4WPYA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
DHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wpyA01
2FGGA 4WPYA 4WSPA
chains in the Genus database with same CATH superfamily
1X6HA 3AUZA 3BIDA 3L00A 3JAMC 4LFCE 4R03A 1UN6B 2KONA 2EMWA 3C6KA 4KZSA 4WX9A 3HXLA 5AC5A 4R8OA 2EQ1A 2V87A 5LL6R 3H09A 3VYYA 2ZM6E 1JK2A 2GLIA 2J7JA 3VHTB 4X62E 2EOQA 3IWBA 4R2CA 2V86A 4DKKA 4R2SA 2JVAA 2N3HA 1BBGA 2DLKA 4WXCA 2LV2A 2LVHA 1RMDA 2LJHA 2RTXA 5TSEA 2B9DA 1KJKA 2MC5A 4BBYA 4R2QA 1A1LA 1QNTA 2RS6A 3EPHA 2ENCA 2EMKA 1N33E 4WYQB 2YRHA 2CPNA 2EOEA 5T6JA 2I9IA 1HNZE 2EOJA 4X64E 1T4NA 4B3ME 4YY3E 3VYXA 4K0KE 4F2JC 4DV7E 2EWLA 2YTPA 2LUQA 4KHPE 2EM7A 3TQMA 1PJQA 5AE2A 4TUIA 2V83A 1FKAE 4DMIA 2EPPA 4JI7E 1X47A 4DV5E 5ADZA 4F9AB 2V88A 2NUEA 2ODRD 2RSIA 4WSGA 4F6NA 2VQEE 1AAYA 2UXBE 2UU9E 4DV6E 1ZAAC 1JK1A 4DR5E 1EH6A 5F3WA 2EOOA 3MHHC 4IS1C 1EKZA 1WRJA 2L3JA 1A1JA 3AV0A 4BHCA 2RQLA 3HTXA 4X8WA 1IBLE 2JY9A 2YSOA 3HPSA 5AASA 2EOMA 4O43A 2FGGA 2EOHA 1WHQA 2EM0A 2RPCA 3THOB 2EM9A 4LF4E 1ZBQA 1ZBTA 2F8BA 1IMUA 1TF6A 4ZYDA 5IV8B 4ZYEA 4JYAE 2EOZA 2EMLA 3FIGA 1BBOA 5IT9C 2HJJA 2NA2A 4DV3E 4Q35B 4RHBB 5A69A 1YPNA 2EQ0A 4DV0E 4B3TE 2LO3A 4X9JA 3HPZA 2MKNA 3UK3C 4M2ZA 2EOFA 4I8OA 1A1GA 1N32E 2YTGA 2YRKA 1X48A 4GEQB 1A1FA 1TF3A 2EMYA 4F54A 1A1HA 1WHNA 2YZTA 2LT7A 2HGHA 3T1HE 4JI3E 1L4SA 4JI5E 2L33A 1IBKE 2R76A 4JI6E 3C4BA 3EPKA 2UXDE 4M30A 2EPRA 2YTQA 4R2PA 1N36E 2M4IA 3THNA 1YYKA 4O5GA 1YUJA 1UHZA 4LF8E 2LMZA 3VK6A 1IBME 1YYWA 1GTKA 2V89A 4X66E 1YFHA 4NHRA 2H36X 1I94E 2YTIA 2EN2A 1N3GA 4JI0E 3ZOQB 1HNWE 2V8QB 2F4VE 3P1XA 3IWCA 2YTOA 2JP9A 2DB2A 4NZVA 2EMGA 1N34E 4GZNC 4BMJA 3EPJA 3C4TA 2B3TB 4DR7E 4RH8A 2EMIA 2KHXA 2EMAA 2LTSA 3ADLA 2WBSA 2PRTA 2EMXA 2K4VA 3ADJA 1STUA 2BBGA 2ENAA 4F9CB 4WSPA 4JI4E 2FTXB 1BB8A 5LMUE 1KYQA 4N4RB 4WXDA 1MGTA 2EM5A 2Q8UA 4DR2E 2EPAA 2EM2A 5A6JA 1T4OA 2EM8A 2JR1A 4GKKE 2YTDA 1ZU1A 2LBSB 1B69A 2E72A 4NXNE 3MSWA 2I13A 2EOIA 2ELZA 4MLVA 1PDAA 2JPAA 5LLQA 4JI1E 1G2DC 1LLMC 2EN6A 1UBDC 4KWYA 