2EM7A

Solution structure of the c2h2 type zinc finger (region 339-371) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEECGKGFICRRDLYTHHMVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 339-371) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em7A01
1UN6B 2A25A 2ENHA 4F2JC 2EMGA 2YSOA 4R2CA 3EPKA 1KJKA 2YTDA 2LCEA 2EMZA 2EMHA 2EOQA 1A1GA 4R2SA 2J7JA 2EPXA 1UBDC 4IJDA 2MKDA 1A1IA 2YRKA 3EPHA 1BB8A 2GHFA 2YTPA 2ENAA 2BB8A 2EM0A 2YTJA 2EN8A 2YTOA 5KL6A 1A1JA 4GZNC 5KL2A 2EOMA 2EQ1A 1X3CA 2EL4A 2EMXA 2EMYA 2EOSA 3EPLA 3MHHC 2EOIA 3EPJA 1X6HA 2JPAA 2EPAA 2YTIA 4WSGA 2EMIA 4M9VC 2YTEA 4FK5C 2EOOA 2EN3A 4R2AA 1B69A 3MHSC 2EOEA 2YU8A 2EM8A 4R2QA 2EMWA 2EN7A 2MKNA 1X5WA 2EOHA 2EOYA 1NCSA 2EM2A 2WBSA 2EN6A 4X9JA 2YRHA 2YTNA 1F2IG 2DMIA 1JK2A 1A1KA 2YTFA 4IS1C 2M9AA 1BBOA 2EL5A 2EMKA 2WBTA 2YU5A 2JP9A 1JK1A 3UK3C 1WJPA 2EN2A 2EMBA 2YTGA 2HGHA 2EMFA 3M99B 2EE8A 2RSIA 2CSHA 2PRTA 2GLIA 2ELZA 4R2EA 2EQ3A 1YSAC 2EOXA 1A1FA 2D9HA 1RMDA 2EM5A 2ELYA 2CT1A 3VHTB 2EN4A 2YTQA 2E72A 2EOFA 2EPZA 1G2FC 1TF3A 1DGCA 5KL7A 2LV2A 1LLMC 2YSPA 1A1LA 1YUIA 2MDGA 2EPCA 4F6NA 2EM6A 2EPPA 1ZU1A 2ENCA 2EM7A 2EMLA 1A1HA 2VRDA 4F6MA 2DLQA 1YUJA 4R2RA 2CTDA 2LT7A 5KL4A 2WBUA 1Z1BA 2EM3A 2DRPA 2EP3A 2LVHA 5KL5A 2NABA 1ZAAC 1X6FA 2ADRA 2EOZA 5KL3A 2DGCA 2EM9A 1X6EA 2EPRA 2YRMA 1MEYC 2EJ4A 1AAYA 1P47A 2DLKA 2EL6A 2EN1A 1ZR9A 4R2DA 1TN9A 2WCC3 2EMAA 1TF6A 2R1FA 2I13A 2EOJA 2EM4A 1G2DC 2LO3A 2EQ0A 2RPCA 2EPUA 2EMCA 2EORA 4R2PA
chains in the Genus database with same CATH superfamily
1UN6B 2A25A 4GEQB 4GKJE 2LBSB 1SFEA 2YSOA 3EPKA 1EH8A 5A2QC 4YHHE 1HNXE 4DUYE 1QU6A 1A1IA 2YRKA 4JI0E 4X8WA 1YFHA 2ENAA 2BB8A 2YTJA 2N3HA 4GZNC 4KHPE 2EPLX 2YWQA 1ZBQA 2EL4A 4JI3E 1N34E 4J8ZA 4MLVA 2LRSA 2YTIA 4R2AA 2EN3A 4X64E 2DIXA 3ECRA 4LF8E 2EOYA 2EN6A 2L92A 2YTNA 1RQ0A 1J26A 2B9DA 2E5LE 4K0KE 3JU0A 4IS1C 5A6JA 2EL5A 5CFFE 1JK1A 2EN2A 2HGHA 3P1XA 2LTSA 3C4TA 4KZSA 3KZZA 4NZVA 4LF6E 2EOXA 2DMYA 