2EQ3A

Solution structure of the 17th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECNQCGKAFSVRSSLTTHQAIHTGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Zinc finger protein 347
publication title Solution structure of the 17th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq3A01
2YTNA 1A1JA 1BB8A 2EM6A 2EPRA 2EN6A 3M99B 2EL4A 4R2CA 2DGCA 2EMFA 2EPAA 2EMGA 5KL6A 2EM2A 2WBUA 1X6EA 2BB8A 2ELZA 3EPLA 4R2PA 2VRDA 2EOQA 1A1HA 5KL3A 2DLQA 2EP3A 1MEYC 2EL5A 2ENAA 2EN7A 2EQ1A 2JPAA 4WSGA 2YTPA 2EOMA 2RPCA 2MKNA 2D9HA 2EMKA 1NCSA 1UBDC 2YRMA 2YU8A 2EM4A 1P47A 2YTEA 2EN3A 2RSIA 2LVHA 1AAYA 1BBOA 2EORA 5KL4A 2LV2A 2EMYA 1WJPA 2R1FA 1TF3A 2EM8A 2EOIA 4M9VC 2E72A 1RMDA 2EMAA 5KL2A 1Z1BA 2I13A 2EOSA 2M9AA 1X5WA 2EOEA 2EOJA 2EOZA 1A1LA 4R2EA 2LO3A 2WCC3 4F2JC 2YTIA 2EN8A 1YUJA 2EMWA 2YTFA 3VHTB 2EN4A 2EL6A 3UK3C 2YTDA 2LCEA 2A25A 2EPCA 1X3CA 1F2IG 2GLIA 5KL5A 1A1GA 2ELYA 2YTGA 3EPKA 5KL7A 4GZNC 4X9JA 2EM5A 1B69A 1A1FA 2DMIA 1LLMC 2ENCA 2NABA 2CT1A 2EMZA 1ZAAC 2CSHA 4F6NA 2ADRA 2YSPA 2EPPA 2JP9A 2ENHA 2WBTA 2YTOA 2EMLA 2EM9A 4R2DA 1A1IA 2EM3A 2EPUA 2YTJA 4R2QA 3EPHA 3MHHC 2EOHA 4F6MA 2EN1A 2EOXA 4R2SA 1ZU1A 2EQ3A 1JK2A 2EMXA 2EMIA 4IJDA 2YU5A 2YSOA 2CTDA 1A1KA 1X6FA 2YRKA 2EN2A 2EM0A 2EJ4A 2J7JA 3EPJA 1UN6B 2EMBA 1JK1A 2EOFA 3MHSC 2EM7A 2EQ0A 2EPXA 4R2AA 1ZR9A 2EMHA 1DGCA 1X6HA 2EMCA 4FK5C 2DRPA 1G2DC 2EOYA 4IS1C 4R2RA 2YTQA 2EE8A 2YRHA 2HGHA 2MDGA 1YSAC 2MKDA 1KJKA 2PRTA 2WBSA 1YUIA 2LT7A 1TF6A 2EPZA 2DLKA 2EOOA 1G2FC 2GHFA 1TN9A
chains in the Genus database with same CATH superfamily
2EPRA 4KZSA 4GKKE 2EL4A 3VYXA 2EMFA 1IBME 3MSWA 5IWAE 2EM2A 2GPIA 1YYOA 4O24A 1YFHA 2F4VE 1PJSA 2VRDA 1A1HA 4DR1E 5LMNE 2EL5A 2RSMA 2LE2A 2EOMA 2EMKA 1NCSA 4I8OA 4DR4E 1P47A 3THOB 4P78A 4NXNE 2YTEA 2RSIA 4R03A 4HEIA 2UUCE 2EORA 4KWYA 2L6MA 2NA2A 4L5NC 1RMDA 2DMYA 5KL2A 1FJGE 2EOSA 4DKKA 1PKPA 4X64E 2HHHE 3BF2A 2MC5A 2EN8A 1WHQA 4JI3E 1IMUA 4DR3E 4BHCA 4JI2E 2UUAE 3VHTB 2JWOA 