2YTOA

Solution structure of the c2h2 type zinc finger (region 659-691) of human zinc finger protein 484
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCSDCGKAFTRKSGLHIHQQSHTGERHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 659-691) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytoA01
2EMKA 2YTIA 2WCC3 1BBOA 4R2RA 2EP3A 2EPPA 2EOXA 2YTOA 1JK2A 2EPXA 2LO3A 2YTGA 4WSGA 1ZU1A 4FK5C 4R2PA 3EPJA 3M99B 2ENAA 1A1KA 2WBTA 2JPAA 2ADRA 2EL4A 1A1IA 2CTDA 3MHSC 5KL4A 1LLMC 1A1JA 3UK3C 2DGCA 2EOJA 2EMWA 2EORA 1BB8A 3EPKA 1MEYC 2EMCA 2E72A 2EOQA 2YRKA 2EMHA 2EN6A 2EOOA 2YSOA 1UN6B 2EM2A 2EMYA 4R2CA 4F6NA 2NABA 4GZNC 2EM9A 2EN3A 2YTFA 4F2JC 1JK1A 5KL5A 1YUIA 2EMXA 5KL3A 2EPRA 1WJPA 4IS1C 2RSIA 4X9JA 1UBDC 5KL2A 2EMGA 1RMDA 2EM7A 2DRPA 2D9HA 2EM3A 2GLIA 1YUJA 1KJKA 2LCEA 2MKDA 1TF6A 4R2DA 1A1LA 2EPCA 1X6EA 2EQ0A 2YSPA 1YSAC 2HGHA 1B69A 1G2FC 1ZAAC 2EMBA 4R2QA 3MHHC 2EE8A 2DLKA 4R2SA 2EM8A 2MKNA 2BB8A 1X6FA 2R1FA 2EN1A 2YTJA 2YTPA 2EOFA 1AAYA 2EOIA 2EPAA 2I13A 2CSHA 1A1GA 2EN8A 2YRHA 1F2IG 2YTDA 1X5WA 2EJ4A 1NCSA 2ELZA 2EQ1A 2EM5A 2EN4A 2LVHA 2LV2A 1ZR9A 2EM4A 2ENHA 4IJDA 5KL7A 1Z1BA 2EOEA 2RPCA 1X3CA 1X6HA 2JP9A 2YU5A 2ENCA 5KL6A 3EPHA 2EN7A 2EN2A 1TN9A 2EOMA 2GHFA 2EOHA 2EL6A 2A25A 2EMFA 2YTQA 2EMLA 2DMIA 2MDGA 3EPLA 4F6MA 4R2EA 2ELYA 2EMIA 1P47A 3VHTB 2YRMA 2LT7A 2YTEA 2CT1A 2EL5A 2EOSA 4R2AA 2WBSA 2WBUA 2J7JA 2PRTA 2EM6A 2EOYA 4M9VC 1TF3A 2YU8A 1A1HA 2DLQA 2EPUA 2VRDA 1DGCA 2YTNA 2EMAA 2EMZA 2EQ3A 2EPZA 2EM0A 2EOZA 1G2DC 2M9AA 1A1FA
chains in the Genus database with same CATH superfamily
2YWQA 2N3GA 4R2RA 5AC5A 5A69A 4O4KA 3C6KA 4WPYA 4OOGC 1XMQE 1ZU1A 2FGGA 4R2PA 2LE2A 2EWLA 1YZ9A 4YY3E 3IWBA 4HTGA 2ADRA 2L6MA 3ADJA 4DR6E 1A1JA 2KOUA 2JXPA 4WSPA 1NEIA 4DUYE 4NHRA 3HPSA 2L2KB 2E72A 2EOQA 3JAMC 2N3HA 1UN6B 4F6NA 1IBME 4LF6E 1XMOE 4GZNC 2KHXA 3VK6A 4DV2E 2EM9A 2YTFA 4O24A 1JK1A 3OTOE 1N34E 2RSIA 1WHNA 1IMUA 4JI8E 2EMGA 1RMDA 2EM7A 4ZYDA 2GLIA 4KHPE 