2YTOA

Solution structure of the c2h2 type zinc finger (region 659-691) of human zinc finger protein 484
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCSDCGKAFTRKSGLHIHQQSHTGERHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 659-691) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytoA01
2MKNA 1BB8A 2ELYA 2D9HA 2EMYA 2YTIA 1A1GA 2ADRA 3EPLA 2GHFA 1Z1BA 2EM7A 2EOXA 2LCEA 1A1JA 2JP9A 2EPAA 3EPHA 2LO3A 1P47A 2EM8A 2GLIA 1TF6A 2WBSA 1KJKA 2CSHA 5KL3A 2YTEA 5KL5A 2M9AA 1ZU1A 2EL6A 3MHHC 5KL2A 2EOIA 1A1FA 4R2DA 2EOHA 2BB8A 2EPPA 3M99B 2EMHA 2EOSA 2EOQA 1BBOA 2EOEA 4IS1C 2EPRA 2YTFA 2PRTA 1UBDC 1TF3A 4R2RA 2EMLA 2EPZA 1NCSA 2EM0A 2EMIA 2ELZA 1TN9A 2DLQA 3MHSC 2LVHA 2E72A 2YTGA 4M9VC 2EMFA 2EM6A 4IJDA 2EN4A 2EM3A 2EL5A 4R2AA 2DLKA 2DMIA 3VHTB 2EORA 2EPXA 2EMKA 2EMAA 2EQ3A 4R2PA 2CT1A 1AAYA 1LLMC 2EM2A 4R2SA 5KL4A 1G2FC 2YRKA 2EOZA 2EN2A 1YUJA 2I13A 2WCC3 2EM9A 2EMXA 1YSAC 2YTDA 4F6MA 2RPCA 1ZAAC 1X5WA 2YRHA 2ENHA 4FK5C 2JPAA 2CTDA 1UN6B 1WJPA 2EN7A 2EOFA 2LV2A 2EN6A 1X6FA 2EM5A 2EN3A 2VRDA 2YTNA 2R1FA 1JK2A 2DRPA 2WBUA 2YU8A 1A1HA 2EOOA 2EMZA 2EQ1A 4R2QA 2LT7A 1A1LA 2EL4A 4F2JC 4WSGA 2ENCA 1DGCA 2EE8A 2YTOA 4F6NA 2ENAA 2RSIA 4GZNC 2EJ4A 2EQ0A 1ZR9A 2YRMA 2YTPA 5KL6A 5KL7A 2J7JA 1F2IG 1X6EA 2WBTA 2MDGA 3UK3C 1YUIA 2EN8A 4R2EA 2A25A 2YU5A 2EN1A 2EMCA 2EM4A 1A1IA 2EOMA 4X9JA 1X6HA 1RMDA 2EMGA 2EOYA 2EPUA 3EPJA 2YTQA 2DGCA 2HGHA 2MKDA 1A1KA 1X3CA 2EP3A 1G2DC 1MEYC 2YSOA 4R2CA 3EPKA 2EPCA 2EMBA 2EMWA 2NABA 2YSPA 2YTJA 2EOJA 1B69A 1JK1A
chains in the Genus database with same CATH superfamily
2MKNA 4JYAE 3HPSA 1IQSA 2ADRA 2UU9E 2EZ6A 1A1JA 2RTXA 2LO3A 1P47A 2GLIA 4LU9A 4Q35B 5AE2A 2M9AA 4TUGA 1IBLE 1YFHA 5TSEA 4NXME 4KWYA 1WRJA 1WHNA 3QG5C 1T4NA 2EOQA 5A6BA 2L8TA 3ECRA 1UBDC 3J80C 2Q8UA 4R2RA 3OTOE 5A6BD 2JOXA 5DNYA 2YPNA 4JI8E 3F6HA 2EPLX 5LMUE 3AUZA 1UILA 2E1MA 2E72A 4M9VC 5LLQA 2EMFA 2EM6A 4IJDA 2V83A 4M0VA 3VHTB 2DMIA 2UXCE 2EPXA 2K4VA 4DR3E 4R2PA 