1X5WA 2WZOA 2EN4A 1YUIA 1X6FA 2YPNA 2EPLX 4O24A 4O4KA 2EPMX 1ZR9A 2EMZA 4HEIA 2UUBE 2YTNA 1PJSA 1AH5A 2B7TA 2EOYA 1DGCA 2DSYA 1X6EA 1PJTA 3F6HA 1IQSA 4DV4E 4ZYGA 4R2AA 2GHFA 3OMLA 4LU9A 1YSAC 3JU0A 4DV1E 4OX9E 5LMNE 1T39A 1FJGE 3ECRA 2VRDA 5BR8E 4DR4E 1SR9A 3BBGA 2VQFE 1J26A 2CT1A 2ELYA 2G7HA 2EM3A 4M9VC 2D9HA 2YWQA 2L2KB 2DRPA 2WCC3 3F6GA 3J81C 2YTJA 1SFEA 4LF9E 3ADGA 4YHHE 5AC4A 2JXPA 3LMLA 3ADIA 3J7AG 5AE3A 2EOSA 2M7QA 1PKPA 4LF6E 2EORA 4DR1E 2EL6A 2EE8A 4BC7A 2NUFA 2RSMA 1NEIA 3MHSC 4IJDA 1XMOE 4MLQA 1XNRE 3OTOE 1P47A 4X65E 2EM4A 3C6MA 4B3RE 4DR6E 1EH8A 1X49A 1NCSA 1RQ0A 2RS7A 1QU6A 1T4LB 2N3GA 2JOXA 5IXMB 2M1SA 2L92A 5KL2A 2UUCE 2EPZA 4R2RA 2BB8A 2EMHA 2HHHE 4P7DA 2EZ6A 2LCEA 2LTRA 2EPUA 4J8ZA 4BHBA 2MC6A 2EPNA 5CFFE 2E1MA 5AE1A 1Z1BA 2LUPB 3HQ1A 3J7Yp 2DMYA 5A6BA 2EN7A 4GKJE 3T1YE 2EN1A 2EOXA 2L2NA 2MKDA 4R2EA 4ZYHA 2L8TA 2EPXA 2LE2A 2WBTA 2EMFA 2YTEA 4R2DA 3KWRA 2FV4B 2NUGA 2LJUA 4OOGC 1T38A 4LF7E 3M99B 2R1FA 3K6QA 4L8NA 2DMIA 1YYOA 2A25A 2V85A 3JTZA 4LF5E 3DF6A 2EPOA 4LTYA 2ODRC 5IWAE 1XMQE 2EPCA 5KL7A 2EL5A 2K7IA 2YU8A 4LFAE 4DR3E 5A6AA 2IHR1 1G2FC 2L2MA 3BF2A 2GPIA 3DJWA 2YT4A 2EMBA 2EJ4A 2EM6A 2YRMA 4AQYE 3EPLA 4M0VA 2ADRA 2KOUA 4WFTA 2DGCA 3RMPA 4FK5C 2DLQA 1A1KA 2HC5A 2EN8A 1UILA 1DQ3A 3EQ1A 2E5LE 5KL5A 2VF1A 2EP3A 2WBUA 2EMCA 2JYAA 5A2QC 3LLHA 1HR0E 1YZ9A 5DNYA 2YTFA 1O0WA 1TN9A 1GQEA 4BS9A 1HNXE 1RC7A 1GZ6A 2EL4A 2VE7C 2CSHA 2EQ3A 1EH7A 1J5EE 1X3CA 2MDGA 4P78A 5A6BD 4B3SE 3IWDA 1F2IG 1IQOA 4LFBE 1WXRA 2JOBA 2JWOA 2MDRA 4Q28A 2B7VA 5KL4A 5KL6A 3BGHA 2LRSA 2CTDA 4WPYA 2ENHA 1MEYC 3J80C 2EPKX 4JV5E 2UXCE 3KZZA 3QG5C 4BCAA 5FLXC 1WJPA 4L5NC 2YU5A 1A1IA 5A6KA 1XNQE 4BC9A 4NXME 2YSPA 2N8XA 2DIXA 4HTGA 3KZYA 4F6MA 4F9BB 4DUZE 1DI2A 4DUYE 4TUGA 4DV2E 2L3CA 5KL3A 4JI8E 2NABA 2L6MA 2EN3A 2UUAE 4JI2E 2M9AA
chains in the Genus database with same CATH topology
