A3SA 2RDPA 3IKTA 2DAOA 2EA2A 1P6RA 4U0WA 3E97A 1YW8A 2XV4S 1BI2A 2VXZA