5CFFE 2LCEA 2A25A 2EPCA 4ZYDA 4X9JA 5IXMB 2EM5A 5T6JA 2JOBA 2ENCA 2JP9A 2EMLA 1PJTA 2K4VA 2LJUA 3HXLA 4R2DA 2V8QB 4F6MA 5TSEA 2BBGA 3P1XA 1FKAE 2V86A 5A6BA 4LFCE 4IJDA 4GKJE 3DJWA 2YWQA 5F3WA 4BBYA 4LF4E 2YRKA 2JYAA 2L8TA 2N8XA 2L2KB 2LTRA 3OTOE 2EQ0A 4R2AA 1WRJA 1ZR9A 4LF5E 4BS9A 1DGCA 3ADIA 5IT9C 2DRPA 1N32E 4BC7A 5AASA 4ZYGA 2UUBE 2HGHA 3ADGA 1IQOA 2UXDE 2PRTA 2B7VA 4HTGA 1YUIA 2LT7A 2EPZA 3ADJA 3JAMC 3RMPA 1G2FC 2V88A 5AC4A 2GHFA 4DV6E 1SR9A 3L00A 1KYQA 2JXPA 1PJQA 1GQEA 2YT4A 2EPAA 2EMGA 3H09A 2WBUA 4F9AB 2HC5A 3LLHA 3AUZA 1HR0E 1N34E 4R2PA 2E5LE 2EOQA 5AE3A 2EZ6A 2L2MA 3BBGA 2VF1A 2EP3A 2G7HA 4DV1E 2MC6A 4JV5E 1YYKA 2RS7A 3K6QA 2YTPA 2RPCA 1UBDC 2YRMA 2VQFE 3T1HE 1BBGA 3J7AG 2LVHA 1AAYA 1BBOA 4GEQB 5KL4A 2LV2A 1TF3A 2EM8A 2EOIA 4M9VC 1XNRE 2DSYA 3JU0A 1Z1BA 2EMAA 2M9AA 4X66E 1X5WA 2EOEA 2WZOA 2IHR1 1A1LA 2LO3A 4WYQB 2WCC3 2VQEE 2YTFA 3DF6A 2EN4A 2EL6A 1X3CA 1F2IG 1HNWE 3HPSA 2ELYA 2YTGA 3EPKA 1QNTA 2UXBE 1B69A 5BR8E 1DI2A 1YPNA 1XNQE 1YYWA 2NABA 2ODRD 5AE1A 1ZAAC 4F6NA 2NUFA 4OX9E 2WBTA 1A1IA 2EM3A 2EPUA 2YTJA 4R2QA 2LJHA 4WXCA 3EPHA 2L3CA 2RQLA 3MHHC 2B7TA 4Q35B 4DR2E 4O43A 4WXDA 2EQ3A 1EH6A 5DNYA 2EMXA 2V87A 4DV3E 1T4LB 2YU5A 2CTDA 1A1KA 2EM0A 2EJ4A 5FLXC 2EMBA 5A6BD 1XMQE 3MHSC 2FV4B 2EMHA 2LMZA 4FK5C 3TQMA 4LF9E 2RTXA 2LTSA 1NEIA 2UU9E 1HNZE 2YRHA 3BIDA 3THNA 2MDGA 1T4OA 1YSAC 2MKDA 4BCAA 3J80C 1I94E 4DV2E 3JTZA 4K0KE 1TF6A 3ZOQB 2FTXB 1A1JA 3KZZA 3KWRA 3M99B 2CPNA 2DGCA 2M1SA 2BB8A 1ZBTA 4NXME 5KL3A 2DLQA 2NUGA 2EN7A 2JPAA 1IBLE 4DR6E 2D9HA 2B9DA 5ADZA 2EM4A 4R8OA 1SFEA 4L8NA 2YZTA 1T38A 4LTYA 2HJJA 4LF8E 2EMYA 1WJPA 2V85A 4OOGC 3VK6A 2I13A 1WXRA 2EPOA 4O5GA 3IWBA 4F2JC 4LF6E 1UHZA 4N4RB 3HTXA 2EMWA 1X47A 2DIXA 4MLQA 4M30A 4WSPA 3UK3C 1A1GA 2JVAA 4LF7E 5KL7A 4AQYE 2F8BA 4JI6E 4RH8A 2L33A 4KHPE 4JI1E 3LMLA 2RS6A 2EMZA 5LLQA 2M4IA 4WX9A 5A6AA 1XMOE 2FGGA 4LU9A 2EPPA 3KZYA 4B3TE 4DV5E 4X62E 2YTOA 2EM9A 2H36X 3J81C 1N36E 4O4KA 1PDAA 4R2SA 2EOXA 