4WPYA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
DHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wpyA01
4WSPA 4WPYA 2FGGA
chains in the Genus database with same CATH superfamily
3UK3C 4RHBB 3H09A 2EPUA 3ADLA 2UUAE 4YHHE 4O24A 3J81C 4NXNE 1L4SA 1X6EA 2YWQA 4LU9A 2I9IA 2V8QB 1HNWE 1RC7A 4WX9A 2DMYA 2WZOA 1WHQA 1X6HA 2EJ4A 2L2KB 3MHHC 2EPZA 2B9DA 2RSIA 2EPLX 5KL3A 5IXMB 4DR4E 4ZYGA 2JOXA 4DV2E 1A1IA 2LT7A 2EORA 2CSHA 3F6GA 1WJPA 4WXDA 2M1SA 3IWCA 4WFTA 2V83A 3JAMC 4DR3E 2KONA 1ZAAC 4DR6E 4MLQA 1G2FC 4X62E 2DLKA 1EKZA 2UXCE 2WBUA 1N33E 5KL7A 3KWRA 1T38A 4R2CA 1PJTA 3HTXA 2EPRA 1MEYC 5CFFE 2EOMA 2EPNA 2G7HA 1QU6A 2FTXB 2YTNA 4ZYHA 5DNYA 2EOOA 2RS7A 4LF4E 5LL6R 3KZZA 1YUJA 2GPIA 1IQOA 3T1YE 1PJSA 2YSPA 4R2AA 2HJJA 1ZBTA 1AAYA 4DUZE 2VE7C 1HR0E 3DF6A 5BR8E 5AC4A 4DV7E 1N36E 4O4KA 2L8TA 2MKNA 2EZ6A 1UILA 5LMNE 1T4NA 3AV0A 1A1JA 4JI1E 4LFAE 2EMXA 4I8OA 1XNRE 4OX9E 2MC5A 4JI5E 3THNA 2EOHA 2BBGA 2EPPA 5A6JA 2EE8A 4LF8E 5AC5A 3EPJA 5IV8B 2EM0A 2DGCA 3C6MA 4M9VC 3AUZA 2NABA 2EMZA 4R2SA 1EH6A 2YTGA 1TF3A 2EN8A 2Q8UA 1HNXE 2ELYA 5FLXC 2EP3A 3VYXA 4X9JA 2EQ0A 2EPKX 2UUCE 1STUA 2MC6A 4R2DA 2RQLA 3VK6A 1A1GA 1QNTA 1F2IG 2EN6A 2KOUA 2EPMX 2WBTA 4ZYEA 1PDAA 2EMBA 2F8BA 1DQ3A 5KL4A 2FV4B 2UXBE 3FIGA 3HXLA 2M4IA 2DMIA 4R2EA 4MLVA 2CPNA 5A69A 2EL6A 2YTQA 4K0KE 1UBDC 1IBLE 5T6JA 2YTOA 2YTPA 3IWBA 3VHTB 4JYAE 4F6MA 2EWLA 2DSYA 4IS1C 1KJKA 2ADRA 2UUBE 3BGHA 2E1MA 3MSWA 4O5GA 4KHPE 1DI2A 1X6FA 3C4BA 4DUYE 4BMJA 2GLIA 1Z1BA 2EOJA 3P1XA 1N34E 2DB2A 5ADZA 3EPLA 2YU5A 4LFCE 2EN7A 5AE3A 4M2ZA 2BB8A 5TSEA 4BCAA 2EOYA 2E5LE 2UXDE 2LRSA 2DLQA 4M0VA 3OMLA 4P78A 1IBKE 2JPAA 3QG5C 3DJWA 4O43A 4DV4E 4GZNC 2LBSB 2UU9E 2R76A 2EMAA 3M99B 5A6KA 2LTRA 3EPHA 3ADJA 1TN9A 4BS9A 3K6QA 4GKKE 2L3CA 1YFHA 3LLHA 2ZM6E 2V85A 1T4OA 1EH7A 2NUEA 2EOEA 2J7JA 2FGGA 2YRMA 4WPYA 2EM8A 2EMHA 2MDRA 2V88A 2EQ3A 1X5WA 1J5EE 1JK1A 4BBYA 5A6AA 1X3CA 2K7IA 4JI3E 1B69A 4DV5E 2LJUA 2JR1A 2ODRC 2V86A 1WRJA 2H36X 5A6BD 4OOGC 2VQEE 2YRKA 1YYWA 2ODRD 2KHXA 