2HJJA 2I9IA 4HEIA 1J26A 2EPCA 1IQOA 4F9BB 4MLVA 4JI7E 4N4RB 1G2FC 2HHHE 4JI1E 3RMPA 3MHHC 2BBGA 2UXCE 2DLKA 1ZBTA 2BB8A 2N8XA 2V8QB 2YTJA 2EOFA 3KWRA 2L92A 1HNWE 2I13A 1GTKA 4TUIA 2M7QA 2YRHA 1X5WA 2ELZA 2JWOA 4I8OA 2LVHA 3ECRA 3AV0A 2RS6A 4IJDA 1Z1BA 1RQ0A 2EOEA 2RPCA 3DJWA 1X6HA 2JP9A 3EPHA 2EN2A 3HPZA 1AH5A 2UUBE 2NUGA 2HC5A 4LFBE 1J5EE 3FIGA 4LU9A 4AQYE 4BC9A 2EPMX 3K6QA 1P47A 2K4VA 2JOBA 2JY9A 2LT7A 4LF8E 3TQMA 4BHCA 4O5GA 2CT1A 2Q8UA 2EL5A 2WBSA 2WBUA 4JI6E 4DV0E 2FTXB 2E1MA 1L4SA 5IWAE 1X48A 2NUEA 2YU8A 2DLQA 2LJUA 3LLHA 4MLQA 2EQ3A 5TSEA 2EPZA 2UXDE 4DMIA 2V85A 1XNRE 4B3ME 5IV8B 3THNA 2EPPA 2EOXA 4JI3E 4ZYGA 2EPKX 2MC6A 2YTOA 1JK2A 2LO3A 2YTGA 1YYWA 3EPJA 1YFHA 1A1KA 2WBTA 2JPAA 3ZOQB 2EL4A 4F54A 2CTDA 3MHSC 5KL4A 4WXDA 5CFFE 2KONA 2EORA 3EPKA 2YT4A 3J80C 1I94E 1DI2A 4NZVA 2YSOA 4BS9A 2JYAA 2EM2A 4R03A 2LTRA 4KWYA 3ADGA 4F2JC 4DR1E 1PJQA 5KL5A 1YUIA 2V83A 2L3JA 4X9JA 4LF7E 2EM3A 1KJKA 2EPOA 4X62E 4R2DA 1A1LA 1YSAC 1X6EA 1B69A 2V86A 1ZAAC 2VF1A 1PKPA 5F3WA 1QU6A 2EMBA 5AE3A 1X6FA 3EQ1A 2R1FA 2EN1A 2YTPA 3ADLA 4L8NA 4NXME 2WZOA 1EH6A 2YTDA 1SFEA 1WXRA 4K0KE 2ENHA 5ADZA 2YZTA 1X3CA 4WYQB 4BBYA 3C4BA 2YU5A 4JI2E 2EN7A 2VQFE 5A6AA 3F6HA 3L00A 4P78A 5LLQA 3J7Yp 5DNYA 3T1HE 4F6MA 1WHQA 2J7JA 3LMLA 3HTXA 4DUZE 4WXCA 1PJTA 4JV5E 2NA2A 1RC7A 2EOYA 2RQLA 1X47A 1QNTA 2VRDA 3DF6A 2B7TA 4WX9A 4X66E 2EMAA 1GZ6A 4B3SE 2M9AA 2YTIA 2DB2A 1KYQA 1BBOA 1T4LB 4DR5E 4DR3E 3VYXA 1T38A 4DV7E 1EKZA 4B3TE 2ENAA 2EPLX 1PJSA 1A1IA 2VE7C 3C4TA 2F4VE 3F6GA 4BHBA 4M0VA 4LTYA 3UK3C 3H09A 2DGCA 2EOJA 2EMWA 1STUA 5LMUE 2LRSA 2EMCA 2H36X 1PDAA 4P7DA 2YRKA 2DMYA 2EN6A 2LJHA 4F9AB 2LUPB 3IWCA 1XNQE 2DSYA 3JTZA 2EMYA 2GPIA 4DKKA 3KZZA 2EN3A 4JYAE 4BCAA 4F9CB 1ZBQA 1WJPA 4IS1C 4M2ZA 4LF9E 3VYYA 2DRPA 2D9HA 1YUJA 1T39A 4R8OA 2LCEA 1TF6A 2HGHA 2V89A 2YSPA 4JI0E 1HNXE 4RHBB 4R2QA 2EE8A 2MKNA 1DQ3A 2EPAA 2F8BA 1X49A 2MDRA 2UUCE 2EJ4A 4X65E 4LFCE 2L8TA 1EH8A 2LTSA 2EQ1A 2LV2A 3HXLA 3BF2A 3OMLA 