1J26A 2EPKX 2EMIA 2YSOA 4DUYE 2V89A 4B3ME 2EN2A 3EPJA 5LMUE 4DR5E 2I9IA 4DUZE 1UN6B 2EPMX 1JK1A 5LL6R 2EPLX 2EM7A 2EPXA 4F9BB 2L3JA 2K7IA 5AC5A 1UILA 4DV0E 4DV4E 1G2DC 2EOYA 2KOUA 4RHBB 4IS1C 4JI4E 3C4TA 3FIGA 2LBSB 3IWCA 2MDRA 4J8ZA 5AE2A 4JYAE 3F6GA 4M0VA 2L92A 1T39A 4F54A 3IWDA 1RQ0A 2JY9A 1IQSA 2NUEA 2DLKA 4YHHE 1TN9A 2YTNA 3C6KA 1BB8A 2EM6A 2KHXA 4ZYHA 2EN6A 4R2CA 2LUPB 4NHRA 1MGTA 1QU6A 5KL6A 2YPNA 1X6EA 2ELZA 4DMIA 3EPLA 2R76A 4MLVA 1X49A 1MEYC 2ENAA 2EQ1A 4WSGA 1YZ9A 4BMJA 4BHBA 2MKNA 4LFAE 1DQ3A 2YU8A 5A69A 2UXCE 2E1MA 1J5EE 1EKZA 1GTKA 2N3HA 2EN3A 4ZYEA 4TUIA 4JI8E 2LRSA 2R1FA 3OMLA 2ZM6E 2E72A 5IV8B 1STUA 2V83A 2JR1A 2Q8UA 3C6MA 3J7Yp 2EOJA 2EOZA 1ZBQA 4R2EA 1RC7A 2YTIA 1YUJA 4B3RE 3AV0A 4DV7E 1T4NA 2YTDA 2VE7C 5KL5A 2GLIA 4GZNC 5A6JA 1IBKE 1A1FA 4JI0E 2DMIA 1LLMC 4BC9A 5A2QC 3ECRA 2CT1A 3T1YE 2CSHA 2ADRA 5A6KA 2YSPA 3VYYA 2DB2A 4Q28A 4M2ZA 2EPNA 2ENHA 3C4BA 1AH5A 2EWLA 4JI5E 3ADLA 2N3GA 4B3SE 2EOHA 4NZVA 2EN1A 1WHNA 1X48A 1ZU1A 4WPYA 2LUQA 4F9CB 4WFTA 1JK2A 1EH7A 1L4SA 2KONA 3HQ1A 1HNXE 1N33E 1X6FA 4YY3E 3EQ1A 1N3GA 2J7JA 2B3TB 4P7DA 2L2NA 2EOFA 3QG5C 1X6HA 2EMCA 4JI7E 1EH8A 2JOXA 4R2RA 1GZ6A 2YTQA 2EE8A 3F6HA 4X8WA 2M7QA 4TUGA 4LFBE 1KJKA 4X65E 2WBSA 3BGHA 1O0WA 2ODRC 4DR7E 2EOOA 3HPZA
chains in the Genus database with same CATH topology
2YTNA 1A1JA 1BB8A 2EM6A 2EPRA 2EN6A 3M99B 2EL4A 4R2CA 2DGCA 2EMFA 2EPAA 2EMGA 5KL6A 2EM2A 2WBUA 1X6EA 2BB8A 2ELZA 3EPLA 4R2PA 2VRDA 2EOQA 1A1HA 5KL3A 2DLQA 2EP3A 1MEYC 2EL5A 2ENAA 2EN7A 2EQ1A 2JPAA 4WSGA 2YTPA 2EOMA 2RPCA 2MKNA 2D9HA 2EMKA 1NCSA 1UBDC 2YRMA 2YU8A 2EM4A 1P47A 2YTEA 2EN3A 2RSIA 2LVHA 1AAYA 1BBOA 2EORA 5KL4A 2LV2A 2EMYA 1WJPA 2R1FA 1TF3A 2EM8A 2EOIA 4M9VC 2E72A 1RMDA 2EMAA 5KL2A 1Z1BA 2I13A 2EOSA 2M9AA 1X5WA 2EOEA 2EOJA 2EOZA 1A1LA 4R2EA 2LO3A 2WCC3 4F2JC 2YTIA 2EN8A 1YUJA 2EMWA 2YTFA 3VHTB 2EN4A 2EL6A 3UK3C 2YTDA 2LCEA 2A25A 2EPCA 1X3CA 1F2IG 2GLIA 5KL5A 1A1GA 2ELYA 2YTGA 3EPKA 5KL7A 4GZNC 4X9JA 