2YTOA

Solution structure of the c2h2 type zinc finger (region 659-691) of human zinc finger protein 484
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCSDCGKAFTRKSGLHIHQQSHTGERHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 659-691) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytoA01
2GLIA 2R1FA 2JP9A 1KJKA 1BB8A 2A25A 2EOMA 2YTGA 2LCEA 5KL7A 3EPLA 2EM2A 2YU5A 2LV2A 5KL5A 2EMYA 2EPRA 2LVHA 2GHFA 1X5WA 2DLQA 2EL4A 2J7JA 1ZAAC 1WJPA 2EM7A 3EPJA 1B69A 1ZR9A 1F2IG 2EL5A 3M99B 2EMKA 1TF3A 2JPAA 2YTOA 1TF6A 1DGCA 2LO3A 2EN1A 2EM5A 2EOJA 2EOSA 1NCSA 1ZU1A 4WSGA 2YRHA 3MHHC 2EN2A 2NABA 1RMDA 2EP3A 1A1LA 5KL3A 2EMCA 2EOYA 5KL4A 2EQ0A 2EOQA 2DMIA 4R2SA 2WCC3 4F6MA 4M9VC 4R2QA 2YSOA 2E72A 2EOOA 4X9JA 2YTJA 2ENAA 2EOFA 2MKNA 2EE8A 2EMFA 2HGHA 2EQ3A 2EL6A 2CSHA 2EMLA 2D9HA 2EPPA 3UK3C 1TN9A 4F2JC 2EMAA 2EN3A 2YTPA 2WBUA 1UN6B 2YSPA 1G2DC 4F6NA 2EM3A 2ELZA 2YU8A 2EM0A 4R2AA 1X6HA 2YTQA 2ENCA 2PRTA 4R2CA 2EORA 2RSIA 2YTFA 2EM6A 1MEYC 2EMXA 2EM4A 1YUJA 1X3CA 2EN8A 1BBOA 1YUIA 2YTDA 2EMIA 2MDGA 4FK5C 2DGCA 2ENHA 2EQ1A 2EN7A 2EOHA 2YRMA 4IS1C 2I13A 2EPZA 1A1JA 1P47A 1A1IA 4GZNC 2EN4A 2DLKA 2EMGA 2EPUA 5KL6A 2VRDA 1A1GA 2BB8A 1JK1A 4R2PA 2EOEA 2EMHA 2CT1A 4R2DA 1A1KA 3EPHA 2EM8A 2EMZA 5KL2A 2EPAA 4R2RA 2LT7A 2EJ4A 2EOXA 2WBSA 2EN6A 2RPCA 1UBDC 2EPCA 2ADRA 3VHTB 2M9AA 1X6FA 2YTIA 1A1FA 4IJDA 1JK2A 2WBTA 2DRPA 2EM9A 2EPXA 1G2FC 2YRKA 1X6EA 2EOIA 3MHSC 3EPKA 1LLMC 2CTDA 2EOZA 1Z1BA 1A1HA 4R2EA 2ELYA 1AAYA 2YTEA 2EMBA 2EMWA 2YTNA 1YSAC 2MKDA
chains in the Genus database with same CATH superfamily
1EKZA 2YPNA 4DV1E 1BB8A 2YTGA 2LCEA 2L8TA 1PJQA 1N36E 2LRSA 3KWRA 2DLQA 1WJPA 2WZOA 1T39A 1B69A 3DJWA 1F2IG 4LU9A 2JR1A 3BIDA 1HR0E 2EM5A 2EOJA 1NCSA 5AE1A 3MHHC 4DV3E 2EN2A 1AH5A 2N3GA 4DR7E 1A1LA 3TQMA 5KL3A 2UU9E 4JI3E 1PJSA 3KZYA 1IMUA 5IXMB 4M9VC 2WCC3 4JI7E 4R2QA 2YSOA 2ENAA 4JI4E 2EE8A 1HNXE 2HGHA 2EL6A 2EMLA 2LTRA 2D9HA 2LMZA 2JWOA 2V89A 4Q35B 2RS6A 4F6NA 