4WPYA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
b'DHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wpyA01
2FGGA 4WPYA 4WSPA
chains in the Genus database with same CATH superfamily
2F4VE 1JK1A 2L3JA 3HQ1A 2EPXA 4YY3E 2FTXB 3BBGA 3AUZA 2EPAA 4GZNC 2EM2A 1MGTA 4DV2E 4R2EA 3F6GA 4BHBA 1A1KA 4WXDA 2EPPA 2L92A 2EWLA 2RS6A 1AH5A 2V89A 4FK5C 1YUJA 2EOIA 2UUCE 4LF8E 1Z1BA 1IQOA 3J7AG 2I13A 2YRHA 2LV2A 4DV3E 1XNRE 4DV0E 3AV0A 2YU5A 4LFBE 4F9BB 3LLHA 5KL4A 2V87A 3EPHA 1BBOA 2EOJA 3BGHA 2E72A 3HPSA 4DKKA 2EM3A 1ZBTA 2EORA 1QU6A 2EPKX 3C6KA 2LVHA 4F9CB 2UUAE 1UN6B 4LF4E 2WBSA 2ODRD 4P7DA 4LF9E 2CT1A 4MLQA 2L2NA 1STUA 2EP3A 4JI4E 2MDGA 2RQLA 3EPJA 4JV5E 2EPRA 4DR5E 5ADZA 2L2MA 3BIDA 2PRTA 1LLMC 2DMIA 2EMBA 3THOB 4DV7E 2V83A 4DR4E 1B69A 5KL5A 1EKZA 2ZM6E 5KL7A 3T1YE 5IWAE 4M9VC 4O43A 1XMOE 1SFEA 2EM9A 2NABA 2JYAA 1HNXE 2N3GA 3M99B 2EMCA 4LF7E 4BS9A 4JI8E 1RQ0A 3J81C 4O24A 2WZOA 4RH8A 1X47A 4DR7E 3FIGA 5A6AA 2DLQA 3VHTB 2LO3A 4X62E 4JI1E 4R2CA 5A6JA 4F9AB 4GKKE 3EQ1A 3K6QA 2EPOA 4KWYA 4M0VA 2EL6A 1P47A 2ENHA 2EM4A 3LMLA 1N36E 4M2ZA 4B3SE 2ELYA 4O4KA 1A1IA 4R8OA 1HR0E 2DIXA 1PKPA 5F3WA 4JI7E 2VQFE 1XMQE 1IBLE 1RC7A 2EE8A 2JOBA 4DV4E 4LU9A 2NUEA 1UILA 4KHPE 4P78A 1ZR9A 1KJKA 4F54A 5IXMB 4WYQB 1EH8A 2JY9A 4LFCE 2WBUA 4DR6E 3IWCA 2NUFA 3ADGA 4DR1E 2DGCA 1T4NA 2EMFA 3EPKA 4LF5E 2VQEE 4L5NC 1UBDC 2KOUA 4F6MA 2EOOA 2FV4B 1PJTA 2EM6A 5A2QC 4ZYHA 2EOXA 2V86A 3T1HE 3C4TA 2E5LE 3DF6A 1IBKE 2EOHA 2VF1A 2EOFA 5A69A 1YYKA 2EM0A 3KWRA 5T6JA 5KL2A 2JXPA 3HPZA 1A1JA 4BC7A 3HXLA 2Q8UA 2L33A 2M9AA 4TUIA 5AE1A 2LUPB 4X65E 4BBYA 2L2KB 4JI5E 1ZBQA 2EMWA 2GPIA 5LMNE 2CSHA 1J26A 2L3CA 3DJWA 1T4OA 3JAMC 2YRMA 4ZYDA 1F2IG 4WXCA 1PJQA 3H09A 3ZOQB 4RHBB 2EMHA 2R76A 2GLIA 3MHHC 5AASA 3BF2A 2K7IA 2RSIA 2EMIA 1WHQA 1T39A 2BB8A 4DUYE 1BB8A 2B7VA 3HTXA 1EH6A 1AAYA 4X8WA 2MKDA 4JI6E 4WSPA 2YTQA 3L00A 3P1XA 2UUBE 1NEIA 2JR1A 3ADJA 2E1MA 2UXCE 2M4IA 5AE2A 1TF6A 1HNZE 1PJSA 1WRJA 1HNWE 2V8QB 2A25A 4X66E 2UXDE 1PDAA 4BHCA 2EPUA 4X9JA 1DI2A 