3F6HA 4P78A 2LJUA 2JXPA 4LF5E 4LF7E 3ADLA 4LF9E 2D9HA 4JI1E 1RMDA 2EM5A 2ELYA 2L6MA 4HTGA 4WPYA 1G2FC 2E72A 3HTXA 4NHRA 2BBGA 3C6KA 1LLMC 5AE2A 4GKKE 5TSEA 1A1HA 1DQ3A 2I9IA 2JYAA 1STUA 2DLQA 1YUJA 4R2RA 2MDRA 1T4OA 2UXDE 2LT7A 5KL4A 2B7TA 2LVHA 5KL5A 4R03A 5A69A 1X6FA 2FTXB 2JOXA 3LLHA 4WSPA 3J81C 4WXCA 3ADIA 4RHBB 2YRMA 2NUGA 2EL6A 2EN1A 1EH6A 3BIDA 5T6JA 2M4IA 2L33A 3KWRA 2B3TB 1XMOE 5AE1A 1UILA 3IWBA 4WFTA 2LO3A 2RPCA 2FGGA 4BBYA 2LUPB 2EMXA 4WXDA 4BHCA 4DV3E 3F6GA 5A6BA 4F2JC 1KJKA 2EOQA 4I8OA 1A1GA 1T4NA 3OMLA 4BS9A 4IJDA 4LFCE 1IBKE 1GTKA 2N8XA 2EM0A 4LFBE 5KL2A 2L8TA 1PJTA 5BR8E 1YPNA 3VYXA 5AC5A 2EOSA 2EOIA 3EPJA 2EPAA 4M9VC 1B69A 4B3RE 3MHSC 1T4LB 2EN7A 4OX9E 1KYQA 2EM2A 2WBSA 1F2IG 3BGHA 2DMIA 1T39A 1A1KA 4X66E 1PJSA 1BBOA 2JP9A 2EMKA 2R76A 3UK3C 1WJPA 4JI4E 2YTGA 2EMBA 4TUIA 2L3CA 2EMFA 2EE8A 2ELZA 2MC6A 2K7IA 4R2EA 2VF1A 2LE2A 3OTOE 2UUCE 4DKKA 1YSAC 4BCAA 1XNRE 1DI2A 4ZYHA 4TUGA 1IQOA 2V83A 2F4VE 4DR6E 4Q35B 3EQ1A 3VHTB 5IV8B 2CT1A 2VE7C 5LMUE 1XMQE 2EOFA 2EPZA 2RTXA 1N32E 2VQEE 5KL7A 2RS7A 2MDGA 3DJWA 2EPCA 2V88A 3ADJA 2HC5A 1GQEA 1NEIA 4OOGC 2EM7A 2M7QA 2VRDA 4F6MA 3BF2A 4MLQA 4LF4E 2WZOA 3L00A 2LUQA 2F8BA 2JR1A 3MSWA 2ADRA 2DSYA 1AH5A 5KL3A 1YYWA 1RC7A 2EM9A 3J7Yp 1X47A 4DR7E 5LL6R 2EJ4A 1AAYA 2JWOA 3VYYA 1WHNA 3THOB 2KHXA 4O24A 4NXME 5AE3A 4DR1E 3ADGA 3BBGA 4Q28A 2WCC3 1UHZA 2EMAA 2RS6A 3J80C 5IWAE 1TF6A 5IXMB 2EOJA 2EM4A 4JI8E 3TQMA 2ODRC 1G2DC 2L2KB 3AUZA 4JYAE 2EQ0A 4M30A 2EORA 1YZ9A 4ZYDA 4B3TE 3HPSA 3C4BA 2LCEA 2N3GA 2EMHA 3HQ1A 4M0VA 5A6AA 4R2SA 2J7JA 2EPXA 1UBDC 1WRJA 3EPHA 4DUZE 4DR2E 2L2NA 2JVAA 2YZTA 4L8NA 1A1JA 5KL6A 2EN8A 4O5GA 1YYKA 3JAMC 2EOMA 4N4RB 2M1SA 1MGTA 4HEIA 2H36X 3JTZA 2EMYA 3MHHC 4DR3E 2JPAA 1X6HA 2EMIA 4FK5C 2KOUA 2EOEA 2YU8A 4R2QA 4JI2E 1ZBTA 1X5WA 2EPKX 1NCSA 4X9JA 2YRHA 2EPNA 1PJQA 2EPMX 4BMJA 2NUEA 1JK2A 4P7DA 2YTFA 1N36E 2V89A 5ADZA 2WBTA 1HNWE 1I94E 3T1HE 2RSIA 1J5EE 5IT9C 4M2ZA 2GLIA 1HR0E 2JOBA 1PKPA 