2VQFE 4F9AB 2EOXA 1NCSA 3IWDA 2ELZA 4DV0E 2EM7A 5A6BA 2EM9A 4LF5E 4M30A 4JI7E 2F4VE 1N32E 2EOIA 1X47A 4R2RA 1G2DC 2EMIA 2MDGA 1A1FA 1P47A 4NHRA 3JTZA 2EQ1A 4F9CB 2YT4A 4LFBE 2EL5A 5LLQA 2HC5A 1O0WA 1A1HA 2LO3A 1FKAE 2LJHA 2E72A 2LCEA 2LUPB 3C6KA 2LMZA 2N8XA 5AASA 3ADGA 2L33A 1XMOE 4TUIA 2EMKA 5KL6A 1YYOA 3MHSC 2YTIA 4F6NA 4JI0E 2ENAA 5F3WA 2EN1A 1DGCA 1SFEA 1XMQE 4L5NC 4N4RB 3VYYA 3F6HA 4ZYDA 2EMLA 2VRDA 4B3TE 1YZ9A 3TQMA 1NEIA 4TUGA 2LV2A 2JWOA 4FK5C 1ZU1A 4DV3E 4JI4E 2JY9A 2RPCA 3HPSA 1BBOA 2B7TA 1UN6B 3EPKA 1T4LB 4F2JC 2L92A 3HQ1A 1A1LA 1YYKA 4BC9A 1AH5A 2DIXA 2ENCA 1X49A 2HGHA 1XNQE 2L2MA 1BB8A 2EPAA 4Q35B 2NUGA 4WSPA 2JP9A 3J7Yp 4B3ME 5AE1A 2EMFA 2L6MA 1HNZE 2A25A 2LVHA 2GHFA 3ECRA 5AE2A 4WSGA 2D9HA 1EH8A 4DV1E 2N3HA 2JVAA 1MGTA 2YTJA 1A1KA 4JI2E 1FJGE 4DV6E 3EQ1A 3LMLA 4X8WA 4LTYA 2YTEA 4DR2E 5IWAE 1WHNA 2YTDA 4GEQB 1YSAC 4X64E 1T39A 2CT1A 4X65E 4P7DA 2WCC3 2EOFA 5LMUE 5A2QC 4L8NA 2HHHE 4DMIA 2EN4A 2L3JA 2EOSA 2YRHA 2N3GA 4JV5E 2IHR1 1BBGA 2EM3A 3L00A 4Q28A 4AQYE 2EOZA 1SR9A 2ENHA 2NA2A 4BC7A 2YZTA 2NUFA 1YPNA 1IBME 1LLMC 3T1HE 1WXRA 3JU0A 4R03A 2EPCA 4R8OA 2EPXA 1ZBQA 4GKJE 1N3GA 3HPZA 2DRPA 2LUQA 2CTDA 2EMCA 1RMDA 4HEIA 2V87A 3J80C 2EPOA 1IMUA 2JOBA 2VF1A 4DKKA 4JI6E 2PRTA 1X48A 3RMPA 2EM2A 4R2PA 2K4VA 4JI8E 4NZVA 2MKDA 2YU8A 4DR5E 1IQSA 1GZ6A 4KZSA 1GQEA 1UHZA 2EMWA 4YY3E 4WXCA 4B3SE 4LF7E 2B3TB 4WYQB 4B3RE 2EM5A 2M7QA 1PKPA 2LE2A 4F9BB 4LF6E 2YPNA 2EM4A 3C4TA 3THOB 3BIDA 3OTOE 3KZYA 4LF9E 2RS6A 2JYAA 4KWYA 1RQ0A 5KL2A 2YTFA 2EM6A 4HTGA 5IT9C 4IJDA 2R1FA 4BHBA 1YUIA 4NXME 3BF2A 4X66E 2EMGA 2L2NA 4RH8A 2EL4A 2M9AA 2LTSA 4J8ZA 2WBSA 2EN2A 1J26A 4BHCA 1PJQA 2B7VA 3BBGA 3J7AG 1ZR9A 2RSMA 2RTXA 2V89A 1JK2A 2EMYA 1GTKA 2JXPA 2YSOA 4DR7E 4R2QA 2EN3A 1I94E 2I13A 5KL5A 1KYQA 2EOQA 3ADIA 3ZOQB 1TF6A 4F54A 4DR1E
chains in the Genus database with same CATH topology