1TN9A 2EPCA 2KONA 2RTXA 4Q35B 3J80C 2ENCA 3JTZA 2UXBE 2EMGA 4M30A 4JI0E 2EOQA 2YTPA 5AC4A 2DB2A 1O0WA 5IT9C 2LBSB 2YWQA 2NUGA 2ELZA 2EMLA 2EQ3A 2LJUA 1YFHA 5DNYA 2IHR1 5KL6A 3C4BA 2YU8A 1G2DC 2EM7A 2LCEA 4LFAE 2M7QA 2JP9A 2DMYA 2EMYA 2EQ0A 2YZTA 1X3CA 2EQ1A 4R2AA 4DR2E 2J7JA 5AC5A 1YPNA 2LMZA 4OOGC 5KL3A 2YTDA 5LLQA 1IBME 1XNQE 1WXRA 5BR8E 2EMXA 2YRKA 4R2RA 1X6FA 2B9DA 2LJHA 3IWDA 3UK3C 2JWOA 2YTIA 2LTRA 2JOXA 1N33E 3OMLA 4JI2E 2JVAA 2YTOA 1FJGE 2EOSA 2WCC3 2ODRC 2EOZA 2R1FA 4JI3E 1A1GA 1GQEA 2EMKA 1EH7A 3JU0A 4B3TE 4OX9E 4DV5E 4ZYEA 4DUZE 4IJDA 1RMDA 2EN4A 1YUIA 4LF6E 2KHXA 2YTJA 4NXNE 1L4SA 4R2DA 3ADLA 1T38A 2EJ4A 4BC9A 1FKAE 2WBTA 2EPNA 2HGHA 2EM5A 4GEQB 3KZYA 4J8ZA 4NXME 2YTFA 2EZ6A 2EMAA 2MDRA 4AQYE 3THNA 1GZ6A 4R2SA 2EN2A 2FGGA 3J7Yp 2I9IA 5A6BD 2F8BA 5LL6R 1TF3A 1WJPA 1I94E 2HHHE 2LE2A 2RSMA 2H36X 2MC5A 2EMZA 2CTDA 2V85A 2EOYA 1A1FA 4Q28A 1T4LB 2B3TB 4TUGA 1N34E 1WHNA 4L8NA 4I8OA 2N3HA 2YT4A 1N32E 4NZVA 4GKJE 1A1LA 4HTGA 2EM8A 2HJJA 4B3RE 1J5EE 2EPZA 2LUQA 1N3GA 1YZ9A 4NHRA 3F6HA 1ZAAC 4DMIA 1X6EA 2ADRA 4YHHE 2EN1A 1X49A 2V88A 2MKNA 2EPMX 2UU9E 2LRSA 2D9HA 1UHZA 2N8XA 2YPNA 4MLVA 1YYWA 3VYYA 2LT7A 4JYAE 3C6MA 4DR3E 1BBGA 4R03A 2YSPA 2YTGA 2EN6A 1A1HA 2G7HA 4B3ME 2DRPA 1MEYC 4X64E 2VRDA 2HC5A 4R2PA 3RMPA 2LTSA 4LTYA 4DV6E 2ENAA 1SR9A 1IMUA 2EN7A 2EPLX 3VYXA 5AE3A 2JPAA 4BCAA 2M1SA 4DV1E 1YYOA 2CPNA 4WPYA 3EPLA 1QNTA 5IV8B 1ZU1A 4WX9A 2B7TA 5CFFE 2EN3A 2VE7C 3TQMA 1DGCA 1DQ3A 1X5WA 2YTNA 4WFTA 5A6KA 3MHSC 2YSOA 4F2JC 1YSAC 3ADIA 4BMJA 1X6HA 2BBGA 4HEIA 2NA2A 3VK6A 4N4RB 2GHFA 2EL5A 2RS7A 2EOEA 4O5GA 3KZZA 1IQSA 2EOMA 4KZSA 1KYQA 3QG5C 3IWBA 4K0KE 2EN8A 2DSYA 5A6BA 4IS1C 3ECRA 5FLXC 1JK2A 2L6MA 2RPCA 5LMUE 2YTEA 2K4VA 4ZYGA 2L8TA 3MSWA 4R2QA 3OTOE 2DLKA 4F6NA 5TSEA 2EL4A 1NCSA 2MC6A 4WSGA 1G2FC 1X48A 1GTKA
chains in the Genus database with same CATH topology
