2EQ3A

Solution structure of the 17th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECNQCGKAFSVRSSLTTHQAIHTGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 347
publication title Solution structure of the 17th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq3A01
1ZR9A 4WSGA 1A1KA 2PRTA 4F6NA 1A1LA 5KL5A 1UN6B 1X6EA 2GHFA 2EJ4A 2E72A 4FK5C 2EOJA 4R2CA 2EQ3A 2RPCA 2EL4A 2EN4A 1TF6A 4F6MA 2BB8A 2LVHA 1WJPA 1YUIA 2EMYA 2RSIA 2YTIA 2J7JA 2DRPA 3EPLA 2EM0A 2CSHA 2JPAA 2DMIA 2EORA 2YTEA 2EPXA 2DGCA 2YRMA 2M9AA 2EMCA 2EOYA 2EN6A 1A1IA 2EQ1A 2YU8A 5KL6A 4IS1C 2EOIA 2EPCA 2D9HA 1X5WA 1JK2A 2ELZA 2WBTA 1BB8A 2LO3A 2NABA 2EOZA 1A1JA 1NCSA 2EM5A 4R2RA 2HGHA 2I13A 1RMDA 5KL7A 1MEYC 2R1FA 4GZNC 1YSAC 2LCEA 2YRHA 3M99B 4F2JC 2A25A 2EM4A 2EOQA 1A1GA 1ZAAC 2GLIA 2WBUA 2CT1A 2YTDA 4R2PA 2EMGA 2ENAA 2MKDA 2ELYA 2YTGA 2EN8A 1P47A 2EMWA 2ENHA 3EPKA 2EMZA 2EN7A 2EM8A 3UK3C 2YTFA 2EPRA 1X6FA 2EOSA 1G2DC 1UBDC 2EMIA 1G2FC 1A1FA 2MKNA 4M9VC 4R2DA 3EPHA 2EMLA 2EN2A 2EN1A 1KJKA 2EMAA 2EM7A 2YTQA 2EM6A 2WCC3 3EPJA 5KL2A 1B69A 2YRKA 1DGCA 2EOXA 4X9JA 2VRDA 4R2EA 2EN3A 2EMKA 1LLMC 1TN9A 3VHTB 1TF3A 2EPZA 2ADRA 2YSPA 4R2SA 2MDGA 2YTOA 2EPPA 2EM9A 1BBOA 1ZU1A 5KL4A 2EOOA 4R2AA 1A1HA 1JK1A 2DLKA 2EP3A 2EM3A 2JP9A 4R2QA 2DLQA 2EOHA 2YTJA 1AAYA 3MHSC 1YUJA 2EL6A 5KL3A 2LT7A 2EPUA 2EM2A 2EMXA 2EQ0A 2YTPA 1F2IG 2YU5A 2CTDA 1Z1BA 2EOFA 2LV2A 2ENCA 2EL5A 2WBSA 2EMHA 1X6HA 2EPAA 1X3CA 2EOEA 2EMFA 2EOMA 2EE8A 2YSOA 3MHHC 2YTNA 2EMBA 4IJDA
chains in the Genus database with same CATH superfamily
1ZR9A 3IWBA 5LLQA 4MLVA 4BMJA 1MGTA 2EQ3A 1IBLE 2RPCA 2EN4A 2M1SA 2L2KB 3RMPA 1TF6A 2MC6A 2EZ6A 2RSIA 1HNXE 3EPLA 3IWCA 4L8NA 1I94E 2DMIA 2YTEA 2KOUA 2L3CA 4JV5E 2JOBA 2EQ1A 3KWRA 2EOIA 2D9HA 1XMOE 1X5WA 2Q8UA 4F9AB 1BB8A 2NABA 5CFFE 3JTZA 4JI2E 4R2RA 1RMDA 3ADLA 3AUZA 1GTKA 3J7Yp 2LCEA 4P7DA 4WX9A 2V89A 2EOQA 1ZAAC 2GLIA 2WZOA 2ELYA 2YTGA 1J26A 2EMWA 2JYAA 3QG5C 2ENHA 4KHPE 1SR9A 2LJHA 