3H09A 4GEQB 2KOUA 4DV0E 3ADLA 4X64E 2UUAE 4X65E 4YHHE 4P7DA 5LMUE 3J81C 2F8BA 1DQ3A 4M30A 5A2QC 2FV4B 4JI7E 4L8NA 2HHHE 4LF5E 4NXNE 4DMIA 2F4VE 1HNWE 3FIGA 4LU9A 2V8QB 2N3GA 2L3JA 3VK6A 1N32E 3HXLA 1X47A 2IHR1 2M4IA 1RC7A 4JV5E 4Q28A 2CPNA 4AQYE 1SR9A 4K0KE 2NA2A 2DMYA 2WZOA 1WHQA 3JTZA 4BC7A 2UXBE 4F9CB 2YZTA 1IBLE 5T6JA 2NUFA 2YT4A 1IBME 4LFBE 3IWBA 3T1HE 1WXRA 2L2KB 3JU0A 4JYAE 4R03A 4R8OA 1O0WA 2B9DA 2EWLA 2DSYA 1FKAE 2LJHA 2LUPB 2LMZA 5AASA 1ZBQA 4DR4E 3ADGA 4GKJE 3HPZA 2LUQA 2UUBE 2E1MA 3MSWA 2L33A 4KHPE 1XMOE 3J80C 2V87A 4TUIA 1DI2A 2JOXA 4DV2E 3C4BA 1YYOA 2JOBA 2VF1A 4DKKA 4DUYE 4BMJA 4JI0E 1X48A 4JI6E 3P1XA 3F6GA 3RMPA 2DB2A 1N34E 2K4VA 5ADZA 4JI8E 2M1SA 3IWCA 4WFTA 2V83A 3JAMC 4DR3E 2KONA 4DR5E 1GZ6A 5F3WA 4KZSA 1GQEA 4LFCE 1UHZA 5AE3A 4YY3E 4M2ZA 4DR6E 4X62E 4BCAA 4B3SE 2E5LE 4LF7E 2B3TB 2LRSA 2UXDE 4WYQB 1XMQE 4B3RE 4L5NC 2M7QA 4M0VA 1PKPA 3VYYA 1EKZA 1N33E 2UXCE 3F6HA 3KWRA 3OMLA 4B3TE 4P78A 1YZ9A 1IBKE 2LE2A 3HTXA 4F9BB 4LF6E 5CFFE 4TUGA 3DJWA 4DV4E 2G7HA 2LBSB 2UU9E 3C4TA 1QU6A 2FTXB 2JWOA 5DNYA 2RS7A 3OTOE 2LTRA 4DV3E 2JY9A 2RS6A 5LL6R 4JI4E 4LF4E 4LF9E 1RQ0A 3ADJA 3HPSA 5IT9C 4BS9A 3T1YE 2B7TA 3K6QA 4GKKE 2L3CA 1ZBTA 1T4LB 3LLHA 2VE7C 4DUZE 1HR0E 2L92A 3DF6A 2V85A 1T4OA 3HQ1A 5BR8E 2ZM6E 4DV7E 1N36E 4NXME 1YYKA 2NUEA 2L8TA 4X66E 4BC9A 2L2NA 2DIXA 1X49A 2FGGA 1XNQE 2EZ6A 1UILA 2L2MA 1T4NA 3AV0A 4WPYA 5LMNE 4JI1E 4LFAE 2NUGA 4I8OA 1XNRE 2LTSA 4J8ZA 4WSPA 4OX9E 1J26A 3J7Yp 2MDRA 4B3ME 5AE1A 2V88A 2MC5A 2B7VA 2L6MA 1HNZE 4JI5E 3J7AG 2RSMA 1J5EE 2RTXA 2V89A 4LF8E 4BBYA 4DR1E 4JI3E 5AE2A 3AUZA 4DV5E 2JR1A 2ODRC 4DV1E 2N3HA 2V86A 2JVAA 4DR7E 2H36X 1I94E 4JI2E 1FJGE 4OOGC 2VQEE 1YYWA 2ODRD 2KHXA 2VQFE 1HNXE 5FLXC 4F9AB 4DV6E 3LMLA 4X8WA 3ADIA 4LTYA 2UUCE 3VYXA 3ZOQB 4DR2E 1STUA 5IWAE 2MC6A 4F54A 1WHNA 3IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSP A;  4WPY A;  2FGG A; 
#chains in the Genus database with same CATH topology