4JV5E 2EWLA 4R2AA 4GKKE 4B3TE 2V88A 3HXLA 2MC6A 2EM4A 1YUJA 4BS9A 5ADZA 5AC5A 2HHHE 1YUIA 2JOXA 2EMIA 3HTXA 2DGCA 2EQ1A 2JXPA 1FJGE 4X65E 3J81C 2BBGA 4GKJE 2EMGA 5KL6A 4LFAE 2BB8A 1UILA 4JI0E 2EZ6A 1PDAA 4DUYE 2CT1A 4N4RB 3J7AG 2L92A 1FKAE 4X8WA 2EMZA 2EJ4A 4X64E 3KZZA 4M2ZA 1X6FA 1I94E 4F9BB 2YTIA 1A1FA 4P7DA 1T4LB 4B3RE 4HTGA 2F8BA 1BBGA 4DV7E 2NUFA 4KHPE 1QNTA 3VYXA 4ZYEA 4O5GA 1XNRE 3BBGA 4DR5E 1A1HA 1N34E 1X47A 2YTEA 2V86A 1KJKA 4RH8A 4BMJA 5KL7A 2EM2A 5KL5A 2LV2A 2NUGA 4DUZE 4YHHE 2GHFA 4TUGA 1X5WA 2EL4A 3VYYA 3OTOE 2EL5A 2EPMX 3T1YE 2YTOA 4NZVA 2JVAA 2EOSA 1EH6A 1X49A 4DV2E 1WRJA 3AV0A 2UXDE 1RMDA 4BHCA 2EMCA 4B3ME 2EOYA 4F6MA 2EOQA 2DMIA 4KZSA 4JI5E 2E72A 1YYOA 2EOOA 3HQ1A 4O43A 2L3CA 2RS7A 4LFCE 2EMFA 1EH7A 4GEQB 4BCAA 3ZOQB 3ADIA 2HC5A 4AQYE 2L2NA 4BC9A 5AE2A 1HNWE 1UN6B 2YSPA 4NXME 2EM3A 2ELZA 4F9AB 2EM0A 2B3TB 5A6BD 3C4TA 1GZ6A 1DI2A 1PJTA 2KHXA 2CPNA 4R2CA 4BBYA 3IWCA 1MEYC 2EM6A 2YZTA 2DB2A 2YTDA 4FK5C 5AE3A 4HEIA 4ZYHA 2EPZA 1A1JA 1P47A 4DKKA 5DNYA 2DLKA 4JI2E 1KYQA 2LUQA 4WXCA 1WHNA 2VQEE 2LUPB 2V85A 5LMNE 1JK1A 4R2PA 2JYAA 2EOEA 4BHBA 2EMHA 4R2DA 1IBKE 4LF7E 4WXDA 1XMOE 4R2RA 2LT7A 4DR6E 2YT4A 2EOXA 1YFHA 2Q8UA 2I9IA 5CFFE 3T1HE 1IBME 2LJUA 4JI8E 4DV6E 2EM9A 5LL6R 1IQOA 2YRKA 4O24A 4LF8E 2KOUA 2B7VA 2LE2A 5A6JA 2UUAE 3IWBA 4DMIA 1Z1BA 2G7HA 3EQ1A 1N32E 4ZYDA 3BF2A 1DQ3A 2KONA 4OX9E 1J5EE 2EMWA 2YTNA 3J7Yp 2VF1A 2GLIA 1J26A 1YPNA 3JAMC 4M30A 2YU5A 2EMYA 2EPRA 2EPOA 2N3HA 2RSMA 1T38A 1ZR9A 3M99B 1TF3A 2UXCE 3QG5C 3P1XA 3THNA 2LO3A 4WX9A 1ZU1A 4WSGA 2YRHA 2LTSA 2NABA 5LMUE 2EP3A 4NHRA 2FV4B 2LBSB 5KL4A 2EQ0A 4R2SA 5F3WA 5IWAE 1N3GA 2EOFA 2MKNA 2EQ3A 2CSHA 4ZYGA 3UK3C 2VQFE 2K7IA 4LF6E 4I8OA 2EN3A 2WBUA 4L8NA 5A6AA 2FTXB 2NA2A 2VE7C 5TSEA 2ENCA 2F4VE 5A6BA 2EORA 2B7TA 1GTKA 1YZ9A 4MLQA 1X3CA 4LTYA 2RQLA 3MSWA 2JOBA 3L00A 4NXNE 5A6KA 2ENHA 2EN7A 2YRMA 2RTXA 2ODRD 2LJHA 1A1IA 4O4KA 4GZNC 2EN4A 4F9CB 3F6HA 2VRDA 2FGGA 2GPIA 2B9DA 3AUZA 2M4IA 3HPZA 