2F4VE 4R8OA 2B3TB 4TUGA 1N34E 2DIXA 2L3JA 1HR0E 1WHNA 3HQ1A 1PKPA 4YY3E 4L8NA 1DI2A 5F3WA 2FTXB 4JI7E 3AUZA 4I8OA 2VQFE 2N3HA 1XMQE 2YT4A 1RC7A 1IBLE 2KONA 1N32E 2RTXA 3J80C 4GKJE 2JOBA 3JTZA 4DV4E 4B3RE 4LU9A 4DV2E 2NUEA 1J5EE 2UXBE 1UILA 2LUQA 4KHPE 1YZ9A 4M30A 4JI0E 3F6GA 4P78A 2L92A 2EWLA 2DB2A 4F54A 1O0WA 2RS6A 3F6HA 2V89A 4WYQB 2LBSB 5IT9C 4DMIA 2NUGA 4YHHE 2JY9A 1X49A 2V88A 2UUCE 4LF8E 4LFCE 2UU9E 4X66E 3IWCA 2NUFA 4DR6E 3ADGA 2IHR1 5DNYA 3C4BA 4DR1E 1T4NA 3J7AG 2LRSA 4LFAE 4LF5E 2VQEE 1UHZA 2M7QA 4DV3E 4L5NC 1YYWA 1XNRE 2KOUA 4DV0E 2FV4B 3VYYA 3AV0A 5A2QC 2DMYA 4JYAE 4LFBE 2V86A 3T1HE 3C4TA 4F9BB 2YZTA 3LLHA 4DR3E 2V87A 3DF6A 4R03A 1IBKE 2E5LE 4DR2E 2VF1A 3HPSA 4DKKA 1YYKA 1ZBTA 2G7HA 2LMZA 1QU6A 3KWRA 5T6JA 4OOGC 4B3ME 4X64E 1IBME 1XNQE 1WXRA 3RMPA 2UUAE 4F9CB 2LTSA 5BR8E 3HPZA 4LF4E 2ODRD 4P7DA 4LTYA 4LF9E 4DV6E 2B9DA 1SR9A 1STUA 2L2NA 2LJHA 3IWDA 4BC7A 2JWOA 3HXLA 3VYXA 4JI4E 2L33A 2UXDE 2LTRA 4TUIA 2JOXA 5AE3A 4JV5E 3OMLA 4BCAA 5AE1A 2M1SA 2JVAA 4JI2E 4DR5E 4DV1E 1N33E 5ADZA 2LUPB 2L2MA 4X65E 2CPNA 1YYOA 4WPYA 4BBYA 1FJGE 2L2KB 4JI5E 2ODRC 2B7TA 1ZBQA 5CFFE 2VE7C 5LMNE 1DQ3A 4WFTA 4JI3E 4DV7E 2L3CA 2V83A 4DR4E 1GQEA 3DJWA 1T4OA 3JAMC 1J26A 3JU0A 4B3TE 3ADIA 4BMJA 1EKZA 4OX9E 3VK6A 2NA2A 4DV5E 4DUZE 2ZM6E 3T1YE 5IWAE 4LF6E 2KHXA 3H09A 3ZOQB 4NXNE 1XMOE 3ADLA 2RS7A 4BC9A 1FKAE 5AASA 1HNXE 2N3GA 4KZSA 4LF7E 4BS9A 4JI8E 1RQ0A 1WHQA 3J81C 2WZOA 3IWBA 4K0KE 4GEQB 4J8ZA 2DSYA 4NXME 1X47A 2EZ6A 2MDRA 4DR7E 4DUYE 4AQYE 3FIGA 5FLXC 2B7VA 3HTXA 1GZ6A 2L6MA 1N36E 5LMUE 2FGGA 4X8WA 3J7Yp 4X62E 4JI1E 2K4VA 2L8TA 3MSWA 4JI6E 2F8BA 4WSPA 5LL6R 4F9AB 4GKKE 3OTOE 3P1XA 3K6QA 2UUBE 1I94E 2JR1A 3ADJA 2E1MA 2LE2A 2HHHE 4M0VA 2UXCE 2M4IA 2MC6A 2RSMA 5AE2A 2H36X 2MC5A 1HNZE 2V85A 1HNWE 3LMLA 2V8QB 4Q28A 4M2ZA 4B3SE 1X48A 1T4LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WPY A;  4WSP A; 
#chains in the Genus database with same CATH topology
