4WPYA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
DHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
total genus 22
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wpyA01
2FGGA 4WSPA 4WPYA
chains in the Genus database with same CATH superfamily
2L2KB 2NA2A 4Q28A 2JR1A 2VRDA 5KL2A 2EPNA 2JYAA 2EM5A 3KZZA 4R2EA 1TF6A 2GHFA 3FIGA 4MLQA 2ENHA 2EMIA 2DIXA 2EOYA 4DV1E 4R2RA 2RS6A 5A6BD 2B7TA 2JP9A 2EMZA 2JOBA 1F2IG 1YUJA 3HXLA 2L92A 3LLHA 4ZYEA 1T38A 2V88A 4RHBB 4FK5C 1I94E 2EOEA 4P78A 3VYYA 4X9JA 2LMZA 1N36E 2N3HA 2L2NA 1TN9A 1DQ3A 1JK1A 2ODRD 4R2SA 4NHRA 3EQ1A 2DLQA 1ZBTA 2JVAA 4B3ME 3KWRA 4HTGA 2YRHA 2UXCE 2EM8A 2ENAA 1JK2A 3EPHA 2EPLX 4KZSA 2K4VA 2DB2A 3ADJA 2MDGA 3DF6A 2YPNA 1UHZA 2VQFE 4DV7E 1DGCA 1RC7A 1NEIA 5TSEA 1O0WA 3THOB 2EN8A 4WPYA 1XMQE 4DR2E 4BHCA 2CSHA 4OOGC 4GZNC 4B3SE 2EQ3A 4KHPE 2YU8A 3VYXA 2YTOA 1YYKA 2HJJA 2MC6A 1X47A 2ZM6E 1J26A 4L8NA 4R2PA 2N8XA 4F2JC 5IV8B 5A6AA 5T6JA 4WSPA 2EN2A 2B3TB 2L2MA 4WXDA 3RMPA 4WSGA 2EJ4A 2L33A 2UU9E 2EZ6A 5KL6A 1GTKA 5BR8E 2L6MA 2LCEA 1A1IA 2R1FA 3MHSC 4ZYHA 2EL5A 2UUCE 2UXDE 1IQOA 1IBLE 2YTGA 3H09A 4X66E 4F6NA 2EWLA 2EN6A 2EM4A 4R03A 1IBKE 2DLKA 5F3WA 2JY9A 4LF9E 2EMCA 4JI1E 1PJSA 4X64E 4BHBA 3TQMA 2ELZA 2NUGA 1WHNA 4BMJA 2M9AA 1Z1BA 5CFFE 2WBUA 1G2DC 1UN6B 2YSPA 4LU9A 2V85A 1YYWA 1BBGA 3KZYA 3ADLA 2EPCA 2L3CA 2EPPA 1UBDC 2LVHA 1SR9A 2YTQA 4NXME 4DR6E 2EPZA 4RH8A 2LUQA 2EOZA 4DR5E 4LF4E 4KWYA 1XNRE 4M30A 1XMOE 2EMGA 3C4BA 2EPRA 1X3CA 2UUBE 4LF5E 2E1MA 2EMHA 5IXMB 1HNXE 3QG5C 4GKKE 4DUYE 3L00A 1RMDA 4GEQB 4B3TE 2YSOA 4JV5E 1YZ9A 2V83A 5A6JA 2EOJA 4X8WA 2L8TA 4JI0E 1NCSA 3C6KA 5KL7A 2ENCA 2HC5A 2EPMX 4JYAE 4WFTA 4DV5E 4MLVA 2JPAA 2GLIA 1EH7A 3BF2A 4DR4E 4F54A 2MDRA 1ZAAC 2EOFA 2EN7A 5LLQA 2EQ0A 1L4SA 3K6QA 3MSWA 3ADGA 4GKJE 4NXNE 2M4IA 1FJGE 5FLXC 1BB8A 3AUZA 3OMLA 2E5LE 4Q35B 2EQ1A 5AASA 2YTIA 2CTDA 4JI4E 2B9DA 1A1KA 2EPUA 4JI3E 4LF7E 2LE2A 2EOHA 5KL4A 5A6BA 1P47A 2NUEA 2YTJA 5ADZA 2VF1A 2EORA 2L3JA 2F4VE 2EOMA 2EPOA 1HNZE 1WRJA 2FV4B 3VHTB 2LJUA 