4LF8E 1A1FA 4DUZE 2EMLA 1N33E 2EN2A 4LFAE 5AE3A 4R03A 2V87A 3LMLA 1B69A 2YRKA 4BC9A 1YYOA 1DGCA 2EOXA 2EWLA 4R2EA 5A6AA 2EN3A 1YYKA 5LL6R 5A6JA 1LLMC 4J8ZA 2ADRA 2MDGA 2EPPA 3C6MA 4P78A 1JK1A 2LE2A 2LBSB 2DLQA 1AAYA 2NUFA 3KZZA 1YUJA 2EPMX 1DQ3A 5KL3A 2UXDE 2EM2A 2EMXA 1EH6A 1F2IG 2LJUA 2ENCA 2V88A 4B3RE 2V8QB 2L3JA 4NXNE 2EOMA 1NEIA 2HGHA 1RQ0A 4M0VA 2JVAA 4F6NA 1GZ6A 1X6EA 2EJ4A 2E72A 3JU0A 4DV5E 4DV6E 2EL4A 2JR1A 2L2NA 2BB8A 2LVHA 2IHR1 1WJPA 2L2MA 2N3HA 4YHHE 3P1XA 5A2QC 2J7JA 2DB2A 4JI5E 2JWOA 2F4VE 2LUPB 2JPAA 5F3WA 2EPXA 4B3SE 4Q35B 2EOYA 2EN6A 4NHRA 3ADJA 2YU8A 2BBGA 1T38A 2WBTA 2LO3A 5AC5A 1A1JA 4DR6E 1NCSA 2EM5A 4O43A 4X66E 1MEYC 1N32E 1IQOA 4LF4E 2B3TB 2N3GA 5LMNE 3M99B 1A1GA 4F2JC 1BBGA 4WFTA 2YTDA 4R2PA 1HNZE 1QNTA 4LF5E 4BS9A 3IWDA 5BR8E 2L6MA 2LRSA 2UU9E 2EMZA 2EN7A 2YTFA 2ODRC 2UUAE 4DMIA 1G2DC 2EOSA 1UBDC 2FV4B 4DV2E 3HPZA 3EPHA 1N3GA 5A6BD 2LMZA 3J7AG 3J81C 2EN1A 5TSEA 2RQLA 4JI1E 4R8OA 2EMAA 2YTQA 5ADZA 3VYYA 5KL2A 4L5NC 2VQFE 1T4LB 1IMUA 2RTXA 1YFHA 1N34E 3BGHA 3K6QA 4JI4E 4LF6E 1TN9A 4DR4E 3VHTB 4YY3E 2YSPA 3DJWA 4DUYE 2YTOA 2EM9A 1ZU1A 4Q28A 5KL4A 2EOOA 4R2AA 1WRJA 2HC5A 1A1HA 4M30A 2EP3A 2V83A 2EM3A 2HJJA 5A6BA 2B9DA 4F9CB 5A6KA 2EPUA 2EQ0A 3F6GA 1DI2A 2YU5A 4ZYEA 2EOFA 2VF1A 3OTOE 4GKKE 4K0KE 2L33A 2YT4A 1YZ9A 1KYQA 5FLXC 2EPAA 3ADGA 1PJQA 4LFCE 3C4BA 4DV0E 2DMYA 3HTXA 4DV7E 2JOXA 2EMBA 5IT9C 2M4IA 4WSGA 4X64E 4BHCA 2PRTA 1A1LA 5KL5A 1UN6B 2NUEA 2GPIA 2GHFA 4LF9E 4M2ZA 3T1HE 2UUCE 4I8OA 2B7TA 2L8TA 1HNWE 4F6MA 4WPYA 3HXLA 1IBME 4X8WA 1YUIA 3EQ1A 1XNQE 5T6JA 2MC5A 3HQ1A 2EPKX 1ZBTA 4WXDA 2G7HA 4LTYA 2CSHA 1SFEA 1IBKE 2EORA 2YRMA 1ZBQA 2LTSA 2M9AA 2EMCA 4TUIA 4JI7E 4BC7A 5AE2A 4IS1C 2EPCA 1JK2A 2V86A 5DNYA 2EOZA 4OOGC 2KONA 4LF7E 3BBGA 4JI3E 4BBYA 2YPNA 5AE1A 2NUGA 1IQSA 2YZTA 2YRHA 2A25A 2EM4A 3LLHA 4JYAE 2UXBE 1STUA 2JXPA 2CT1A 1FJGE 2EMGA 2MKDA 1P47A 4GKJE 2MDRA 2EM8A 3ECRA 4R2DA 4JI6E 3TQMA 2F8BA 1X47A 2WCC3 2EM7A 1RC7A 2EM6A 