 3UK3 C;  4RHB B;  3H09 A;  2EPU A;  3ADL A;  2UUA E;  4YHH E;  4O24 A;  3J81 C;  4NXN E;  1L4S A;  1X6E A;  2YWQ A;  4LU9 A;  2I9I A;  2V8Q B;  1HNW E;  1RC7 A;  4WX9 A;  2DMY A;  2WZO A;  1WHQ A;  1X6H A;  2EJ4 A;  2L2K B;  3MHH C;  2EPZ A;  2B9D A;  2RSI A;  2EPL X;  5KL3 A;  5IXM B;  4DR4 E;  4ZYG A;  2JOX A;  4DV2 E;  1A1I A;  2LT7 A;  2EOR A;  2CSH A;  3F6G A;  1WJP A;  4WXD A;  2M1S A;  3IWC A;  4WFT A;  2V83 A;  3JAM C;  4DR3 E;  2KON A;  1ZAA C;  4DR6 E;  4MLQ A;  1G2F C;  4X62 E;  2DLK A;  1EKZ A;  2UXC E;  2WBU A;  1N33 E;  5KL7 A;  3KWR A;  1T38 A;  4R2C A;  1PJT A;  3HTX A;  2EPR A;  1MEY C;  5CFF E;  2EOM A;  2EPN A;  2G7H A;  1QU6 A;  2FTX B;  2YTN A;  4ZYH A;  5DNY A;  2EOO A;  2RS7 A;  4LF4 E;  5LL6 R;  3KZZ A;  1YUJ A;  2GPI A;  1IQO A;  3T1Y E;  1PJS A;  2YSP A;  4R2A A;  2HJJ A;  1ZBT A;  1AAY A;  4DUZ E;  2VE7 C;  1HR0 E;  3DF6 A;  5BR8 E;  5AC4 A;  4DV7 E;  1N36 E;  4O4K A;  2L8T A;  2MKN A;  2EZ6 A;  1UIL A;  5LMN E;  1T4N A;  3AV0 A;  1A1J A;  4JI1 E;  4LFA E;  2EMX A;  4I8O A;  1XNR E;  4OX9 E;  2MC5 A;  4JI5 E;  3THN A;  2EOH A;  2BBG A;  2EPP A;  5A6J A;  2EE8 A;  4LF8 E;  5AC5 A;  3EPJ A;  5IV8 B;  2EM0 A;  2DGC A;  3C6M A;  4M9V C;  3AUZ A;  2NAB A;  2EMZ A;  4R2S A;  1EH6 A;  2YTG A;  1TF3 A;  2EN8 A;  2Q8U A;  1HNX E;  2ELY A;  5FLX C;  2EP3 A;  3VYX A;  4X9J A;  2EQ0 A;  2EPK X;  2UUC E;  1STU A;  2MC6 A;  4R2D A;  2RQL A;  3VK6 A;  1A1G A;  1QNT A;  1F2I G;  2EN6 A;  2KOU A;  2EPM X;  2WBT A;  4ZYE A;  1PDA A;  2EMB A;  2F8B A;  1DQ3 A;  5KL4 A;  2FV4 B;  2UXB E;  3FIG A;  3HXL A;  2M4I A;  2DMI A;  4R2E A;  4MLV A;  2CPN A;  5A69 A;  2EL6 A;  2YTQ A;  4K0K E;  1UBD C;  1IBL E;  5T6J A;  2YTO A;  2YTP A;  3IWB A;  3VHT B;  4JYA E;  4F6M A;  2EWL A;  2DSY A;  4IS1 C;  1KJK A;  2ADR A;  2UUB E;  3BGH A;  2E1M A;  3MSW A;  4O5G A;  4KHP E;  1DI2 A;  1X6F A;  3C4B A;  4DUY E;  4BMJ A;  2GLI A;  1Z1B A;  2EOJ A;  3P1X A;  1N34 E;  2DB2 A;  5ADZ A;  3EPL A;  2YU5 A;  4LFC E;  2EN7 A;  5AE3 A;  4M2Z A;  2BB8 A;  5TSE A;  4BCA A;  2EOY A;  2E5L E;  2UXD E;  2LRS A;  2DLQ A;  4M0V A;  3OML A;  4P78 A;  1IBK E;  2JPA A;  3QG5 C;  3DJW A;  4O43 A;  4DV4 E;  4GZN C;  2LBS B;  2UU9 