4YY3E 3IWBA 1YYOA 1SFEA 1T4OA 2YU5A 3VK6A 4JI8E 4P7DA 2ADRA 4BC9A 5LL6R 3LMLA 2PRTA 2EP3A 2B7VA 2A25A 3BBGA 4R8OA 1GZ6A 1T39A 4DV0E 4BCAA 3EPLA 1A1HA 1PJQA 4TUIA 4YHHE 2RSMA 5AC5A 2UUAE 4LF8E 2JWOA 2EL6A 4WYQB 2EE8A 1X5WA 4I8OA 2DMIA 2WBSA 1A1JA 1IBME 4DKKA 3BIDA 1FKAE 2KOUA 4R2CA 1ZU1A 2VQEE 5A2QC 2EL4A 3J7Yp 3F6GA 2NUFA 2J7JA 4M0VA 4F9BB 4TUGA 5KL3A 1YFHA 4DV4E 2RPCA 1EH8A 1ZR9A 2ELYA 2EMFA 2EM9A 2KHXA 2EMAA 4WXCA 2EMWA 1J5EE 1PDAA 1RQ0A 1T4LB 2RS7A 2YTEA 1EH6A 4O5GA 4O4KA 4R2DA 4B3RE 1QU6A 2JXPA 3JU0A 1N3GA 4BC7A 1BBOA 4F9CB 2EMYA 3T1YE 4R2AA 1YSAC 2N3GA 4DR1E 1HNWE 1PKPA 4IJDA 2F8BA 2NABA 3BGHA 4NZVA 2HHHE 3P1XA 2EN1A 2M7QA 4N4RB 3HTXA 5AE1A 3HPZA 1X6HA 5AC4A 2LJHA 3ZOQB 4LFAE 1MEYC 4DV6E 1XNQE 4X65E 2M1SA 4LFCE 2MC5A 4JI6E 3J80C 4IS1C 2EOQA 4X62E 4ZYDA 3ECRA 2FTXB 4O43A 1QNTA 1ZBQA 2VE7C 2EPKX 4F9AB 5KL5A 2LT7A 2LTRA 1KYQA 1WXRA 4OX9E 2EN3A 4K0KE 2V8QB 2YTFA 2E72A 3EPKA 1HR0E 3AV0A 2YTNA 2JOXA 2DMYA 2YRMA 2CPNA 3IWCA 2EOOA 4DUZE 3M99B 4R2QA 2YZTA 2LRSA 2LV2A 4F6MA 1WHQA 4DR3E 1T4NA 4DR7E 5IWAE 5LMUE 2V87A 1GQEA 3T1HE 1A1FA 2IHR1 5A69A 1G2FC 2WBTA 2KONA 4BBYA 2BB8A 4LTYA 1N34E 1IMUA 3UK3C 1N32E 2DRPA 2LO3A 3HPSA 3C6MA 2UXBE 4DV2E 5IT9C 2ODRC 4LFBE 2DGCA 2WZOA 2EPXA 2YTPA 3IWDA 1AAYA 4ZYGA 2LBSB 3C4TA 1STUA 2V89A 3THNA 1MGTA 4L5NC 1KJKA 1AH5A 1PJTA 2EM2A 2EM0A 5LMNE 2EPAA 1A1LA 3EPJA 1N33E 1YUIA 3MHHC 4HEIA 2YTDA 2YWQA 4LF6E 4WX9A 2MKNA 1UILA 1X6FA 1X6EA 1WJPA 4JI5E 5AE2A 2EM7A 3F6HA 2WCC3 1A1GA 2EM3A 2EM6A 4JI2E 4M2ZA 2DSYA 2H36X 1LLMC 2RSIA 3HQ1A 2LTSA 4O24A 5A6KA 2RTXA 1YPNA 2D9HA 2BBGA 2K7IA 2EOIA 4J8ZA 5DNYA 4M9VC 2EOSA 1EKZA 3DJWA 1B69A 4AQYE 1TF3A 2EMLA 1IQSA 3ADIA 2EMBA 4JI7E 2LUPB 4DMIA 2V86A 2YRKA 2G7HA 2CT1A 2MKDA 2RQLA 3JTZA 1DI2A 2I9IA 3JAMC 2EMKA 2GPIA 2I13A 1X48A 2R76A 1X49A 2YT4A 3OTOE 2EOXA 2EN4A 2FGGA 2Q8UA 3J81C 4BS9A 2HGHA 3J7AG 2EMXA 5AE3A 4DV3E
chains in the Genus database with same CATH topology