2EM5A 1B69A 1A1FA 2DMIA 1LLMC 2ENCA 2NABA 2CT1A 2EMZA 1ZAAC 2CSHA 4F6NA 2ADRA 2YSPA 2EPPA 2JP9A 2ENHA 2WBTA 2YTOA 2EMLA 2EM9A 4R2DA 1A1IA 2EM3A 2EPUA 2YTJA 4R2QA 3EPHA 3MHHC 2EOHA 4F6MA 2EN1A 2EOXA 4R2SA 1ZU1A 2EQ3A 1JK2A 2EMXA 2EMIA 4IJDA 2YU5A 2YSOA 2CTDA 1A1KA 1X6FA 2YRKA 2EN2A 2EM0A 2EJ4A 2J7JA 3EPJA 1UN6B 2EMBA 1JK1A 2EOFA 3MHSC 2EM7A 2EQ0A 2EPXA 4R2AA 1ZR9A 2EMHA 1DGCA 1X6HA 2EMCA 4FK5C 2DRPA 1G2DC 2EOYA 4IS1C 4R2RA 2YTQA 2EE8A 2YRHA 2HGHA 2MDGA 1YSAC 2MKDA 1KJKA 2PRTA 2WBSA 1YUIA 2LT7A 1TF6A 2EPZA 2DLKA 2EOOA 1G2FC 2GHFA 1TN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTN A;  1A1J A;  1BB8 A;  2EM6 A;  2EPR A;  2EN6 A;  3M99 B;  2EL4 A;  4R2C A;  2DGC A;  2EMF A;  2EPA A;  2EMG A;  5KL6 A;  2EM2 A;  2WBU A;  1X6E A;  2BB8 A;  2ELZ A;  3EPL A;  4R2P A;  2VRD A;  2EOQ A;  1A1H A;  5KL3 A;  2DLQ A;  2EP3 A;  1MEY C;  2EL5 A;  2ENA A;  2EN7 A;  2EQ1 A;  2JPA A;  4WSG A;  2YTP A;  2EOM A;  2RPC A;  2MKN A;  2D9H A;  2EMK A;  1NCS A;  1UBD C;  2YRM A;  2YU8 A;  2EM4 A;  1P47 A;  2YTE A;  2EN3 A;  2RSI A;  2LVH A;  1AAY A;  1BBO A;  2EOR A;  5KL4 A;  2LV2 A;  2EMY A;  1WJP A;  2R1F A;  1TF3 A;  2EM8 A;  2EOI A;  4M9V C;  2E72 A;  1RMD A;  2EMA A;  5KL2 A;  1Z1B A;  2I13 A;  2EOS A;  2M9A A;  1X5W A;  2EOE A;  2EOJ A;  2EOZ A;  1A1L A;  4R2E A;  2LO3 A;  2WCC 3;  4F2J C;  2YTI A;  2EN8 A;  1YUJ A;  2EMW A;  2YTF A;  3VHT B;  2EN4 A;  2EL6 A;  3UK3 C;  2YTD A;  2LCE A;  2A25 A;  2EPC A;  1X3C A;  1F2I G;  2GLI A;  5KL5 A;  1A1G A;  2ELY A;  2YTG A;  3EPK A;  5KL7 A;  4GZN C;  4X9J A;  2EM5 A;  1B69 A;  1A1F A;  2DMI A;  1LLM C;  2ENC A;  2NAB A;  2CT1 A;  2EMZ A;  1ZAA C;  2CSH A;  4F6N A;  2ADR A;  2YSP A;  2EPP A;  2JP9 A;  2ENH A;  2WBT A;  2YTO A;  2EML A;  2EM9 A;  4R2D A;  1A1I A;  2EM3 A;  2EPU A;  2YTJ A;  4R2Q A;  3EPH A;  3MHH C;  2EOH A;  4F6M A;  2EN1 A;  2EOX A;  4R2S A;  1ZU1 A;  2EQ3 A;  1JK2 A;  2EMX A;  2EMI A;  4IJD A;  2YU5 A;  2YSO