2EM7A

Solution structure of the c2h2 type zinc finger (region 339-371) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEECGKGFICRRDLYTHHMVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 339-371) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em7A01
2LV2A 4R2AA 1DGCA 1ZU1A 4F2JC 2DMIA 2EMCA 3EPLA 2GHFA 2EOSA 2EMLA 2EJ4A 2EMFA 1KJKA 2EM5A 2EOQA 2YTIA 3EPKA 1YSAC 2EMAA 2WCC3 5KL4A 1WJPA 4FK5C 2EN6A 2LCEA 2YTNA 2YTGA 5KL2A 1A1LA 2EMWA 2YSPA 1AAYA 4GZNC 2BB8A 2DRPA 2EL5A 2YSOA 2YRHA 1Z1BA 2EM6A 2EOEA 4R2PA 2MKNA 1A1GA 2WBUA 2ENAA 2EM0A 1A1FA 2RPCA 2EPCA 2ENHA 3VHTB 1TF3A 2GLIA 2EOZA 1UBDC 1B69A 4F6MA 2EPUA 3EPJA 2CTDA 2LVHA 2DGCA 2YU5A 2YRMA 2EMBA 4R2CA 1A1JA 2EN8A 1P47A 4R2RA 2EL4A 2RSIA 3UK3C 1JK1A 2EOMA 2EN2A 3MHSC 2ENCA 2LT7A 2EMXA 2YTDA 3EPHA 2EOHA 2EOYA 1BB8A 2DLKA 2ELZA 2D9HA 2EPAA 2EQ1A 1TN9A 1ZAAC 2EOOA 2EOIA 2YTEA 4WSGA 2EN4A 1G2DC 1JK2A 5KL6A 2EOFA 5KL5A 2I13A 2YTQA 2ADRA 1YUJA 1X5WA 2A25A 4M9VC 2EPXA 1YUIA 2EQ0A 2ELYA 2EN3A 3M99B 1BBOA 2EMKA 2LO3A 1A1HA 1MEYC 2EP3A 2EORA 1ZR9A 2J7JA 2YTFA 2EPZA 2EPRA 5KL3A 1A1KA 1X3CA 1F2IG 2EN1A 1X6HA 1LLMC 1UN6B 2EPPA 4R2EA 4F6NA 1X6EA 1TF6A 2EOJA 2EMZA 2WBTA 2CT1A 2YTPA 2VRDA 2EM9A 2JPAA 4R2SA 2YRKA 2EL6A 2YTJA 2EM8A 2MDGA 2MKDA 2R1FA 2EQ3A 2DLQA 5KL7A 2EN7A 3MHHC 2EM2A 1NCSA 2M9AA 2EMYA 2EM3A 2EMHA 1RMDA 2PRTA 2CSHA 2JP9A 2E72A 2YTOA 2EOXA 2YU8A 1X6FA 2EM7A 2EMGA 1A1IA 2WBSA 1G2FC 2EMIA 4X9JA 4R2QA 2HGHA 2EM4A 2NABA 4IJDA 4R2DA 2EE8A 4IS1C
chains in the Genus database with same CATH superfamily
4WFTA 2UXCE 1UHZA 1DGCA 2DIXA 3KZZA 2B3TB 4BHBA 2DMIA 3J7AG 5A2QC 2EJ4A 2EMFA 1KJKA 4JI6E 3KZYA 1PJSA 2M7QA 3EPKA 2WCC3 1GQEA 2VE7C 2R76A 4P78A 2L3CA 2EMWA 1MGTA 4DV5E 2DRPA 3T1HE 2LJHA 2JOBA 4M2ZA 2GLIA 3VK6A 1YYOA 4M0VA 3HTXA 3EPJA 3VYYA 2CTDA 4DR3E 3F6HA 2YRMA 2EMBA 4WXDA 1N32E 1YYWA 1P47A 3IWBA 3J80C 1YPNA 2ENCA 3AUZA 2V88A 2YTDA 1BB8A 1AH5A 2D9HA 2EQ1A 2L2KB 4JI5E 5IXMB 3JU0A 1WRJA 4F9CB 2K4VA 1ZBTA 