1YYKA 4DR2E 1A1KA 3EPHA 2K4VA 2EM8A 2EPNA 2EPAA 2H36X 2WBSA 1EH8A 2EN6A 2RPCA 4R03A 1UBDC 2MDRA 4DR3E 2ODRC 5IV8B 3IWDA 1IQSA 1STUA 1XMQE 1MGTA 4IJDA 2EPXA 1T4OA 4JI6E 2EOIA 3MHSC 3EPKA 1NEIA 2ZM6E 4MLVA 2CTDA 4J8ZA 2EOZA 4R2EA 4DR1E 2ELYA 2M7QA 2L6MA 1AAYA 1O0WA 2EMBA 3THOB 1YSAC 2MKDA 4RHBB 2JP9A 2R1FA 5FLXC 3BGHA 4OOGC 4F54A 2A25A 3J80C 2UUBE 2EOMA 2V87A 3F6GA 3EPLA 2JY9A 1YYWA 2LVHA 1WHQA 2L33A 3LLHA 1L4SA 2V83A 2J7JA 1ZAAC 4LFBE 1SFEA 2EM7A 3EPJA 3ADGA 1SR9A 1QU6A 2EMKA 4B3SE 5AASA 2JPAA 4K0KE 4L5NC 4LF9E 2E1MA 4JYAE 4TUIA 2MC5A 1DGCA 1TF6A 2E5LE 2EN1A 4LF4E 4P78A 1ZBQA 2IHR1 4DR4E 3OMLA 3VK6A 1WXRA 1X48A 2EPKX 4X9JA 1N33E 2YTJA 2L2KB 3C6KA 2M1SA 1RQ0A 1UHZA 2NUEA 2EPPA 1PKPA 1TN9A 4WPYA 4F2JC 2EMAA 3ADLA 2YTPA 1G2DC 4R8OA 1IBLE 2HJJA 1T4NA 2YU8A 3LMLA 1RC7A 1X6HA 2YTQA 2PRTA 4LF5E 3C6MA 4BC7A 2UUCE 2RSIA 2YTFA 2N8XA 5AC4A 2EMXA 3HPSA 2EN8A 1GQEA 1BBOA 2YWQA 2L3JA 4DV4E 2DMYA 2MDGA 3RMPA 4X62E 2DIXA 4KWYA 4M0VA 4WYQB 4DV0E 2EOHA 4IS1C 2I13A 2EPLX 3ECRA 2EPUA 5A2QC 1A1GA 1XNQE 3JTZA 5IT9C 1HNZE 5A69A 1ZBTA 3DF6A 4JI1E 5KL2A 4YY3E 3FIGA 2EPCA 2ADRA 3VHTB 2M9AA 5T6JA 4WFTA 3K6QA 2L2MA 1JK2A 2R76A 4Q28A 2WBTA 2DRPA 3C4BA 1G2FC 2V8QB 2DSYA 4DV5E 1X6EA 1LLMC 5BR8E 2UXBE 4WSPA 3ADJA 4X66E 3JU0A 3H09A 5LLQA
chains in the Genus database with same CATH topology
2GLIA 2R1FA 2JP9A 1KJKA 1BB8A 2A25A 2EOMA 2YTGA 2LCEA 5KL7A 3EPLA 2EM2A 2YU5A 2LV2A 5KL5A 2EMYA 2EPRA 2LVHA 2GHFA 1X5WA 2DLQA 2EL4A 2J7JA 1ZAAC 1WJPA 2EM7A 3EPJA 1B69A 1ZR9A 1F2IG 2EL5A 3M99B 2EMKA 1TF3A 2JPAA 2YTOA 1TF6A 1DGCA 2LO3A 2EN1A 2EM5A 2EOJA 2EOSA 1NCSA 1ZU1A 4WSGA 2YRHA 3MHHC 2EN2A 2NABA 1RMDA 2EP3A 1A1LA 5KL3A 2EMCA 2EOYA 5KL4A 2EQ0A 2EOQA 2DMIA 4R2SA 2WCC3 4F6MA 4M9VC 4R2QA 2YSOA 2E72A 2EOOA 4X9JA 2YTJA 2ENAA 2EOFA 2MKNA 2EE8A 2EMFA 2HGHA 2EQ3A 2EL6A 2CSHA 2EMLA 2D9HA 2EPPA 3UK3C 1TN9A 4F2JC 2EMAA 2EN3A 2YTPA 2WBUA 1UN6B 2YSPA 1G2DC 4F6NA 2EM3A 2ELZA 2YU8A 2EM0A 4R2AA 1X6HA 2YTQA 2ENCA 2PRTA 