3AUZA 3ADJA 1STUA 2HHHE 4P7DA 4F9CB 2EZ6A 4WSPA 4LF4E 2LTRA 1ZBQA 1ZBTA 3JAMC 2F8BA 2FTXB 4JI4E 4DUZE 4LFCE 4J8ZA 4R03A 2MC6A 2KONA 5CFFE 5LMUE 4KZSA 2E1MA 3HXLA 5AE1A 4JYAE 4R8OA 2LUPB 3HQ1A 3J7Yp 2DMYA 3FIGA 4GKJE 5IT9C 3T1YE 4DR2E 2L2NA 2V87A 5LL6R 3ADLA 3H09A 2L8TA 3VYYA 2ZM6E 1T4OA 2NA2A 4DV3E 2JR1A 4GKKE 2LE2A 3KWRA 2LBSB 2FV4B 2NUGA 4X62E 4OOGC 4NXNE 4LF7E 3MSWA 3IWBA 3K6QA 4L8NA 2V86A 4DKKA 4JI1E 1YYOA 4DV0E 4B3TE 2JVAA 2V85A 2N3HA 3JTZA 4LF5E 3HPZA 3DF6A 4JI2E 4LTYA 4M2ZA 2ODRC 4I8OA 5IWAE 2LJHA 2WZOA 1XMQE 1N32E 2RTXA 1X48A 4LFAE 4GEQB 2B9DA 4DR3E 2IHR1 2L2MA 3DJWA 4F54A 2YT4A 1WHNA 2YZTA 2MC5A 4BBYA 2UUBE 2RS6A 4AQYE 3T1HE 2UUCE 4M0VA 4WFTA 2KOUA 2B7TA 1N33E 3RMPA 4WYQB 4JI3E 2DSYA 1DQ3A 1UILA 2E5LE 5T6JA 2CPNA 2VF1A 3F6HA 4DV4E 1HNZE 4JI5E 2L33A 4X64E 1IBKE 5A2QC 1HR0E 1T4NA 3LLHA 4YY3E 4B3ME 3OMLA 3C4BA 4LU9A 5DNYA 1O0WA 4JI6E 1YZ9A 3JU0A 4DV1E 4OX9E 3VYXA 4K0KE 5LMNE 2UXDE 1GQEA 4DV7E 4M30A 1FJGE 4BS9A 1DI2A 1HNXE 1RC7A 1GZ6A 2EWLA 5BR8E 1N36E 4DR4E 2M4IA 2VE7C 1YYKA 1SR9A 2LUQA 4KHPE 2VQFE 1J26A 5AE2A 2G7HA 4TUIA 1J5EE 1UHZA 4P78A 4B3SE 4LF8E 2LMZA 3IWDA 2V83A 3VK6A 2L2KB 4DMIA 1FKAE 1IBME 1YYWA 4JI7E 1X47A 3F6GA 2V89A 3J81C 4X66E 4DV5E 4LFBE 1WXRA 2JOBA 5ADZA 2H36X 2MDRA 2JWOA 3ADGA 4Q28A 4F9AB 4YHHE 1I94E 2V88A 4LF9E 4JI0E 3LMLA 3ZOQB 2NUEA 3ADIA 2ODRD 2V8QB 5AE3A 3J7AG 2F4VE 2M7QA 1HNWE 1PKPA 2B7VA 4LF6E 3P1XA 2VQEE 4DR1E 3IWCA 2LRSA 2UXBE 4WPYA 4DV6E 2UU9E 4BC7A 2DB2A 2NUFA 2RSMA 3J80C 4JV5E 1N34E 4DR5E 1IBLE 2UXCE 1XMOE 5F3WA 4BCAA 4BMJA 1EKZA 5FLXC 4L5NC 1XNRE 3C4TA 3OTOE 2B3TB 2L3JA 4BC9A 3AV0A 4X65E 4NXME 1XNQE 4B3RE 4DR6E 1X49A 4DR7E 3HTXA 2DIXA 2KHXA 4X8WA 1RQ0A 2JY9A 2LTSA 2RS7A 4F9BB 4TUGA 1QU6A 3HPSA 4DUYE 4DV2E 1T4LB 5AASA 2L3CA 2N3GA 2JOXA 4JI8E 2M1SA 2L6MA 2UUAE 2FGGA 2K4VA 2L92A 1WHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WPY A;  4WSP A; 
#chains in the Genus database with same CATH topology
