2YTOA

Solution structure of the c2h2 type zinc finger (region 659-691) of human zinc finger protein 484
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCSDCGKAFTRKSGLHIHQQSHTGERHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 659-691) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytoA01
2EPPA 2EOYA 2YSOA 3EPJA 2EMXA 2E72A 2EOJA 3M99B 4IJDA 2ELYA 2EQ0A 2EMHA 2LV2A 1A1JA 1A1FA 2YTOA 1BB8A 2DGCA 2EL5A 2EOXA 2LVHA 4F6NA 1A1HA 2EM9A 2EM2A 2EN1A 1DGCA 2DMIA 2EOOA 1Z1BA 2EPCA 1JK2A 2EN7A 2J7JA 2JPAA 2YRMA 4FK5C 4R2QA 2WBTA 2EJ4A 2WCC3 2LCEA 2PRTA 2YRHA 2YTIA 2EN6A 1X5WA 4R2EA 2LT7A 2EE8A 2EL4A 1F2IG 4F6MA 1ZR9A 1ZU1A 5KL4A 2YTFA 1TN9A 1BBOA 2EOIA 2MKDA 4R2PA 1X6HA 3MHHC 1KJKA 5KL6A 3EPLA 1RMDA 2CT1A 1JK1A 2EN3A 3UK3C 2EMCA 2MDGA 2EP3A 2EL6A 2I13A 2EM7A 2YTDA 2ENCA 2EMYA 1ZAAC 2EM3A 2EMKA 1WJPA 2EMIA 2EMFA 2EM4A 2EQ3A 2EMLA 2EM0A 3EPHA 2YTEA 5KL2A 2EPUA 2YTQA 1P47A 2GLIA 2EN4A 2YRKA 1LLMC 2EMZA 2DLKA 2JP9A 2DRPA 2EPAA 1UBDC 5KL3A 2DLQA 2YTPA 1MEYC 1UN6B 2EOHA 2YSPA 4M9VC 2YTGA 2MKNA 2EN8A 1AAYA 1YSAC 2A25A 1NCSA 2EQ1A 4R2SA 2ELZA 2EPRA 1A1KA 2EPXA 2ENAA 2YU8A 2EOFA 4R2DA 1A1IA 1X6FA 1G2FC 2RPCA 5KL5A 2ADRA 1YUJA 2GHFA 1A1GA 2YTJA 2EM5A 1A1LA 2D9HA 2LO3A 2EOMA 2VRDA 4F2JC 1B69A 2EMAA 1X6EA 2ENHA 2HGHA 2M9AA 2WBSA 4X9JA 4R2AA 2EMBA 2EMGA 4IS1C 2EPZA 3EPKA 4GZNC 2EOEA 1G2DC 2CSHA 2EOSA 2YTNA 2BB8A 2EM8A 2EOQA 4R2CA 2NABA 2WBUA 2EOZA 2EN2A 2CTDA 4R2RA 2EM6A 2EMWA 3VHTB 1YUIA 5KL7A 1TF3A 3MHSC 4WSGA 1X3CA 2RSIA 1TF6A 2R1FA 2EORA 2YU5A
chains in the Genus database with same CATH superfamily
4LF8E 4BCAA 3ADIA 2F4VE 3FIGA 3RMPA 2LUQA 2ELYA 1RQ0A 2EQ0A 2EMHA 2LV2A 1XNRE 1BB8A 2DGCA 4BC9A 1A1HA 2EM2A 2EN1A 5IV8B 1Z1BA 2EOOA 2EPCA 1IMUA 2RSMA 5LMNE 2J7JA 4M0VA 2JPAA 5T6JA 3H09A 1WXRA 2B3TB 2F8BA 2L92A 2M7QA 2LT7A 1N34E 4LFCE 1F2IG 2NUFA 2YTFA 2MC6A 5AASA 3EPLA 1JK1A 2EMCA 2EP3A 3ZOQB 2JR1A 3ADJA 4TUGA 2EMIA 2EM4A 2EQ3A 2EMLA 1YFHA 4DV3E 1HNXE 1QU6A 1PKPA 