4X62E 4R2SA 1X48A 4DR2E 1YUJA 2F4VE 4F6MA 2EPKX 2FGGA 4BHCA 4FK5C 3IWCA 2N3GA 3EQ1A 1UN6B 2EOFA 2EN6A 1T38A 1X6FA 2EM5A 1DI2A 2UUCE 4DR6E 4P78A 4B3SE 4WYQB 2WZOA 4WX9A 2EQ1A 2LT7A 1DGCA 3OMLA 4DR1E 2EE8A 4WSPA 2LBSB 5FLXC 1ZBQA 4GKKE 4NXNE 4YY3E 2RSIA 2L2KB 3JU0A 2EJ4A 2EQ0A 1ZR9A 5KL7A 2UUBE 1X6EA 1RQ0A 3THOB 1PKPA 4DV2E 3BF2A 4LF8E 2EMCA 4F9BB 2EM4A 4YHHE 3C6MA 3LMLA 2EOMA 4X9JA 4DV6E 2EMGA 2EPUA 2DGCA 4K0KE 1EH8A 2MKDA 2FV4B 1GQEA 1L4SA 1JK1A 1BB8A 2ELYA 4X66E 1MGTA 2LCEA 5ADZA 5A2QC 1HNXE 1SFEA 2R76A 1FKAE 3EPHA 5IT9C 3JTZA 5AASA 2L33A 4DV0E 1TF6A 2CSHA 4LFAE 2JY9A 5A6KA 2EL6A 2L2MA 5KL2A 2EPNA 2NUFA 4R2DA 4AQYE 3T1YE 2BB8A 2EPPA 3M99B 2LUQA 2V86A 3VYYA 4KHPE 2LMZA 1YYWA 1EH7A 1XMOE 4M2ZA 4OOGC 2EOEA 4KZSA 4IS1C 2YTFA 2PRTA 2LTRA 1RC7A 5A6AA 2EMLA 4RHBB 2LTSA 1J5EE 4OX9E 4LF9E 2NA2A 4I8OA 3MHSC 2JWOA 2UUAE 4B3ME 2EN4A 2EM3A 2EL5A 2L3JA 2EQ3A 3DF6A 2CT1A 4X65E 4LF6E 4LF5E 1IQOA 2EN2A 5A6JA 2WCC3 2EWLA 2EMXA 4BS9A 1YYKA 1X5WA 2EPOA 2ENHA 2YRHA 1WXRA 1WJPA 2EN7A 2LV2A 4LF7E 2ZM6E 2R1FA 2ODRD 2V87A 4DV7E 1JK2A 2YWQA 4NHRA 2YU8A 4L5NC 2EOOA 2EMZA 3K6QA 5LL6R 4ZYGA 4R2QA 3T1HE 3THNA 2F8BA 1T39A 2M7QA 2ENAA 3ZOQB 2N8XA 2YRMA 2KONA 5KL6A 1F2IG 2UXBE 1HNZE 3UK3C 1N34E 3LLHA 3ADGA 2KHXA 1RMDA 3FIGA 3EPJA 2LRSA 2RS6A 1QU6A 1G2DC 4WPYA 2EPCA 2EMWA 2NABA 1N3GA 2YTJA 2EOJA 2E5LE 2IHR1 2YTIA 5AC5A 1A1GA 2GHFA 2CPNA 2EOXA 2JYAA 4F54A 2JP9A 4MLQA 2KOUA 4O24A 2EM8A 1XMQE 4LFBE 4O5GA 2WBSA 2DSYA 5LMNE 2DB2A 5KL3A 5KL5A 1ZU1A 3MHHC 1A1FA 2B7TA 1PJQA 4DV1E 4DR7E 3HXLA 2EMHA 1BBOA 2EPRA 1YPNA 2V89A 4F9AB 1NCSA 2EM0A 2HC5A 4R03A 2EMIA 1SR9A 2YZTA 3HPZA 2B9DA 4ZYHA 3VK6A 2LVHA 1PJTA 3IWDA 4JI4E 4JI6E 4JI2E 2V8QB 2ODRC 3ADJA 4R2AA 1GZ6A 2DLKA 2EORA 2EMKA 2LUPB 2EMAA 2DIXA 4LTYA 1LLMC 1AAYA 2LJHA 2EM2A 3F6GA 5T6JA 3J7Yp 1G2FC 1WHQA 2MC6A 5BR8E 4DUYE 1FJGE 4J8ZA 1NEIA 2JXPA 4JI7E 1ZAAC 2G7HA 1UHZA 2VRDA 4GKJE 4BC9A 2JVAA 3RMPA 4LF4E 3HTXA 4BCAA 2NUEA 4B3RE 2DRPA 3H09A 2HHHE 3L00A 