E;  2R76 A;  2EMA A;  3M99 B;  5A6K A;  2LTR A;  3EPH A;  3ADJ A;  1TN9 A;  4BS9 A;  3K6Q A;  4GKK E;  2L3C A;  1YFH A;  3LLH A;  2ZM6 E;  2V85 A;  1T4O A;  1EH7 A;  2NUE A;  2EOE A;  2J7J A;  2FGG A;  2YRM A;  4WPY A;  2EM8 A;  2EMH A;  2MDR A;  2V88 A;  2EQ3 A;  1X5W A;  1J5E E;  1JK1 A;  4BBY A;  5A6A A;  1X3C A;  2K7I A;  4JI3 E;  1B69 A;  4DV5 E;  2LJU A;  2JR1 A;  2ODR C;  2V86 A;  1WRJ A;  2H36 X;  5A6B D;  4OOG C;  2VQE E;  2YRK A;  1YYW A;  2ODR D;  2KHX A;  2VQF E;  4F9A B;  2EOX A;  1NCS A;  3IWD A;  2ELZ A;  4DV0 E;  2EM7 A;  5A6B A;  2EM9 A;  4LF5 E;  4M30 A;  4JI7 E;  2F4V E;  1N32 E;  2EOI A;  1X47 A;  4R2R A;  1G2D C;  2EMI A;  2MDG A;  1A1F A;  1P47 A;  4NHR A;  3JTZ A;  2EQ1 A;  4F9C B;  2YT4 A;  4LFB E;  2EL5 A;  5LLQ A;  2HC5 A;  1O0W A;  1A1H A;  2LO3 A;  1FKA E;  2LJH A;  2E72 A;  2LCE A;  2LUP B;  3C6K A;  2LMZ A;  2N8X A;  5AAS A;  3ADG A;  2L33 A;  1XMO E;  4TUI A;  2EMK A;  5KL6 A;  1YYO A;  3MHS C;  2YTI A;  4F6N A;  4JI0 E;  2ENA A;  5F3W A;  2EN1 A;  1DGC A;  1SFE A;  1XMQ E;  4L5N C;  4N4R B;  3VYY A;  3F6H A;  4ZYD A;  2EML A;  2VRD A;  4B3T E;  1YZ9 A;  3TQM A;  1NEI A;  4TUG A;  2LV2 A;  2JWO A;  4FK5 C;  1ZU1 A;  4DV3 E;  4JI4 E;  2JY9 A;  2RPC A;  3HPS A;  1BBO A;  2B7T A;  1UN6 B;  3EPK A;  1T4L B;  4F2J C;  2L92 A;  3HQ1 A;  1A1L A;  1YYK A;  4BC9 A;  1AH5 A;  2DIX A;  2ENC A;  1X49 A;  2HGH A;  1XNQ E;  2L2M A;  1BB8 A;  2EPA A;  4Q35 B;  2NUG A;  4WSP A;  2JP9 A;  3J7Y p;  4B3M E;  5AE1 A;  2EMF A;  2L6M A;  1HNZ E;  2A25 A;  2LVH A;  2GHF A;  3ECR A;  5AE2 A;  4WSG A;  2D9H A;  1EH8 A;  4DV1 E;  2N3H A;  2JVA A;  1MGT A;  2YTJ A;  1A1K A;  4JI2 E;  1FJG E;  4DV6 E;  3EQ1 A;  3LML A;  4X8W A;  4LTY A;  2YTE A;  4DR2 E;  5IWA E;  1WHN A;  2YTD A;  4GEQ B;  1YSA C;  4X64 E;  1T39 A;  2CT1 A;  4X65 E;  4P7D A;  2WCC 3;  2EOF A;  5LMU E;  5A2Q C;  4L8N A;  2HHH E;  4DMI A;  2EN4 A;  2L3J A;  2EOS A;  2YRH A;  2N3G A;  4JV5 E;  2IHR 1;  1BBG A;  2EM3 A;  3L00 A;  4Q28 