2L2KB 2NA2A 4R03A 2V8QB 4P7DA 4Q28A 4JI8E 1IBKE 2JR1A 4BC9A 5LL6R 5F3WA 1YYWA 2JY9A 3LMLA 1HR0E 3AV0A 4LF9E 2B7VA 2JOXA 2DMYA 4JI1E 2CPNA 3IWCA 3FIGA 4R8OA 4X64E 1GZ6A 4DUZE 2DIXA 2NUGA 2YZTA 2LRSA 4DV0E 4DV1E 1WHNA 4BMJA 4BCAA 2RS6A 5CFFE 4TUIA 4YHHE 1WHQA 2B7TA 2JOBA 1T4NA 2RSMA 4DR3E 2UUAE 4LF8E 4DR7E 2JWOA 4LU9A 2V85A 5IWAE 2V87A 1GQEA 4WYQB 3HXLA 2L92A 2IHR1 4I8OA 3LLHA 5LMUE 3T1HE 3ADLA 2V88A 1IBME 4DKKA 2KONA 4BBYA 1FKAE 2KOUA 4LTYA 1I94E 4P78A 2L3CA 3VYYA 1N34E 2VQEE 1SR9A 2LMZA 1N36E 2N3HA 4NXME 2L2NA 1N32E 4DR6E 2LUQA 5A2QC 1DQ3A 3J7Yp 2ODRD 3HPSA 4DR5E 4LF4E 2UXBE 4DV2E 1XNRE 5IT9C 3F6GA 2ODRC 1ZBTA 2JVAA 2NUFA 3KWRA 4B3ME 4LFBE 4M30A 2WZOA 4M0VA 3C4BA 1XMOE 4F9BB 2UUBE 4LF5E 4TUGA 2UXCE 2E1MA 3IWDA 2LBSB 4DV4E 1HNXE 4GKKE 3C4TA 1STUA 2V89A 4DUYE 4KZSA 2K4VA 2DB2A 2KHXA 4L5NC 4GEQB 4B3TE 4JV5E 1YZ9A 5LMNE 2V83A 3ADJA 3DF6A 1UHZA 1J5EE 1N33E 2VQFE 4DV7E 1RC7A 4X8WA 2L8TA 4JI0E 1RQ0A 1O0WA 1T4LB 4WPYA 1XMQE 4DR2E 2RS7A 4LF6E 4B3RE 1UILA 4JI5E 4JYAE 5AE2A 1QU6A 3JU0A 4WFTA 3F6HA 4DV5E 4OOGC 4BC7A 4M2ZA 4JI2E 4F9CB 4B3SE 3T1YE 4DR4E 2DSYA 4F54A 3VYXA 2H36X 2N3GA 4KHPE 4DR1E 1HNWE 3HQ1A 1PKPA 2MDRA 1YYKA 2LTSA 2F8BA 2MC6A 1X47A 2ZM6E 1J26A 2HHHE 3P1XA 2RTXA 4L8NA 2M7QA 3K6QA 3MSWA 3ADGA 5DNYA 4J8ZA 3HTXA 5AE1A 4NXNE 2M4IA 3HPZA 5FLXC 1FJGE 3AUZA 4K0KE 4GKJE 1EKZA 5T6JA 3DJWA 3OMLA 4WSPA 4AQYE 2L2MA 2B3TB 2LJHA 3ZOQB 4LFAE 3RMPA 2E5LE 4DV6E 1XNQE 2L33A 2UU9E 2EZ6A 4X65E 3ADIA 5AASA 2M1SA 4JI7E 5BR8E 2LUPB 4LFCE 2MC5A 4JI6E 2L6MA 2B9DA 3J80C 4JI4E 4DMIA 2V86A 4X62E 2G7HA 4JI3E 4LF7E 2LE2A 2NUEA 3JTZA 2FTXB 5ADZA 1DI2A 3JAMC 1ZBQA 1X48A 2VF1A 2YT4A 1X49A 2L3JA 2VE7C 3OTOE 2UUCE 2F4VE 2UXDE 1HNZE 2FGGA 2FV4B 3J81C 4BS9A 4F9AB 4YY3E 1IBLE 3IWBA 1YYOA 3J7AG 3H09A 2LTRA 4X66E 5AE3A 1WXRA 1T4OA 4OX9E 2EWLA 4DV3E 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WSP A;  4WPY A; 
#chains in the Genus database with same CATH topology