4JI0E 3THNA 4O5GA 4GEQB 3ADIA 4BHBA 4DV3E 1J5EE 2NA2A 2VRDA 3L00A 3VK6A 2EMKA 2K7IA 2RS7A 4O4KA 2RS6A 2B7VA 4R2SA 2RSMA 1XMQE 2ODRD 2UXCE 1BBOA 4O24A 3HPSA 4ZYGA 1QU6A 2DLKA 2VE7C 2JP9A 4R2QA 3MHSC 2CPNA 2EL6A 2DSYA 4NXME 2YTPA 4F9BB 1T4NA 2CTDA 4KZSA 2LV2A 1Z1BA 3VYXA 4WYQB 4MLQA 2WBSA 2EMHA 4BCAA 1X3CA 1UILA 1X49A 2EMFA 2ZM6E 4LFBE 3DF6A 2K4VA 2YSOA 2YTNA 3MHHC 4X62E 4TUGA 4IJDA 4LU9A 4DR3E 4AQYE 3C6KA 1A1KA 3F6HA 2V85A 2YWQA 4DV4E 2JY9A 1PKPA 1YPNA 5A69A 2I9IA 4FK5C 2EOJA 3THOB 4R2CA 1PJSA 3C4TA 2E1MA 2EPLX 3J80C 2EMYA 2YTIA 2DRPA 2EM0A 4F54A 1XNRE 2FTXB 4DR1E 4HTGA 4RHBB 4HEIA 1EH7A 4OX9E 2DGCA 4DR2E 1WXRA 3FIGA 1A1IA 5KL6A 1T39A 4DR7E 2ELZA 3KZYA 2N8XA 4JI8E 2I13A 2R76A 5KL7A 4B3ME 2R1FA 4DV1E 4GZNC 3BF2A 1YSAC 1L4SA 1PJTA 4ZYDA 2WBUA 2ENAA 2EN8A 1PDAA 4RH8A 4X65E 1N36E 3EPKA 4KWYA 2EPNA 2M7QA 3UK3C 2EPRA 5LMUE 5AC4A 1X6FA 2EMIA 4DKKA 1G2FC 2MKNA 1GQEA 4M9VC 1EH8A 1HR0E 4NZVA 4WSPA 1KJKA 3AV0A 3EPJA 3MSWA 2UUBE 4X9JA 2HHHE 4DR5E 2L92A 3H09A 1EKZA 1AH5A 1TF3A 2EPZA 5IXMB 2LUQA 5IWAE 1WHNA 1X48A 1YYWA 4B3TE 3BIDA 2LTRA 2EOHA 2YTJA 3JAMC 2DIXA 1WHQA 2LT7A 4N4RB 2VQEE 1O0WA 2EL5A 2EPOA 1UHZA 3OMLA 2H36X 4WXCA 5AASA 1T4OA 1X6HA 5IV8B 2EOEA 2FGGA 1FKAE 3ZOQB 2EE8A 3T1YE 4ZYHA 2E5LE 2KHXA
chains in the Genus database with same CATH topology
1ZR9A 4WSGA 1A1KA 2PRTA 4F6NA 1A1LA 5KL5A 1UN6B 1X6EA 2GHFA 2EJ4A 2E72A 4FK5C 2EOJA 4R2CA 2EQ3A 2RPCA 2EL4A 2EN4A 1TF6A 4F6MA 2BB8A 2LVHA 1WJPA 1YUIA 2EMYA 2RSIA 2YTIA 2J7JA 2DRPA 3EPLA 2EM0A 2CSHA 2JPAA 2DMIA 2EORA 2YTEA 2EPXA 2DGCA 2YRMA 2M9AA 2EMCA 2EOYA 2EN6A 1A1IA 2EQ1A 2YU8A 5KL6A 4IS1C 2EOIA 2EPCA 2D9HA 1X5WA 1JK2A 2ELZA 2WBTA 1BB8A 2LO3A 2NABA 2EOZA 1A1JA 1NCSA 2EM5A 4R2RA 2HGHA 2I13A 1RMDA 5KL7A 1MEYC 2R1FA 4GZNC 1YSAC 2LCEA 2YRHA 3M99B 4F2JC 2A25A 2EM4A 2EOQA 1A1GA 1ZAAC 2GLIA 2WBUA 2CT1A 2YTDA 4R2PA 2EMGA 2ENAA 2MKDA 2ELYA 2YTGA 2EN8A 1P47A 2EMWA 2ENHA 3EPKA 2EMZA 2EN7A 2EM8A 3UK3C 2YTFA 2EPRA 1X6FA 2EOSA 1G2DC 