2YT4A 4JI3E 3MSWA 1X5WA 1O0WA 2KHXA 4KZSA 1DQ3A 2MC5A 2LUQA 2YPNA 4DV1E 3BIDA 2HJJA 1IQSA 2LO3A 2L8TA 3THNA 2Q8UA 2EORA 3J81C 1ZR9A 2LBSB 2EPRA 1A1KA 1T4OA 5IWAE 5LMUE 4F6NA 1X49A 1PJTA 2EM9A 4N4RB 4LF9E 1XNQE 2MDGA 1XMQE 2EQ3A 2DLQA 3IWDA 2VQFE 3ADLA 2M9AA 2EMYA 1HNXE 2EM3A 5A6AA 2LTSA 2LTRA 2LUPB 2KONA 5A6JA 4JYAE 1J5EE 3C4BA 5A6BD 1A1IA 4X9JA 2EM4A 2JXPA 4R03A 4F2JC 3HXLA 2GHFA 5LLQA 2EMLA 1GZ6A 4BMJA 2EM5A 2YTIA 3KWRA 4DR2E 1YSAC 5F3WA 2EMAA 4KHPE 2V87A 2H36X 1WJPA 3C6KA 1XMOE 2EN6A 2YTNA 5KL2A 2UU9E 4WXCA 3HPSA 3THOB 1A1LA 4X64E 1AAYA 1DI2A 2YSOA 1Z1BA 2EOEA 1A1GA 2WBUA 2ENAA 4DV4E 4F54A 2RPCA 1UBDC 3VYXA 2UUBE 2FV4B 2ODRC 4JI8E 2UXDE 4MLVA 3AV0A 1A1JA 2JR1A 2VQEE 4BC7A 1QU6A 2LMZA 4MLQA 1IBKE 4I8OA 1N34E 2EMXA 3EPHA 2EOYA 1EH6A 1IBME 1IBLE 1TN9A 1T4LB 4B3TE 1ZAAC 2EOOA 2NUEA 2YTEA 4WSGA 2JVAA 3JTZA 1RQ0A 4RHBB 3C4TA 1JK2A 5KL6A 5AE1A 5TSEA 2I13A 1EH8A 2YTQA 4R8OA 4AQYE 5LL6R 4M30A 2EQ0A 2ELYA 2EN3A 2LJUA 3M99B 4BS9A 4LF8E 4GEQB 2I9IA 4TUGA 3L00A 1N36E 2EP3A 1MEYC 4DUZE 1N33E 4KWYA 2L2NA 4X8WA 2N3GA 4ZYGA 2YWQA 1YFHA 4JI0E 3QG5C 2YTFA 2L2MA 3BGHA 4NZVA 4DKKA 2V89A 5KL3A 1X3CA 2EN1A 2DB2A 2UUCE 1X6EA 3HQ1A 1TF6A 2FTXB 2EOJA 1WHQA 2EMZA 2V83A 5LMNE 5T6JA 2CT1A 2VRDA 4LF6E 2JPAA 4LTYA 2RQLA 4R2SA 2YTJA 5A69A 4ZYEA 5KL7A 2EN7A 3F6GA 1NCSA 2L3JA 4DR1E 4L5NC 2EMHA 1RMDA 2CSHA 4WSPA 2L92A 2YTOA 3TQMA 3C6MA 2EM7A 1PKPA 2EMGA 4O43A 2UUAE 4JI2E 5IV8B 4R2QA 2HGHA 5A6KA 2NABA 2JY9A 4NXNE 4BHCA 5AC4A 1QNTA 4DUYE 1HR0E 4R2AA 1T39A 4J8ZA 1ZU1A 4YY3E 3EPLA 4RH8A 2MC6A 2HC5A 2KOUA 1FKAE 4DR7E 5FLXC 4JI7E 2YTGA 4DV3E 1I94E 4GZNC 2BB8A 2E1MA 4O24A 1L4SA 2BBGA 2LRSA 3ADIA 2L6MA 1A1FA 1TF3A 2EPCA 2ENHA 2YZTA 3VHTB 1B69A 3OMLA 3LMLA 4L8NA 4GKKE 4NXME 2EPUA 4DV0E 4LFCE 2LVHA 1XNRE 1J26A 2JWOA 1JK1A 2EL4A 3UK3C 2CPNA 1EKZA 2EN2A 1PJQA 2GPIA 1GTKA 3BF2A 2DLKA 2ELZA 4GKJE 4OX9E 4LFBE 2LE2A 2EOFA 2RS7A 2B7TA 1YZ9A 2EZ6A 2UXBE 2ADRA 4WYQB 1YUJA 2A25A 1RC7A 2EPXA 1YUIA 2N8XA 