2EQ3A 2UU9E 2YPNA 1SR9A 2LJHA 1T38A 2UXCE 1IMUA 4ZYGA 3C6MA 3DF6A 1TF3A 2NUFA 1HNZE 2LV2A 2EWLA 3KZYA 1YUIA 5A6BD 4F6NA 1ZU1A 2EMLA 4YY3E 1XNQE 2V8QB 3LMLA 2LMZA 2CTDA 4NXNE 4DR4E 1Z1BA 2DRPA 4F9CB 1N3GA 5A6KA 1X49A 2NABA 1ZAAC 3HPZA 4DV6E 2CPNA 2EOZA 2RQLA 2ZM6E 2VQFE 1X6EA 2EPRA 1MEYC 1EKZA 1P47A 4R2DA 2L3JA 2V85A 2UUBE 1PDAA 4LFAE 4JI5E 1O0WA 3IWDA 2E1MA 2FV4B 5LMNE 4KWYA 4F54A 4R8OA 2UXBE 2EMCA 4R2PA 2ENHA 2JY9A 2EMGA 1QNTA 2LTRA 4R2CA 3J7AG 2YTDA 4RH8A 4F9BB 2EMZA 4X65E 5AC4A 2MKDA 2GPIA 3FIGA 5F3WA 1BB8A 2GHFA 3THNA 2YTPA 2G7HA 2YTOA 3IWCA 2EQ1A 1GZ6A 2UUAE 1X3CA 3T1YE 4DMIA 1IBME 1WXRA 3EPLA 4WSGA 2YTEA 3QG5C 2EOOA 4ZYEA 1X48A 2MKNA 2EM8A 2EMWA 2NA2A 2ODRD 1EH7A 2EOHA 4BC7A 2V87A 4B3ME 4X62E 4LU9A 1L4SA 2M9AA 1BBGA 4B3SE 4F9AB 2YU5A 2V86A 4DV1E 3K6QA 3M99B 2CSHA 4LTYA 2PRTA 4DV5E 4L5NC 1A1FA 4DR5E 2EN4A 2YTQA 2B7VA 2IHR1 2Q8UA 4O43A 4BC9A 2EZ6A 1DGCA 2MC5A 4DV0E 1A1LA 2YSPA 4WX9A 2EM6A 4AQYE 1WHQA 2L2MA 2EPPA 2ENCA 2HHHE 2K4VA 3AV0A 3VK6A 4DV7E 1FJGE 5FLXC 3HXLA 3ZOQB 3RMPA 5LLQA 2WBUA 2EM3A 4DV2E 2EP3A 4JV5E 5DNYA 3H09A 1N33E 4JI7E 2DGCA 5AASA 2DB2A 4O4KA 4WYQB 2RSMA 2DLKA 2EPOA 4BHBA 1ZR9A 1TN9A 2YT4A 1IBLE 1IQSA 1YYOA 2HJJA 2R1FA 2I13A 4DV4E 2KONA 1FKAE 4JI6E 2EPUA
chains in the Genus database with same CATH topology
1UN6B 2A25A 2ENHA 4F2JC 2EMGA 2YSOA 4R2CA 3EPKA 1KJKA 2YTDA 2LCEA 2EMZA 2EMHA 2EOQA 1A1GA 4R2SA 2J7JA 2EPXA 1UBDC 4IJDA 2MKDA 1A1IA 2YRKA 3EPHA 1BB8A 2GHFA 2YTPA 2ENAA 2BB8A 2EM0A 2YTJA 2EN8A 2YTOA 5KL6A 1A1JA 4GZNC 5KL2A 2EOMA 2EQ1A 1X3CA 2EL4A 2EMXA 2EMYA 2EOSA 3EPLA 3MHHC 2EOIA 3EPJA 1X6HA 2JPAA 2EPAA 2YTIA 4WSGA 2EMIA 4M9VC 2YTEA 4FK5C 2EOOA 2EN3A 4R2AA 1B69A 3MHSC 2EOEA 2YU8A 2EM8A 4R2QA 2EMWA 2EN7A 2MKNA 1X5WA 2EOHA 2EOYA 1NCSA 2EM2A 2WBSA 2EN6A 4X9JA 2YRHA 2YTNA 1F2IG 2DMIA 1JK2A 1A1KA 2YTFA 4IS1C 2M9AA 1BBOA 2EL5A 2EMKA 2WBTA 2YU5A 2JP9A 1JK1A 3UK3C 1WJPA 2EN2A 2EMBA 2YTGA 2HGHA 2EMFA 3M99B 2EE8A 2RSIA 2CSHA 2PRTA 2GLIA 2ELZA 