5AASA 5KL7A 2EPNA 3THOB 2ENCA 4GEQB 1TN9A 2B9DA 2GHFA 2EOHA 2EL6A 1N32E 2L3CA 1IQSA 2MDGA 2DMIA 2JOXA 1N36E 1MGTA 3BGHA 4R2EA 2IHR1 3VHTB 2EOSA 2PRTA 1FJGE 2L2NA 4B3RE 2EM6A 4OX9E 1T4NA 1TF3A 4M9VC 1YPNA 1EH7A 2EPUA 4J8ZA 4DV5E 2YTNA 1FKAE 1T4OA 1HNZE 1G2DC 2ODRD 1A1FA 4RH8A 2YPNA 4LF5E 2EMKA 5LL6R 2WCC3 2R76A 2EP3A 1YYOA 4NXNE 1GQEA 1UHZA 4GKKE 2EPXA 4WSGA 5A6BD 4DR2E 4FK5C 3ADIA 1N3GA 5LMNE 3M99B 2RS7A 2V87A 2M1SA 4LFAE 2UXBE 1IBLE 2B3TB 1LLMC 2ZM6E 1IBKE 1BB8A 1MEYC 5AC4A 4KZSA 2EMHA 2EOOA 5IXMB 4L5NC 2JVAA 4R2CA 2B7VA 4DR4E 1HR0E 2ODRC 2NABA 3BBGA 4O43A 1N33E 5FLXC 2LMZA 4BC7A 4JI4E 2EMXA 2JR1A 2EPRA 2LUQA 5KL3A 1UBDC 2RSMA 4ZYEA 5KL2A 4DV6E 4LF4E 2G7HA 2MKDA 2K7IA 2EQ0A 2CPNA 2LBSB 4M30A 5AE1A 5A6BA 3QG5C 3MSWA 4R2SA 2EM8A 1YYKA 2MC5A 5A6KA 3J7AG 2VQEE 5AE2A 2EOIA 1AAYA 2CSHA 1A1GA 2EN8A 1F2IG 1UILA 3JU0A 1NCSA 2L2MA 4BMJA 3IWDA 2EM5A 2EN4A 2UUAE 1ZR9A 2EM4A 1WRJA 3AUZA 4Q35B 3KZYA 4DV4E 5KL6A 4GKJE 4X8WA 3HQ1A 3BIDA 2EOMA 4JI5E 4DR7E 5A6JA 2EZ6A 1O0WA 2A25A 4TUGA 2EMFA 4DV3E 2YTQA 4Q28A 4WFTA 2EMLA 2V88A 5A2QC 5T6JA 3EPLA 2UU9E 2ELYA 2M4IA 2EMIA 4YHHE 3C6MA 2YRMA 2YTEA 4R2AA 1SR9A 2E5LE 2FV4B 2L33A 2RTXA 2DIXA 1A1HA 2NUFA 3P1XA 1DGCA 5IT9C 2EMZA 4DV1E 2EM0A 5BR8E 1BBGA 2EOZA 3T1YE 4ZYHA 4X64E 3J81C
chains in the Genus database with same CATH topology
2EMKA 2YTIA 2WCC3 1BBOA 4R2RA 2EP3A 2EPPA 2EOXA 2YTOA 1JK2A 2EPXA 2LO3A 2YTGA 4WSGA 1ZU1A 4FK5C 4R2PA 3EPJA 3M99B 2ENAA 1A1KA 2WBTA 2JPAA 2ADRA 2EL4A 1A1IA 2CTDA 3MHSC 5KL4A 1LLMC 1A1JA 3UK3C 2DGCA 2EOJA 2EMWA 2EORA 1BB8A 3EPKA 1MEYC 2EMCA 2E72A 2EOQA 2YRKA 2EMHA 2EN6A 2EOOA 2YSOA 1UN6B 2EM2A 2EMYA 4R2CA 4F6NA 2NABA 4GZNC 2EM9A 2EN3A 2YTFA 4F2JC 1JK1A 5KL5A 1YUIA 2EMXA 5KL3A 2EPRA 1WJPA 4IS1C 2RSIA 4X9JA 1UBDC 5KL2A 2EMGA 1RMDA 2EM7A 2DRPA 2D9HA 2EM3A 2GLIA 1YUJA 1KJKA 2LCEA 2MKDA 1TF6A 4R2DA 1A1LA 2EPCA 1X6EA 2EQ0A 2YSPA 1YSAC 2HGHA 1B69A 1G2FC 1ZAAC 2EMBA 4R2QA 3MHHC 2EE8A 2DLKA 4R2SA 2EM8A 2MKNA 2BB8A 