4JV5E 2EPKX 4WX9A 1BBOA 2EMKA 2G7HA 3LLHA 2IHR1 2EPOA 4LFAE 3H09A 1YYKA 3OTOE 2MDRA 4DR4E 2RS6A 5AASA 3IWCA 2J7JA 5CFFE 2EPZA 4JI4E 1HNWE 2EWLA 3RMPA 1KYQA 1X6HA 1UN6B 2DMYA 2V86A 3T1YE 4BCAA 2JYAA 1X48A 2B9DA 4JI1E 2EM8A 4B3ME 1PDAA 4HEIA 1STUA 5A6BA 4DV7E 4X62E 3EQ1A 3MHHC 2NUGA 4P7DA 3DF6A 1IQOA 2ZM6E 4LF4E 2EOXA 2YU8A 2V85A 5DNYA 2ODRD 2WBSA 4TUIA 1G2FC 2EMIA 4IJDA 1EH7A 2B7VA 2EE8A 4IS1C 4LF5E 1FJGE 2LV2A 2WZOA 4NHRA 4DV2E 2EMCA 2EOSA 2EOQA 3DJWA 3ECRA 4BC9A 4X66E 5KL4A 2EPNA 4FK5C 3J7Yp 2LCEA 3ZOQB 3ADJA 4B3SE 2YSPA 4Q28A 2EL5A 2YRHA 4ZYHA 2EM6A 4R2PA 3HPZA 2MKNA 1UILA 2EM0A 2EOZA 2NA2A 4ZYDA 1BBGA 2DGCA 2YU5A 4R2CA 5AC5A 4WPYA 2EN8A 2FGGA 4R2RA 1SFEA 2RSIA 2E5LE 4DR5E 2EOMA 2M1SA 3MHSC 1N3GA 4O5GA 2LT7A 2EOHA 2EPLX 2EPAA 4F9BB 2EOIA 2EN4A 1G2DC 2RTXA 2N3HA 4OOGC 2JOXA 4DV6E 5KL5A 2L33A 1WHNA 1X47A 5IT9C 4M9VC 4LU9A 3JAMC 3BBGA 4YHHE 4F9AB 3P1XA 5AE3A 4X65E 2V8QB 1A1HA 4B3RE 2HHHE 2F8BA 4K0KE 1T4NA 2RSMA 4HTGA 3ADGA 4LF7E 2EPMX 1F2IG 5AE2A 1LLMC 3FIGA 1SR9A 2EPPA 4R2EA 2NUFA 2M4IA 1IMUA 2WBTA 2YTPA 1HNZE 1WXRA 1NEIA 2YRKA 2EL6A 4Q35B 3K6QA 1ZBQA 2R1FA 2DSYA 2MKDA 4O4KA 2EM2A 4BBYA 5BR8E 2K7IA 2VF1A 2PRTA 2JP9A 2E72A 4DMIA 1X6FA 2F4VE 4R2DA 4F6MA 5ADZA 1T38A 4DR6E
chains in the Genus database with same CATH topology
2LV2A 4R2AA 1DGCA 1ZU1A 4F2JC 2DMIA 2EMCA 3EPLA 2GHFA 2EOSA 2EMLA 2EJ4A 2EMFA 1KJKA 2EM5A 2EOQA 2YTIA 3EPKA 1YSAC 2EMAA 2WCC3 5KL4A 1WJPA 4FK5C 2EN6A 2LCEA 2YTNA 2YTGA 5KL2A 1A1LA 2EMWA 2YSPA 1AAYA 4GZNC 2BB8A 2DRPA 2EL5A 2YSOA 2YRHA 1Z1BA 2EM6A 2EOEA 4R2PA 2MKNA 1A1GA 2WBUA 2ENAA 2EM0A 1A1FA 2RPCA 2EPCA 2ENHA 3VHTB 1TF3A 2GLIA 2EOZA 1UBDC 1B69A 4F6MA 2EPUA 3EPJA 2CTDA 2LVHA 2DGCA 2YU5A 2YRMA 2EMBA 4R2CA 1A1JA 2EN8A 1P47A 4R2RA 2EL4A 2RSIA 3UK3C 1JK1A 2EOMA 2EN2A 3MHSC 2ENCA 2LT7A 2EMXA 2YTDA 3EPHA 2EOHA 2EOYA 1BB8A 2DLKA 2ELZA 2D9HA 2EPAA 2EQ1A 1TN9A 1ZAAC 2EOOA 2EOIA 2YTEA 4WSGA 2EN4A 1G2DC 1JK2A 5KL6A 2EOFA 5KL5A 2I13A 2YTQA 2ADRA 