4R2EA 2EQ3A 1YSAC 2EOXA 1A1FA 2D9HA 1RMDA 2EM5A 2ELYA 2CT1A 3VHTB 2EN4A 2YTQA 2E72A 2EOFA 2EPZA 1G2FC 1TF3A 1DGCA 5KL7A 2LV2A 1LLMC 2YSPA 1A1LA 1YUIA 2MDGA 2EPCA 4F6NA 2EM6A 2EPPA 1ZU1A 2ENCA 2EM7A 2EMLA 1A1HA 2VRDA 4F6MA 2DLQA 1YUJA 4R2RA 2CTDA 2LT7A 5KL4A 2WBUA 1Z1BA 2EM3A 2DRPA 2EP3A 2LVHA 5KL5A 2NABA 1ZAAC 1X6FA 2ADRA 2EOZA 5KL3A 2DGCA 2EM9A 1X6EA 2EPRA 2YRMA 1MEYC 2EJ4A 1AAYA 1P47A 2DLKA 2EL6A 2EN1A 1ZR9A 4R2DA 1TN9A 2WCC3 2EMAA 1TF6A 2R1FA 2I13A 2EOJA 2EM4A 1G2DC 2LO3A 2EQ0A 2RPCA 2EPUA 2EMCA 2EORA 4R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN6 B;  2A25 A;  2ENH A;  4F2J C;  2EMG A;  2YSO A;  4R2C A;  3EPK A;  1KJK A;  2YTD A;  2LCE A;  2EMZ A;  2EMH A;  2EOQ A;  1A1G A;  4R2S A;  2J7J A;  2EPX A;  1UBD C;  4IJD A;  2MKD A;  1A1I A;  2YRK A;  3EPH A;  1BB8 A;  2GHF A;  2YTP A;  2ENA A;  2BB8 A;  2EM0 A;  2YTJ A;  2EN8 A;  2YTO A;  5KL6 A;  1A1J A;  4GZN C;  5KL2 A;  2EOM A;  2EQ1 A;  1X3C A;  2EL4 A;  2EMX A;  2EMY A;  2EOS A;  3EPL A;  3MHH C;  2EOI A;  3EPJ A;  1X6H A;  2JPA A;  2EPA A;  2YTI A;  4WSG A;  2EMI A;  4M9V C;  2YTE A;  4FK5 C;  2EOO A;  2EN3 A;  4R2A A;  1B69 A;  3MHS C;  2EOE A;  2YU8 A;  2EM8 A;  4R2Q A;  2EMW A;  2EN7 A;  2MKN A;  1X5W A;  2EOH A;  2EOY A;  1NCS A;  2EM2 A;  2WBS A;  2EN6 A;  4X9J A;  2YRH A;  2YTN A;  1F2I G;  2DMI A;  1JK2 A;  1A1K A;  2YTF A;  4IS1 C;  2M9A A;  1BBO A;  2EL5 A;  2EMK A;  2WBT A;  2YU5 A;  2JP9 A;  1JK1 A;  3UK3 C;  1WJP A;  2EN2 A;  2EMB A;  2YTG A;  2HGH A;  2EMF A;  3M99 B;  2EE8 A;  2RSI A;  2CSH A;  2PRT A;  2GLI A;  2ELZ A;  4R2E A;  2EQ3 A;  1YSA C;  2EOX A;  1A1F A;  2D9H A;  1RMD A;  2EM5 A;  2ELY A;  2CT1 A;  3VHT B;  2EN4 A;  2YTQ A;  2E72 A;  2EOF A;  2EPZ A;  1G2F C;  1TF3 A;  1DGC A;  5KL7 A;  2LV2 A;  1LLM C;  2YSP A;  1A1L A;  1YUI A;  2MDG A;  2EPC A;  4F6N A;  2EM6 A;  2EPP A;  1ZU1 A;  2ENC A;  2EM7 A;  2EML A;  1A1H A;  2VRD A;  4F6M A;  2DLQ A;  1YUJ A;  4R2R