 1X6H A;  3AUZ A;  3BID A;  3L00 A;  3JAM C;  4LFC E;  4R03 A;  1UN6 B;  2KON A;  2EMW A;  3C6K A;  4KZS A;  4WX9 A;  3HXL A;  5AC5 A;  4R8O A;  2EQ1 A;  2V87 A;  5LL6 R;  3H09 A;  3VYY A;  2ZM6 E;  1JK2 A;  2GLI A;  2J7J A;  3VHT B;  4X62 E;  2EOQ A;  3IWB A;  4R2C A;  2V86 A;  4DKK A;  4R2S A;  2JVA A;  2N3H A;  1BBG A;  2DLK A;  4WXC A;  2LV2 A;  2LVH A;  1RMD A;  2LJH A;  2RTX A;  5TSE A;  2B9D A;  1KJK A;  2MC5 A;  4BBY A;  4R2Q A;  1A1L A;  1QNT A;  2RS6 A;  3EPH A;  2ENC A;  2EMK A;  1N33 E;  4WYQ B;  2YRH A;  2CPN A;  2EOE A;  5T6J A;  2I9I A;  1HNZ E;  2EOJ A;  4X64 E;  1T4N A;  4B3M E;  4YY3 E;  3VYX A;  4K0K E;  4F2J C;  4DV7 E;  2EWL A;  2YTP A;  2LUQ A;  4KHP E;  2EM7 A;  3TQM A;  1PJQ A;  5AE2 A;  4TUI A;  2V83 A;  1FKA E;  4DMI A;  2EPP A;  4JI7 E;  1X47 A;  4DV5 E;  5ADZ A;  4F9A B;  2V88 A;  2NUE A;  2ODR D;  2RSI A;  4WSG A;  4F6N A;  2VQE E;  1AAY A;  2UXB E;  2UU9 E;  4DV6 E;  1ZAA C;  1JK1 A;  4DR5 E;  1EH6 A;  5F3W A;  2EOO A;  3MHH C;  4IS1 C;  1EKZ A;  1WRJ A;  2L3J A;  1A1J A;  3AV0 A;  4BHC A;  2RQL A;  3HTX A;  4X8W A;  1IBL E;  2JY9 A;  2YSO A;  3HPS A;  5AAS A;  2EOM A;  4O43 A;  2FGG A;  2EOH A;  1WHQ A;  2EM0 A;  2RPC A;  3THO B;  2EM9 A;  4LF4 E;  1ZBQ A;  1ZBT A;  2F8B A;  1IMU A;  1TF6 A;  4ZYD A;  5IV8 B;  4ZYE A;  4JYA E;  2EOZ A;  2EML A;  3FIG A;  1BBO A;  5IT9 C;  2HJJ A;  2NA2 A;  4DV3 E;  4Q35 B;  4RHB B;  5A69 A;  1YPN A;  2EQ0 A;  4DV0 E;  4B3T E;  2LO3 A;  4X9J A;  3HPZ A;  2MKN A;  3UK3 C;  4M2Z A;  2EOF A;  4I8O A;  1A1G A;  1N32 E;  2YTG A;  2YRK A;  1X48 A;  4GEQ B;  1A1F A;  1TF3 A;  2EMY A;  4F54 A;  1A1H A;  1WHN A;  2YZT A;  2LT7 A;  2HGH A;  3T1H E;  4JI3 E;  1L4S A;  4JI5 E;  2L33 A;  1IBK E;  2R76 A;  4JI6 E;  3C4B A;  3EPK A;  2UXD E;  4M30 A;  2EPR A;  2YTQ A;  4R2P A;  1N36 E;  2M4I A;  3THN A;  1YYK A;  4O5G A;  1YUJ A;  1UHZ A;  4LF8 E;  2LMZ A;  3VK6 A;  1IBM E;  1YYW A;  1GTK A;  2V89 A;  4X66 E;  1YFH A;  4NHR A;  2H36 X;  1I94 E;  2YTI A;  2EN2 A;  1N3G A;  4JI0 E;  3ZOQ B;  1HNW E;  2V8Q B;  2F4V E;  3P1X A;  3IWC A;  2YTO A;  2JP9 A;  2DB2 A;  4NZV A;  2EMG A;  1N34 E;  4GZN C;  4BMJ A;  3EPJ A;  3C4T A;  2B3T B;  4DR7 E;  4RH8 A;  2EMI A;  