1X6FA 2R1FA 2EN1A 2YTJA 2YTPA 2EOFA 1AAYA 2EOIA 2EPAA 2I13A 2CSHA 1A1GA 2EN8A 2YRHA 1F2IG 2YTDA 1X5WA 2EJ4A 1NCSA 2ELZA 2EQ1A 2EM5A 2EN4A 2LVHA 2LV2A 1ZR9A 2EM4A 2ENHA 4IJDA 5KL7A 1Z1BA 2EOEA 2RPCA 1X3CA 1X6HA 2JP9A 2YU5A 2ENCA 5KL6A 3EPHA 2EN7A 2EN2A 1TN9A 2EOMA 2GHFA 2EOHA 2EL6A 2A25A 2EMFA 2YTQA 2EMLA 2DMIA 2MDGA 3EPLA 4F6MA 4R2EA 2ELYA 2EMIA 1P47A 3VHTB 2YRMA 2LT7A 2YTEA 2CT1A 2EL5A 2EOSA 4R2AA 2WBSA 2WBUA 2J7JA 2PRTA 2EM6A 2EOYA 4M9VC 1TF3A 2YU8A 1A1HA 2DLQA 2EPUA 2VRDA 1DGCA 2YTNA 2EMAA 2EMZA 2EQ3A 2EPZA 2EM0A 2EOZA 1G2DC 2M9AA 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMK A;  2YTI A;  2WCC 3;  1BBO A;  4R2R A;  2EP3 A;  2EPP A;  2EOX A;  2YTO A;  1JK2 A;  2EPX A;  2LO3 A;  2YTG A;  4WSG A;  1ZU1 A;  4FK5 C;  4R2P A;  3EPJ A;  3M99 B;  2ENA A;  1A1K A;  2WBT A;  2JPA A;  2ADR A;  2EL4 A;  1A1I A;  2CTD A;  3MHS C;  5KL4 A;  1LLM C;  1A1J A;  3UK3 C;  2DGC A;  2EOJ A;  2EMW A;  2EOR A;  1BB8 A;  3EPK A;  1MEY C;  2EMC A;  2E72 A;  2EOQ A;  2YRK A;  2EMH A;  2EN6 A;  2EOO A;  2YSO A;  1UN6 B;  2EM2 A;  2EMY A;  4R2C A;  4F6N A;  2NAB A;  4GZN C;  2EM9 A;  2EN3 A;  2YTF A;  4F2J C;  1JK1 A;  5KL5 A;  1YUI A;  2EMX A;  5KL3 A;  2EPR A;  1WJP A;  4IS1 C;  2RSI A;  4X9J A;  1UBD C;  5KL2 A;  2EMG A;  1RMD A;  2EM7 A;  2DRP A;  2D9H A;  2EM3 A;  2GLI A;  1YUJ A;  1KJK A;  2LCE A;  2MKD A;  1TF6 A;  4R2D A;  1A1L A;  2EPC A;  1X6E A;  2EQ0 A;  2YSP A;  1YSA C;  2HGH A;  1B69 A;  1G2F C;  1ZAA C;  2EMB A;  4R2Q A;  3MHH C;  2EE8 A;  2DLK A;  4R2S A;  2EM8 A;  2MKN A;  2BB8 A;  1X6F A;  2R1F A;  2EN1 A;  2YTJ A;  2YTP A;  2EOF A;  1AAY A;  2EOI A;  2EPA A;  2I13 A;  2CSH A;  1A1G A;  2EN8 A;  2YRH A;  1F2I G;  2YTD A;  1X5W A;  2EJ4 A;  1NCS A;  2ELZ A;  2EQ1 A;  2EM5 A;  2EN4 A;  2LVH A;  2LV2 A;  1ZR9 A;  2EM4 A;  2ENH A;  4IJD A;  5KL7 A;  1Z1B A;  2EOE A;  2RPC A;  1X3C A;  1X6H A;  2JP9 A;  2YU5 A;  2ENC A;  5KL6 A;  3EPH A;  2EN7 A;  2EN2 A;  