A;  2CTD A;  2LT7 A;  5KL4 A;  2WBU A;  1Z1B A;  2EM3 A;  2DRP A;  2EP3 A;  2LVH A;  5KL5 A;  2NAB A;  1ZAA C;  1X6F A;  2ADR A;  2EOZ A;  5KL3 A;  2DGC A;  2EM9 A;  1X6E A;  2EPR A;  2YRM A;  1MEY C;  2EJ4 A;  1AAY A;  1P47 A;  2DLK A;  2EL6 A;  2EN1 A;  1ZR9 A;  4R2D A;  1TN9 A;  2WCC 3;  2EMA A;  1TF6 A;  2R1F A;  2I13 A;  2EOJ A;  2EM4 A;  1G2D C;  2LO3 A;  2EQ0 A;  2RPC A;  2EPU A;  2EMC A;  2EOR A;  4R2P A; 
#chains in the Genus database with same CATH topology
 1UN6 B;  2A25 A;  4GEQ B;  4GKJ E;  2LBS B;  1SFE A;  2YSO A;  3EPK A;  1EH8 A;  5A2Q C;  4YHH E;  1HNX E;  4DUY E;  1QU6 A;  1A1I A;  2YRK A;  4JI0 E;  4X8W A;  1YFH A;  2ENA A;  2BB8 A;  2YTJ A;  2N3H A;  4GZN C;  4KHP E;  2EPL X;  2YWQ A;  1ZBQ A;  2EL4 A;  4JI3 E;  1N34 E;  4J8Z A;  4MLV A;  2LRS A;  2YTI A;  4R2A A;  2EN3 A;  4X64 E;  2DIX A;  3ECR A;  4LF8 E;  2EOY A;  2EN6 A;  2L92 A;  2YTN A;  1RQ0 A;  1J26 A;  2B9D A;  2E5L E;  4K0K E;  3JU0 A;  4IS1 C;  5A6J A;  2EL5 A;  5CFF E;  1JK1 A;  2EN2 A;  2HGH A;  3P1X A;  2LTS A;  3C4T A;  4KZS A;  3KZZ A;  4NZV A;  4LF6 E;  2EOX A;  2DMY A;  3F6H A;  4P78 A;  2LJU A;  2JXP A;  4LF5 E;  4LF7 E;  3ADL A;  4LF9 E;  2D9H A;  4JI1 E;  1RMD A;  2EM5 A;  2ELY A;  2L6M A;  4HTG A;  4WPY A;  1G2F C;  2E72 A;  3HTX A;  4NHR A;  2BBG A;  3C6K A;  1LLM C;  5AE2 A;  4GKK E;  5TSE A;  1A1H A;  1DQ3 A;  2I9I A;  2JYA A;  1STU A;  2DLQ A;  1YUJ A;  4R2R A;  2MDR A;  1T4O A;  2UXD E;  2LT7 A;  5KL4 A;  2B7T A;  2LVH A;  5KL5 A;  4R03 A;  5A69 A;  1X6F A;  2FTX B;  2JOX A;  3LLH A;  4WSP A;  3J81 C;  4WXC A;  3ADI A;  4RHB B;  2YRM A;  2NUG A;  2EL6 A;  2EN1 A;  1EH6 A;  3BID A;  5T6J A;  2M4I A;  2L33 A;  3KWR A;  2B3T B;  1XMO E;  5AE1 A;  1UIL A;  3IWB A;  4WFT A;  2LO3 A;  2RPC A;  2FGG A;  4BBY A;  2LUP B;  2EMX A;  4WXD A;  4BHC A;  4DV3 E;  3F6G A;  5A6B A;  4F2J C;  1KJK A;  2EOQ A;  4I8O A;  1A1G A;  1T4N A;  3OML A;  4BS9 A;  4IJD A;  4LFC