2EM7A

Solution structure of the c2h2 type zinc finger (region 339-371) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEECGKGFICRRDLYTHHMVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 339-371) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em7A01
2ENHA 2EPCA 2EL4A 2EMZA 2RSIA 2EJ4A 2DMIA 2EMLA 2EOZA 1X6EA 2YRMA 1G2DC 2EN3A 2MDGA 1A1HA 2DGCA 3EPLA 2YTIA 1A1GA 1TF3A 2EOYA 1DGCA 3M99B 2YSPA 2J7JA 2MKDA 2EPPA 2EPRA 2YTGA 1NCSA 2EOQA 2YTEA 2EMFA 4R2AA 3EPHA 2EP3A 5KL4A 1TN9A 2ENCA 1ZR9A 4F2JC 1JK1A 1UN6B 2YTOA 2DLKA 1TF6A 1AAYA 2ELZA 4X9JA 1WJPA 3MHSC 1ZU1A 4GZNC 1A1LA 2EM0A 4R2RA 1KJKA 4F6NA 5KL3A 1BB8A 2LV2A 2EM5A 2CT1A 2EMBA 2EMAA 2GLIA 1X6HA 4F6MA 2D9HA 1LLMC 2YTPA 1X6FA 2ELYA 4WSGA 1ZAAC 4M9VC 1B69A 2EPXA 2LCEA 2MKNA 4R2CA 2CSHA 2BB8A 4R2PA 4IJDA 2EM2A 2EM4A 2EM8A 2LO3A 2HGHA 2ADRA 2DLQA 4R2QA 2EL5A 2WBSA 2I13A 2YTJA 2EOOA 2EMCA 1X5WA 4IS1C 1A1KA 2EMXA 2EOIA 2GHFA 2EN1A 2M9AA 2YRHA 2EN2A 1RMDA 2WCC3 2JP9A 2EMYA 2CTDA 4R2SA 2VRDA 2EN8A 5KL7A 2EOMA 2PRTA 2EE8A 1BBOA 2JPAA 2YTDA 2EN6A 3EPKA 1G2FC 2EM3A 2WBUA 2EOFA 2EMWA 2EOEA 2EPAA 2EOHA 1F2IG 1UBDC 1A1IA 2YSOA 2EL6A 3VHTB 2E72A 2RPCA 4R2EA 3UK3C 5KL2A 5KL6A 3EPJA 1JK2A 2EMHA 2EQ3A 4FK5C 2YTNA 1YSAC 2EQ0A 1YUJA 2NABA 2EN7A 2LT7A 1A1JA 2EM9A 2YTQA 2EQ1A 1YUIA 2DRPA 1A1FA 1P47A 2YTFA 2EN4A 2YRKA 2YU8A 2EM7A 2ENAA 3MHHC 1MEYC 2EOXA 2LVHA 2EMIA 5KL5A 1Z1BA 2A25A 1X3CA 2EM6A 4R2DA 2EMKA 2WBTA 2YU5A 2R1FA 2EPUA 2EOSA 2EMGA 2EOJA 2EORA 2EPZA
chains in the Genus database with same CATH superfamily
4JI8E 4F9CB 2Q8UA 4DR7E 1PKPA 2EMLA 2EOZA 1HR0E 2YRMA 1G2DC 2EN3A 4WXCA 3BGHA 2DGCA 5LMUE 2EPKX 1A1GA 4F9AB 2EOYA 2YSPA 2MKDA 1HNXE 2EPMX 2EOQA 4DR3E 1WHQA 4JI7E 2DLKA 3C6MA 2ELZA 2FGGA 2RS7A 4B3TE 1L4SA 1ZU1A 5FLXC 1BB8A 2YPNA 2EM5A 2N3HA 1X6HA 1IQSA 4F6MA 1LLMC 4NZVA 4DMIA 1X6FA 1ZAAC 1B69A 2EPOA 1N33E 5LMNE 4R03A 1DQ3A 4IJDA 3LLHA 1FKAE 4RH8A 4DV5E 2HGHA 2NUGA 4O24A 2V83A 4R8OA 2N3GA 2L3CA 4BS9A 2EMCA 4JI3E 2L33A 2YRHA 3THOB 2EN2A 5IV8B 2WCC3 4O5GA 3ADLA 2VRDA 1EH7A 2JOBA 4OOGC 4F54A 4AQYE 2EZ6A 2LTRA 1IBKE 4LF9E 4ZYGA 1G2FC 2WBUA 2UUCE 2EOFA 1F2IG 2N8XA 1RQ0A 4X62E 2KOUA 2RPCA 3UK3C 2LUQA 5A69A 5KL2A 2UXDE 1EH6A 3J7Yp 2LUPB 2EMHA 4FK5C 1YSAC 3ZOQB 4LF6E 3ADGA 2EN7A 4BHBA 4ZYHA 2YTQA 2EQ1A 1QNTA 1STUA 1YUIA 2YTFA 2EN4A 3HXLA 5AC5A 5CFFE 2EOXA 2LVHA 2EMIA 2VE7C 1BBGA 2EM6A 3OTOE 2GPIA 3HQ1A 4O43A 2R1FA 2BB8A 2EOJA 2V85A 4JI0E 5T6JA 2EL4A 2EMZA 4JYAE 4NHRA 1T4OA 3HPSA 4P7DA 1X6EA 4DR6E 2M7QA 2B7TA 