1TN9 A;  2EOM A;  2GHF A;  2EOH A;  2EL6 A;  2A25 A;  2EMF A;  2YTQ A;  2EML A;  2DMI A;  2MDG A;  3EPL A;  4F6M A;  4R2E A;  2ELY A;  2EMI A;  1P47 A;  3VHT B;  2YRM A;  2LT7 A;  2YTE A;  2CT1 A;  2EL5 A;  2EOS A;  4R2A A;  2WBS A;  2WBU A;  2J7J A;  2PRT A;  2EM6 A;  2EOY A;  4M9V C;  1TF3 A;  2YU8 A;  1A1H A;  2DLQ A;  2EPU A;  2VRD A;  1DGC A;  2YTN A;  2EMA A;  2EMZ A;  2EQ3 A;  2EPZ A;  2EM0 A;  2EOZ A;  1G2D C;  2M9A A;  1A1F A; 
#chains in the Genus database with same CATH topology
 2YWQ A;  2N3G A;  4R2R A;  5AC5 A;  5A69 A;  4O4K A;  3C6K A;  4WPY A;  4OOG C;  1XMQ E;  1ZU1 A;  2FGG A;  4R2P A;  2LE2 A;  2EWL A;  1YZ9 A;  4YY3 E;  3IWB A;  4HTG A;  2ADR A;  2L6M A;  3ADJ A;  4DR6 E;  1A1J A;  2KOU A;  2JXP A;  4WSP A;  1NEI A;  4DUY E;  4NHR A;  3HPS A;  2L2K B;  2E72 A;  2EOQ A;  3JAM C;  2N3H A;  1UN6 B;  4F6N A;  1IBM E;  4LF6 E;  1XMO E;  4GZN C;  2KHX A;  3VK6 A;  4DV2 E;  2EM9 A;  2YTF A;  4O24 A;  1JK1 A;  3OTO E;  1N34 E;  2RSI A;  1WHN A;  1IMU A;  4JI8 E;  2EMG A;  1RMD A;  2EM7 A;  4ZYD A;  2GLI A;  4KHP E;  2HJJ A;  2I9I A;  4HEI A;  1J26 A;  2EPC A;  1IQO A;  4F9B B;  4MLV A;  4JI7 E;  4N4R B;  1G2F C;  2HHH E;  4JI1 E;  3RMP A;  3MHH C;  2BBG A;  2UXC E;  2DLK A;  1ZBT A;  2BB8 A;  2N8X A;  2V8Q B;  2YTJ A;  2EOF A;  3KWR A;  2L92 A;  1HNW E;  2I13 A;  1GTK A;  4TUI A;  2M7Q A;  2YRH A;  1X5W A;  2ELZ A;  2JWO A;  4I8O A;  2LVH A;  3ECR A;  3AV0 A;  2RS6 A;  4IJD A;  1Z1B A;  1RQ0 A;  2EOE A;  2RPC A;  3DJW A;  1X6H A;  2JP9 A;  3EPH A;  2EN2 A;  3HPZ A;  1AH5 A;  2UUB E;  2NUG A;  2HC5 A;  4LFB E;  1J5E E;  3FIG A;  4LU9 A;  4AQY E;  4BC9 A;  2EPM X;  3K6Q A;  1P47 A;  2K4V A;  2JOB A;  2JY9 A;  2LT7 A;  4LF8 E;  3TQM A;  4BHC A;  4O5G A;  2CT1 A;  2Q8U A;  2EL5 A;  2WBS A;  2WBU A;  4JI6 E;  4DV0 E;  2FTX B;  2E1M A;  1L4S A;  5IWA E;  1X48 A;  2NUE A;  2YU8 A;  2DLQ A;  2LJU A;  3LLH A;  4MLQ A;  2EQ3 A;  5TSE A;  2EPZ A;  2UXD