1A1HA 3ADIA 2EL4A 4F2JC 2ENCA 1EKZA 3J81C 2H36X 5IV8B 1X49A 4BC7A 1N32E 2LE2A 4B3TE 4JI1E 2NUGA 2B7VA 2YTPA 4WFTA 2M4IA 2J7JA 2VF1A 4DV4E 5F3WA 4BMJA 4O4KA 1YUIA 4GEQB 4Q28A 4R2EA 2A25A 2RSMA 3VYXA 2EN1A 2MDRA 3IWBA 1A1IA 2JOBA 1YZ9A 2HJJA 3C4BA 1IBME 3BGHA 3ADLA 1IBKE 2VQFE 2YTQA 2I9IA 2B3TB 2HGHA 2YT4A 1XNQE 4JI3E 1A1KA 1X3CA 1MEYC 2YSOA 3C4TA 1STUA 3BIDA 3EPKA 2EMBA 4JI0E 2D9HA 2EMYA 1HR0E 3JAMC 1BBGA 5IWAE 3EPLA 1Z1BA 1T4LB 4DKKA 2EM7A 4R8OA 1YYOA 2UXDE 2EPAA 4DV5E 4BHBA 1GTKA 1ZBTA 2DMYA 4JI5E 4DV3E 1KJKA 1N36E 1IMUA 2YTEA 2EOIA 1EH6A 2EOHA 3TQMA 4N4RB 5AC4A 2EOSA 1HNWE 1TF3A 2EPZA 2V88A 1PDAA 3HQ1A 4ZYEA 1AH5A 1PJSA 2ELZA 1TN9A 2DLQA 2MC5A 4DMIA 4DUZE 4JV5E 1T4OA 2RQLA 2YTGA 1J26A 5AE1A 2L2NA 2M1SA 3AV0A 2BBGA 4F9CB 1KYQA 3DJWA 4O43A 5A69A 4TUIA 2VE7C 5KL4A 2YRKA 4M30A 2EOZA 2I13A 4P7DA 2EM9A 4NZVA 2K7IA 2N3HA 2YTDA 1YSAC 2RPCA 2LJUA 2JPAA 2GPIA 2CTDA 2L92A 1I94E 3J7AG 2EN3A 2YTNA 4RH8A 1O0WA 2WBUA 2VQEE 4DR4E 4WXDA 4DR5E 1A1LA 4WSGA 2L6MA 2YTOA 1X47A 5CFFE 4LFCE 3KZZA 2L3CA 3MSWA 4F6NA 4GZNC 2WBTA 2JR1A 2MDGA 2EN8A 4HTGA 4MLVA 4X64E 1DQ3A 2YU5A 1N33E 2RS7A 1QNTA 3P1XA 2V85A 3BBGA 1X6HA 3C6KA 2EOYA 4BBYA 4ZYDA 1XNRE 4L8NA 4HEIA 3KWRA 2EP3A 3KZYA 4WXCA 4X8WA 5AE3A 5IXMB 2FTXB 4R2CA 2YSPA 1B69A 2EPMX
chains in the Genus database with same CATH topology
2MKNA 1BB8A 2ELYA 2D9HA 2EMYA 2YTIA 1A1GA 2ADRA 3EPLA 2GHFA 1Z1BA 2EM7A 2EOXA 2LCEA 1A1JA 2JP9A 2EPAA 3EPHA 2LO3A 1P47A 2EM8A 2GLIA 1TF6A 2WBSA 1KJKA 2CSHA 5KL3A 2YTEA 5KL5A 2M9AA 1ZU1A 2EL6A 3MHHC 5KL2A 2EOIA 1A1FA 4R2DA 2EOHA 2BB8A 2EPPA 3M99B 2EMHA 2EOSA 2EOQA 1BBOA 2EOEA 4IS1C 2EPRA 2YTFA 2PRTA 1UBDC 1TF3A 4R2RA 2EMLA 2EPZA 1NCSA 2EM0A 2EMIA 2ELZA 1TN9A 2DLQA 3MHSC 2LVHA 2E72A 2YTGA 4M9VC 2EMFA 2EM6A 4IJDA 2EN4A 2EM3A 2EL5A 4R2AA 2DLKA 2DMIA 3VHTB 2EORA 2EPXA 2EMKA 2EMAA 2EQ3A 4R2PA 2CT1A 1AAYA 1LLMC 2EM2A 4R2SA 5KL4A 1G2FC 2YRKA 2EOZA 2EN2A 1YUJA 2I13A 2WCC3 2EM9A 2EMXA 1YSAC 2YTDA 4F6MA 2RPCA 1ZAAC 