1UBDC 2EMIA 1G2FC 1A1FA 2MKNA 4M9VC 4R2DA 3EPHA 2EMLA 2EN2A 2EN1A 1KJKA 2EMAA 2EM7A 2YTQA 2EM6A 2WCC3 3EPJA 5KL2A 1B69A 2YRKA 1DGCA 2EOXA 4X9JA 2VRDA 4R2EA 2EN3A 2EMKA 1LLMC 1TN9A 3VHTB 1TF3A 2EPZA 2ADRA 2YSPA 4R2SA 2MDGA 2YTOA 2EPPA 2EM9A 1BBOA 1ZU1A 5KL4A 2EOOA 4R2AA 1A1HA 1JK1A 2DLKA 2EP3A 2EM3A 2JP9A 4R2QA 2DLQA 2EOHA 2YTJA 1AAYA 3MHSC 1YUJA 2EL6A 5KL3A 2LT7A 2EPUA 2EM2A 2EMXA 2EQ0A 2YTPA 1F2IG 2YU5A 2CTDA 1Z1BA 2EOFA 2LV2A 2ENCA 2EL5A 2WBSA 2EMHA 1X6HA 2EPAA 1X3CA 2EOEA 2EMFA 2EOMA 2EE8A 2YSOA 3MHHC 2YTNA 2EMBA 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR9 A;  4WSG A;  1A1K A;  2PRT A;  4F6N A;  1A1L A;  5KL5 A;  1UN6 B;  1X6E A;  2GHF A;  2EJ4 A;  2E72 A;  4FK5 C;  2EOJ A;  4R2C A;  2EQ3 A;  2RPC A;  2EL4 A;  2EN4 A;  1TF6 A;  4F6M A;  2BB8 A;  2LVH A;  1WJP A;  1YUI A;  2EMY A;  2RSI A;  2YTI A;  2J7J A;  2DRP A;  3EPL A;  2EM0 A;  2CSH A;  2JPA A;  2DMI A;  2EOR A;  2YTE A;  2EPX A;  2DGC A;  2YRM A;  2M9A A;  2EMC A;  2EOY A;  2EN6 A;  1A1I A;  2EQ1 A;  2YU8 A;  5KL6 A;  4IS1 C;  2EOI A;  2EPC A;  2D9H A;  1X5W A;  1JK2 A;  2ELZ A;  2WBT A;  1BB8 A;  2LO3 A;  2NAB A;  2EOZ A;  1A1J A;  1NCS A;  2EM5 A;  4R2R A;  2HGH A;  2I13 A;  1RMD A;  5KL7 A;  1MEY C;  2R1F A;  4GZN C;  1YSA C;  2LCE A;  2YRH A;  3M99 B;  4F2J C;  2A25 A;  2EM4 A;  2EOQ A;  1A1G A;  1ZAA C;  2GLI A;  2WBU A;  2CT1 A;  2YTD A;  4R2P A;  2EMG A;  2ENA A;  2MKD A;  2ELY A;  2YTG A;  2EN8 A;  1P47 A;  2EMW A;  2ENH A;  3EPK A;  2EMZ A;  2EN7 A;  2EM8 A;  3UK3 C;  2YTF A;  2EPR A;  1X6F A;  2EOS A;  1G2D C;  1UBD C;  2EMI A;  1G2F C;  1A1F A;  2MKN A;  4M9V C;  4R2D A;  3EPH A;  2EML A;  2EN2 A;  2EN1 A;  1KJK A;  2EMA A;  2EM7 A;  2YTQ A;  2EM6 A;  2WCC 3;  3EPJ A;  5KL2 A;  1B69 A;  2YRK A;  1DGC A;  2EOX A;  4X9J A;  2VRD A;  4R2E A;  2EN3 A;  2EMK A;  1LLM C;  1TN9 A;  3VHT B;  1TF3 A;  2EPZ A;  2ADR A;  2YSP A;  4R2S A;  2MDG A;  2YTO A;  2EPP A;  2EM9 A;  1BBO