4BC7A 1XNQE 5LLQA 5IT9C 2RQLA 2YRKA 4BS9A 2DLKA 2UU9E 5KL3A 1UN6B 2EOHA 1AAYA 2L2MA 3THOB 3J7Yp 1IBKE 1I94E 2YU8A 4JI5E 4R2DA 4DR4E 2RPCA 3C4BA 2JXPA 1BBGA 1UHZA 2VF1A 2VRDA 1J26A 2B9DA 1X6EA 2ENHA 4R2AA 4GZNC 2LRSA 1STUA 4B3SE 3J81C 2CSHA 2EOSA 2BB8A 2V86A 2NABA 2KHXA 2KONA 2JOXA 4YY3E 2EN2A 4F54A 4R2RA 1O0WA 4WYQB 2EMWA 3VHTB 4BMJA 1SR9A 3JU0A 4P7DA 4DV6E 2V83A 3MSWA 3VYXA 1DI2A 1IBLE 2JVAA 1GQEA 1T39A 1DQ3A 4Q35B 1A1JA 1A1FA 4F9AB 2GPIA 2EL5A 2DIXA 2LVHA 4DR2E 4F6NA 4DR5E 4OX9E 1GZ6A 5AC5A 4K0KE 1X47A 2ZM6E 2B7VA 3C6MA 2WCC3 2WBTA 2VQEE 1PJSA 2L2NA 2NUEA 2EN6A 4OOGC 4LTYA 4LF9E 2EL4A 2H36X 2VQFE 2L33A 2MKDA 4R2PA 2MC5A 1X6HA 5KL6A 1UILA 1EH7A 2MDGA 3BBGA 2FGGA 2YTDA 4NXME 3DJWA 2L8TA 1YYWA 2EMKA 1WJPA 2EPKX 4X62E 2E5LE 3LMLA 1HR0E 3OMLA 5AE3A 5KL2A 2UUCE 1T38A 2GLIA 4LFBE 2V88A 3J80C 2EN4A 1LLMC 2JWOA 2EMZA 2JP9A 3HXLA 4JYAE 2RTXA 3F6HA 5A6BD 4DV4E 2YTGA 3EQ1A 2LJUA 2LE2A 2A25A 2EQ1A 4JI8E 1YYKA 5CFFE 4JI0E 4DV2E 4J8ZA 2EOFA 5KL5A 4DUZE 4LF6E 3IWDA 2GHFA 2YTJA 1A1LA 4KZSA 1T4OA 2UUAE 2Q8UA 3AV0A 4F2JC 2M9AA 4IS1C 2EPZA 2LTSA 2UXBE 2V85A 3P1XA 4DKKA 2M1SA 2YTNA 2LMZA 2ODRD 2FV4B 4WSPA 4M30A 4JI7E 1X48A 3F6GA 2EPLX 4O5GA 3BGHA 4NXNE 3MHSC 3C6KA 1X3CA 1ZBTA 1TF6A 2ODRC 2V8QB 1PJQA 2YSOA 5A6KA 1YYOA 4NZVA 2EMXA 4ZYHA 3HTXA 4O24A 4X66E 1IQSA 4IJDA 1YZ9A 1NEIA 2RS7A 3ADLA 2WZOA 3HPZA 4DV5E 4F9BB 3AUZA 5IXMB 2JOBA 2LBSB 1XMQE 2DMIA 3HPSA 2UXDE 2EN7A 4JI4E 4KHPE 4L5NC 3L00A 3THNA 4FK5C 1YPNA 1HNZE 4BHBA 4R2QA 2L6MA 2LCEA 2PRTA 2YRHA 2YTIA 5FLXC 1X5WA 4R2EA 1EKZA 1ZBQA 4LF4E 4F6MA 1ZU1A 4LU9A 4LF5E 2EOIA 4O4KA 5ADZA 5LMUE 1BBOA 4R03A 3LLHA 2JY9A 1T4LB 1RMDA 2CT1A 2KOUA 5A6AA 2EN3A 4WXDA 2EL6A 2I13A 4B3TE 1MGTA 4F9CB 3K6QA 2CPNA 1IBME 1ZAAC 2EM3A 2EMFA 5A2QC 2DB2A 2EM0A 4JV5E 4X64E 2UUBE 2I9IA 3ADGA 2YTEA 2EPOA 4X8WA 4I8OA 4DV1E 2N3GA 4Q28A 4ZYEA 3VK6A 4B3ME 2EPNA 2MDRA 1UBDC 2EPMX 2DLQA 2YTPA 1MEYC 4ZYGA 1N3GA 2EN8A 1AH5A 1FJGE 4R2SA 2YWQA 2EPRA 3DF6A 4HTGA 