1X5WA 2YRHA 2ENHA 4FK5C 2JPAA 2CTDA 1UN6B 1WJPA 2EN7A 2EOFA 2LV2A 2EN6A 1X6FA 2EM5A 2EN3A 2VRDA 2YTNA 2R1FA 1JK2A 2DRPA 2WBUA 2YU8A 1A1HA 2EOOA 2EMZA 2EQ1A 4R2QA 2LT7A 1A1LA 2EL4A 4F2JC 4WSGA 2ENCA 1DGCA 2EE8A 2YTOA 4F6NA 2ENAA 2RSIA 4GZNC 2EJ4A 2EQ0A 1ZR9A 2YRMA 2YTPA 5KL6A 5KL7A 2J7JA 1F2IG 1X6EA 2WBTA 2MDGA 3UK3C 1YUIA 2EN8A 4R2EA 2A25A 2YU5A 2EN1A 2EMCA 2EM4A 1A1IA 2EOMA 4X9JA 1X6HA 1RMDA 2EMGA 2EOYA 2EPUA 3EPJA 2YTQA 2DGCA 2HGHA 2MKDA 1A1KA 1X3CA 2EP3A 1G2DC 1MEYC 2YSOA 4R2CA 3EPKA 2EPCA 2EMBA 2EMWA 2NABA 2YSPA 2YTJA 2EOJA 1B69A 1JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKN A;  1BB8 A;  2ELY A;  2D9H A;  2EMY A;  2YTI A;  1A1G A;  2ADR A;  3EPL A;  2GHF A;  1Z1B A;  2EM7 A;  2EOX A;  2LCE A;  1A1J A;  2JP9 A;  2EPA A;  3EPH A;  2LO3 A;  1P47 A;  2EM8 A;  2GLI A;  1TF6 A;  2WBS A;  1KJK A;  2CSH A;  5KL3 A;  2YTE A;  5KL5 A;  2M9A A;  1ZU1 A;  2EL6 A;  3MHH C;  5KL2 A;  2EOI A;  1A1F A;  4R2D A;  2EOH A;  2BB8 A;  2EPP A;  3M99 B;  2EMH A;  2EOS A;  2EOQ A;  1BBO A;  2EOE A;  4IS1 C;  2EPR A;  2YTF A;  2PRT A;  1UBD C;  1TF3 A;  4R2R A;  2EML A;  2EPZ A;  1NCS A;  2EM0 A;  2EMI A;  2ELZ A;  1TN9 A;  2DLQ A;  3MHS C;  2LVH A;  2E72 A;  2YTG A;  4M9V C;  2EMF A;  2EM6 A;  4IJD A;  2EN4 A;  2EM3 A;  2EL5 A;  4R2A A;  2DLK A;  2DMI A;  3VHT B;  2EOR A;  2EPX A;  2EMK A;  2EMA A;  2EQ3 A;  4R2P A;  2CT1 A;  1AAY A;  1LLM C;  2EM2 A;  4R2S A;  5KL4 A;  1G2F C;  2YRK A;  2EOZ A;  2EN2 A;  1YUJ A;  2I13 A;  2WCC 3;  2EM9 A;  2EMX A;  1YSA C;  2YTD A;  4F6M A;  2RPC A;  1ZAA C;  1X5W A;  2YRH A;  2ENH A;  4FK5 C;  2JPA A;  2CTD A;  1UN6 B;  1WJP A;  2EN7 A;  2EOF A;  2LV2 A;  2EN6 A;  1X6F A;  2EM5 A;  2EN3 A;  2VRD A;  2YTN A;  2R1F A;  1JK2 A;  2DRP A;  2WBU A;  2YU8 A;  1A1H A;  2EOO A;  2EMZ A;  2EQ1 A;  4R2Q A;  2LT7 A;  1A1L A;  2EL4 A;  4F2J C;  4WSG A;  2ENC A;  1DGC A;  2EE8 A;  2YTO A;  4F6N A;  2ENA A;  2RSI A;  4GZN C;  2EJ4 A;  2EQ0 A;  