 2F4V E;  1JK1 A;  2L3J A;  3HQ1 A;  2EPX A;  4YY3 E;  2FTX B;  3BBG A;  3AUZ A;  2EPA A;  4GZN C;  2EM2 A;  1MGT A;  4DV2 E;  4R2E A;  3F6G A;  4BHB A;  1A1K A;  4WXD A;  2EPP A;  2L92 A;  2EWL A;  2RS6 A;  1AH5 A;  2V89 A;  4FK5 C;  1YUJ A;  2EOI A;  2UUC E;  4LF8 E;  1Z1B A;  1IQO A;  3J7A G;  2I13 A;  2YRH A;  2LV2 A;  4DV3 E;  1XNR E;  4DV0 E;  3AV0 A;  2YU5 A;  4LFB E;  4F9B B;  3LLH A;  5KL4 A;  2V87 A;  3EPH A;  1BBO A;  2EOJ A;  3BGH A;  2E72 A;  3HPS A;  4DKK A;  2EM3 A;  1ZBT A;  2EOR A;  1QU6 A;  2EPK X;  3C6K A;  2LVH A;  4F9C B;  2UUA E;  1UN6 B;  4LF4 E;  2WBS A;  2ODR D;  4P7D A;  4LF9 E;  2CT1 A;  4MLQ A;  2L2N A;  1STU A;  2EP3 A;  4JI4 E;  2MDG A;  2RQL A;  3EPJ A;  4JV5 E;  2EPR A;  4DR5 E;  5ADZ A;  2L2M A;  3BID A;  2PRT A;  1LLM C;  2DMI A;  2EMB A;  3THO B;  4DV7 E;  2V83 A;  4DR4 E;  1B69 A;  5KL5 A;  1EKZ A;  2ZM6 E;  5KL7 A;  3T1Y E;  5IWA E;  4M9V C;  4O43 A;  1XMO E;  1SFE A;  2EM9 A;  2NAB A;  2JYA A;  1HNX E;  2N3G A;  3M99 B;  2EMC A;  4LF7 E;  4BS9 A;  4JI8 E;  1RQ0 A;  3J81 C;  4O24 A;  2WZO A;  4RH8 A;  1X47 A;  4DR7 E;  3FIG A;  5A6A A;  2DLQ A;  3VHT B;  2LO3 A;  4X62 E;  4JI1 E;  4R2C A;  5A6J A;  4F9A B;  4GKK E;  3EQ1 A;  3K6Q A;  2EPO A;  4KWY A;  4M0V A;  2EL6 A;  1P47 A;  2ENH A;  2EM4 A;  3LML A;  1N36 E;  4M2Z A;  4B3S E;  2ELY A;  4O4K A;  1A1I A;  4R8O A;  1HR0 E;  2DIX A;  1PKP A;  5F3W A;  4JI7 E;  2VQF E;  1XMQ E;  1IBL E;  1RC7 A;  2EE8 A;  2JOB A;  4DV4 E;  4LU9 A;  2NUE A;  1UIL A;  4KHP E;  4P78 A;  1ZR9 A;  1KJK A;  4F54 A;  5IXM B;  4WYQ B;  1EH8 A;  2JY9 A;  4LFC E;  2WBU A;  4DR6 E;  3IWC A;  2NUF A;  3ADG A;  4DR1 E;  2DGC A;  1T4N A;  2EMF A;  3EPK A;  4LF5 E;  2VQE E;  4L5N C;  1UBD C;  2KOU A;  4F6M A;  2EOO A;  2FV4 B;  1PJT A;  2EM6 A;  5A2Q C;  4ZYH A;  2EOX A;  2V86 A;  3T1H E;  3C4T A;  2E5L E;  3DF6 A;  1IBK E;  2EOH A;  2VF1 A;  2EOF A;  5A69 A;  1YYK A;  2EM0 A;  3KWR A;  5T6J A;  5KL2 A;  2JXP A;  3HPZ A;  1A1J A;  4BC7 A;  3HXL A;  2Q8U A;  2L33 A;  2M9A A;  4TUI A;  5AE1 A;  2LUP B;  4X65 E;  4BBY A;  2L2K B;  4JI5 E;  1ZBQ A;  2EMW A;  2GPI A;  5LMN E;  2CSH A;  1J26 A;  2L3C A;  3DJW A;  1T4O A;  3JAM C;  2YRM A;  4ZYD A;  1F2I G;  