2KHX A;  2EMA A;  2LTS A;  3ADL A;  2WBS A;  2PRT A;  2EMX A;  2K4V A;  3ADJ A;  1STU A;  2BBG A;  2ENA A;  4F9C B;  4WSP A;  4JI4 E;  2FTX B;  1BB8 A;  5LMU E;  1KYQ A;  4N4R B;  4WXD A;  1MGT A;  2EM5 A;  2Q8U A;  4DR2 E;  2EPA A;  2EM2 A;  5A6J A;  1T4O A;  2EM8 A;  2JR1 A;  4GKK E;  2YTD A;  1ZU1 A;  2LBS B;  1B69 A;  2E72 A;  4NXN E;  3MSW A;  2I13 A;  2EOI A;  2ELZ A;  4MLV A;  1PDA A;  2JPA A;  5LLQ A;  4JI1 E;  1G2D C;  1LLM C;  2EN6 A;  1UBD C;  4KWY A;  1X5W A;  2WZO A;  2EN4 A;  1YUI A;  1X6F A;  2YPN A;  2EPL X;  4O24 A;  4O4K A;  2EPM X;  1ZR9 A;  2EMZ A;  4HEI A;  2UUB E;  2YTN A;  1PJS A;  1AH5 A;  2B7T A;  2EOY A;  1DGC A;  2DSY A;  1X6E A;  1PJT A;  3F6H A;  1IQS A;  4DV4 E;  4ZYG A;  4R2A A;  2GHF A;  3OML A;  4LU9 A;  1YSA C;  3JU0 A;  4DV1 E;  4OX9 E;  5LMN E;  1T39 A;  1FJG E;  3ECR A;  2VRD A;  5BR8 E;  4DR4 E;  1SR9 A;  3BBG A;  2VQF E;  1J26 A;  2CT1 A;  2ELY A;  2G7H A;  2EM3 A;  4M9V C;  2D9H A;  2YWQ A;  2L2K B;  2DRP A;  2WCC 3;  3F6G A;  3J81 C;  2YTJ A;  1SFE A;  4LF9 E;  3ADG A;  4YHH E;  5AC4 A;  2JXP A;  3LML A;  3ADI A;  3J7A G;  5AE3 A;  2EOS A;  2M7Q A;  1PKP A;  4LF6 E;  2EOR A;  4DR1 E;  2EL6 A;  2EE8 A;  4BC7 A;  2NUF A;  2RSM A;  1NEI A;  3MHS C;  4IJD A;  1XMO E;  4MLQ A;  1XNR E;  3OTO E;  1P47 A;  4X65 E;  2EM4 A;  3C6M A;  4B3R E;  4DR6 E;  1EH8 A;  1X49 A;  1NCS A;  1RQ0 A;  2RS7 A;  1QU6 A;  1T4L B;  2N3G A;  2JOX A;  5IXM B;  2M1S A;  2L92 A;  5KL2 A;  2UUC E;  2EPZ A;  4R2R A;  2BB8 A;  2EMH A;  2HHH E;  4P7D A;  2EZ6 A;  2LCE A;  2LTR A;  2EPU A;  4J8Z A;  4BHB A;  2MC6 A;  2EPN A;  5CFF E;  2E1M A;  5AE1 A;  1Z1B A;  2LUP B;  3HQ1 A;  3J7Y p;  2DMY A;  5A6B A;  2EN7 A;  4GKJ E;  3T1Y E;  2EN1 A;  2EOX A;  2L2N A;  2MKD A;  4R2E A;  4ZYH A;  2L8T A;  2EPX A;  2LE2 A;  2WBT A;  2EMF A;  2YTE A;  4R2D A;  3KWR A;  2FV4 B;  2NUG A;  2LJU A;  4OOG C;  1T38 A;  4LF7 E;  3M99 B;  2R1F A;  3K6Q A;  4L8N A;  2DMI A;  1YYO A;  2A25 A;  2V85 A;  3JTZ A;  4LF5 E;  