1ZR9 A;  2YRM A;  2YTP A;  5KL6 A;  5KL7 A;  2J7J A;  1F2I G;  1X6E A;  2WBT A;  2MDG A;  3UK3 C;  1YUI A;  2EN8 A;  4R2E A;  2A25 A;  2YU5 A;  2EN1 A;  2EMC A;  2EM4 A;  1A1I A;  2EOM A;  4X9J A;  1X6H A;  1RMD A;  2EMG A;  2EOY A;  2EPU A;  3EPJ A;  2YTQ A;  2DGC A;  2HGH A;  2MKD A;  1A1K A;  1X3C A;  2EP3 A;  1G2D C;  1MEY C;  2YSO A;  4R2C A;  3EPK A;  2EPC A;  2EMB A;  2EMW A;  2NAB A;  2YSP A;  2YTJ A;  2EOJ A;  1B69 A;  1JK1 A; 
#chains in the Genus database with same CATH topology
 2MKN A;  4JYA E;  3HPS A;  1IQS A;  2ADR A;  2UU9 E;  2EZ6 A;  1A1J A;  2RTX A;  2LO3 A;  1P47 A;  2GLI A;  4LU9 A;  4Q35 B;  5AE2 A;  2M9A A;  4TUG A;  1IBL E;  1YFH A;  5TSE A;  4NXM E;  4KWY A;  1WRJ A;  1WHN A;  3QG5 C;  1T4N A;  2EOQ A;  5A6B A;  2L8T A;  3ECR A;  1UBD C;  3J80 C;  2Q8U A;  4R2R A;  3OTO E;  5A6B D;  2JOX A;  5DNY A;  2YPN A;  4JI8 E;  3F6H A;  2EPL X;  5LMU E;  3AUZ A;  1UIL A;  2E1M A;  2E72 A;  4M9V C;  5LLQ A;  2EMF A;  2EM6 A;  4IJD A;  2V83 A;  4M0V A;  3VHT B;  2DMI A;  2UXC E;  2EPX A;  2K4V A;  4DR3 E;  4R2P A;  4X62 E;  4R2S A;  1X48 A;  4DR2 E;  1YUJ A;  2F4V E;  4F6M A;  2EPK X;  2FGG A;  4BHC A;  4FK5 C;  3IWC A;  2N3G A;  3EQ1 A;  1UN6 B;  2EOF A;  2EN6 A;  1T38 A;  1X6F A;  2EM5 A;  1DI2 A;  2UUC E;  4DR6 E;  4P78 A;  4B3S E;  4WYQ B;  2WZO A;  4WX9 A;  2EQ1 A;  2LT7 A;  1DGC A;  3OML A;  4DR1 E;  2EE8 A;  4WSP A;  2LBS B;  5FLX C;  1ZBQ A;  4GKK E;  4NXN E;  4YY3 E;  2RSI A;  2L2K B;  3JU0 A;  2EJ4 A;  2EQ0 A;  1ZR9 A;  5KL7 A;  2UUB E;  1X6E A;  1RQ0 A;  3THO B;  1PKP A;  4DV2 E;  3BF2 A;  4LF8 E;  2EMC A;  4F9B B;  2EM4 A;  4YHH E;  3C6M A;  3LML A;  2EOM A;  4X9J A;  4DV6 E;  2EMG A;  2EPU A;  2DGC A;  4K0K E;  1EH8 A;  2MKD A;  2FV4 B;  1GQE A;  1L4S A;  1JK1 A;  1BB8 A;  2ELY A;  4X66 E;  1MGT A;  2LCE A;  5ADZ A;  5A2Q C;  1HNX E;  1SFE A;  2R76 A;  1FKA E;  3EPH A;  5IT9 C;  3JTZ A;  5AAS A;  2L33 A;  4DV0 E;  1TF6 A;  2CSH A;  