4R2CA 2EORA 2RSIA 2YTFA 2EM6A 1MEYC 2EMXA 2EM4A 1YUJA 1X3CA 2EN8A 1BBOA 1YUIA 2YTDA 2EMIA 2MDGA 4FK5C 2DGCA 2ENHA 2EQ1A 2EN7A 2EOHA 2YRMA 4IS1C 2I13A 2EPZA 1A1JA 1P47A 1A1IA 4GZNC 2EN4A 2DLKA 2EMGA 2EPUA 5KL6A 2VRDA 1A1GA 2BB8A 1JK1A 4R2PA 2EOEA 2EMHA 2CT1A 4R2DA 1A1KA 3EPHA 2EM8A 2EMZA 5KL2A 2EPAA 4R2RA 2LT7A 2EJ4A 2EOXA 2WBSA 2EN6A 2RPCA 1UBDC 2EPCA 2ADRA 3VHTB 2M9AA 1X6FA 2YTIA 1A1FA 4IJDA 1JK2A 2WBTA 2DRPA 2EM9A 2EPXA 1G2FC 2YRKA 1X6EA 2EOIA 3MHSC 3EPKA 1LLMC 2CTDA 2EOZA 1Z1BA 1A1HA 4R2EA 2ELYA 1AAYA 2YTEA 2EMBA 2EMWA 2YTNA 1YSAC 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLI A;  2R1F A;  2JP9 A;  1KJK A;  1BB8 A;  2A25 A;  2EOM A;  2YTG A;  2LCE A;  5KL7 A;  3EPL A;  2EM2 A;  2YU5 A;  2LV2 A;  5KL5 A;  2EMY A;  2EPR A;  2LVH A;  2GHF A;  1X5W A;  2DLQ A;  2EL4 A;  2J7J A;  1ZAA C;  1WJP A;  2EM7 A;  3EPJ A;  1B69 A;  1ZR9 A;  1F2I G;  2EL5 A;  3M99 B;  2EMK A;  1TF3 A;  2JPA A;  2YTO A;  1TF6 A;  1DGC A;  2LO3 A;  2EN1 A;  2EM5 A;  2EOJ A;  2EOS A;  1NCS A;  1ZU1 A;  4WSG A;  2YRH A;  3MHH C;  2EN2 A;  2NAB A;  1RMD A;  2EP3 A;  1A1L A;  5KL3 A;  2EMC A;  2EOY A;  5KL4 A;  2EQ0 A;  2EOQ A;  2DMI A;  4R2S A;  2WCC 3;  4F6M A;  4M9V C;  4R2Q A;  2YSO A;  2E72 A;  2EOO A;  4X9J A;  2YTJ A;  2ENA A;  2EOF A;  2MKN A;  2EE8 A;  2EMF A;  2HGH A;  2EQ3 A;  2EL6 A;  2CSH A;  2EML A;  2D9H A;  2EPP A;  3UK3 C;  1TN9 A;  4F2J C;  2EMA A;  2EN3 A;  2YTP A;  2WBU A;  1UN6 B;  2YSP A;  1G2D C;  4F6N A;  2EM3 A;  2ELZ A;  2YU8 A;  2EM0 A;  4R2A A;  1X6H A;  2YTQ A;  2ENC A;  2PRT A;  4R2C A;  2EOR A;  2RSI A;  2YTF A;  2EM6 A;  1MEY C;  2EMX A;  2EM4 A;  1YUJ A;  1X3C A;  2EN8 A;  1BBO A;  1YUI A;  2YTD A;  2EMI A;  2MDG A;  4FK5 C;  2DGC A;  2ENH A;  2EQ1 A;  2EN7 A;  2EOH A;  2YRM A;  4IS1 C;  2I13 A;  2EPZ A;  1A1J A;  1P47 A;  1A1I A;  4GZN C;  2EN4 A;  2DLK A;  2EMG A;  2EPU A;  5KL6 A;  2VRD A;  1A1G A;  2BB8 A;  1JK1 A;  4R2P A;  2EOE A;  2EMH A;  