1YUJA 1X5WA 2A25A 4M9VC 2EPXA 1YUIA 2EQ0A 2ELYA 2EN3A 3M99B 1BBOA 2EMKA 2LO3A 1A1HA 1MEYC 2EP3A 2EORA 1ZR9A 2J7JA 2YTFA 2EPZA 2EPRA 5KL3A 1A1KA 1X3CA 1F2IG 2EN1A 1X6HA 1LLMC 1UN6B 2EPPA 4R2EA 4F6NA 1X6EA 1TF6A 2EOJA 2EMZA 2WBTA 2CT1A 2YTPA 2VRDA 2EM9A 2JPAA 4R2SA 2YRKA 2EL6A 2YTJA 2EM8A 2MDGA 2MKDA 2R1FA 2EQ3A 2DLQA 5KL7A 2EN7A 3MHHC 2EM2A 1NCSA 2M9AA 2EMYA 2EM3A 2EMHA 1RMDA 2PRTA 2CSHA 2JP9A 2E72A 2YTOA 2EOXA 2YU8A 1X6FA 2EM7A 2EMGA 1A1IA 2WBSA 1G2FC 2EMIA 4X9JA 4R2QA 2HGHA 2EM4A 2NABA 4IJDA 4R2DA 2EE8A 4IS1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV2 A;  4R2A A;  1DGC A;  1ZU1 A;  4F2J C;  2DMI A;  2EMC A;  3EPL A;  2GHF A;  2EOS A;  2EML A;  2EJ4 A;  2EMF A;  1KJK A;  2EM5 A;  2EOQ A;  2YTI A;  3EPK A;  1YSA C;  2EMA A;  2WCC 3;  5KL4 A;  1WJP A;  4FK5 C;  2EN6 A;  2LCE A;  2YTN A;  2YTG A;  5KL2 A;  1A1L A;  2EMW A;  2YSP A;  1AAY A;  4GZN C;  2BB8 A;  2DRP A;  2EL5 A;  2YSO A;  2YRH A;  1Z1B A;  2EM6 A;  2EOE A;  4R2P A;  2MKN A;  1A1G A;  2WBU A;  2ENA A;  2EM0 A;  1A1F A;  2RPC A;  2EPC A;  2ENH A;  3VHT B;  1TF3 A;  2GLI A;  2EOZ A;  1UBD C;  1B69 A;  4F6M A;  2EPU A;  3EPJ A;  2CTD A;  2LVH A;  2DGC A;  2YU5 A;  2YRM A;  2EMB A;  4R2C A;  1A1J A;  2EN8 A;  1P47 A;  4R2R A;  2EL4 A;  2RSI A;  3UK3 C;  1JK1 A;  2EOM A;  2EN2 A;  3MHS C;  2ENC A;  2LT7 A;  2EMX A;  2YTD A;  3EPH A;  2EOH A;  2EOY A;  1BB8 A;  2DLK A;  2ELZ A;  2D9H A;  2EPA A;  2EQ1 A;  1TN9 A;  1ZAA C;  2EOO A;  2EOI A;  2YTE A;  4WSG A;  2EN4 A;  1G2D C;  1JK2 A;  5KL6 A;  2EOF A;  5KL5 A;  2I13 A;  2YTQ A;  2ADR A;  1YUJ A;  1X5W A;  2A25 A;  4M9V C;  2EPX A;  1YUI A;  2EQ0 A;  2ELY A;  2EN3 A;  3M99 B;  1BBO A;  2EMK A;  2LO3 A;  1A1H A;  1MEY C;  2EP3 A;  2EOR A;  1ZR9 A;  2J7J A;  2YTF A;  2EPZ A;  2EPR A;  5KL3 A;  1A1K A;  1X3C A;  1F2I G;  2EN1 A;  1X6H A;  1LLM C;  1UN6 B;  2EPP A;  4R2E A;  4F6N A;  1X6E A;  1TF6 A;  2EOJ A;  2EMZ A;  2WBT A;  2CT1 A;  2YTP