1A1KA 4DR3E 4BBYA 4DR1E 3VYYA 2DSYA 5AE2A 2HHHE 1WHNA 1YUJA 2M4IA 2NA2A 1A1GA 2LJHA 4WFTA 2N3HA 3C4TA 1WRJA 2D9HA 2LO3A 2EMAA 1SFEA 1WHQA 2K7IA 4N4RB 1HNWE 1PJTA 2WBSA 2YPNA 4X9JA 1QNTA 2EMGA 3J7AG 3EPKA 1N33E 1G2DC 2EOEA 4X65E 4YHHE 2L3CA 2EM8A 1KYQA 4JI3E 4KWYA 4B3RE 2V89A 2YZTA 2IHR1 2CTDA 5AC4A 2LUPB 1YUIA 5KL7A 5AE1A 4TUIA 5BR8E 4WPYA 2VE7C 2UXCE 2EORA 2EPPA 2EOYA 3BIDA 3EPJA 2E72A 4DUYE 2EOJA 3M99B 1X49A 2YTOA 1N36E 2EOXA 2EM9A 1DGCA 2E1MA 1JK2A 1FKAE 1EH8A 3ECRA 4DR7E 4LFAE 2YRMA 2HJJA 4DMIA 2EJ4A 4WX9A 4RH8A 1J5EE 2EE8A 4JI2E 4MLVA 1L4SA 1ZR9A 3HQ1A 2B7TA 5KL4A 1TN9A 3MHHC 1KJKA 2R76A 4MLQA 3IWBA 3UK3C 4DR6E 5F3WA 2EM7A 5TSEA 4GKKE 2ENCA 2EWLA 2EMYA 3KZYA 2N8XA 2JYAA 2BBGA 2G7HA 3EPHA 1RC7A 5LL6R 4BHCA 4ZYDA 2EPUA 2YTQA 1P47A 1EH6A 5A6JA 4DV0E 2DRPA 2EPAA 4JI6E 4LF7E 3TQMA 2YSPA 4M9VC 2V87A 2MKNA 2RS6A 3QG5C 3T1YE 4GKJE 1YSAC 4HEIA 1NCSA 2ELZA 2FTXB 2EPXA 4NHRA 1T4NA 1GTKA 2ENAA 1A1IA 1X6FA 2DMYA 1G2FC 2L2KB 3T1HE 2ADRA 2NUGA 4P78A 2EM5A 3JTZA 1IQOA 3KWRA 5A6BA 4AQYE 2EOMA 5IWAE 1B69A 3JAMC 2HGHA 2K4VA 2EMBA 3BF2A 2L3JA 3OTOE 4M2ZA 4WXCA 4O43A 2EZ6A 4DV7E 5A69A 2EOQA 4L8NA 4R2CA 1N32E 5DNYA 2WBUA 4GEQB 1XMOE 2EOZA 2YT4A 3KZZA 4JI1E 2EM6A 2LTRA 4RHBB 1PDAA 2HC5A 1TF3A 4R8OA 4WSGA 2RSIA 2R1FA 3IWCA 2YU5A
chains in the Genus database with same CATH topology
2EPPA 2EOYA 2YSOA 3EPJA 2EMXA 2E72A 2EOJA 3M99B 4IJDA 2ELYA 2EQ0A 2EMHA 2LV2A 1A1JA 1A1FA 2YTOA 1BB8A 2DGCA 2EL5A 2EOXA 2LVHA 4F6NA 1A1HA 2EM9A 2EM2A 2EN1A 1DGCA 2DMIA 2EOOA 1Z1BA 2EPCA 1JK2A 2EN7A 2J7JA 2JPAA 2YRMA 4FK5C 4R2QA 2WBTA 2EJ4A 2WCC3 2LCEA 2PRTA 2YRHA 2YTIA 2EN6A 1X5WA 4R2EA 2LT7A 2EE8A 2EL4A 1F2IG 4F6MA 1ZR9A 1ZU1A 5KL4A 2YTFA 1TN9A 1BBOA 2EOIA 2MKDA 4R2PA 1X6HA 3MHHC 1KJKA 5KL6A 3EPLA 1RMDA 2CT1A 1JK1A 2EN3A 3UK3C 2EMCA 2MDGA 2EP3A 2EL6A 2I13A 2EM7A 2YTDA 2ENCA 2EMYA 1ZAAC 2EM3A 2EMKA 1WJPA 2EMIA 2EMFA 2EM4A 2EQ3A 2EMLA 2EM0A 3EPHA 2YTEA 5KL2A 2EPUA 2YTQA 1P47A 2GLIA 2EN4A 2YRKA 1LLMC 