3DF6 A;  2EPO A;  4LTY A;  2ODR C;  5IWA E;  1XMQ E;  2EPC A;  5KL7 A;  2EL5 A;  2K7I A;  2YU8 A;  4LFA E;  4DR3 E;  5A6A A;  2IHR 1;  1G2F C;  2L2M A;  3BF2 A;  2GPI A;  3DJW A;  2YT4 A;  2EMB A;  2EJ4 A;  2EM6 A;  2YRM A;  4AQY E;  3EPL A;  4M0V A;  2ADR A;  2KOU A;  4WFT A;  2DGC A;  3RMP A;  4FK5 C;  2DLQ A;  1A1K A;  2HC5 A;  2EN8 A;  1UIL A;  1DQ3 A;  3EQ1 A;  2E5L E;  5KL5 A;  2VF1 A;  2EP3 A;  2WBU A;  2EMC A;  2JYA A;  5A2Q C;  3LLH A;  1HR0 E;  1YZ9 A;  5DNY A;  2YTF A;  1O0W A;  1TN9 A;  1GQE A;  4BS9 A;  1HNX E;  1RC7 A;  1GZ6 A;  2EL4 A;  2VE7 C;  2CSH A;  2EQ3 A;  1EH7 A;  1J5E E;  1X3C A;  2MDG A;  4P78 A;  5A6B D;  4B3S E;  3IWD A;  1F2I G;  1IQO A;  4LFB E;  1WXR A;  2JOB A;  2JWO A;  2MDR A;  4Q28 A;  2B7V A;  5KL4 A;  5KL6 A;  3BGH A;  2LRS A;  2CTD A;  4WPY A;  2ENH A;  1MEY C;  3J80 C;  2EPK X;  4JV5 E;  2UXC E;  3KZZ A;  3QG5 C;  4BCA A;  5FLX C;  1WJP A;  4L5N C;  2YU5 A;  1A1I A;  5A6K A;  1XNQ E;  4BC9 A;  4NXM E;  2YSP A;  2N8X A;  2DIX A;  4HTG A;  3KZY A;  4F6M A;  4F9B B;  4DUZ E;  1DI2 A;  4DUY E;  4TUG A;  4DV2 E;  2L3C A;  5KL3 A;  4JI8 E;  2NAB A;  2L6M A;  2EN3 A;  2UUA E;  4JI2 E;  2M9A A; 
#chains in the Genus database with same CATH homology
 3AUZ A;  3ADJ A;  1STU A;  2HHH E;  4P7D A;  4F9C B;  2EZ6 A;  4WSP A;  4LF4 E;  2LTR A;  1ZBQ A;  1ZBT A;  3JAM C;  2F8B A;  2FTX B;  4JI4 E;  4DUZ E;  4LFC E;  4J8Z A;  4R03 A;  2MC6 A;  2KON A;  5CFF E;  5LMU E;  4KZS A;  2E1M A;  3HXL A;  5AE1 A;  4JYA E;  4R8O A;  2LUP B;  3HQ1 A;  3J7Y p;  2DMY A;  3FIG A;  4GKJ E;  5IT9 C;  3T1Y E;  4DR2 E;  2L2N A;  2V87 A;  5LL6 R;  3ADL A;  3H09 A;  2L8T A;  3VYY A;  2ZM6 E;  1T4O A;  2NA2 A;  4DV3 E;  2JR1 A;  4GKK E;  2LE2 A;  3KWR A;  2LBS B;  2FV4 B;  2NUG A;  4X62 E;  4OOG C;  4NXN E;  4LF7 E;  3MSW A;  3IWB A;  3K6Q A;  4L8N A;  2V86 A;  4DKK A;  4JI1 E;  1YYO A;  4DV0 E;  4B3T E;  2JVA A;  2V85 A;  2N3H A;  3JTZ A;  4LF5 E;  3HPZ A;  3DF6 A;  4JI2 E;  4LTY A;  4M2Z A;  2ODR