E;  1IBK E;  1GTK A;  2N8X A;  2EM0 A;  4LFB E;  5KL2 A;  2L8T A;  1PJT A;  5BR8 E;  1YPN A;  3VYX A;  5AC5 A;  2EOS A;  2EOI A;  3EPJ A;  2EPA A;  4M9V C;  1B69 A;  4B3R E;  3MHS C;  1T4L B;  2EN7 A;  4OX9 E;  1KYQ A;  2EM2 A;  2WBS A;  1F2I G;  3BGH A;  2DMI A;  1T39 A;  1A1K A;  4X66 E;  1PJS A;  1BBO A;  2JP9 A;  2EMK A;  2R76 A;  3UK3 C;  1WJP A;  4JI4 E;  2YTG A;  2EMB A;  4TUI A;  2L3C A;  2EMF A;  2EE8 A;  2ELZ A;  2MC6 A;  2K7I A;  4R2E A;  2VF1 A;  2LE2 A;  3OTO E;  2UUC E;  4DKK A;  1YSA C;  4BCA A;  1XNR E;  1DI2 A;  4ZYH A;  4TUG A;  1IQO A;  2V83 A;  2F4V E;  4DR6 E;  4Q35 B;  3EQ1 A;  3VHT B;  5IV8 B;  2CT1 A;  2VE7 C;  5LMU E;  1XMQ E;  2EOF A;  2EPZ A;  2RTX A;  1N32 E;  2VQE E;  5KL7 A;  2RS7 A;  2MDG A;  3DJW A;  2EPC A;  2V88 A;  3ADJ A;  2HC5 A;  1GQE A;  1NEI A;  4OOG C;  2EM7 A;  2M7Q A;  2VRD A;  4F6M A;  3BF2 A;  4MLQ A;  4LF4 E;  2WZO A;  3L00 A;  2LUQ A;  2F8B A;  2JR1 A;  3MSW A;  2ADR A;  2DSY A;  1AH5 A;  5KL3 A;  1YYW A;  1RC7 A;  2EM9 A;  3J7Y p;  1X47 A;  4DR7 E;  5LL6 R;  2EJ4 A;  1AAY A;  2JWO A;  3VYY A;  1WHN A;  3THO B;  2KHX A;  4O24 A;  4NXM E;  5AE3 A;  4DR1 E;  3ADG A;  3BBG A;  4Q28 A;  2WCC 3;  1UHZ A;  2EMA A;  2RS6 A;  3J80 C;  5IWA E;  1TF6 A;  5IXM B;  2EOJ A;  2EM4 A;  4JI8 E;  3TQM A;  2ODR C;  1G2D C;  2L2K B;  3AUZ A;  4JYA E;  2EQ0 A;  4M30 A;  2EOR A;  1YZ9 A;  4ZYD A;  4B3T E;  3HPS A;  3C4B A;  2LCE A;  2N3G A;  2EMH A;  3HQ1 A;  4M0V A;  5A6A A;  4R2S A;  2J7J A;  2EPX A;  1UBD C;  1WRJ A;  3EPH A;  4DUZ E;  4DR2 E;  2L2N A;  2JVA A;  2YZT A;  4L8N A;  1A1J A;  5KL6 A;  2EN8 A;  4O5G A;  1YYK A;  3JAM C;  2EOM A;  4N4R B;  2M1S A;  1MGT A;  4HEI A;  2H36 X;  3JTZ A;  2EMY A;  3MHH C;  4DR3 E;  2JPA A;  1X6H A;  2EMI A;  4FK5 C;  2KOU A;  2EOE A;  2YU8 A;  4R2Q A;  4JI2 E;  1ZBT A;  1X5W A;  2EPK X;  1NCS A;  4X9J A;  2YRH A;  2EPN A;  1PJQ A;  2EPM X;  4BMJ A;  2NUE A;  1JK2 A;  4P7D A;  2YTF A;  