E;  4DMI A;  2V85 A;  1XNR E;  4B3M E;  5IV8 B;  3THN A;  2EPP A;  2EOX A;  4JI3 E;  4ZYG A;  2EPK X;  2MC6 A;  2YTO A;  1JK2 A;  2LO3 A;  2YTG A;  1YYW A;  3EPJ A;  1YFH A;  1A1K A;  2WBT A;  2JPA A;  3ZOQ B;  2EL4 A;  4F54 A;  2CTD A;  3MHS C;  5KL4 A;  4WXD A;  5CFF E;  2KON A;  2EOR A;  3EPK A;  2YT4 A;  3J80 C;  1I94 E;  1DI2 A;  4NZV A;  2YSO A;  4BS9 A;  2JYA A;  2EM2 A;  4R03 A;  2LTR A;  4KWY A;  3ADG A;  4F2J C;  4DR1 E;  1PJQ A;  5KL5 A;  1YUI A;  2V83 A;  2L3J A;  4X9J A;  4LF7 E;  2EM3 A;  1KJK A;  2EPO A;  4X62 E;  4R2D A;  1A1L A;  1YSA C;  1X6E A;  1B69 A;  2V86 A;  1ZAA C;  2VF1 A;  1PKP A;  5F3W A;  1QU6 A;  2EMB A;  5AE3 A;  1X6F A;  3EQ1 A;  2R1F A;  2EN1 A;  2YTP A;  3ADL A;  4L8N A;  4NXM E;  2WZO A;  1EH6 A;  2YTD A;  1SFE A;  1WXR A;  4K0K E;  2ENH A;  5ADZ A;  2YZT A;  1X3C A;  4WYQ B;  4BBY A;  3C4B A;  2YU5 A;  4JI2 E;  2EN7 A;  2VQF E;  5A6A A;  3F6H A;  3L00 A;  4P78 A;  5LLQ A;  3J7Y p;  5DNY A;  3T1H E;  4F6M A;  1WHQ A;  2J7J A;  3LML A;  3HTX A;  4DUZ E;  4WXC A;  1PJT A;  4JV5 E;  2NA2 A;  1RC7 A;  2EOY A;  2RQL A;  1X47 A;  1QNT A;  2VRD A;  3DF6 A;  2B7T A;  4WX9 A;  4X66 E;  2EMA A;  1GZ6 A;  4B3S E;  2M9A A;  2YTI A;  2DB2 A;  1KYQ A;  1BBO A;  1T4L B;  4DR5 E;  4DR3 E;  3VYX A;  1T38 A;  4DV7 E;  1EKZ A;  4B3T E;  2ENA A;  2EPL X;  1PJS A;  1A1I A;  2VE7 C;  3C4T A;  2F4V E;  3F6G A;  4BHB A;  4M0V A;  4LTY A;  3UK3 C;  3H09 A;  2DGC A;  2EOJ A;  2EMW A;  1STU A;  5LMU E;  2LRS A;  2EMC A;  2H36 X;  1PDA A;  4P7D A;  2YRK A;  2DMY A;  2EN6 A;  2LJH A;  4F9A B;  2LUP B;  3IWC A;  1XNQ E;  2DSY A;  3JTZ A;  2EMY A;  2GPI A;  4DKK A;  3KZZ A;  2EN3 A;  4JYA E;  4BCA A;  4F9C B;  1ZBQ A;  1WJP A;  4IS1 C;  4M2Z A;  4LF9 E;  3VYY A;  2DRP A;  2D9H A;  1YUJ A;  1T39 A;  4R8O A;  2LCE A;  1TF6 A;  2HGH A;  2V89 A;  2YSP A;  4JI0 E;  1HNX E;  4RHB B;  4R2Q A;  2EE8 A;  2MKN A;  1DQ3 A;  2EPA A;  2F8B A;  1X49 A;  2MDR A;  2UUC