2CT1 A;  4R2D A;  1A1K A;  3EPH A;  2EM8 A;  2EMZ A;  5KL2 A;  2EPA A;  4R2R A;  2LT7 A;  2EJ4 A;  2EOX A;  2WBS A;  2EN6 A;  2RPC A;  1UBD C;  2EPC A;  2ADR A;  3VHT B;  2M9A A;  1X6F A;  2YTI A;  1A1F A;  4IJD A;  1JK2 A;  2WBT A;  2DRP A;  2EM9 A;  2EPX A;  1G2F C;  2YRK A;  1X6E A;  2EOI A;  3MHS C;  3EPK A;  1LLM C;  2CTD A;  2EOZ A;  1Z1B A;  1A1H A;  4R2E A;  2ELY A;  1AAY A;  2YTE A;  2EMB A;  2EMW A;  2YTN A;  1YSA C;  2MKD A; 
#chains in the Genus database with same CATH topology
 1EKZ A;  2YPN A;  4DV1 E;  1BB8 A;  2YTG A;  2LCE A;  2L8T A;  1PJQ A;  1N36 E;  2LRS A;  3KWR A;  2DLQ A;  1WJP A;  2WZO A;  1T39 A;  1B69 A;  3DJW A;  1F2I G;  4LU9 A;  2JR1 A;  3BID A;  1HR0 E;  2EM5 A;  2EOJ A;  1NCS A;  5AE1 A;  3MHH C;  4DV3 E;  2EN2 A;  1AH5 A;  2N3G A;  4DR7 E;  1A1L A;  3TQM A;  5KL3 A;  2UU9 E;  4JI3 E;  1PJS A;  3KZY A;  1IMU A;  5IXM B;  4M9V C;  2WCC 3;  4JI7 E;  4R2Q A;  2YSO A;  2ENA A;  4JI4 E;  2EE8 A;  1HNX E;  2HGH A;  2EL6 A;  2EML A;  2LTR A;  2D9H A;  2LMZ A;  2JWO A;  2V89 A;  4Q35 B;  2RS6 A;  4F6N A;  4JV5 E;  2EWL A;  4R2A A;  4GKK E;  4B3T E;  2V88 A;  3HXL A;  2MC6 A;  2EM4 A;  1YUJ A;  4BS9 A;  5ADZ A;  5AC5 A;  2HHH E;  1YUI A;  2JOX A;  2EMI A;  3HTX A;  2DGC A;  2EQ1 A;  2JXP A;  1FJG E;  4X65 E;  3J81 C;  2BBG A;  4GKJ E;  2EMG A;  5KL6 A;  4LFA E;  2BB8 A;  1UIL A;  4JI0 E;  2EZ6 A;  1PDA A;  4DUY E;  2CT1 A;  4N4R B;  3J7A G;  2L92 A;  1FKA E;  4X8W A;  2EMZ A;  2EJ4 A;  4X64 E;  3KZZ A;  4M2Z A;  1X6F A;  1I94 E;  4F9B B;  2YTI A;  1A1F A;  4P7D A;  1T4L B;  4B3R E;  4HTG A;  2F8B A;  1BBG A;  4DV7 E;  2NUF A;  4KHP E;  1QNT A;  3VYX A;  4ZYE A;  4O5G A;  1XNR E;  3BBG A;  4DR5 E;  1A1H A;  1N34 E;  1X47 A;  2YTE A;  2V86 A;  1KJK A;  4RH8 A;  4BMJ A;  5KL7 A;  2EM2 A;  5KL5 A;  2LV2 A;  2NUG A;  4DUZ E;  4YHH E;  2GHF A;  4TUG A;  1X5W A;  2EL4 A;  3VYY A;  3OTO E;  2EL5 A;  2EPM X;  3T1Y E;  2YTO A;  4NZV A;  2JVA