1N36 E;  2V89 A;  5ADZ A;  2WBT A;  1HNW E;  1I94 E;  3T1H E;  2RSI A;  1J5E E;  5IT9 C;  4M2Z A;  2GLI A;  1HR0 E;  2JOB A;  1PKP A;  2EQ3 A;  2UU9 E;  2YPN A;  1SR9 A;  2LJH A;  1T38 A;  2UXC E;  1IMU A;  4ZYG A;  3C6M A;  3DF6 A;  1TF3 A;  2NUF A;  1HNZ E;  2LV2 A;  2EWL A;  3KZY A;  1YUI A;  5A6B D;  4F6N A;  1ZU1 A;  2EML A;  4YY3 E;  1XNQ E;  2V8Q B;  3LML A;  2LMZ A;  2CTD A;  4NXN E;  4DR4 E;  1Z1B A;  2DRP A;  4F9C B;  1N3G A;  5A6K A;  1X49 A;  2NAB A;  1ZAA C;  3HPZ A;  4DV6 E;  2CPN A;  2EOZ A;  2RQL A;  2ZM6 E;  2VQF E;  1X6E A;  2EPR A;  1MEY C;  1EKZ A;  1P47 A;  4R2D A;  2L3J A;  2V85 A;  2UUB E;  1PDA A;  4LFA E;  4JI5 E;  1O0W A;  3IWD A;  2E1M A;  2FV4 B;  5LMN E;  4KWY A;  4F54 A;  4R8O A;  2UXB E;  2EMC A;  4R2P A;  2ENH A;  2JY9 A;  2EMG A;  1QNT A;  2LTR A;  4R2C A;  3J7A G;  2YTD A;  4RH8 A;  4F9B B;  2EMZ A;  4X65 E;  5AC4 A;  2MKD A;  2GPI A;  3FIG A;  5F3W A;  1BB8 A;  2GHF A;  3THN A;  2YTP A;  2G7H A;  2YTO A;  3IWC A;  2EQ1 A;  1GZ6 A;  2UUA E;  1X3C A;  3T1Y E;  4DMI A;  1IBM E;  1WXR A;  3EPL A;  4WSG A;  2YTE A;  3QG5 C;  2EOO A;  4ZYE A;  1X48 A;  2MKN A;  2EM8 A;  2EMW A;  2NA2 A;  2ODR D;  1EH7 A;  2EOH A;  4BC7 A;  2V87 A;  4B3M E;  4X62 E;  4LU9 A;  1L4S A;  2M9A A;  1BBG A;  4B3S E;  4F9A B;  2YU5 A;  2V86 A;  4DV1 E;  3K6Q A;  3M99 B;  2CSH A;  4LTY A;  2PRT A;  4DV5 E;  4L5N C;  1A1F A;  4DR5 E;  2EN4 A;  2YTQ A;  2B7V A;  2IHR 1;  2Q8U A;  4O43 A;  4BC9 A;  2EZ6 A;  1DGC A;  2MC5 A;  4DV0 E;  1A1L A;  2YSP A;  4WX9 A;  2EM6 A;  4AQY E;  1WHQ A;  2L2M A;  2EPP A;  2ENC A;  2HHH E;  2K4V A;  3AV0 A;  3VK6 A;  4DV7 E;  1FJG E;  5FLX C;  3HXL A;  3ZOQ B;  3RMP A;  5LLQ A;  2WBU A;  2EM3 A;  4DV2 E;  2EP3 A;  4JV5 E;  5DNY A;  3H09 A;  1N33 E;  4JI7 E;  2DGC A;  5AAS A;  2DB2 A;  4O4K A;  4WYQ B;  2RSM A;  2DLK A;  2EPO A;  4BHB A;  1ZR9 A;  1TN9 A;  2YT4 A;  1IBL E;  1IQS A;  1YYO A;  2HJJ A;  2R1F A;  2I13 A;  4DV4 E;  2KON A;  1FKA E;  4JI6 E;  2EPU A; 