A;  1ZU1 A;  5KL4 A;  2EOO A;  4R2A A;  1A1H A;  1JK1 A;  2DLK A;  2EP3 A;  2EM3 A;  2JP9 A;  4R2Q A;  2DLQ A;  2EOH A;  2YTJ A;  1AAY A;  3MHS C;  1YUJ A;  2EL6 A;  5KL3 A;  2LT7 A;  2EPU A;  2EM2 A;  2EMX A;  2EQ0 A;  2YTP A;  1F2I G;  2YU5 A;  2CTD A;  1Z1B A;  2EOF A;  2LV2 A;  2ENC A;  2EL5 A;  2WBS A;  2EMH A;  1X6H A;  2EPA A;  1X3C A;  2EOE A;  2EMF A;  2EOM A;  2EE8 A;  2YSO A;  3MHH C;  2YTN A;  2EMB A;  4IJD A; 
#chains in the Genus database with same CATH topology
 1ZR9 A;  3IWB A;  5LLQ A;  4MLV A;  4BMJ A;  1MGT A;  2EQ3 A;  1IBL E;  2RPC A;  2EN4 A;  2M1S A;  2L2K B;  3RMP A;  1TF6 A;  2MC6 A;  2EZ6 A;  2RSI A;  1HNX E;  3EPL A;  3IWC A;  4L8N A;  1I94 E;  2DMI A;  2YTE A;  2KOU A;  2L3C A;  4JV5 E;  2JOB A;  2EQ1 A;  3KWR A;  2EOI A;  2D9H A;  1XMO E;  1X5W A;  2Q8U A;  4F9A B;  1BB8 A;  2NAB A;  5CFF E;  3JTZ A;  4JI2 E;  4R2R A;  1RMD A;  3ADL A;  3AUZ A;  1GTK A;  3J7Y p;  2LCE A;  4P7D A;  4WX9 A;  2V89 A;  2EOQ A;  1ZAA C;  2GLI A;  2WZO A;  2ELY A;  2YTG A;  1J26 A;  2EMW A;  2JYA A;  3QG5 C;  2ENH A;  4KHP E;  1SR9 A;  2LJH A;  4LF8 E;  1A1F A;  4DUZ E;  2EML A;  1N33 E;  2EN2 A;  4LFA E;  5AE3 A;  4R03 A;  2V87 A;  3LML A;  1B69 A;  2YRK A;  4BC9 A;  1YYO A;  1DGC A;  2EOX A;  2EWL A;  4R2E A;  5A6A A;  2EN3 A;  1YYK A;  5LL6 R;  5A6J A;  1LLM C;  4J8Z A;  2ADR A;  2MDG A;  2EPP A;  3C6M A;  4P78 A;  1JK1 A;  2LE2 A;  2LBS B;  2DLQ A;  1AAY A;  2NUF A;  3KZZ A;  1YUJ A;  2EPM X;  1DQ3 A;  5KL3 A;  2UXD E;  2EM2 A;  2EMX A;  1EH6 A;  1F2I G;  2LJU A;  2ENC A;  2V88 A;  4B3R E;  2V8Q B;  2L3J A;  4NXN E;  2EOM A;  1NEI A;  2HGH A;  1RQ0 A;  4M0V A;  2JVA A;  4F6N A;  1GZ6 A;  1X6E A;  2EJ4 A;  2E72 A;  3JU0 A;  4DV5 E;  4DV6 E;  2EL4 A;  2JR1 A;  2L2N A;  2BB8 A;  2LVH A;  2IHR 1;  1WJP A;  2L2M A;  2N3H A;  4YHH E;  3P1X A;  5A2Q C;  2J7J A;  2DB2 A;  4JI5 E;  2JWO A;  2F4V E;  2LUP B;  2JPA A;  5F3W A;  2EPX A;  4B3S E;  4Q35 B;  