4LFA E;  2JY9 A;  5A6K A;  2EL6 A;  2L2M A;  5KL2 A;  2EPN A;  2NUF A;  4R2D A;  4AQY E;  3T1Y E;  2BB8 A;  2EPP A;  3M99 B;  2LUQ A;  2V86 A;  3VYY A;  4KHP E;  2LMZ A;  1YYW A;  1EH7 A;  1XMO E;  4M2Z A;  4OOG C;  2EOE A;  4KZS A;  4IS1 C;  2YTF A;  2PRT A;  2LTR A;  1RC7 A;  5A6A A;  2EML A;  4RHB B;  2LTS A;  1J5E E;  4OX9 E;  4LF9 E;  2NA2 A;  4I8O A;  3MHS C;  2JWO A;  2UUA E;  4B3M E;  2EN4 A;  2EM3 A;  2EL5 A;  2L3J A;  2EQ3 A;  3DF6 A;  2CT1 A;  4X65 E;  4LF6 E;  4LF5 E;  1IQO A;  2EN2 A;  5A6J A;  2WCC 3;  2EWL A;  2EMX A;  4BS9 A;  1YYK A;  1X5W A;  2EPO A;  2ENH A;  2YRH A;  1WXR A;  1WJP A;  2EN7 A;  2LV2 A;  4LF7 E;  2ZM6 E;  2R1F A;  2ODR D;  2V87 A;  4DV7 E;  1JK2 A;  2YWQ A;  4NHR A;  2YU8 A;  4L5N C;  2EOO A;  2EMZ A;  3K6Q A;  5LL6 R;  4ZYG A;  4R2Q A;  3T1H E;  3THN A;  2F8B A;  1T39 A;  2M7Q A;  2ENA A;  3ZOQ B;  2N8X A;  2YRM A;  2KON A;  5KL6 A;  1F2I G;  2UXB E;  1HNZ E;  3UK3 C;  1N34 E;  3LLH A;  3ADG A;  2KHX A;  1RMD A;  3FIG A;  3EPJ A;  2LRS A;  2RS6 A;  1QU6 A;  1G2D C;  4WPY A;  2EPC A;  2EMW A;  2NAB A;  1N3G A;  2YTJ A;  2EOJ A;  2E5L E;  2IHR 1;  2YTI A;  5AC5 A;  1A1G A;  2GHF A;  2CPN A;  2EOX A;  2JYA A;  4F54 A;  2JP9 A;  4MLQ A;  2KOU A;  4O24 A;  2EM8 A;  1XMQ E;  4LFB E;  4O5G A;  2WBS A;  2DSY A;  5LMN E;  2DB2 A;  5KL3 A;  5KL5 A;  1ZU1 A;  3MHH C;  1A1F A;  2B7T A;  1PJQ A;  4DV1 E;  4DR7 E;  3HXL A;  2EMH A;  1BBO A;  2EPR A;  1YPN A;  2V89 A;  4F9A B;  1NCS A;  2EM0 A;  2HC5 A;  4R03 A;  2EMI A;  1SR9 A;  2YZT A;  3HPZ A;  2B9D A;  4ZYH A;  3VK6 A;  2LVH A;  1PJT A;  3IWD A;  4JI4 E;  4JI6 E;  4JI2 E;  2V8Q B;  2ODR C;  3ADJ A;  4R2A A;  1GZ6 A;  2DLK A;  2EOR A;  2EMK A;  2LUP B;  2EMA A;  2DIX A;  4LTY A;  1LLM C;  1AAY A;  2LJH A;  2EM2 A;  3F6G A;  5T6J A;  3J7Y p;  1G2F C;  1WHQ A;  2MC6 A;  5BR8 E;  4DUY E;  1FJG E;  4J8Z A;  1NEI A;  2JXP A;  4JI7 E;  1ZAA C;  2G7H A;  1UHZ A;  2VRD A;  4GKJ E;  4BC9 A;  