4WXC A;  1PJQ A;  3H09 A;  3ZOQ B;  4RHB B;  2EMH A;  2R76 A;  2GLI A;  3MHH C;  5AAS A;  3BF2 A;  2K7I A;  2RSI A;  2EMI A;  1WHQ A;  1T39 A;  2BB8 A;  4DUY E;  1BB8 A;  2B7V A;  3HTX A;  1EH6 A;  1AAY A;  4X8W A;  2MKD A;  4JI6 E;  4WSP A;  2YTQ A;  3L00 A;  3P1X A;  2UUB E;  1NEI A;  2JR1 A;  3ADJ A;  2E1M A;  2UXC E;  2M4I A;  5AE2 A;  1TF6 A;  1HNZ E;  1PJS A;  1WRJ A;  1HNW E;  2V8Q B;  2A25 A;  4X66 E;  2UXD E;  1PDA A;  4BHC A;  2EPU A;  4X9J A;  1DI2 A;  1TN9 A;  2EPC A;  2KON A;  2RTX A;  4Q35 B;  3J80 C;  2ENC A;  3JTZ A;  2UXB E;  2EMG A;  4M30 A;  4JI0 E;  2EOQ A;  2YTP A;  5AC4 A;  2DB2 A;  1O0W A;  5IT9 C;  2LBS B;  2YWQ A;  2NUG A;  2ELZ A;  2EML A;  2EQ3 A;  2LJU A;  1YFH A;  5DNY A;  2IHR 1;  5KL6 A;  3C4B A;  2YU8 A;  1G2D C;  2EM7 A;  2LCE A;  4LFA E;  2M7Q A;  2JP9 A;  2DMY A;  2EMY A;  2EQ0 A;  2YZT A;  1X3C A;  2EQ1 A;  4R2A A;  4DR2 E;  2J7J A;  5AC5 A;  1YPN A;  2LMZ A;  4OOG C;  5KL3 A;  2YTD A;  5LLQ A;  1IBM E;  1XNQ E;  1WXR A;  5BR8 E;  2EMX A;  2YRK A;  4R2R A;  1X6F A;  2B9D A;  2LJH A;  3IWD A;  3UK3 C;  2JWO A;  2YTI A;  2LTR A;  2JOX A;  1N33 E;  3OML A;  4JI2 E;  2JVA A;  2YTO A;  1FJG E;  2EOS A;  2WCC 3;  2ODR C;  2EOZ A;  2R1F A;  4JI3 E;  1A1G A;  1GQE A;  2EMK A;  1EH7 A;  3JU0 A;  4B3T E;  4OX9 E;  4DV5 E;  4ZYE A;  4DUZ E;  4IJD A;  1RMD A;  2EN4 A;  1YUI A;  4LF6 E;  2KHX A;  2YTJ A;  4NXN E;  1L4S A;  4R2D A;  3ADL A;  1T38 A;  2EJ4 A;  4BC9 A;  1FKA E;  2WBT A;  2EPN A;  2HGH A;  2EM5 A;  4GEQ B;  3KZY A;  4J8Z A;  4NXM E;  2YTF A;  2EZ6 A;  2EMA A;  2MDR A;  4AQY E;  3THN A;  1GZ6 A;  4R2S A;  2EN2 A;  2FGG A;  3J7Y p;  2I9I A;  5A6B D;  2F8B A;  5LL6 R;  1TF3 A;  1WJP A;  1I94 E;  2HHH E;  2LE2 A;  2RSM A;  2H36 X;  2MC5 A;  2EMZ A;  2CTD A;  2V85 A;  2EOY A;  1A1F A;  4Q28 A;  1T4L B;  2B3T B;  4TUG A;  1N34 E;  1WHN A;  4L8N A;  4I8O A;  2N3H A;  2YT4 A;  1N32 E;  4NZV A;  4GKJ E;  1A1L A;  4HTG A;  2EM8 A;  2HJJ A;  4B3R E;  1J5E E;  2EPZ A;  2LUQ A;  