 2L2K B;  2NA2 A;  4Q28 A;  2JR1 A;  2VRD A;  5KL2 A;  2EPN A;  2JYA A;  2EM5 A;  3KZZ A;  4R2E A;  1TF6 A;  2GHF A;  3FIG A;  4MLQ A;  2ENH A;  2EMI A;  2DIX A;  2EOY A;  4DV1 E;  4R2R A;  2RS6 A;  5A6B D;  2B7T A;  2JP9 A;  2EMZ A;  2JOB A;  1F2I G;  1YUJ A;  3HXL A;  2L92 A;  3LLH A;  4ZYE A;  1T38 A;  2V88 A;  4RHB B;  4FK5 C;  1I94 E;  2EOE A;  4P78 A;  3VYY A;  4X9J A;  2LMZ A;  1N36 E;  2N3H A;  2L2N A;  1TN9 A;  1DQ3 A;  1JK1 A;  2ODR D;  4R2S A;  4NHR A;  3EQ1 A;  2DLQ A;  1ZBT A;  2JVA A;  4B3M E;  3KWR A;  4HTG A;  2YRH A;  2UXC E;  2EM8 A;  2ENA A;  1JK2 A;  3EPH A;  2EPL X;  4KZS A;  2K4V A;  2DB2 A;  3ADJ A;  2MDG A;  3DF6 A;  2YPN A;  1UHZ A;  2VQF E;  4DV7 E;  1DGC A;  1RC7 A;  1NEI A;  5TSE A;  1O0W A;  3THO B;  2EN8 A;  4WPY A;  1XMQ E;  4DR2 E;  4BHC A;  2CSH A;  4OOG C;  4GZN C;  4B3S E;  2EQ3 A;  4KHP E;  2YU8 A;  3VYX A;  2YTO A;  1YYK A;  2HJJ A;  2MC6 A;  1X47 A;  2ZM6 E;  1J26 A;  4L8N A;  4R2P A;  2N8X A;  4F2J C;  5IV8 B;  5A6A A;  5T6J A;  4WSP A;  2EN2 A;  2B3T B;  2L2M A;  4WXD A;  3RMP A;  4WSG A;  2EJ4 A;  2L33 A;  2UU9 E;  2EZ6 A;  5KL6 A;  1GTK A;  5BR8 E;  2L6M A;  2LCE A;  1A1I A;  2R1F A;  3MHS C;  4ZYH A;  2EL5 A;  2UUC E;  2UXD E;  1IQO A;  1IBL E;  2YTG A;  3H09 A;  4X66 E;  4F6N A;  2EWL A;  2EN6 A;  2EM4 A;  4R03 A;  1IBK E;  2DLK A;  5F3W A;  2JY9 A;  4LF9 E;  2EMC A;  4JI1 E;  1PJS A;  4X64 E;  4BHB A;  3TQM A;  2ELZ A;  2NUG A;  1WHN A;  4BMJ A;  2M9A A;  1Z1B A;  5CFF E;  2WBU A;  1G2D C;  1UN6 B;  2YSP A;  4LU9 A;  2V85 A;  1YYW A;  1BBG A;  3KZY A;  3ADL A;  2EPC A;  2L3C A;  2EPP A;  1UBD C;  2LVH A;  1SR9 A;  2YTQ A;  4NXM E;  4DR6 E;  2EPZ A;  4RH8 A;  2LUQ A;  2EOZ A;  4DR5 E;  4LF4 E;  4KWY A;  1XNR E;  4M30 A;  1XMO E;  2EMG A;  3C4B A;  2EPR A;  1X3C A;  2UUB E;  4LF5 E;  2E1M A;  2EMH A;  5IXM B;  1HNX E;  3QG5 C;  4GKK E;  4DUY E;  3L00 A;  1RMD A;  4GEQ B;  4B3T E;  2YSO A;  4JV5 E;  1YZ9 A;  2V83 A;  5A6J A;  2EOJ A;  4X8W A;  2L8T A;  4JI0 E;  1NCS A;  3C6K A;  5KL7 A;  2ENC A;  2HC5 A;  2EPM X;  4JYA E;  4WFT A;  4DV5 E;  4MLV A;  2JPA A;  2GLI A;  1EH7 A;  3BF2 A;  4DR4 E;  4F54 A;  2MDR A;  1ZAA C;  2EOF A;  2EN7 