A;  4AQY E;  2EOZ A;  1SR9 A;  2ENH A;  2NA2 A;  4BC7 A;  2YZT A;  2NUF A;  1YPN A;  1IBM E;  1LLM C;  3T1H E;  1WXR A;  3JU0 A;  4R03 A;  2EPC A;  4R8O A;  2EPX A;  1ZBQ A;  4GKJ E;  1N3G A;  3HPZ A;  2DRP A;  2LUQ A;  2CTD A;  2EMC A;  1RMD A;  4HEI A;  2V87 A;  3J80 C;  2EPO A;  1IMU A;  2JOB A;  2VF1 A;  4DKK A;  4JI6 E;  2PRT A;  1X48 A;  3RMP A;  2EM2 A;  4R2P A;  2K4V A;  4JI8 E;  4NZV A;  2MKD A;  2YU8 A;  4DR5 E;  1IQS A;  1GZ6 A;  4KZS A;  1GQE A;  1UHZ A;  2EMW A;  4YY3 E;  4WXC A;  4B3S E;  4LF7 E;  2B3T B;  4WYQ B;  4B3R E;  2EM5 A;  2M7Q A;  1PKP A;  2LE2 A;  4F9B B;  4LF6 E;  2YPN A;  2EM4 A;  3C4T A;  3THO B;  3BID A;  3OTO E;  3KZY A;  4LF9 E;  2RS6 A;  2JYA A;  4KWY A;  1RQ0 A;  5KL2 A;  2YTF A;  2EM6 A;  4HTG A;  5IT9 C;  4IJD A;  2R1F A;  4BHB A;  1YUI A;  4NXM E;  3BF2 A;  4X66 E;  2EMG A;  2L2N A;  4RH8 A;  2EL4 A;  2M9A A;  2LTS A;  4J8Z A;  2WBS A;  2EN2 A;  1J26 A;  4BHC A;  1PJQ A;  2B7V A;  3BBG A;  3J7A G;  1ZR9 A;  2RSM A;  2RTX A;  2V89 A;  1JK2 A;  2EMY A;  1GTK A;  2JXP A;  2YSO A;  4DR7 E;  4R2Q A;  2EN3 A;  1I94 E;  2I13 A;  5KL5 A;  1KYQ A;  2EOQ A;  3ADI A;  3ZOQ B;  1TF6 A;  4F54 A;  4DR1 E; 
#chains in the Genus database with same CATH homology
 3H09 A;  4GEQ B;  2KOU A;  4DV0 E;  3ADL A;  4X64 E;  2UUA E;  4X65 E;  4YHH E;  4P7D A;  5LMU E;  3J81 C;  2F8B A;  1DQ3 A;  4M30 A;  5A2Q C;  2FV4 B;  4JI7 E;  4L8N A;  2HHH E;  4LF5 E;  4NXN E;  4DMI A;  2F4V E;  1HNW E;  3FIG A;  4LU9 A;  2V8Q B;  2N3G A;  2L3J A;  3VK6 A;  1N32 E;  3HXL A;  1X47 A;  2IHR 1;  2M4I A;  1RC7 A;  4JV5 E;  4Q28 A;  2CPN A;  4AQY E;  1SR9 A;  4K0K E;  2NA2 A;  2DMY A;  2WZO A;  1WHQ A;  3JTZ A;  4BC7 A;  2UXB E;  4F9C B;  2YZT A;  1IBL E;  5T6J A;  2NUF A;  2YT4 A;  1IBM E;  4LFB E;  3IWB A;  3T1H E;  1WXR A;  2L2K B;  3JU0 A;  4JYA E;  4R03 A;  4R8O A;  1O0W A;  2B9D A;  2EWL A;  2DSY A;  1FKA E;  2LJH A;  2LUP B;  2LMZ A;  5AAS A;  1ZBQ A;  4DR4 E;  3ADG A;  4GKJ E;  3HPZ A;  2LUQ A;  2UUB