A;  2CTD A;  1A1K A;  1X6F A;  2YRK A;  2EN2 A;  2EM0 A;  2EJ4 A;  2J7J A;  3EPJ A;  1UN6 B;  2EMB A;  1JK1 A;  2EOF A;  3MHS C;  2EM7 A;  2EQ0 A;  2EPX A;  4R2A A;  1ZR9 A;  2EMH A;  1DGC A;  1X6H A;  2EMC A;  4FK5 C;  2DRP A;  1G2D C;  2EOY A;  4IS1 C;  4R2R A;  2YTQ A;  2EE8 A;  2YRH A;  2HGH A;  2MDG A;  1YSA C;  2MKD A;  1KJK A;  2PRT A;  2WBS A;  1YUI A;  2LT7 A;  1TF6 A;  2EPZ A;  2DLK A;  2EOO A;  1G2F C;  2GHF A;  1TN9 A; 
#chains in the Genus database with same CATH topology
 2EPR A;  4KZS A;  4GKK E;  2EL4 A;  3VYX A;  2EMF A;  1IBM E;  3MSW A;  5IWA E;  2EM2 A;  2GPI A;  1YYO A;  4O24 A;  1YFH A;  2F4V E;  1PJS A;  2VRD A;  1A1H A;  4DR1 E;  5LMN E;  2EL5 A;  2RSM A;  2LE2 A;  2EOM A;  2EMK A;  1NCS A;  4I8O A;  4DR4 E;  1P47 A;  3THO B;  4P78 A;  4NXN E;  2YTE A;  2RSI A;  4R03 A;  4HEI A;  2UUC E;  2EOR A;  4KWY A;  2L6M A;  2NA2 A;  4L5N C;  1RMD A;  2DMY A;  5KL2 A;  1FJG E;  2EOS A;  4DKK A;  1PKP A;  4X64 E;  2HHH E;  3BF2 A;  2MC5 A;  2EN8 A;  1WHQ A;  4JI3 E;  1IMU A;  4DR3 E;  4BHC A;  4JI2 E;  2UUA E;  3VHT B;  2JWO A;  5CFF E;  2LCE A;  2A25 A;  2EPC A;  4ZYD A;  4X9J A;  5IXM B;  2EM5 A;  5T6J A;  2JOB A;  2ENC A;  2JP9 A;  2EML A;  1PJT A;  2K4V A;  2LJU A;  3HXL A;  4R2D A;  2V8Q B;  4F6M A;  5TSE A;  2BBG A;  3P1X A;  1FKA E;  2V86 A;  5A6B A;  4LFC E;  4IJD A;  4GKJ E;  3DJW A;  2YWQ A;  5F3W A;  4BBY A;  4LF4 E;  2YRK A;  2JYA A;  2L8T A;  2N8X A;  2L2K B;  2LTR A;  3OTO E;  2EQ0 A;  4R2A A;  1WRJ A;  1ZR9 A;  4LF5 E;  4BS9 A;  1DGC A;  3ADI A;  5IT9 C;  2DRP A;  1N32 E;  4BC7 A;  5AAS A;  4ZYG A;  2UUB E;  2HGH A;  3ADG A;  1IQO A;  2UXD E;  2PRT A;  2B7V A;  4HTG A;  1YUI A;  2LT7 A;  2EPZ A;  3ADJ A;  3JAM C;  3RMP A;  1G2F C;  2V88 A;  5AC4 A;  2GHF A;  4DV6 E;  1SR9 A;  3L00 A;  1KYQ A;  2JXP A;  1PJQ A;  1GQE A;  2YT4 A;  2EPA A;  2EMG A;  3H09 A;  2WBU A;  4F9A B;  2HC5 A;  3LLH A;  3AUZ A;  1HR0 E;  1N34 E;  4R2P A;  2E5L