2EMZA 2DLKA 2JP9A 2DRPA 2EPAA 1UBDC 5KL3A 2DLQA 2YTPA 1MEYC 1UN6B 2EOHA 2YSPA 4M9VC 2YTGA 2MKNA 2EN8A 1AAYA 1YSAC 2A25A 1NCSA 2EQ1A 4R2SA 2ELZA 2EPRA 1A1KA 2EPXA 2ENAA 2YU8A 2EOFA 4R2DA 1A1IA 1X6FA 1G2FC 2RPCA 5KL5A 2ADRA 1YUJA 2GHFA 1A1GA 2YTJA 2EM5A 1A1LA 2D9HA 2LO3A 2EOMA 2VRDA 4F2JC 1B69A 2EMAA 1X6EA 2ENHA 2HGHA 2M9AA 2WBSA 4X9JA 4R2AA 2EMBA 2EMGA 4IS1C 2EPZA 3EPKA 4GZNC 2EOEA 1G2DC 2CSHA 2EOSA 2YTNA 2BB8A 2EM8A 2EOQA 4R2CA 2NABA 2WBUA 2EOZA 2EN2A 2CTDA 4R2RA 2EM6A 2EMWA 3VHTB 1YUIA 5KL7A 1TF3A 3MHSC 4WSGA 1X3CA 2RSIA 1TF6A 2R1FA 2EORA 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  2EOY A;  2YSO A;  3EPJ A;  2EMX A;  2E72 A;  2EOJ A;  3M99 B;  4IJD A;  2ELY A;  2EQ0 A;  2EMH A;  2LV2 A;  1A1J A;  1A1F A;  2YTO A;  1BB8 A;  2DGC A;  2EL5 A;  2EOX A;  2LVH A;  4F6N A;  1A1H A;  2EM9 A;  2EM2 A;  2EN1 A;  1DGC A;  2DMI A;  2EOO A;  1Z1B A;  2EPC A;  1JK2 A;  2EN7 A;  2J7J A;  2JPA A;  2YRM A;  4FK5 C;  4R2Q A;  2WBT A;  2EJ4 A;  2WCC 3;  2LCE A;  2PRT A;  2YRH A;  2YTI A;  2EN6 A;  1X5W A;  4R2E A;  2LT7 A;  2EE8 A;  2EL4 A;  1F2I G;  4F6M A;  1ZR9 A;  1ZU1 A;  5KL4 A;  2YTF A;  1TN9 A;  1BBO A;  2EOI A;  2MKD A;  4R2P A;  1X6H A;  3MHH C;  1KJK A;  5KL6 A;  3EPL A;  1RMD A;  2CT1 A;  1JK1 A;  2EN3 A;  3UK3 C;  2EMC A;  2MDG A;  2EP3 A;  2EL6 A;  2I13 A;  2EM7 A;  2YTD A;  2ENC A;  2EMY A;  1ZAA C;  2EM3 A;  2EMK A;  1WJP A;  2EMI A;  2EMF A;  2EM4 A;  2EQ3 A;  2EML A;  2EM0 A;  3EPH A;  2YTE A;  5KL2 A;  2EPU A;  2YTQ A;  1P47 A;  2GLI A;  2EN4 A;  2YRK A;  1LLM C;  2EMZ A;  2DLK A;  2JP9 A;  2DRP A;  2EPA A;  1UBD C;  5KL3 A;  2DLQ A;  2YTP A;  1MEY C;  1UN6 B;  2EOH A;  2YSP A;  4M9V C;  2YTG A;  2MKN A;  2EN8 A;  1AAY A;  1YSA C;  2A25 A;  1NCS A;  2EQ1 A;  4R2S A;  2ELZ A;  2EPR A;  1A1K A;  2EPX A;  2ENA A;  2YU8 A;  2EOF A;  4R2D A;  1A1I A;  1X6F A;  1G2F C;  2RPC A;  5KL5 A;  2ADR A;  1YUJ A;  2GHF A;  1A1G A;  2YTJ A;  2EM5 A;  1A1L