2EOY A;  2EN6 A;  4NHR A;  3ADJ A;  2YU8 A;  2BBG A;  1T38 A;  2WBT A;  2LO3 A;  5AC5 A;  1A1J A;  4DR6 E;  1NCS A;  2EM5 A;  4O43 A;  4X66 E;  1MEY C;  1N32 E;  1IQO A;  4LF4 E;  2B3T B;  2N3G A;  5LMN E;  3M99 B;  1A1G A;  4F2J C;  1BBG A;  4WFT A;  2YTD A;  4R2P A;  1HNZ E;  1QNT A;  4LF5 E;  4BS9 A;  3IWD A;  5BR8 E;  2L6M A;  2LRS A;  2UU9 E;  2EMZ A;  2EN7 A;  2YTF A;  2ODR C;  2UUA E;  4DMI A;  1G2D C;  2EOS A;  1UBD C;  2FV4 B;  4DV2 E;  3HPZ A;  3EPH A;  1N3G A;  5A6B D;  2LMZ A;  3J7A G;  3J81 C;  2EN1 A;  5TSE A;  2RQL A;  4JI1 E;  4R8O A;  2EMA A;  2YTQ A;  5ADZ A;  3VYY A;  5KL2 A;  4L5N C;  2VQF E;  1T4L B;  1IMU A;  2RTX A;  1YFH A;  1N34 E;  3BGH A;  3K6Q A;  4JI4 E;  4LF6 E;  1TN9 A;  4DR4 E;  3VHT B;  4YY3 E;  2YSP A;  3DJW A;  4DUY E;  2YTO A;  2EM9 A;  1ZU1 A;  4Q28 A;  5KL4 A;  2EOO A;  4R2A A;  1WRJ A;  2HC5 A;  1A1H A;  4M30 A;  2EP3 A;  2V83 A;  2EM3 A;  2HJJ A;  5A6B A;  2B9D A;  4F9C B;  5A6K A;  2EPU A;  2EQ0 A;  3F6G A;  1DI2 A;  2YU5 A;  4ZYE A;  2EOF A;  2VF1 A;  3OTO E;  4GKK E;  4K0K E;  2L33 A;  2YT4 A;  1YZ9 A;  1KYQ A;  5FLX C;  2EPA A;  3ADG A;  1PJQ A;  4LFC E;  3C4B A;  4DV0 E;  2DMY A;  3HTX A;  4DV7 E;  2JOX A;  2EMB A;  5IT9 C;  2M4I A;  4WSG A;  4X64 E;  4BHC A;  2PRT A;  1A1L A;  5KL5 A;  1UN6 B;  2NUE A;  2GPI A;  2GHF A;  4LF9 E;  4M2Z A;  3T1H E;  2UUC E;  4I8O A;  2B7T A;  2L8T A;  1HNW E;  4F6M A;  4WPY A;  3HXL A;  1IBM E;  4X8W A;  1YUI A;  3EQ1 A;  1XNQ E;  5T6J A;  2MC5 A;  3HQ1 A;  2EPK X;  1ZBT A;  4WXD A;  2G7H A;  4LTY A;  2CSH A;  1SFE A;  1IBK E;  2EOR A;  2YRM A;  1ZBQ A;  2LTS A;  2M9A A;  2EMC A;  4TUI A;  4JI7 E;  4BC7 A;  5AE2 A;  4IS1 C;  2EPC A;  1JK2 A;  2V86 A;  5DNY A;  2EOZ A;  4OOG C;  2KON A;  4LF7 E;  3BBG A;  4JI3 E;  4BBY A;  2YPN A;  5AE1 A;  2NUG A;  1IQS A;  2YZT A;  2YRH A;  2A25 A;  2EM4 A;  3LLH A;  4JYA E;  2UXB E;  1STU A;  2JXP A;  2CT1 A;  1FJG E;  2EMG A;  2MKD A;  