E;  2EOQ A;  5AE3 A;  2EZ6 A;  2L2M A;  3BBG A;  2VF1 A;  2EP3 A;  2G7H A;  4DV1 E;  2MC6 A;  4JV5 E;  1YYK A;  2RS7 A;  3K6Q A;  2YTP A;  2RPC A;  1UBD C;  2YRM A;  2VQF E;  3T1H E;  1BBG A;  3J7A G;  2LVH A;  1AAY A;  1BBO A;  4GEQ B;  5KL4 A;  2LV2 A;  1TF3 A;  2EM8 A;  2EOI A;  4M9V C;  1XNR E;  2DSY A;  3JU0 A;  1Z1B A;  2EMA A;  2M9A A;  4X66 E;  1X5W A;  2EOE A;  2WZO A;  2IHR 1;  1A1L A;  2LO3 A;  4WYQ B;  2WCC 3;  2VQE E;  2YTF A;  3DF6 A;  2EN4 A;  2EL6 A;  1X3C A;  1F2I G;  1HNW E;  3HPS A;  2ELY A;  2YTG A;  3EPK A;  1QNT A;  2UXB E;  1B69 A;  5BR8 E;  1DI2 A;  1YPN A;  1XNQ E;  1YYW A;  2NAB A;  2ODR D;  5AE1 A;  1ZAA C;  4F6N A;  2NUF A;  4OX9 E;  2WBT A;  1A1I A;  2EM3 A;  2EPU A;  2YTJ A;  4R2Q A;  2LJH A;  4WXC A;  3EPH A;  2L3C A;  2RQL A;  3MHH C;  2B7T A;  4Q35 B;  4DR2 E;  4O43 A;  4WXD A;  2EQ3 A;  1EH6 A;  5DNY A;  2EMX A;  2V87 A;  4DV3 E;  1T4L B;  2YU5 A;  2CTD A;  1A1K A;  2EM0 A;  2EJ4 A;  5FLX C;  2EMB A;  5A6B D;  1XMQ E;  3MHS C;  2FV4 B;  2EMH A;  2LMZ A;  4FK5 C;  3TQM A;  4LF9 E;  2RTX A;  2LTS A;  1NEI A;  2UU9 E;  1HNZ E;  2YRH A;  3BID A;  3THN A;  2MDG A;  1T4O A;  1YSA C;  2MKD A;  4BCA A;  3J80 C;  1I94 E;  4DV2 E;  3JTZ A;  4K0K E;  1TF6 A;  3ZOQ B;  2FTX B;  1A1J A;  3KZZ A;  3KWR A;  3M99 B;  2CPN A;  2DGC A;  2M1S A;  2BB8 A;  1ZBT A;  4NXM E;  5KL3 A;  2DLQ A;  2NUG A;  2EN7 A;  2JPA A;  1IBL E;  4DR6 E;  2D9H A;  2B9D A;  5ADZ A;  2EM4 A;  4R8O A;  1SFE A;  4L8N A;  2YZT A;  1T38 A;  4LTY A;  2HJJ A;  4LF8 E;  2EMY A;  1WJP A;  2V85 A;  4OOG C;  3VK6 A;  2I13 A;  1WXR A;  2EPO A;  4O5G A;  3IWB A;  4F2J C;  4LF6 E;  1UHZ A;  4N4R B;  3HTX A;  2EMW A;  1X47 A;  2DIX A;  4MLQ A;  4M30 A;  4WSP A;  3UK3 C;  1A1G A;  2JVA A;  4LF7 E;  5KL7 A;  4AQY E;  2F8B A;  4JI6 E;  4RH8 A;  2L33 A;  4KHP E;  4JI1 E;  3LML A;  2RS6 A;  2EMZ A;  5LLQ A;  2M4I A;  4WX9 A;  5A6A A;  1XMO E;  2FGG A;  4LU9 A;  2EPP A;  3KZY A;  