A;  2EOS A;  1EH6 A;  1X49 A;  4DV2 E;  1WRJ A;  3AV0 A;  2UXD E;  1RMD A;  4BHC A;  2EMC A;  4B3M E;  2EOY A;  4F6M A;  2EOQ A;  2DMI A;  4KZS A;  4JI5 E;  2E72 A;  1YYO A;  2EOO A;  3HQ1 A;  4O43 A;  2L3C A;  2RS7 A;  4LFC E;  2EMF A;  1EH7 A;  4GEQ B;  4BCA A;  3ZOQ B;  3ADI A;  2HC5 A;  4AQY E;  2L2N A;  4BC9 A;  5AE2 A;  1HNW E;  1UN6 B;  2YSP A;  4NXM E;  2EM3 A;  2ELZ A;  4F9A B;  2EM0 A;  2B3T B;  5A6B D;  3C4T A;  1GZ6 A;  1DI2 A;  1PJT A;  2KHX A;  2CPN A;  4R2C A;  4BBY A;  3IWC A;  1MEY C;  2EM6 A;  2YZT A;  2DB2 A;  2YTD A;  4FK5 C;  5AE3 A;  4HEI A;  4ZYH A;  2EPZ A;  1A1J A;  1P47 A;  4DKK A;  5DNY A;  2DLK A;  4JI2 E;  1KYQ A;  2LUQ A;  4WXC A;  1WHN A;  2VQE E;  2LUP B;  2V85 A;  5LMN E;  1JK1 A;  4R2P A;  2JYA A;  2EOE A;  4BHB A;  2EMH A;  4R2D A;  1IBK E;  4LF7 E;  4WXD A;  1XMO E;  4R2R A;  2LT7 A;  4DR6 E;  2YT4 A;  2EOX A;  1YFH A;  2Q8U A;  2I9I A;  5CFF E;  3T1H E;  1IBM E;  2LJU A;  4JI8 E;  4DV6 E;  2EM9 A;  5LL6 R;  1IQO A;  2YRK A;  4O24 A;  4LF8 E;  2KOU A;  2B7V A;  2LE2 A;  5A6J A;  2UUA E;  3IWB A;  4DMI A;  1Z1B A;  2G7H A;  3EQ1 A;  1N32 E;  4ZYD A;  3BF2 A;  1DQ3 A;  2KON A;  4OX9 E;  1J5E E;  2EMW A;  2YTN A;  3J7Y p;  2VF1 A;  2GLI A;  1J26 A;  1YPN A;  3JAM C;  4M30 A;  2YU5 A;  2EMY A;  2EPR A;  2EPO A;  2N3H A;  2RSM A;  1T38 A;  1ZR9 A;  3M99 B;  1TF3 A;  2UXC E;  3QG5 C;  3P1X A;  3THN A;  2LO3 A;  4WX9 A;  1ZU1 A;  4WSG A;  2YRH A;  2LTS A;  2NAB A;  5LMU E;  2EP3 A;  4NHR A;  2FV4 B;  2LBS B;  5KL4 A;  2EQ0 A;  4R2S A;  5F3W A;  5IWA E;  1N3G A;  2EOF A;  2MKN A;  2EQ3 A;  2CSH A;  4ZYG A;  3UK3 C;  2VQF E;  2K7I A;  4LF6 E;  4I8O A;  2EN3 A;  2WBU A;  4L8N A;  5A6A A;  2FTX B;  2NA2 A;  2VE7 C;  5TSE A;  2ENC A;  2F4V E;  5A6B A;  2EOR A;  2B7T A;  1GTK A;  1YZ9 A;  4MLQ A;  1X3C A;  4LTY A;  2RQL A;  3MSW A;  2JOB A;  3L00 A;  4NXN E;  5A6K A;  2ENH A;  2EN7 A;  2YRM A;  2RTX A;  2ODR D;  2LJH A;  1A1I A;  4O4K