C;  4I8O A;  5IWA E;  2LJH A;  2WZO A;  1XMQ E;  1N32 E;  2RTX A;  1X48 A;  4LFA E;  4GEQ B;  2B9D A;  4DR3 E;  2IHR 1;  2L2M A;  3DJW A;  4F54 A;  2YT4 A;  1WHN A;  2YZT A;  2MC5 A;  4BBY A;  2UUB E;  2RS6 A;  4AQY E;  3T1H E;  2UUC E;  4M0V A;  4WFT A;  2KOU A;  2B7T A;  1N33 E;  3RMP A;  4WYQ B;  4JI3 E;  2DSY A;  1DQ3 A;  1UIL A;  2E5L E;  5T6J A;  2CPN A;  2VF1 A;  3F6H A;  4DV4 E;  1HNZ E;  4JI5 E;  2L33 A;  4X64 E;  1IBK E;  5A2Q C;  1HR0 E;  1T4N A;  3LLH A;  4YY3 E;  4B3M E;  3OML A;  3C4B A;  4LU9 A;  5DNY A;  1O0W A;  4JI6 E;  1YZ9 A;  3JU0 A;  4DV1 E;  4OX9 E;  3VYX A;  4K0K E;  5LMN E;  2UXD E;  1GQE A;  4DV7 E;  4M30 A;  1FJG E;  4BS9 A;  1DI2 A;  1HNX E;  1RC7 A;  1GZ6 A;  2EWL A;  5BR8 E;  1N36 E;  4DR4 E;  2M4I A;  2VE7 C;  1YYK A;  1SR9 A;  2LUQ A;  4KHP E;  2VQF E;  1J26 A;  5AE2 A;  2G7H A;  4TUI A;  1J5E E;  1UHZ A;  4P78 A;  4B3S E;  4LF8 E;  2LMZ A;  3IWD A;  2V83 A;  3VK6 A;  2L2K B;  4DMI A;  1FKA E;  1IBM E;  1YYW A;  4JI7 E;  1X47 A;  3F6G A;  2V89 A;  3J81 C;  4X66 E;  4DV5 E;  4LFB E;  1WXR A;  2JOB A;  5ADZ A;  2H36 X;  2MDR A;  2JWO A;  3ADG A;  4Q28 A;  4F9A B;  4YHH E;  1I94 E;  2V88 A;  4LF9 E;  4JI0 E;  3LML A;  3ZOQ B;  2NUE A;  3ADI A;  2ODR D;  2V8Q B;  5AE3 A;  3J7A G;  2F4V E;  2M7Q A;  1HNW E;  1PKP A;  2B7V A;  4LF6 E;  3P1X A;  2VQE E;  4DR1 E;  3IWC A;  2LRS A;  2UXB E;  4WPY A;  4DV6 E;  2UU9 E;  4BC7 A;  2DB2 A;  2NUF A;  2RSM A;  3J80 C;  4JV5 E;  1N34 E;  4DR5 E;  1IBL E;  2UXC E;  1XMO E;  5F3W A;  4BCA A;  4BMJ A;  1EKZ A;  5FLX C;  4L5N C;  1XNR E;  3C4T A;  3OTO E;  2B3T B;  2L3J A;  4BC9 A;  3AV0 A;  4X65 E;  4NXM E;  1XNQ E;  4B3R E;  4DR6 E;  1X49 A;  4DR7 E;  3HTX A;  2DIX A;  2KHX A;  4X8W A;  1RQ0 A;  2JY9 A;  2LTS A;  2RS7 A;  4F9B B;  4TUG A;  1QU6 A;  3HPS A;  4DUY E;  4DV2 E;  1T4L B;  5AAS A;  2L3C A;  2N3G A;  2JOX A;  4JI8 E;  2M1S A;  2L6M A;  2UUA E;  2FGG A;  2K4V A;  2L92 A;  1WHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...