A;  2D9H A;  2LO3 A;  2EOM A;  2VRD A;  4F2J C;  1B69 A;  2EMA A;  1X6E A;  2ENH A;  2HGH A;  2M9A A;  2WBS A;  4X9J A;  4R2A A;  2EMB A;  2EMG A;  4IS1 C;  2EPZ A;  3EPK A;  4GZN C;  2EOE A;  1G2D C;  2CSH A;  2EOS A;  2YTN A;  2BB8 A;  2EM8 A;  2EOQ A;  4R2C A;  2NAB A;  2WBU A;  2EOZ A;  2EN2 A;  2CTD A;  4R2R A;  2EM6 A;  2EMW A;  3VHT B;  1YUI A;  5KL7 A;  1TF3 A;  3MHS C;  4WSG A;  1X3C A;  2RSI A;  1TF6 A;  2R1F A;  2EOR A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 4LF8 E;  4BCA A;  3ADI A;  2F4V E;  3FIG A;  3RMP A;  2LUQ A;  2ELY A;  1RQ0 A;  2EQ0 A;  2EMH A;  2LV2 A;  1XNR E;  1BB8 A;  2DGC A;  4BC9 A;  1A1H A;  2EM2 A;  2EN1 A;  5IV8 B;  1Z1B A;  2EOO A;  2EPC A;  1IMU A;  2RSM A;  5LMN E;  2J7J A;  4M0V A;  2JPA A;  5T6J A;  3H09 A;  1WXR A;  2B3T B;  2F8B A;  2L92 A;  2M7Q A;  2LT7 A;  1N34 E;  4LFC E;  1F2I G;  2NUF A;  2YTF A;  2MC6 A;  5AAS A;  3EPL A;  1JK1 A;  2EMC A;  2EP3 A;  3ZOQ B;  2JR1 A;  3ADJ A;  4TUG A;  2EMI A;  2EM4 A;  2EQ3 A;  2EML A;  1YFH A;  4DV3 E;  1HNX E;  1QU6 A;  1PKP A;  4BC7 A;  1XNQ E;  5LLQ A;  5IT9 C;  2RQL A;  2YRK A;  4BS9 A;  2DLK A;  2UU9 E;  5KL3 A;  1UN6 B;  2EOH A;  1AAY A;  2L2M A;  3THO B;  3J7Y p;  1IBK E;  1I94 E;  2YU8 A;  4JI5 E;  4R2D A;  4DR4 E;  2RPC A;  3C4B A;  2JXP A;  1BBG A;  1UHZ A;  2VF1 A;  2VRD A;  1J26 A;  2B9D A;  1X6E A;  2ENH A;  4R2A A;  4GZN C;  2LRS A;  1STU A;  4B3S E;  3J81 C;  2CSH A;  2EOS A;  2BB8 A;  2V86 A;  2NAB A;  2KHX A;  2KON A;  2JOX A;  4YY3 E;  2EN2 A;  4F54 A;  4R2R A;  1O0W A;  4WYQ B;  2EMW A;  3VHT B;  4BMJ A;  1SR9 A;  3JU0 A;  4P7D A;  4DV6 E;  2V83 A;  3MSW A;  3VYX A;  1DI2 A;  1IBL E;  2JVA A;  1GQE A;  1T39 A;  1DQ3 A;  4Q35 B;  1A1J A;  1A1F A;  4F9A B;  2GPI A;  2EL5 A;  2DIX A;  2LVH A;  4DR2 E;  4F6N A;  4DR5 E;  4OX9 E;  1GZ6 A;  5AC5 A;  4K0K E;  1X47 A;  2ZM6 E;  2B7V A;  3C6M A;  2WCC 3;  2WBT A;  2VQE E;  1PJS A;  2L2N A;  2NUE A;  2EN6 