E;  2E1M A;  3MSW A;  2L33 A;  4KHP E;  1XMO E;  3J80 C;  2V87 A;  4TUI A;  1DI2 A;  2JOX A;  4DV2 E;  3C4B A;  1YYO A;  2JOB A;  2VF1 A;  4DKK A;  4DUY E;  4BMJ A;  4JI0 E;  1X48 A;  4JI6 E;  3P1X A;  3F6G A;  3RMP A;  2DB2 A;  1N34 E;  2K4V A;  5ADZ A;  4JI8 E;  2M1S A;  3IWC A;  4WFT A;  2V83 A;  3JAM C;  4DR3 E;  2KON A;  4DR5 E;  1GZ6 A;  5F3W A;  4KZS A;  1GQE A;  4LFC E;  1UHZ A;  5AE3 A;  4YY3 E;  4M2Z A;  4DR6 E;  4X62 E;  4BCA A;  4B3S E;  2E5L E;  4LF7 E;  2B3T B;  2LRS A;  2UXD E;  4WYQ B;  1XMQ E;  4B3R E;  4L5N C;  2M7Q A;  4M0V A;  1PKP A;  3VYY A;  1EKZ A;  1N33 E;  2UXC E;  3F6H A;  3KWR A;  3OML A;  4B3T E;  4P78 A;  1YZ9 A;  1IBK E;  2LE2 A;  3HTX A;  4F9B B;  4LF6 E;  5CFF E;  4TUG A;  3DJW A;  4DV4 E;  2G7H A;  2LBS B;  2UU9 E;  3C4T A;  1QU6 A;  2FTX B;  2JWO A;  5DNY A;  2RS7 A;  3OTO E;  2LTR A;  4DV3 E;  2JY9 A;  2RS6 A;  5LL6 R;  4JI4 E;  4LF4 E;  4LF9 E;  1RQ0 A;  3ADJ A;  3HPS A;  5IT9 C;  4BS9 A;  3T1Y E;  2B7T A;  3K6Q A;  4GKK E;  2L3C A;  1ZBT A;  1T4L B;  3LLH A;  2VE7 C;  4DUZ E;  1HR0 E;  2L92 A;  3DF6 A;  2V85 A;  1T4O A;  3HQ1 A;  5BR8 E;  2ZM6 E;  4DV7 E;  1N36 E;  4NXM E;  1YYK A;  2NUE A;  2L8T A;  4X66 E;  4BC9 A;  2L2N A;  2DIX A;  1X49 A;  2FGG A;  1XNQ E;  2EZ6 A;  1UIL A;  2L2M A;  1T4N A;  3AV0 A;  4WPY A;  5LMN E;  4JI1 E;  4LFA E;  2NUG A;  4I8O A;  1XNR E;  2LTS A;  4J8Z A;  4WSP A;  4OX9 E;  1J26 A;  3J7Y p;  2MDR A;  4B3M E;  5AE1 A;  2V88 A;  2MC5 A;  2B7V A;  2L6M A;  1HNZ E;  4JI5 E;  3J7A G;  2RSM A;  1J5E E;  2RTX A;  2V89 A;  4LF8 E;  4BBY A;  4DR1 E;  4JI3 E;  5AE2 A;  3AUZ A;  4DV5 E;  2JR1 A;  2ODR C;  4DV1 E;  2N3H A;  2V86 A;  2JVA A;  4DR7 E;  2H36 X;  1I94 E;  4JI2 E;  1FJG E;  4OOG C;  2VQE E;  1YYW A;  2ODR D;  2KHX A;  2VQF E;  1HNX E;  5FLX C;  4F9A B;  4DV6 E;  3LML A;  4X8W A;  3ADI A;  4LTY A;  2UUC E;  3VYX A;  3ZOQ B;  4DR2 E;  1STU A;  5IWA E;  2MC6 A;  4F54 A;  1WHN A;  3IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...