1N3G A;  1YZ9 A;  4NHR A;  3F6H A;  1ZAA C;  4DMI A;  1X6E A;  2ADR A;  4YHH E;  2EN1 A;  1X49 A;  2V88 A;  2MKN A;  2EPM X;  2UU9 E;  2LRS A;  2D9H A;  1UHZ A;  2N8X A;  2YPN A;  4MLV A;  1YYW A;  3VYY A;  2LT7 A;  4JYA E;  3C6M A;  4DR3 E;  1BBG A;  4R03 A;  2YSP A;  2YTG A;  2EN6 A;  1A1H A;  2G7H A;  4B3M E;  2DRP A;  1MEY C;  4X64 E;  2VRD A;  2HC5 A;  4R2P A;  3RMP A;  2LTS A;  4LTY A;  4DV6 E;  2ENA A;  1SR9 A;  1IMU A;  2EN7 A;  2EPL X;  3VYX A;  5AE3 A;  2JPA A;  4BCA A;  2M1S A;  4DV1 E;  1YYO A;  2CPN A;  4WPY A;  3EPL A;  1QNT A;  5IV8 B;  1ZU1 A;  4WX9 A;  2B7T A;  5CFF E;  2EN3 A;  2VE7 C;  3TQM A;  1DGC A;  1DQ3 A;  1X5W A;  2YTN A;  4WFT A;  5A6K A;  3MHS C;  2YSO A;  4F2J C;  1YSA C;  3ADI A;  4BMJ A;  1X6H A;  2BBG A;  4HEI A;  2NA2 A;  3VK6 A;  4N4R B;  2GHF A;  2EL5 A;  2RS7 A;  2EOE A;  4O5G A;  3KZZ A;  1IQS A;  2EOM A;  4KZS A;  1KYQ A;  3QG5 C;  3IWB A;  4K0K E;  2EN8 A;  2DSY A;  5A6B A;  4IS1 C;  3ECR A;  5FLX C;  1JK2 A;  2L6M A;  2RPC A;  5LMU E;  2YTE A;  2K4V A;  4ZYG A;  2L8T A;  3MSW A;  4R2Q A;  3OTO E;  2DLK A;  4F6N A;  5TSE A;  2EL4 A;  1NCS A;  2MC6 A;  4WSG A;  1G2F C;  1X48 A;  1GTK A; 
#chains in the Genus database with same CATH homology
 2F4V E;  4R8O A;  2B3T B;  4TUG A;  1N34 E;  2DIX A;  2L3J A;  1HR0 E;  1WHN A;  3HQ1 A;  1PKP A;  4YY3 E;  4L8N A;  1DI2 A;  5F3W A;  2FTX B;  4JI7 E;  3AUZ A;  4I8O A;  2VQF E;  2N3H A;  1XMQ E;  2YT4 A;  1RC7 A;  1IBL E;  2KON A;  1N32 E;  2RTX A;  3J80 C;  4GKJ E;  2JOB A;  3JTZ A;  4DV4 E;  4B3R E;  4LU9 A;  4DV2 E;  2NUE A;  1J5E E;  2UXB E;  1UIL A;  2LUQ A;  4KHP E;  1YZ9 A;  4M30 A;  4JI0 E;  3F6G A;  4P78 A;  2L92 A;  2EWL A;  2DB2 A;  4F54 A;  1O0W A;  2RS6 A;  3F6H A;  2V89 A;  4WYQ B;  2LBS B;  5IT9 C;  4DMI A;  2NUG A;  4YHH E;  2JY9 A;  1X49 A;  2V88 A;  2UUC E;  4LF8 E;  4LFC E;  2UU9 E;  4X66 E;  3IWC A;  2NUF A;  4DR6 E;  3ADG A;  2IHR 1;  5DNY A;  3C4B A;  4DR1 E;  1T4N A;  3J7A G;  2LRS A;  4LFA E;  4LF5 