A;  4OOG C;  4LTY A;  4LF9 E;  2EL4 A;  2H36 X;  2VQF E;  2L33 A;  2MKD A;  4R2P A;  2MC5 A;  1X6H A;  5KL6 A;  1UIL A;  1EH7 A;  2MDG A;  3BBG A;  2FGG A;  2YTD A;  4NXM E;  3DJW A;  2L8T A;  1YYW A;  2EMK A;  1WJP A;  2EPK X;  4X62 E;  2E5L E;  3LML A;  1HR0 E;  3OML A;  5AE3 A;  5KL2 A;  2UUC E;  1T38 A;  2GLI A;  4LFB E;  2V88 A;  3J80 C;  2EN4 A;  1LLM C;  2JWO A;  2EMZ A;  2JP9 A;  3HXL A;  4JYA E;  2RTX A;  3F6H A;  5A6B D;  4DV4 E;  2YTG A;  3EQ1 A;  2LJU A;  2LE2 A;  2A25 A;  2EQ1 A;  4JI8 E;  1YYK A;  5CFF E;  4JI0 E;  4DV2 E;  4J8Z A;  2EOF A;  5KL5 A;  4DUZ E;  4LF6 E;  3IWD A;  2GHF A;  2YTJ A;  1A1L A;  4KZS A;  1T4O A;  2UUA E;  2Q8U A;  3AV0 A;  4F2J C;  2M9A A;  4IS1 C;  2EPZ A;  2LTS A;  2UXB E;  2V85 A;  3P1X A;  4DKK A;  2M1S A;  2YTN A;  2LMZ A;  2ODR D;  2FV4 B;  4WSP A;  4M30 A;  4JI7 E;  1X48 A;  3F6G A;  2EPL X;  4O5G A;  3BGH A;  4NXN E;  3MHS C;  3C6K A;  1X3C A;  1ZBT A;  1TF6 A;  2ODR C;  2V8Q B;  1PJQ A;  2YSO A;  5A6K A;  1YYO A;  4NZV A;  2EMX A;  4ZYH A;  3HTX A;  4O24 A;  4X66 E;  1IQS A;  4IJD A;  1YZ9 A;  1NEI A;  2RS7 A;  3ADL A;  2WZO A;  3HPZ A;  4DV5 E;  4F9B B;  3AUZ A;  5IXM B;  2JOB A;  2LBS B;  1XMQ E;  2DMI A;  3HPS A;  2UXD E;  2EN7 A;  4JI4 E;  4KHP E;  4L5N C;  3L00 A;  3THN A;  4FK5 C;  1YPN A;  1HNZ E;  4BHB A;  4R2Q A;  2L6M A;  2LCE A;  2PRT A;  2YRH A;  2YTI A;  5FLX C;  1X5W A;  4R2E A;  1EKZ A;  1ZBQ A;  4LF4 E;  4F6M A;  1ZU1 A;  4LU9 A;  4LF5 E;  2EOI A;  4O4K A;  5ADZ A;  5LMU E;  1BBO A;  4R03 A;  3LLH A;  2JY9 A;  1T4L B;  1RMD A;  2CT1 A;  2KOU A;  5A6A A;  2EN3 A;  4WXD A;  2EL6 A;  2I13 A;  4B3T E;  1MGT A;  4F9C B;  3K6Q A;  2CPN A;  1IBM E;  1ZAA C;  2EM3 A;  2EMF A;  5A2Q C;  2DB2 A;  2EM0 A;  4JV5 E;  4X64 E;  2UUB E;  2I9I A;  3ADG A;  2YTE A;  2EPO A;  4X8W A;  4I8O A;  4DV1 E;  2N3G A;  4Q28 A;  4ZYE A;  3VK6 A;  4B3M E;  2EPN A;  2MDR A;  1UBD C;  2EPM X;  2DLQ A;  2YTP A;  1MEY C;  