E;  2EJ4 A;  4X65 E;  4LFC E;  2L8T A;  1EH8 A;  2LTS A;  2EQ1 A;  2LV2 A;  3HXL A;  3BF2 A;  3OML A;  5AAS A;  5KL7 A;  2EPN A;  3THO B;  2ENC A;  4GEQ B;  1TN9 A;  2B9D A;  2GHF A;  2EOH A;  2EL6 A;  1N32 E;  2L3C A;  1IQS A;  2MDG A;  2DMI A;  2JOX A;  1N36 E;  1MGT A;  3BGH A;  4R2E A;  2IHR 1;  3VHT B;  2EOS A;  2PRT A;  1FJG E;  2L2N A;  4B3R E;  2EM6 A;  4OX9 E;  1T4N A;  1TF3 A;  4M9V C;  1YPN A;  1EH7 A;  2EPU A;  4J8Z A;  4DV5 E;  2YTN A;  1FKA E;  1T4O A;  1HNZ E;  1G2D C;  2ODR D;  1A1F A;  4RH8 A;  2YPN A;  4LF5 E;  2EMK A;  5LL6 R;  2WCC 3;  2R76 A;  2EP3 A;  1YYO A;  4NXN E;  1GQE A;  1UHZ A;  4GKK E;  2EPX A;  4WSG A;  5A6B D;  4DR2 E;  4FK5 C;  3ADI A;  1N3G A;  5LMN E;  3M99 B;  2RS7 A;  2V87 A;  2M1S A;  4LFA E;  2UXB E;  1IBL E;  2B3T B;  1LLM C;  2ZM6 E;  1IBK E;  1BB8 A;  1MEY C;  5AC4 A;  4KZS A;  2EMH A;  2EOO A;  5IXM B;  4L5N C;  2JVA A;  4R2C A;  2B7V A;  4DR4 E;  1HR0 E;  2ODR C;  2NAB A;  3BBG A;  4O43 A;  1N33 E;  5FLX C;  2LMZ A;  4BC7 A;  4JI4 E;  2EMX A;  2JR1 A;  2EPR A;  2LUQ A;  5KL3 A;  1UBD C;  2RSM A;  4ZYE A;  5KL2 A;  4DV6 E;  4LF4 E;  2G7H A;  2MKD A;  2K7I A;  2EQ0 A;  2CPN A;  2LBS B;  4M30 A;  5AE1 A;  5A6B A;  3QG5 C;  3MSW A;  4R2S A;  2EM8 A;  1YYK A;  2MC5 A;  5A6K A;  3J7A G;  2VQE E;  5AE2 A;  2EOI A;  1AAY A;  2CSH A;  1A1G A;  2EN8 A;  1F2I G;  1UIL A;  3JU0 A;  1NCS A;  2L2M A;  4BMJ A;  3IWD A;  2EM5 A;  2EN4 A;  2UUA E;  1ZR9 A;  2EM4 A;  1WRJ A;  3AUZ A;  4Q35 B;  3KZY A;  4DV4 E;  5KL6 A;  4GKJ E;  4X8W A;  3HQ1 A;  3BID A;  2EOM A;  4JI5 E;  4DR7 E;  5A6J A;  2EZ6 A;  1O0W A;  2A25 A;  4TUG A;  2EMF A;  4DV3 E;  2YTQ A;  4Q28 A;  4WFT A;  2EML A;  2V88 A;  5A2Q C;  5T6J A;  3EPL A;  2UU9 E;  2ELY A;  2M4I A;  2EMI A;  4YHH E;  3C6M A;  2YRM A;  2YTE A;  4R2A A;  1SR9 A;  2E5L E;  2FV4 B;  2L33 A;  2RTX A;  2DIX A;  1A1H A;  2NUF A;  3P1X A;  1DGC A;  5IT9 C;  2EMZ A;  4DV1 E;  2EM0 A;  5BR8 E;  1BBG A;  2EOZ A;  3T1Y E;  4ZYH A;  4X64 E;  3J81 C; 