4B3T E;  4DV5 E;  4X62 E;  2YTO A;  2EM9 A;  2H36 X;  3J81 C;  1N36 E;  4O4K A;  1PDA A;  4R2S A;  2EOX A;  1J26 A;  2EPK X;  2EMI A;  2YSO A;  4DUY E;  2V89 A;  4B3M E;  2EN2 A;  3EPJ A;  5LMU E;  4DR5 E;  2I9I A;  4DUZ E;  1UN6 B;  2EPM X;  1JK1 A;  5LL6 R;  2EPL X;  2EM7 A;  2EPX A;  4F9B B;  2L3J A;  2K7I A;  5AC5 A;  1UIL A;  4DV0 E;  4DV4 E;  1G2D C;  2EOY A;  2KOU A;  4RHB B;  4IS1 C;  4JI4 E;  3C4T A;  3FIG A;  2LBS B;  3IWC A;  2MDR A;  4J8Z A;  5AE2 A;  4JYA E;  3F6G A;  4M0V A;  2L92 A;  1T39 A;  4F54 A;  3IWD A;  1RQ0 A;  2JY9 A;  1IQS A;  2NUE A;  2DLK A;  4YHH E;  1TN9 A;  2YTN A;  3C6K A;  1BB8 A;  2EM6 A;  2KHX A;  4ZYH A;  2EN6 A;  4R2C A;  2LUP B;  4NHR A;  1MGT A;  1QU6 A;  5KL6 A;  2YPN A;  1X6E A;  2ELZ A;  4DMI A;  3EPL A;  2R76 A;  4MLV A;  1X49 A;  1MEY C;  2ENA A;  2EQ1 A;  4WSG A;  1YZ9 A;  4BMJ A;  4BHB A;  2MKN A;  4LFA E;  1DQ3 A;  2YU8 A;  5A69 A;  2UXC E;  2E1M A;  1J5E E;  1EKZ A;  1GTK A;  2N3H A;  2EN3 A;  4ZYE A;  4TUI A;  4JI8 E;  2LRS A;  2R1F A;  3OML A;  2ZM6 E;  2E72 A;  5IV8 B;  1STU A;  2V83 A;  2JR1 A;  2Q8U A;  3C6M A;  3J7Y p;  2EOJ A;  2EOZ A;  1ZBQ A;  4R2E A;  1RC7 A;  2YTI A;  1YUJ A;  4B3R E;  3AV0 A;  4DV7 E;  1T4N A;  2YTD A;  2VE7 C;  5KL5 A;  2GLI A;  4GZN C;  5A6J A;  1IBK E;  1A1F A;  4JI0 E;  2DMI A;  1LLM C;  4BC9 A;  5A2Q C;  3ECR A;  2CT1 A;  3T1Y E;  2CSH A;  2ADR A;  5A6K A;  2YSP A;  3VYY A;  2DB2 A;  4Q28 A;  4M2Z A;  2EPN A;  2ENH A;  3C4B A;  1AH5 A;  2EWL A;  4JI5 E;  3ADL A;  2N3G A;  4B3S E;  2EOH A;  4NZV A;  2EN1 A;  1WHN A;  1X48 A;  1ZU1 A;  4WPY A;  2LUQ A;  4F9C B;  4WFT A;  1JK2 A;  1EH7 A;  1L4S A;  2KON A;  3HQ1 A;  1HNX E;  1N33 E;  1X6F A;  4YY3 E;  3EQ1 A;  1N3G A;  2J7J A;  2B3T B;  4P7D A;  2L2N A;  2EOF A;  3QG5 C;  1X6H A;  2EMC A;  4JI7 E;  1EH8 A;  2JOX A;  4R2R A;  1GZ6 A;  2YTQ A;  2EE8 A;  3F6H A;  4X8W A;  2M7Q A;  4TUG A;  4LFB E;  1KJK A;  4X65 E;  2WBS A;  3BGH A;  1O0W A;  2ODR C;  4DR7 E;  2EOO A;  3HPZ A; 