A;  2VRD A;  2EM9 A;  2JPA A;  4R2S A;  2YRK A;  2EL6 A;  2YTJ A;  2EM8 A;  2MDG A;  2MKD A;  2R1F A;  2EQ3 A;  2DLQ A;  5KL7 A;  2EN7 A;  3MHH C;  2EM2 A;  1NCS A;  2M9A A;  2EMY A;  2EM3 A;  2EMH A;  1RMD A;  2PRT A;  2CSH A;  2JP9 A;  2E72 A;  2YTO A;  2EOX A;  2YU8 A;  1X6F A;  2EM7 A;  2EMG A;  1A1I A;  2WBS A;  1G2F C;  2EMI A;  4X9J A;  4R2Q A;  2HGH A;  2EM4 A;  2NAB A;  4IJD A;  4R2D A;  2EE8 A;  4IS1 C; 
#chains in the Genus database with same CATH topology
 4WFT A;  2UXC E;  1UHZ A;  1DGC A;  2DIX A;  3KZZ A;  2B3T B;  4BHB A;  2DMI A;  3J7A G;  5A2Q C;  2EJ4 A;  2EMF A;  1KJK A;  4JI6 E;  3KZY A;  1PJS A;  2M7Q A;  3EPK A;  2WCC 3;  1GQE A;  2VE7 C;  2R76 A;  4P78 A;  2L3C A;  2EMW A;  1MGT A;  4DV5 E;  2DRP A;  3T1H E;  2LJH A;  2JOB A;  4M2Z A;  2GLI A;  3VK6 A;  1YYO A;  4M0V A;  3HTX A;  3EPJ A;  3VYY A;  2CTD A;  4DR3 E;  3F6H A;  2YRM A;  2EMB A;  4WXD A;  1N32 E;  1YYW A;  1P47 A;  3IWB A;  3J80 C;  1YPN A;  2ENC A;  3AUZ A;  2V88 A;  2YTD A;  1BB8 A;  1AH5 A;  2D9H A;  2EQ1 A;  2L2K B;  4JI5 E;  5IXM B;  3JU0 A;  1WRJ A;  4F9C B;  2K4V A;  1ZBT A;  2YT4 A;  4JI3 E;  3MSW A;  1X5W A;  1O0W A;  2KHX A;  4KZS A;  1DQ3 A;  2MC5 A;  2LUQ A;  2YPN A;  4DV1 E;  3BID A;  2HJJ A;  1IQS A;  2LO3 A;  2L8T A;  3THN A;  2Q8U A;  2EOR A;  3J81 C;  1ZR9 A;  2LBS B;  2EPR A;  1A1K A;  1T4O A;  5IWA E;  5LMU E;  4F6N A;  1X49 A;  1PJT A;  2EM9 A;  4N4R B;  4LF9 E;  1XNQ E;  2MDG A;  1XMQ E;  2EQ3 A;  2DLQ A;  3IWD A;  2VQF E;  3ADL A;  2M9A A;  2EMY A;  1HNX E;  2EM3 A;  5A6A A;  2LTS A;  2LTR A;  2LUP B;  2KON A;  5A6J A;  4JYA E;  1J5E E;  3C4B A;  5A6B D;  1A1I A;  4X9J A;  2EM4 A;  2JXP A;  4R03 A;  4F2J C;  3HXL A;  2GHF A;  5LLQ A;  2EML A;  1GZ6 A;  4BMJ A;  2EM5 A;  2YTI A;  3KWR A;  4DR2 E;  1YSA C;  5F3W A;  2EMA A;  4KHP E;  2V87 A;  2H36 X;  1WJP A;  3C6K A;  1XMO E;  2EN6 A;  2YTN A;  5KL2 A;  2UU9 E;  4WXC A;  3HPS A;  3THO B;  1A1L