A;  4GZN C;  2EN4 A;  4F9C B;  3F6H A;  2VRD A;  2FGG A;  2GPI A;  2B9D A;  3AUZ A;  2M4I A;  3HPZ A;  1YYK A;  4DR2 E;  1A1K A;  3EPH A;  2K4V A;  2EM8 A;  2EPN A;  2EPA A;  2H36 X;  2WBS A;  1EH8 A;  2EN6 A;  2RPC A;  4R03 A;  1UBD C;  2MDR A;  4DR3 E;  2ODR C;  5IV8 B;  3IWD A;  1IQS A;  1STU A;  1XMQ E;  1MGT A;  4IJD A;  2EPX A;  1T4O A;  4JI6 E;  2EOI A;  3MHS C;  3EPK A;  1NEI A;  2ZM6 E;  4MLV A;  2CTD A;  4J8Z A;  2EOZ A;  4R2E A;  4DR1 E;  2ELY A;  2M7Q A;  2L6M A;  1AAY A;  1O0W A;  2EMB A;  3THO B;  1YSA C;  2MKD A;  4RHB B;  2JP9 A;  2R1F A;  5FLX C;  3BGH A;  4OOG C;  4F54 A;  2A25 A;  3J80 C;  2UUB E;  2EOM A;  2V87 A;  3F6G A;  3EPL A;  2JY9 A;  1YYW A;  2LVH A;  1WHQ A;  2L33 A;  3LLH A;  1L4S A;  2V83 A;  2J7J A;  1ZAA C;  4LFB E;  1SFE A;  2EM7 A;  3EPJ A;  3ADG A;  1SR9 A;  1QU6 A;  2EMK A;  4B3S E;  5AAS A;  2JPA A;  4K0K E;  4L5N C;  4LF9 E;  2E1M A;  4JYA E;  4TUI A;  2MC5 A;  1DGC A;  1TF6 A;  2E5L E;  2EN1 A;  4LF4 E;  4P78 A;  1ZBQ A;  2IHR 1;  4DR4 E;  3OML A;  3VK6 A;  1WXR A;  1X48 A;  2EPK X;  4X9J A;  1N33 E;  2YTJ A;  2L2K B;  3C6K A;  2M1S A;  1RQ0 A;  1UHZ A;  2NUE A;  2EPP A;  1PKP A;  1TN9 A;  4WPY A;  4F2J C;  2EMA A;  3ADL A;  2YTP A;  1G2D C;  4R8O A;  1IBL E;  2HJJ A;  1T4N A;  2YU8 A;  3LML A;  1RC7 A;  1X6H A;  2YTQ A;  2PRT A;  4LF5 E;  3C6M A;  4BC7 A;  2UUC E;  2RSI A;  2YTF A;  2N8X A;  5AC4 A;  2EMX A;  3HPS A;  2EN8 A;  1GQE A;  1BBO A;  2YWQ A;  2L3J A;  4DV4 E;  2DMY A;  2MDG A;  3RMP A;  4X62 E;  2DIX A;  4KWY A;  4M0V A;  4WYQ B;  4DV0 E;  2EOH A;  4IS1 C;  2I13 A;  2EPL X;  3ECR A;  2EPU A;  5A2Q C;  1A1G A;  1XNQ E;  3JTZ A;  5IT9 C;  1HNZ E;  5A69 A;  1ZBT A;  3DF6 A;  4JI1 E;  5KL2 A;  4YY3 E;  3FIG A;  2EPC A;  2ADR A;  3VHT B;  2M9A A;  5T6J A;  4WFT A;  3K6Q A;  2L2M A;  1JK2 A;  2R76 A;  4Q28 A;  2WBT A;  2DRP A;  3C4B A;  1G2F C;  2V8Q B;  2DSY A;  4DV5 E;  1X6E A;  1LLM C;  5BR8 E;  2UXB E;  4WSP A;  3ADJ A;  4X66 E;  3JU0 A;  3H09 A;  5LLQ A; 