A;  5LLQ A;  2EQ0 A;  1L4S A;  3K6Q A;  3MSW A;  3ADG A;  4GKJ E;  4NXN E;  2M4I A;  1FJG E;  5FLX C;  1BB8 A;  3AUZ A;  3OML A;  2E5L E;  4Q35 B;  2EQ1 A;  5AAS A;  2YTI A;  2CTD A;  4JI4 E;  2B9D A;  1A1K A;  2EPU A;  4JI3 E;  4LF7 E;  2LE2 A;  2EOH A;  5KL4 A;  5A6B A;  1P47 A;  2NUE A;  2YTJ A;  5ADZ A;  2VF1 A;  2EOR A;  2L3J A;  2F4V E;  2EOM A;  2EPO A;  1HNZ E;  1WRJ A;  2FV4 B;  3VHT B;  2LJU A;  4YY3 E;  3IWB A;  1YYO A;  1SFE A;  1T4O A;  2YU5 A;  3VK6 A;  4JI8 E;  4P7D A;  2ADR A;  4BC9 A;  5LL6 R;  3LML A;  2PRT A;  2EP3 A;  2B7V A;  2A25 A;  3BBG A;  4R8O A;  1GZ6 A;  1T39 A;  4DV0 E;  4BCA A;  3EPL A;  1A1H A;  1PJQ A;  4TUI A;  4YHH E;  2RSM A;  5AC5 A;  2UUA E;  4LF8 E;  2JWO A;  2EL6 A;  4WYQ B;  2EE8 A;  1X5W A;  4I8O A;  2DMI A;  2WBS A;  1A1J A;  1IBM E;  4DKK A;  3BID A;  1FKA E;  2KOU A;  4R2C A;  1ZU1 A;  2VQE E;  5A2Q C;  2EL4 A;  3J7Y p;  3F6G A;  2NUF A;  2J7J A;  4M0V A;  4F9B B;  4TUG A;  5KL3 A;  1YFH A;  4DV4 E;  2RPC A;  1EH8 A;  1ZR9 A;  2ELY A;  2EMF A;  2EM9 A;  2KHX A;  2EMA A;  4WXC A;  2EMW A;  1J5E E;  1PDA A;  1RQ0 A;  1T4L B;  2RS7 A;  2YTE A;  1EH6 A;  4O5G A;  4O4K A;  4R2D A;  4B3R E;  1QU6 A;  2JXP A;  3JU0 A;  1N3G A;  4BC7 A;  1BBO A;  4F9C B;  2EMY A;  3T1Y E;  4R2A A;  1YSA C;  2N3G A;  4DR1 E;  1HNW E;  1PKP A;  4IJD A;  2F8B A;  2NAB A;  3BGH A;  4NZV A;  2HHH E;  3P1X A;  2EN1 A;  2M7Q A;  4N4R B;  3HTX A;  5AE1 A;  3HPZ A;  1X6H A;  5AC4 A;  2LJH A;  3ZOQ B;  4LFA E;  1MEY C;  4DV6 E;  1XNQ E;  4X65 E;  2M1S A;  4LFC E;  2MC5 A;  4JI6 E;  3J80 C;  4IS1 C;  2EOQ A;  4X62 E;  4ZYD A;  3ECR A;  2FTX B;  4O43 A;  1QNT A;  1ZBQ A;  2VE7 C;  2EPK X;  4F9A B;  5KL5 A;  2LT7 A;  2LTR A;  1KYQ A;  1WXR A;  4OX9 E;  2EN3 A;  4K0K E;  2V8Q B;  2YTF A;  2E72 A;  3EPK A;  1HR0 E;  3AV0 A;  2YTN A;  2JOX A;  2DMY A;  2YRM A;  2CPN A;  3IWC A;  2EOO A;  4DUZ E;  3M99 B;  4R2Q A;  2YZT A;  2LRS A;  2LV2 A;  4F6M A;  1WHQ A;  4DR3 E;  1T4N A;  4DR7 E;  5IWA E;  5LMU E;  2V87 