A;  4X64 E;  1AAY A;  1DI2 A;  2YSO A;  1Z1B A;  2EOE A;  1A1G A;  2WBU A;  2ENA A;  4DV4 E;  4F54 A;  2RPC A;  1UBD C;  3VYX A;  2UUB E;  2FV4 B;  2ODR C;  4JI8 E;  2UXD E;  4MLV A;  3AV0 A;  1A1J A;  2JR1 A;  2VQE E;  4BC7 A;  1QU6 A;  2LMZ A;  4MLQ A;  1IBK E;  4I8O A;  1N34 E;  2EMX A;  3EPH A;  2EOY A;  1EH6 A;  1IBM E;  1IBL E;  1TN9 A;  1T4L B;  4B3T E;  1ZAA C;  2EOO A;  2NUE A;  2YTE A;  4WSG A;  2JVA A;  3JTZ A;  1RQ0 A;  4RHB B;  3C4T A;  1JK2 A;  5KL6 A;  5AE1 A;  5TSE A;  2I13 A;  1EH8 A;  2YTQ A;  4R8O A;  4AQY E;  5LL6 R;  4M30 A;  2EQ0 A;  2ELY A;  2EN3 A;  2LJU A;  3M99 B;  4BS9 A;  4LF8 E;  4GEQ B;  2I9I A;  4TUG A;  3L00 A;  1N36 E;  2EP3 A;  1MEY C;  4DUZ E;  1N33 E;  4KWY A;  2L2N A;  4X8W A;  2N3G A;  4ZYG A;  2YWQ A;  1YFH A;  4JI0 E;  3QG5 C;  2YTF A;  2L2M A;  3BGH A;  4NZV A;  4DKK A;  2V89 A;  5KL3 A;  1X3C A;  2EN1 A;  2DB2 A;  2UUC E;  1X6E A;  3HQ1 A;  1TF6 A;  2FTX B;  2EOJ A;  1WHQ A;  2EMZ A;  2V83 A;  5LMN E;  5T6J A;  2CT1 A;  2VRD A;  4LF6 E;  2JPA A;  4LTY A;  2RQL A;  4R2S A;  2YTJ A;  5A69 A;  4ZYE A;  5KL7 A;  2EN7 A;  3F6G A;  1NCS A;  2L3J A;  4DR1 E;  4L5N C;  2EMH A;  1RMD A;  2CSH A;  4WSP A;  2L92 A;  2YTO A;  3TQM A;  3C6M A;  2EM7 A;  1PKP A;  2EMG A;  4O43 A;  2UUA E;  4JI2 E;  5IV8 B;  4R2Q A;  2HGH A;  5A6K A;  2NAB A;  2JY9 A;  4NXN E;  4BHC A;  5AC4 A;  1QNT A;  4DUY E;  1HR0 E;  4R2A A;  1T39 A;  4J8Z A;  1ZU1 A;  4YY3 E;  3EPL A;  4RH8 A;  2MC6 A;  2HC5 A;  2KOU A;  1FKA E;  4DR7 E;  5FLX C;  4JI7 E;  2YTG A;  4DV3 E;  1I94 E;  4GZN C;  2BB8 A;  2E1M A;  4O24 A;  1L4S A;  2BBG A;  2LRS A;  3ADI A;  2L6M A;  1A1F A;  1TF3 A;  2EPC A;  2ENH A;  2YZT A;  3VHT B;  1B69 A;  3OML A;  3LML A;  4L8N A;  4GKK E;  4NXM E;  2EPU A;  4DV0 E;  4LFC E;  2LVH A;  1XNR E;  1J26 A;  2JWO A;  1JK1 A;  2EL4 A;  3UK3 C;  2CPN A;  1EKZ A;  2EN2 A;  1PJQ A;  2GPI A;  1GTK A;  3BF2 A;  2DLK A;  2ELZ A;  4GKJ E;  4OX9 E;  