4ZYG A;  1N3G A;  2EN8 A;  1AH5 A;  1FJG E;  4R2S A;  2YWQ A;  2EPR A;  3DF6 A;  4HTG A;  1A1K A;  4DR3 E;  4BBY A;  4DR1 E;  3VYY A;  2DSY A;  5AE2 A;  2HHH E;  1WHN A;  1YUJ A;  2M4I A;  2NA2 A;  1A1G A;  2LJH A;  4WFT A;  2N3H A;  3C4T A;  1WRJ A;  2D9H A;  2LO3 A;  2EMA A;  1SFE A;  1WHQ A;  2K7I A;  4N4R B;  1HNW E;  1PJT A;  2WBS A;  2YPN A;  4X9J A;  1QNT A;  2EMG A;  3J7A G;  3EPK A;  1N33 E;  1G2D C;  2EOE A;  4X65 E;  4YHH E;  2L3C A;  2EM8 A;  1KYQ A;  4JI3 E;  4KWY A;  4B3R E;  2V89 A;  2YZT A;  2IHR 1;  2CTD A;  5AC4 A;  2LUP B;  1YUI A;  5KL7 A;  5AE1 A;  4TUI A;  5BR8 E;  4WPY A;  2VE7 C;  2UXC E;  2EOR A;  2EPP A;  2EOY A;  3BID A;  3EPJ A;  2E72 A;  4DUY E;  2EOJ A;  3M99 B;  1X49 A;  2YTO A;  1N36 E;  2EOX A;  2EM9 A;  1DGC A;  2E1M A;  1JK2 A;  1FKA E;  1EH8 A;  3ECR A;  4DR7 E;  4LFA E;  2YRM A;  2HJJ A;  4DMI A;  2EJ4 A;  4WX9 A;  4RH8 A;  1J5E E;  2EE8 A;  4JI2 E;  4MLV A;  1L4S A;  1ZR9 A;  3HQ1 A;  2B7T A;  5KL4 A;  1TN9 A;  3MHH C;  1KJK A;  2R76 A;  4MLQ A;  3IWB A;  3UK3 C;  4DR6 E;  5F3W A;  2EM7 A;  5TSE A;  4GKK E;  2ENC A;  2EWL A;  2EMY A;  3KZY A;  2N8X A;  2JYA A;  2BBG A;  2G7H A;  3EPH A;  1RC7 A;  5LL6 R;  4BHC A;  4ZYD A;  2EPU A;  2YTQ A;  1P47 A;  1EH6 A;  5A6J A;  4DV0 E;  2DRP A;  2EPA A;  4JI6 E;  4LF7 E;  3TQM A;  2YSP A;  4M9V C;  2V87 A;  2MKN A;  2RS6 A;  3QG5 C;  3T1Y E;  4GKJ E;  1YSA C;  4HEI A;  1NCS A;  2ELZ A;  2FTX B;  2EPX A;  4NHR A;  1T4N A;  1GTK A;  2ENA A;  1A1I A;  1X6F A;  2DMY A;  1G2F C;  2L2K B;  3T1H E;  2ADR A;  2NUG A;  4P78 A;  2EM5 A;  3JTZ A;  1IQO A;  3KWR A;  5A6B A;  4AQY E;  2EOM A;  5IWA E;  1B69 A;  3JAM C;  2HGH A;  2K4V A;  2EMB A;  3BF2 A;  2L3J A;  3OTO E;  4M2Z A;  4WXC A;  4O43 A;  2EZ6 A;  4DV7 E;  5A69 A;  2EOQ A;  4L8N A;  4R2C A;  1N32 E;  5DNY A;  2WBU A;  4GEQ B;  1XMO E;  2EOZ A;  2YT4 A;  3KZZ A;  4JI1 E;  2EM6 A;  2LTR A;  4RHB B;  1PDA A;  2HC5 A;  1TF3 A;  4R8O A;  4WSG A;  2RSI A;  2R1F A;  3IWC A;  2YU5 A; 