#chains in the Genus database with same CATH homology
 2YTN A;  1A1J A;  1BB8 A;  2EM6 A;  2EPR A;  2EN6 A;  3M99 B;  2EL4 A;  4R2C A;  2DGC A;  2EMF A;  2EPA A;  2EMG A;  5KL6 A;  2EM2 A;  2WBU A;  1X6E A;  2BB8 A;  2ELZ A;  3EPL A;  4R2P A;  2VRD A;  2EOQ A;  1A1H A;  5KL3 A;  2DLQ A;  2EP3 A;  1MEY C;  2EL5 A;  2ENA A;  2EN7 A;  2EQ1 A;  2JPA A;  4WSG A;  2YTP A;  2EOM A;  2RPC A;  2MKN A;  2D9H A;  2EMK A;  1NCS A;  1UBD C;  2YRM A;  2YU8 A;  2EM4 A;  1P47 A;  2YTE A;  2EN3 A;  2RSI A;  2LVH A;  1AAY A;  1BBO A;  2EOR A;  5KL4 A;  2LV2 A;  2EMY A;  1WJP A;  2R1F A;  1TF3 A;  2EM8 A;  2EOI A;  4M9V C;  2E72 A;  1RMD A;  2EMA A;  5KL2 A;  1Z1B A;  2I13 A;  2EOS A;  2M9A A;  1X5W A;  2EOE A;  2EOJ A;  2EOZ A;  1A1L A;  4R2E A;  2LO3 A;  2WCC 3;  4F2J C;  2YTI A;  2EN8 A;  1YUJ A;  2EMW A;  2YTF A;  3VHT B;  2EN4 A;  2EL6 A;  3UK3 C;  2YTD A;  2LCE A;  2A25 A;  2EPC A;  1X3C A;  1F2I G;  2GLI A;  5KL5 A;  1A1G A;  2ELY A;  2YTG A;  3EPK A;  5KL7 A;  4GZN C;  4X9J A;  2EM5 A;  1B69 A;  1A1F A;  2DMI A;  1LLM C;  2ENC A;  2NAB A;  2CT1 A;  2EMZ A;  1ZAA C;  2CSH A;  4F6N A;  2ADR A;  2YSP A;  2EPP A;  2JP9 A;  2ENH A;  2WBT A;  2YTO A;  2EML A;  2EM9 A;  4R2D A;  1A1I A;  2EM3 A;  2EPU A;  2YTJ A;  4R2Q A;  3EPH A;  3MHH C;  2EOH A;  4F6M A;  2EN1 A;  2EOX A;  4R2S A;  1ZU1 A;  2EQ3 A;  1JK2 A;  2EMX A;  2EMI A;  4IJD A;  2YU5 A;  2YSO A;  2CTD A;  1A1K A;  1X6F A;  2YRK A;  2EN2 A;  2EM0 A;  2EJ4 A;  2J7J A;  3EPJ A;  1UN6 B;  2EMB A;  1JK1 A;  2EOF A;  3MHS C;  2EM7 A;  2EQ0 A;  2EPX A;  4R2A A;  1ZR9 A;  2EMH A;  1DGC A;  1X6H A;  2EMC A;  4FK5 C;  2DRP A;  1G2D C;  2EOY A;  4IS1 C;  4R2R A;  2YTQ A;  2EE8 A;  2YRH A;  2HGH A;  2MDG A;  1YSA C;  2MKD A;  1KJK A;  2PRT A;  2WBS A;  1YUI A;  2LT7 A;  1TF6 A;  2EPZ A;  2DLK A;  2EOO A;  1G2F C;  2GHF A;  1TN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...