E;  2VQE E;  1UHZ A;  2M7Q A;  4DV3 E;  4L5N C;  1YYW A;  1XNR E;  2KOU A;  4DV0 E;  2FV4 B;  3VYY A;  3AV0 A;  5A2Q C;  2DMY A;  4JYA E;  4LFB E;  2V86 A;  3T1H E;  3C4T A;  4F9B B;  2YZT A;  3LLH A;  4DR3 E;  2V87 A;  3DF6 A;  4R03 A;  1IBK E;  2E5L E;  4DR2 E;  2VF1 A;  3HPS A;  4DKK A;  1YYK A;  1ZBT A;  2G7H A;  2LMZ A;  1QU6 A;  3KWR A;  5T6J A;  4OOG C;  4B3M E;  4X64 E;  1IBM E;  1XNQ E;  1WXR A;  3RMP A;  2UUA E;  4F9C B;  2LTS A;  5BR8 E;  3HPZ A;  4LF4 E;  2ODR D;  4P7D A;  4LTY A;  4LF9 E;  4DV6 E;  2B9D A;  1SR9 A;  1STU A;  2L2N A;  2LJH A;  3IWD A;  4BC7 A;  2JWO A;  3HXL A;  3VYX A;  4JI4 E;  2L33 A;  2UXD E;  2LTR A;  4TUI A;  2JOX A;  5AE3 A;  4JV5 E;  3OML A;  4BCA A;  5AE1 A;  2M1S A;  2JVA A;  4JI2 E;  4DR5 E;  4DV1 E;  1N33 E;  5ADZ A;  2LUP B;  2L2M A;  4X65 E;  2CPN A;  1YYO A;  4WPY A;  4BBY A;  1FJG E;  2L2K B;  4JI5 E;  2ODR C;  2B7T A;  1ZBQ A;  5CFF E;  2VE7 C;  5LMN E;  1DQ3 A;  4WFT A;  4JI3 E;  4DV7 E;  2L3C A;  2V83 A;  4DR4 E;  1GQE A;  3DJW A;  1T4O A;  3JAM C;  1J26 A;  3JU0 A;  4B3T E;  3ADI A;  4BMJ A;  1EKZ A;  4OX9 E;  3VK6 A;  2NA2 A;  4DV5 E;  4DUZ E;  2ZM6 E;  3T1Y E;  5IWA E;  4LF6 E;  2KHX A;  3H09 A;  3ZOQ B;  4NXN E;  1XMO E;  3ADL A;  2RS7 A;  4BC9 A;  1FKA E;  5AAS A;  1HNX E;  2N3G A;  4KZS A;  4LF7 E;  4BS9 A;  4JI8 E;  1RQ0 A;  1WHQ A;  3J81 C;  2WZO A;  3IWB A;  4K0K E;  4GEQ B;  4J8Z A;  2DSY A;  4NXM E;  1X47 A;  2EZ6 A;  2MDR A;  4DR7 E;  4DUY E;  4AQY E;  3FIG A;  5FLX C;  2B7V A;  3HTX A;  1GZ6 A;  2L6M A;  1N36 E;  5LMU E;  2FGG A;  4X8W A;  3J7Y p;  4X62 E;  4JI1 E;  2K4V A;  2L8T A;  3MSW A;  4JI6 E;  2F8B A;  4WSP A;  5LL6 R;  4F9A B;  4GKK E;  3OTO E;  3P1X A;  3K6Q A;  2UUB E;  1I94 E;  2JR1 A;  3ADJ A;  2E1M A;  2LE2 A;  2HHH E;  4M0V A;  2UXC E;  2M4I A;  2MC6 A;  2RSM A;  5AE2 A;  2H36 X;  2MC5 A;  1HNZ E;  2V85 A;  1HNW E;  3LML A;  2V8Q B;  4Q28 A;  4M2Z A;  4B3S E;  1X48 A;  1T4L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...