4LFB E;  2LE2 A;  2EOF A;  2RS7 A;  2B7T A;  1YZ9 A;  2EZ6 A;  2UXB E;  2ADR A;  4WYQ B;  1YUJ A;  2A25 A;  1RC7 A;  2EPX A;  1YUI A;  2N8X A;  4JV5 E;  2EPK X;  4WX9 A;  1BBO A;  2EMK A;  2G7H A;  3LLH A;  2IHR 1;  2EPO A;  4LFA E;  3H09 A;  1YYK A;  3OTO E;  2MDR A;  4DR4 E;  2RS6 A;  5AAS A;  3IWC A;  2J7J A;  5CFF E;  2EPZ A;  4JI4 E;  1HNW E;  2EWL A;  3RMP A;  1KYQ A;  1X6H A;  1UN6 B;  2DMY A;  2V86 A;  3T1Y E;  4BCA A;  2JYA A;  1X48 A;  2B9D A;  4JI1 E;  2EM8 A;  4B3M E;  1PDA A;  4HEI A;  1STU A;  5A6B A;  4DV7 E;  4X62 E;  3EQ1 A;  3MHH C;  2NUG A;  4P7D A;  3DF6 A;  1IQO A;  2ZM6 E;  4LF4 E;  2EOX A;  2YU8 A;  2V85 A;  5DNY A;  2ODR D;  2WBS A;  4TUI A;  1G2F C;  2EMI A;  4IJD A;  1EH7 A;  2B7V A;  2EE8 A;  4IS1 C;  4LF5 E;  1FJG E;  2LV2 A;  2WZO A;  4NHR A;  4DV2 E;  2EMC A;  2EOS A;  2EOQ A;  3DJW A;  3ECR A;  4BC9 A;  4X66 E;  5KL4 A;  2EPN A;  4FK5 C;  3J7Y p;  2LCE A;  3ZOQ B;  3ADJ A;  4B3S E;  2YSP A;  4Q28 A;  2EL5 A;  2YRH A;  4ZYH A;  2EM6 A;  4R2P A;  3HPZ A;  2MKN A;  1UIL A;  2EM0 A;  2EOZ A;  2NA2 A;  4ZYD A;  1BBG A;  2DGC A;  2YU5 A;  4R2C A;  5AC5 A;  4WPY A;  2EN8 A;  2FGG A;  4R2R A;  1SFE A;  2RSI A;  2E5L E;  4DR5 E;  2EOM A;  2M1S A;  3MHS C;  1N3G A;  4O5G A;  2LT7 A;  2EOH A;  2EPL X;  2EPA A;  4F9B B;  2EOI A;  2EN4 A;  1G2D C;  2RTX A;  2N3H A;  4OOG C;  2JOX A;  4DV6 E;  5KL5 A;  2L33 A;  1WHN A;  1X47 A;  5IT9 C;  4M9V C;  4LU9 A;  3JAM C;  3BBG A;  4YHH E;  4F9A B;  3P1X A;  5AE3 A;  4X65 E;  2V8Q B;  1A1H A;  4B3R E;  2HHH E;  2F8B A;  4K0K E;  1T4N A;  2RSM A;  4HTG A;  3ADG A;  4LF7 E;  2EPM X;  1F2I G;  5AE2 A;  1LLM C;  3FIG A;  1SR9 A;  2EPP A;  4R2E A;  2NUF A;  2M4I A;  1IMU A;  2WBT A;  2YTP A;  1HNZ E;  1WXR A;  1NEI A;  2YRK A;  2EL6 A;  4Q35 B;  3K6Q A;  1ZBQ A;  2R1F A;  2DSY A;  2MKD A;  4O4K A;  2EM2 A;  4BBY A;  5BR8 E;  2K7I A;  2VF1 A;  2PRT A;  2JP9 A;  2E72 A;  4DMI A;  1X6F A;  2F4V E;  4R2D A;  4F6M A;  5ADZ A;  1T38 A;  4DR6 E; 