#chains in the Genus database with same CATH homology
 2GLI A;  2R1F A;  2JP9 A;  1KJK A;  1BB8 A;  2A25 A;  2EOM A;  2YTG A;  2LCE A;  5KL7 A;  3EPL A;  2EM2 A;  2YU5 A;  2LV2 A;  5KL5 A;  2EMY A;  2EPR A;  2LVH A;  2GHF A;  1X5W A;  2DLQ A;  2EL4 A;  2J7J A;  1ZAA C;  1WJP A;  2EM7 A;  3EPJ A;  1B69 A;  1ZR9 A;  1F2I G;  2EL5 A;  3M99 B;  2EMK A;  1TF3 A;  2JPA A;  2YTO A;  1TF6 A;  1DGC A;  2LO3 A;  2EN1 A;  2EM5 A;  2EOJ A;  2EOS A;  1NCS A;  1ZU1 A;  4WSG A;  2YRH A;  3MHH C;  2EN2 A;  2NAB A;  1RMD A;  2EP3 A;  1A1L A;  5KL3 A;  2EMC A;  2EOY A;  5KL4 A;  2EQ0 A;  2EOQ A;  2DMI A;  4R2S A;  2WCC 3;  4F6M A;  4M9V C;  4R2Q A;  2YSO A;  2E72 A;  2EOO A;  4X9J A;  2YTJ A;  2ENA A;  2EOF A;  2MKN A;  2EE8 A;  2EMF A;  2HGH A;  2EQ3 A;  2EL6 A;  2CSH A;  2EML A;  2D9H A;  2EPP A;  3UK3 C;  1TN9 A;  4F2J C;  2EMA A;  2EN3 A;  2YTP A;  2WBU A;  1UN6 B;  2YSP A;  1G2D C;  4F6N A;  2EM3 A;  2ELZ A;  2YU8 A;  2EM0 A;  4R2A A;  1X6H A;  2YTQ A;  2ENC A;  2PRT A;  4R2C A;  2EOR A;  2RSI A;  2YTF A;  2EM6 A;  1MEY C;  2EMX A;  2EM4 A;  1YUJ A;  1X3C A;  2EN8 A;  1BBO A;  1YUI A;  2YTD A;  2EMI A;  2MDG A;  4FK5 C;  2DGC A;  2ENH A;  2EQ1 A;  2EN7 A;  2EOH A;  2YRM A;  4IS1 C;  2I13 A;  2EPZ A;  1A1J A;  1P47 A;  1A1I A;  4GZN C;  2EN4 A;  2DLK A;  2EMG A;  2EPU A;  5KL6 A;  2VRD A;  1A1G A;  2BB8 A;  1JK1 A;  4R2P A;  2EOE A;  2EMH A;  2CT1 A;  4R2D A;  1A1K A;  3EPH A;  2EM8 A;  2EMZ A;  5KL2 A;  2EPA A;  4R2R A;  2LT7 A;  2EJ4 A;  2EOX A;  2WBS A;  2EN6 A;  2RPC A;  1UBD C;  2EPC A;  2ADR A;  3VHT B;  2M9A A;  1X6F A;  2YTI A;  1A1F A;  4IJD A;  1JK2 A;  2WBT A;  2DRP A;  2EM9 A;  2EPX A;  1G2F C;  2YRK A;  1X6E A;  2EOI A;  3MHS C;  3EPK A;  1LLM C;  2CTD A;  2EOZ A;  1Z1B A;  1A1H A;  4R2E A;  2ELY A;  1AAY A;  2YTE A;  2EMB A;  2EMW A;  2YTN A;  1YSA C;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...