A;  1GQE A;  3T1H E;  1A1F A;  2IHR 1;  5A69 A;  1G2F C;  2WBT A;  2KON A;  4BBY A;  2BB8 A;  4LTY A;  1N34 E;  1IMU A;  3UK3 C;  1N32 E;  2DRP A;  2LO3 A;  3HPS A;  3C6M A;  2UXB E;  4DV2 E;  5IT9 C;  2ODR C;  4LFB E;  2DGC A;  2WZO A;  2EPX A;  2YTP A;  3IWD A;  1AAY A;  4ZYG A;  2LBS B;  3C4T A;  1STU A;  2V89 A;  3THN A;  1MGT A;  4L5N C;  1KJK A;  1AH5 A;  1PJT A;  2EM2 A;  2EM0 A;  5LMN E;  2EPA A;  1A1L A;  3EPJ A;  1N33 E;  1YUI A;  3MHH C;  4HEI A;  2YTD A;  2YWQ A;  4LF6 E;  4WX9 A;  2MKN A;  1UIL A;  1X6F A;  1X6E A;  1WJP A;  4JI5 E;  5AE2 A;  2EM7 A;  3F6H A;  2WCC 3;  1A1G A;  2EM3 A;  2EM6 A;  4JI2 E;  4M2Z A;  2DSY A;  2H36 X;  1LLM C;  2RSI A;  3HQ1 A;  2LTS A;  4O24 A;  5A6K A;  2RTX A;  1YPN A;  2D9H A;  2BBG A;  2K7I A;  2EOI A;  4J8Z A;  5DNY A;  4M9V C;  2EOS A;  1EKZ A;  3DJW A;  1B69 A;  4AQY E;  1TF3 A;  2EML A;  1IQS A;  3ADI A;  2EMB A;  4JI7 E;  2LUP B;  4DMI A;  2V86 A;  2YRK A;  2G7H A;  2CT1 A;  2MKD A;  2RQL A;  3JTZ A;  1DI2 A;  2I9I A;  3JAM C;  2EMK A;  2GPI A;  2I13 A;  1X48 A;  2R76 A;  1X49 A;  2YT4 A;  3OTO E;  2EOX A;  2EN4 A;  2FGG A;  2Q8U A;  3J81 C;  4BS9 A;  2HGH A;  3J7A G;  2EMX A;  5AE3 A;  4DV3 E; 
#chains in the Genus database with same CATH homology
 2L2K B;  2NA2 A;  4R03 A;  2V8Q B;  4P7D A;  4Q28 A;  4JI8 E;  1IBK E;  2JR1 A;  4BC9 A;  5LL6 R;  5F3W A;  1YYW A;  2JY9 A;  3LML A;  1HR0 E;  3AV0 A;  4LF9 E;  2B7V A;  2JOX A;  2DMY A;  4JI1 E;  2CPN A;  3IWC A;  3FIG A;  4R8O A;  4X64 E;  1GZ6 A;  4DUZ E;  2DIX A;  2NUG A;  2YZT A;  2LRS A;  4DV0 E;  4DV1 E;  1WHN A;  4BMJ A;  4BCA A;  2RS6 A;  5CFF E;  4TUI A;  4YHH E;  1WHQ A;  2B7T A;  2JOB A;  1T4N A;  2RSM A;  4DR3 E;  2UUA E;  4LF8 E;  4DR7 E;  2JWO A;  4LU9 A;  2V85 A;  5IWA E;  2V87 A;  1GQE A;  4WYQ B;  3HXL A;  2L92 A;  2IHR 1;  4I8O A;  3LLH A;  5LMU E;  3T1H E;  3ADL A;  2V88 A;  1IBM E;  4DKK A;  2KON A;  4BBY A;  1FKA E;  2KOU A;  4LTY A;  1I94 E;  4P78 A;  2L3C A;  3VYY A;  1N34 E;  2VQE E;  