2JVA A;  3RMP A;  4LF4 E;  3HTX A;  4BCA A;  2NUE A;  4B3R E;  2DRP A;  3H09 A;  2HHH E;  3L00 A;  1A1H A;  3ADI A;  2EL4 A;  4F2J C;  2ENC A;  1EKZ A;  3J81 C;  2H36 X;  5IV8 B;  1X49 A;  4BC7 A;  1N32 E;  2LE2 A;  4B3T E;  4JI1 E;  2NUG A;  2B7V A;  2YTP A;  4WFT A;  2M4I A;  2J7J A;  2VF1 A;  4DV4 E;  5F3W A;  4BMJ A;  4O4K A;  1YUI A;  4GEQ B;  4Q28 A;  4R2E A;  2A25 A;  2RSM A;  3VYX A;  2EN1 A;  2MDR A;  3IWB A;  1A1I A;  2JOB A;  1YZ9 A;  2HJJ A;  3C4B A;  1IBM E;  3BGH A;  3ADL A;  1IBK E;  2VQF E;  2YTQ A;  2I9I A;  2B3T B;  2HGH A;  2YT4 A;  1XNQ E;  4JI3 E;  1A1K A;  1X3C A;  1MEY C;  2YSO A;  3C4T A;  1STU A;  3BID A;  3EPK A;  2EMB A;  4JI0 E;  2D9H A;  2EMY A;  1HR0 E;  3JAM C;  1BBG A;  5IWA E;  3EPL A;  1Z1B A;  1T4L B;  4DKK A;  2EM7 A;  4R8O A;  1YYO A;  2UXD E;  2EPA A;  4DV5 E;  4BHB A;  1GTK A;  1ZBT A;  2DMY A;  4JI5 E;  4DV3 E;  1KJK A;  1N36 E;  1IMU A;  2YTE A;  2EOI A;  1EH6 A;  2EOH A;  3TQM A;  4N4R B;  5AC4 A;  2EOS A;  1HNW E;  1TF3 A;  2EPZ A;  2V88 A;  1PDA A;  3HQ1 A;  4ZYE A;  1AH5 A;  1PJS A;  2ELZ A;  1TN9 A;  2DLQ A;  2MC5 A;  4DMI A;  4DUZ E;  4JV5 E;  1T4O A;  2RQL A;  2YTG A;  1J26 A;  5AE1 A;  2L2N A;  2M1S A;  3AV0 A;  2BBG A;  4F9C B;  1KYQ A;  3DJW A;  4O43 A;  5A69 A;  4TUI A;  2VE7 C;  5KL4 A;  2YRK A;  4M30 A;  2EOZ A;  2I13 A;  4P7D A;  2EM9 A;  4NZV A;  2K7I A;  2N3H A;  2YTD A;  1YSA C;  2RPC A;  2LJU A;  2JPA A;  2GPI A;  2CTD A;  2L92 A;  1I94 E;  3J7A G;  2EN3 A;  2YTN A;  4RH8 A;  1O0W A;  2WBU A;  2VQE E;  4DR4 E;  4WXD A;  4DR5 E;  1A1L A;  4WSG A;  2L6M A;  2YTO A;  1X47 A;  5CFF E;  4LFC E;  3KZZ A;  2L3C A;  3MSW A;  4F6N A;  4GZN C;  2WBT A;  2JR1 A;  2MDG A;  2EN8 A;  4HTG A;  4MLV A;  4X64 E;  1DQ3 A;  2YU5 A;  1N33 E;  2RS7 A;  1QNT A;  3P1X A;  2V85 A;  3BBG A;  1X6H A;  3C6K A;  2EOY A;  4BBY A;  4ZYD A;  1XNR E;  4L8N A;  4HEI A;  3KWR A;  2EP3 A;  3KZY A;  4WXC A;  4X8W A;  5AE3 A;  5IXM B;  2FTX B;  4R2C A;  2YSP A;  1B69 A;  2EPM X; 