#chains in the Genus database with same CATH homology
 2EPP A;  2EOY A;  2YSO A;  3EPJ A;  2EMX A;  2E72 A;  2EOJ A;  3M99 B;  4IJD A;  2ELY A;  2EQ0 A;  2EMH A;  2LV2 A;  1A1J A;  1A1F A;  2YTO A;  1BB8 A;  2DGC A;  2EL5 A;  2EOX A;  2LVH A;  4F6N A;  1A1H A;  2EM9 A;  2EM2 A;  2EN1 A;  1DGC A;  2DMI A;  2EOO A;  1Z1B A;  2EPC A;  1JK2 A;  2EN7 A;  2J7J A;  2JPA A;  2YRM A;  4FK5 C;  4R2Q A;  2WBT A;  2EJ4 A;  2WCC 3;  2LCE A;  2PRT A;  2YRH A;  2YTI A;  2EN6 A;  1X5W A;  4R2E A;  2LT7 A;  2EE8 A;  2EL4 A;  1F2I G;  4F6M A;  1ZR9 A;  1ZU1 A;  5KL4 A;  2YTF A;  1TN9 A;  1BBO A;  2EOI A;  2MKD A;  4R2P A;  1X6H A;  3MHH C;  1KJK A;  5KL6 A;  3EPL A;  1RMD A;  2CT1 A;  1JK1 A;  2EN3 A;  3UK3 C;  2EMC A;  2MDG A;  2EP3 A;  2EL6 A;  2I13 A;  2EM7 A;  2YTD A;  2ENC A;  2EMY A;  1ZAA C;  2EM3 A;  2EMK A;  1WJP A;  2EMI A;  2EMF A;  2EM4 A;  2EQ3 A;  2EML A;  2EM0 A;  3EPH A;  2YTE A;  5KL2 A;  2EPU A;  2YTQ A;  1P47 A;  2GLI A;  2EN4 A;  2YRK A;  1LLM C;  2EMZ A;  2DLK A;  2JP9 A;  2DRP A;  2EPA A;  1UBD C;  5KL3 A;  2DLQ A;  2YTP A;  1MEY C;  1UN6 B;  2EOH A;  2YSP A;  4M9V C;  2YTG A;  2MKN A;  2EN8 A;  1AAY A;  1YSA C;  2A25 A;  1NCS A;  2EQ1 A;  4R2S A;  2ELZ A;  2EPR A;  1A1K A;  2EPX A;  2ENA A;  2YU8 A;  2EOF A;  4R2D A;  1A1I A;  1X6F A;  1G2F C;  2RPC A;  5KL5 A;  2ADR A;  1YUJ A;  2GHF A;  1A1G A;  2YTJ A;  2EM5 A;  1A1L A;  2D9H A;  2LO3 A;  2EOM A;  2VRD A;  4F2J C;  1B69 A;  2EMA A;  1X6E A;  2ENH A;  2HGH A;  2M9A A;  2WBS A;  4X9J A;  4R2A A;  2EMB A;  2EMG A;  4IS1 C;  2EPZ A;  3EPK A;  4GZN C;  2EOE A;  1G2D C;  2CSH A;  2EOS A;  2YTN A;  2BB8 A;  2EM8 A;  2EOQ A;  4R2C A;  2NAB A;  2WBU A;  2EOZ A;  2EN2 A;  2CTD A;  4R2R A;  2EM6 A;  2EMW A;  3VHT B;  1YUI A;  5KL7 A;  1TF3 A;  3MHS C;  4WSG A;  1X3C A;  2RSI A;  1TF6 A;  2R1F A;  2EOR A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...