#chains in the Genus database with same CATH homology
 1UN6 B;  2A25 A;  2ENH A;  4F2J C;  2EMG A;  2YSO A;  4R2C A;  3EPK A;  1KJK A;  2YTD A;  2LCE A;  2EMZ A;  2EMH A;  2EOQ A;  1A1G A;  4R2S A;  2J7J A;  2EPX A;  1UBD C;  4IJD A;  2MKD A;  1A1I A;  2YRK A;  3EPH A;  1BB8 A;  2GHF A;  2YTP A;  2ENA A;  2BB8 A;  2EM0 A;  2YTJ A;  2EN8 A;  2YTO A;  5KL6 A;  1A1J A;  4GZN C;  5KL2 A;  2EOM A;  2EQ1 A;  1X3C A;  2EL4 A;  2EMX A;  2EMY A;  2EOS A;  3EPL A;  3MHH C;  2EOI A;  3EPJ A;  1X6H A;  2JPA A;  2EPA A;  2YTI A;  4WSG A;  2EMI A;  4M9V C;  2YTE A;  4FK5 C;  2EOO A;  2EN3 A;  4R2A A;  1B69 A;  3MHS C;  2EOE A;  2YU8 A;  2EM8 A;  4R2Q A;  2EMW A;  2EN7 A;  2MKN A;  1X5W A;  2EOH A;  2EOY A;  1NCS A;  2EM2 A;  2WBS A;  2EN6 A;  4X9J A;  2YRH A;  2YTN A;  1F2I G;  2DMI A;  1JK2 A;  1A1K A;  2YTF A;  4IS1 C;  2M9A A;  1BBO A;  2EL5 A;  2EMK A;  2WBT A;  2YU5 A;  2JP9 A;  1JK1 A;  3UK3 C;  1WJP A;  2EN2 A;  2EMB A;  2YTG A;  2HGH A;  2EMF A;  3M99 B;  2EE8 A;  2RSI A;  2CSH A;  2PRT A;  2GLI A;  2ELZ A;  4R2E A;  2EQ3 A;  1YSA C;  2EOX A;  1A1F A;  2D9H A;  1RMD A;  2EM5 A;  2ELY A;  2CT1 A;  3VHT B;  2EN4 A;  2YTQ A;  2E72 A;  2EOF A;  2EPZ A;  1G2F C;  1TF3 A;  1DGC A;  5KL7 A;  2LV2 A;  1LLM C;  2YSP A;  1A1L A;  1YUI A;  2MDG A;  2EPC A;  4F6N A;  2EM6 A;  2EPP A;  1ZU1 A;  2ENC A;  2EM7 A;  2EML A;  1A1H A;  2VRD A;  4F6M A;  2DLQ A;  1YUJ A;  4R2R A;  2CTD A;  2LT7 A;  5KL4 A;  2WBU A;  1Z1B A;  2EM3 A;  2DRP A;  2EP3 A;  2LVH A;  5KL5 A;  2NAB A;  1ZAA C;  1X6F A;  2ADR A;  2EOZ A;  5KL3 A;  2DGC A;  2EM9 A;  1X6E A;  2EPR A;  2YRM A;  1MEY C;  2EJ4 A;  1AAY A;  1P47 A;  2DLK A;  2EL6 A;  2EN1 A;  1ZR9 A;  4R2D A;  1TN9 A;  2WCC 3;  2EMA A;  1TF6 A;  2R1F A;  2I13 A;  2EOJ A;  2EM4 A;  1G2D C;  2LO3 A;  2EQ0 A;  2RPC A;  2EPU A;  2EMC A;  2EOR A;  4R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...