#chains in the Genus database with same CATH homology
 2MKN A;  1BB8 A;  2ELY A;  2D9H A;  2EMY A;  2YTI A;  1A1G A;  2ADR A;  3EPL A;  2GHF A;  1Z1B A;  2EM7 A;  2EOX A;  2LCE A;  1A1J A;  2JP9 A;  2EPA A;  3EPH A;  2LO3 A;  1P47 A;  2EM8 A;  2GLI A;  1TF6 A;  2WBS A;  1KJK A;  2CSH A;  5KL3 A;  2YTE A;  5KL5 A;  2M9A A;  1ZU1 A;  2EL6 A;  3MHH C;  5KL2 A;  2EOI A;  1A1F A;  4R2D A;  2EOH A;  2BB8 A;  2EPP A;  3M99 B;  2EMH A;  2EOS A;  2EOQ A;  1BBO A;  2EOE A;  4IS1 C;  2EPR A;  2YTF A;  2PRT A;  1UBD C;  1TF3 A;  4R2R A;  2EML A;  2EPZ A;  1NCS A;  2EM0 A;  2EMI A;  2ELZ A;  1TN9 A;  2DLQ A;  3MHS C;  2LVH A;  2E72 A;  2YTG A;  4M9V C;  2EMF A;  2EM6 A;  4IJD A;  2EN4 A;  2EM3 A;  2EL5 A;  4R2A A;  2DLK A;  2DMI A;  3VHT B;  2EOR A;  2EPX A;  2EMK A;  2EMA A;  2EQ3 A;  4R2P A;  2CT1 A;  1AAY A;  1LLM C;  2EM2 A;  4R2S A;  5KL4 A;  1G2F C;  2YRK A;  2EOZ A;  2EN2 A;  1YUJ A;  2I13 A;  2WCC 3;  2EM9 A;  2EMX A;  1YSA C;  2YTD A;  4F6M A;  2RPC A;  1ZAA C;  1X5W A;  2YRH A;  2ENH A;  4FK5 C;  2JPA A;  2CTD A;  1UN6 B;  1WJP A;  2EN7 A;  2EOF A;  2LV2 A;  2EN6 A;  1X6F A;  2EM5 A;  2EN3 A;  2VRD A;  2YTN A;  2R1F A;  1JK2 A;  2DRP A;  2WBU A;  2YU8 A;  1A1H A;  2EOO A;  2EMZ A;  2EQ1 A;  4R2Q A;  2LT7 A;  1A1L A;  2EL4 A;  4F2J C;  4WSG A;  2ENC A;  1DGC A;  2EE8 A;  2YTO A;  4F6N A;  2ENA A;  2RSI A;  4GZN C;  2EJ4 A;  2EQ0 A;  1ZR9 A;  2YRM A;  2YTP A;  5KL6 A;  5KL7 A;  2J7J A;  1F2I G;  1X6E A;  2WBT A;  2MDG A;  3UK3 C;  1YUI A;  2EN8 A;  4R2E A;  2A25 A;  2YU5 A;  2EN1 A;  2EMC A;  2EM4 A;  1A1I A;  2EOM A;  4X9J A;  1X6H A;  1RMD A;  2EMG A;  2EOY A;  2EPU A;  3EPJ A;  2YTQ A;  2DGC A;  2HGH A;  2MKD A;  1A1K A;  1X3C A;  2EP3 A;  1G2D C;  1MEY C;  2YSO A;  4R2C A;  3EPK A;  2EPC A;  2EMB A;  2EMW A;  2NAB A;  2YSP A;  2YTJ A;  2EOJ A;  1B69 A;  1JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...