1P47 A;  4GKJ E;  2MDR A;  2EM8 A;  3ECR A;  4R2D A;  4JI6 E;  3TQM A;  2F8B A;  1X47 A;  2WCC 3;  2EM7 A;  1RC7 A;  2EM6 A;  4JI0 E;  3THN A;  4O5G A;  4GEQ B;  3ADI A;  4BHB A;  4DV3 E;  1J5E E;  2NA2 A;  2VRD A;  3L00 A;  3VK6 A;  2EMK A;  2K7I A;  2RS7 A;  4O4K A;  2RS6 A;  2B7V A;  4R2S A;  2RSM A;  1XMQ E;  2ODR D;  2UXC E;  1BBO A;  4O24 A;  3HPS A;  4ZYG A;  1QU6 A;  2DLK A;  2VE7 C;  2JP9 A;  4R2Q A;  3MHS C;  2CPN A;  2EL6 A;  2DSY A;  4NXM E;  2YTP A;  4F9B B;  1T4N A;  2CTD A;  4KZS A;  2LV2 A;  1Z1B A;  3VYX A;  4WYQ B;  4MLQ A;  2WBS A;  2EMH A;  4BCA A;  1X3C A;  1UIL A;  1X49 A;  2EMF A;  2ZM6 E;  4LFB E;  3DF6 A;  2K4V A;  2YSO A;  2YTN A;  3MHH C;  4X62 E;  4TUG A;  4IJD A;  4LU9 A;  4DR3 E;  4AQY E;  3C6K A;  1A1K A;  3F6H A;  2V85 A;  2YWQ A;  4DV4 E;  2JY9 A;  1PKP A;  1YPN A;  5A69 A;  2I9I A;  4FK5 C;  2EOJ A;  3THO B;  4R2C A;  1PJS A;  3C4T A;  2E1M A;  2EPL X;  3J80 C;  2EMY A;  2YTI A;  2DRP A;  2EM0 A;  4F54 A;  1XNR E;  2FTX B;  4DR1 E;  4HTG A;  4RHB B;  4HEI A;  1EH7 A;  4OX9 E;  2DGC A;  4DR2 E;  1WXR A;  3FIG A;  1A1I A;  5KL6 A;  1T39 A;  4DR7 E;  2ELZ A;  3KZY A;  2N8X A;  4JI8 E;  2I13 A;  2R76 A;  5KL7 A;  4B3M E;  2R1F A;  4DV1 E;  4GZN C;  3BF2 A;  1YSA C;  1L4S A;  1PJT A;  4ZYD A;  2WBU A;  2ENA A;  2EN8 A;  1PDA A;  4RH8 A;  4X65 E;  1N36 E;  3EPK A;  4KWY A;  2EPN A;  2M7Q A;  3UK3 C;  2EPR A;  5LMU E;  5AC4 A;  1X6F A;  2EMI A;  4DKK A;  1G2F C;  2MKN A;  1GQE A;  4M9V C;  1EH8 A;  1HR0 E;  4NZV A;  4WSP A;  1KJK A;  3AV0 A;  3EPJ A;  3MSW A;  2UUB E;  4X9J A;  2HHH E;  4DR5 E;  2L92 A;  3H09 A;  1EKZ A;  1AH5 A;  1TF3 A;  2EPZ A;  5IXM B;  2LUQ A;  5IWA E;  1WHN A;  1X48 A;  1YYW A;  4B3T E;  3BID A;  2LTR A;  2EOH A;  2YTJ A;  3JAM C;  2DIX A;  1WHQ A;  2LT7 A;  4N4R B;  2VQE E;  1O0W A;  2EL5 A;  2EPO A;  1UHZ A;  3OML A;  2H36 X;  4WXC A;  5AAS A;  1T4O A;  1X6H A;  5IV8 B;  2EOE A;  2FGG A;  1FKA E;  3ZOQ B;  2EE8 A;  3T1Y E;  4ZYH A;  2E5L E;  2KHX A; 