1SR9 A;  2LMZ A;  1N36 E;  2N3H A;  4NXM E;  2L2N A;  1N32 E;  4DR6 E;  2LUQ A;  5A2Q C;  1DQ3 A;  3J7Y p;  2ODR D;  3HPS A;  4DR5 E;  4LF4 E;  2UXB E;  4DV2 E;  1XNR E;  5IT9 C;  3F6G A;  2ODR C;  1ZBT A;  2JVA A;  2NUF A;  3KWR A;  4B3M E;  4LFB E;  4M30 A;  2WZO A;  4M0V A;  3C4B A;  1XMO E;  4F9B B;  2UUB E;  4LF5 E;  4TUG A;  2UXC E;  2E1M A;  3IWD A;  2LBS B;  4DV4 E;  1HNX E;  4GKK E;  3C4T A;  1STU A;  2V89 A;  4DUY E;  4KZS A;  2K4V A;  2DB2 A;  2KHX A;  4L5N C;  4GEQ B;  4B3T E;  4JV5 E;  1YZ9 A;  5LMN E;  2V83 A;  3ADJ A;  3DF6 A;  1UHZ A;  1J5E E;  1N33 E;  2VQF E;  4DV7 E;  1RC7 A;  4X8W A;  2L8T A;  4JI0 E;  1RQ0 A;  1O0W A;  1T4L B;  4WPY A;  1XMQ E;  4DR2 E;  2RS7 A;  4LF6 E;  4B3R E;  1UIL A;  4JI5 E;  4JYA E;  5AE2 A;  1QU6 A;  3JU0 A;  4WFT A;  3F6H A;  4DV5 E;  4OOG C;  4BC7 A;  4M2Z A;  4JI2 E;  4F9C B;  4B3S E;  3T1Y E;  4DR4 E;  2DSY A;  4F54 A;  3VYX A;  2H36 X;  2N3G A;  4KHP E;  4DR1 E;  1HNW E;  3HQ1 A;  1PKP A;  2MDR A;  1YYK A;  2LTS A;  2F8B A;  2MC6 A;  1X47 A;  2ZM6 E;  1J26 A;  2HHH E;  3P1X A;  2RTX A;  4L8N A;  2M7Q A;  3K6Q A;  3MSW A;  3ADG A;  5DNY A;  4J8Z A;  3HTX A;  5AE1 A;  4NXN E;  2M4I A;  3HPZ A;  5FLX C;  1FJG E;  3AUZ A;  4K0K E;  4GKJ E;  1EKZ A;  5T6J A;  3DJW A;  3OML A;  4WSP A;  4AQY E;  2L2M A;  2B3T B;  2LJH A;  3ZOQ B;  4LFA E;  3RMP A;  2E5L E;  4DV6 E;  1XNQ E;  2L33 A;  2UU9 E;  2EZ6 A;  4X65 E;  3ADI A;  5AAS A;  2M1S A;  4JI7 E;  5BR8 E;  2LUP B;  4LFC E;  2MC5 A;  4JI6 E;  2L6M A;  2B9D A;  3J80 C;  4JI4 E;  4DMI A;  2V86 A;  4X62 E;  2G7H A;  4JI3 E;  4LF7 E;  2LE2 A;  2NUE A;  3JTZ A;  2FTX B;  5ADZ A;  1DI2 A;  3JAM C;  1ZBQ A;  1X48 A;  2VF1 A;  2YT4 A;  1X49 A;  2L3J A;  2VE7 C;  3OTO E;  2UUC E;  2F4V E;  2UXD E;  1HNZ E;  2FGG A;  2FV4 B;  3J81 C;  4BS9 A;  4F9A B;  4YY3 E;  1IBL E;  3IWB A;  1YYO A;  3J7A G;  3H09 A;  2LTR A;  4X66 E;  5AE3 A;  1WXR A;  1T4O A;  4OX9 E;  2EWL A;  4DV3 E;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...