#chains in the Genus database with same CATH homology
 2LV2 A;  4R2A A;  1DGC A;  1ZU1 A;  4F2J C;  2DMI A;  2EMC A;  3EPL A;  2GHF A;  2EOS A;  2EML A;  2EJ4 A;  2EMF A;  1KJK A;  2EM5 A;  2EOQ A;  2YTI A;  3EPK A;  1YSA C;  2EMA A;  2WCC 3;  5KL4 A;  1WJP A;  4FK5 C;  2EN6 A;  2LCE A;  2YTN A;  2YTG A;  5KL2 A;  1A1L A;  2EMW A;  2YSP A;  1AAY A;  4GZN C;  2BB8 A;  2DRP A;  2EL5 A;  2YSO A;  2YRH A;  1Z1B A;  2EM6 A;  2EOE A;  4R2P A;  2MKN A;  1A1G A;  2WBU A;  2ENA A;  2EM0 A;  1A1F A;  2RPC A;  2EPC A;  2ENH A;  3VHT B;  1TF3 A;  2GLI A;  2EOZ A;  1UBD C;  1B69 A;  4F6M A;  2EPU A;  3EPJ A;  2CTD A;  2LVH A;  2DGC A;  2YU5 A;  2YRM A;  2EMB A;  4R2C A;  1A1J A;  2EN8 A;  1P47 A;  4R2R A;  2EL4 A;  2RSI A;  3UK3 C;  1JK1 A;  2EOM A;  2EN2 A;  3MHS C;  2ENC A;  2LT7 A;  2EMX A;  2YTD A;  3EPH A;  2EOH A;  2EOY A;  1BB8 A;  2DLK A;  2ELZ A;  2D9H A;  2EPA A;  2EQ1 A;  1TN9 A;  1ZAA C;  2EOO A;  2EOI A;  2YTE A;  4WSG A;  2EN4 A;  1G2D C;  1JK2 A;  5KL6 A;  2EOF A;  5KL5 A;  2I13 A;  2YTQ A;  2ADR A;  1YUJ A;  1X5W A;  2A25 A;  4M9V C;  2EPX A;  1YUI A;  2EQ0 A;  2ELY A;  2EN3 A;  3M99 B;  1BBO A;  2EMK A;  2LO3 A;  1A1H A;  1MEY C;  2EP3 A;  2EOR A;  1ZR9 A;  2J7J A;  2YTF A;  2EPZ A;  2EPR A;  5KL3 A;  1A1K A;  1X3C A;  1F2I G;  2EN1 A;  1X6H A;  1LLM C;  1UN6 B;  2EPP A;  4R2E A;  4F6N A;  1X6E A;  1TF6 A;  2EOJ A;  2EMZ A;  2WBT A;  2CT1 A;  2YTP A;  2VRD A;  2EM9 A;  2JPA A;  4R2S A;  2YRK A;  2EL6 A;  2YTJ A;  2EM8 A;  2MDG A;  2MKD A;  2R1F A;  2EQ3 A;  2DLQ A;  5KL7 A;  2EN7 A;  3MHH C;  2EM2 A;  1NCS A;  2M9A A;  2EMY A;  2EM3 A;  2EMH A;  1RMD A;  2PRT A;  2CSH A;  2JP9 A;  2E72 A;  2YTO A;  2EOX A;  2YU8 A;  1X6F A;  2EM7 A;  2EMG A;  1A1I A;  2WBS A;  1G2F C;  2EMI A;  4X9J A;  4R2Q A;  2HGH A;  2EM4 A;  2NAB A;  4IJD A;  4R2D A;  2EE8 A;  4IS1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...