#chains in the Genus database with same CATH homology
 1ZR9 A;  4WSG A;  1A1K A;  2PRT A;  4F6N A;  1A1L A;  5KL5 A;  1UN6 B;  1X6E A;  2GHF A;  2EJ4 A;  2E72 A;  4FK5 C;  2EOJ A;  4R2C A;  2EQ3 A;  2RPC A;  2EL4 A;  2EN4 A;  1TF6 A;  4F6M A;  2BB8 A;  2LVH A;  1WJP A;  1YUI A;  2EMY A;  2RSI A;  2YTI A;  2J7J A;  2DRP A;  3EPL A;  2EM0 A;  2CSH A;  2JPA A;  2DMI A;  2EOR A;  2YTE A;  2EPX A;  2DGC A;  2YRM A;  2M9A A;  2EMC A;  2EOY A;  2EN6 A;  1A1I A;  2EQ1 A;  2YU8 A;  5KL6 A;  4IS1 C;  2EOI A;  2EPC A;  2D9H A;  1X5W A;  1JK2 A;  2ELZ A;  2WBT A;  1BB8 A;  2LO3 A;  2NAB A;  2EOZ A;  1A1J A;  1NCS A;  2EM5 A;  4R2R A;  2HGH A;  2I13 A;  1RMD A;  5KL7 A;  1MEY C;  2R1F A;  4GZN C;  1YSA C;  2LCE A;  2YRH A;  3M99 B;  4F2J C;  2A25 A;  2EM4 A;  2EOQ A;  1A1G A;  1ZAA C;  2GLI A;  2WBU A;  2CT1 A;  2YTD A;  4R2P A;  2EMG A;  2ENA A;  2MKD A;  2ELY A;  2YTG A;  2EN8 A;  1P47 A;  2EMW A;  2ENH A;  3EPK A;  2EMZ A;  2EN7 A;  2EM8 A;  3UK3 C;  2YTF A;  2EPR A;  1X6F A;  2EOS A;  1G2D C;  1UBD C;  2EMI A;  1G2F C;  1A1F A;  2MKN A;  4M9V C;  4R2D A;  3EPH A;  2EML A;  2EN2 A;  2EN1 A;  1KJK A;  2EMA A;  2EM7 A;  2YTQ A;  2EM6 A;  2WCC 3;  3EPJ A;  5KL2 A;  1B69 A;  2YRK A;  1DGC A;  2EOX A;  4X9J A;  2VRD A;  4R2E A;  2EN3 A;  2EMK A;  1LLM C;  1TN9 A;  3VHT B;  1TF3 A;  2EPZ A;  2ADR A;  2YSP A;  4R2S A;  2MDG A;  2YTO A;  2EPP A;  2EM9 A;  1BBO A;  1ZU1 A;  5KL4 A;  2EOO A;  4R2A A;  1A1H A;  1JK1 A;  2DLK A;  2EP3 A;  2EM3 A;  2JP9 A;  4R2Q A;  2DLQ A;  2EOH A;  2YTJ A;  1AAY A;  3MHS C;  1YUJ A;  2EL6 A;  5KL3 A;  2LT7 A;  2EPU A;  2EM2 A;  2EMX A;  2EQ0 A;  2YTP A;  1F2I G;  2YU5 A;  2CTD A;  1Z1B A;  2EOF A;  2LV2 A;  2ENC A;  2EL5 A;  2WBS A;  2EMH A;  1X6H A;  2EPA A;  1X3C A;  2EOE A;  2EMF A;  2EOM A;  2EE8 A;  2YSO A;  3MHH C;  2YTN A;  2EMB A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...