#chains in the Genus database with same CATH homology
 2EMK A;  2YTI A;  2WCC 3;  1BBO A;  4R2R A;  2EP3 A;  2EPP A;  2EOX A;  2YTO A;  1JK2 A;  2EPX A;  2LO3 A;  2YTG A;  4WSG A;  1ZU1 A;  4FK5 C;  4R2P A;  3EPJ A;  3M99 B;  2ENA A;  1A1K A;  2WBT A;  2JPA A;  2ADR A;  2EL4 A;  1A1I A;  2CTD A;  3MHS C;  5KL4 A;  1LLM C;  1A1J A;  3UK3 C;  2DGC A;  2EOJ A;  2EMW A;  2EOR A;  1BB8 A;  3EPK A;  1MEY C;  2EMC A;  2E72 A;  2EOQ A;  2YRK A;  2EMH A;  2EN6 A;  2EOO A;  2YSO A;  1UN6 B;  2EM2 A;  2EMY A;  4R2C A;  4F6N A;  2NAB A;  4GZN C;  2EM9 A;  2EN3 A;  2YTF A;  4F2J C;  1JK1 A;  5KL5 A;  1YUI A;  2EMX A;  5KL3 A;  2EPR A;  1WJP A;  4IS1 C;  2RSI A;  4X9J A;  1UBD C;  5KL2 A;  2EMG A;  1RMD A;  2EM7 A;  2DRP A;  2D9H A;  2EM3 A;  2GLI A;  1YUJ A;  1KJK A;  2LCE A;  2MKD A;  1TF6 A;  4R2D A;  1A1L A;  2EPC A;  1X6E A;  2EQ0 A;  2YSP A;  1YSA C;  2HGH A;  1B69 A;  1G2F C;  1ZAA C;  2EMB A;  4R2Q A;  3MHH C;  2EE8 A;  2DLK A;  4R2S A;  2EM8 A;  2MKN A;  2BB8 A;  1X6F A;  2R1F A;  2EN1 A;  2YTJ A;  2YTP A;  2EOF A;  1AAY A;  2EOI A;  2EPA A;  2I13 A;  2CSH A;  1A1G A;  2EN8 A;  2YRH A;  1F2I G;  2YTD A;  1X5W A;  2EJ4 A;  1NCS A;  2ELZ A;  2EQ1 A;  2EM5 A;  2EN4 A;  2LVH A;  2LV2 A;  1ZR9 A;  2EM4 A;  2ENH A;  4IJD A;  5KL7 A;  1Z1B A;  2EOE A;  2RPC A;  1X3C A;  1X6H A;  2JP9 A;  2YU5 A;  2ENC A;  5KL6 A;  3EPH A;  2EN7 A;  2EN2 A;  1TN9 A;  2EOM A;  2GHF A;  2EOH A;  2EL6 A;  2A25 A;  2EMF A;  2YTQ A;  2EML A;  2DMI A;  2MDG A;  3EPL A;  4F6M A;  4R2E A;  2ELY A;  2EMI A;  1P47 A;  3VHT B;  2YRM A;  2LT7 A;  2YTE A;  2CT1 A;  2EL5 A;  2EOS A;  4R2A A;  2WBS A;  2WBU A;  2J7J A;  2PRT A;  2EM6 A;  2EOY A;  4M9V C;  1TF3 A;  2YU8 A;  1A1H A;  2DLQ A;  2EPU A;  2VRD A;  1DGC A;  2YTN A;  2EMA A;  2EMZ A;  2EQ3 A;  2EPZ A;  2EM0 A;  2EOZ A;  1G2D C;  2M9A A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...