1TF3A 3DJWA 3QG5C 4GKKE 3BIDA 5IXMB 2MDRA 2V8QB 2ODRC 2YTEA 2EP3A 5KL4A 2CPNA 3AUZA 2L8TA 1ZR9A 2HJJA 4F2JC 4B3SE 2YTOA 1IMUA 2UU9E 1XNRE 2V89A 2YZTA 4M2ZA 1FJGE 2DSYA 1WJPA 3MHSC 4WFTA 3OMLA 1UILA 2EMBA 2L2MA 2L2NA 3C4BA 3BF2A 2LE2A 4P78A 2V87A 4NXME 3LMLA 4B3RE 2ELYA 4DV1E 2LCEA 3F6HA 4R2PA 1ZBQA 4KHPE 4WX9A 2LO3A 4LTYA 2ADRA 4YY3E 2EL5A 2WBSA 1XMQE 4DR2E 3J80C 2I13A 1EKZA 1YPNA 3IWBA 3ECRA 1A1KA 2NA2A 2EOIA 4JI1E 2M9AA 4HTGA 2NUFA 2L2KB 5IWAE 1RMDA 3EQ1A 2EMYA 2CTDA 1N36E 4R2SA 2LMZA 5KL7A 1UHZA 2EOMA 3BBGA 3H09A 4F9BB 1BBOA 2JPAA 1KYQA 3EPKA 3HTXA 5LL6R 2EM3A 4J8ZA 2EL6A 3FIGA 4DV2E 2E72A 4LFCE 4L8NA 4Q35B 3JTZA 2YTNA 4DUZE 5LLQA 1YUJA 5AE1A 5ADZA 2JOXA 5DNYA 4I8OA 2LT7A 2YT4A 1XMOE 2EM9A 2JY9A 3VK6A 4MLVA 2HC5A 2YRKA 2YU8A 2ENAA 1GTKA 2UXBE 1Z1BA 5KL5A 1T4NA 3JAMC 1AH5A 2L6MA 4R2DA 2RS6A 5AASA 1J26A 2WBTA 2H36X 2EPUA 3KWRA 2EORA 2ENHA 4DV6E 2L92A 2NUEA 1PJQA 5A6KA 5IT9C 1J5EE 2MDGA 3KZZA 1A1HA 2M4IA 2B3TB 2J7JA 2KONA 4X64E 2EPPA 1PJTA 2YTGA 3L00A 5AE2A 4BC9A 2EWLA 1XNQE 2RSMA 2ENCA 1PJSA 1N3GA 2JWOA 4X8WA 4DR4E 4JI5E 1X48A 1GQEA 5BR8E 4WSPA 4X9JA 2E1MA 4LF8E 1SR9A 2EM0A 2LJUA 4R2RA 1KJKA 4F6NA 5KL3A 4LFAE 2CT1A 2VF1A 3T1HE 5F3WA 4BHCA 2FTXB 2GLIA 4WYQB 5A6BD 2D9HA 4JI2E 1X49A 3JU0A 4M9VC 1YYKA 1HNWE 3T1YE 2RQLA 2MKNA 4R2CA 2E5LE 5A6JA 2EM2A 4DUYE 1IBME 4M0VA 2EM4A 2EM8A 2IHR1 2EPNA 2KHXA 1SFEA 1T4LB 2YTJA 2EOOA 2YWQA 1X5WA 4HEIA 4IS1C 1MGTA 5AE3A 4JI6E 1GZ6A 2GHFA 2EPLX 4DV4E 2JP9A 1WXRA 2DB2A 4LFBE 2PRTA 2EE8A 1HNZE 2UUBE 2JYAA 2YTDA 2EN6A 2FV4B 5AC4A 2EMWA 2EOEA 2EOHA 4N4RB 1UBDC 1A1IA 4X66E 4O4KA 1O0WA 3VHTB 2UXCE 4R2EA 3EPJA 1JK2A 3RMPA 2LTSA 4B3ME 1IBLE 2I9IA 3J7AG 1X47A 2RTXA 1NEIA 1A1JA 3THNA 2DRPA 4X65E 1T39A 1WHNA 2EM7A 4DV3E 4RHBB 2JR1A 4LU9A 3ADIA 4GEQB 2EMKA 2B7VA 2YU5A 2VQFE 2EOSA 4WSGA 4TUIA 5A6AA 1T38A 2EPCA 2RSIA 2EJ4A 2DMIA 2DIXA 3HPZA 4Q28A 2YTIA 2K7IA 1DGCA 3M99B 2EPRA 4K0KE 3MSWA 4YHHE 4WXDA 1NCSA 5A2QC 2UUAE 2EMFA 4DKKA 4R2AA 3EPHA 4M30A 1TN9A 3F6GA 2DMYA 1JK1A 1UN6B 1EH8A 4BBYA 1TF6A 1YZ9A 1AAYA 2BBGA 2F8BA 4DR5E 3K6QA 4BC7A 1YYWA 4GZNC 1A1LA 1WRJA 5A6BA 1RC7A 2LV2A 3VYYA 3IWCA 2EMAA 2ODRD 2ZM6E 2YTPA 5TSEA 4OX9E 3TQMA 4GKJE 2EPXA 1I94E 2F4VE 2CSHA 2LJHA 4KZSA 2JXPA 4LF7E 2V88A 2DLQA 4R2QA 2G7HA 3ADJA 4L5NC 2B9DA 2EMXA 2EN1A 3C4TA 4MLQA 4NXNE 4KWYA 3P1XA 2K4VA 2EN8A 3DF6A 1N32E 1N34E 4ZYEA 4ZYDA 4WPYA 3J81C 1YFHA 2MC6A 1IQOA 2EPAA 3KZYA 2YSOA 4JI4E 4LF4E 1ZBTA 3C6KA 5KL6A 4JV5E 2EQ3A 2LBSB 2WZOA 1DI2A 1YYOA 4DV0E 2EQ0A 4DV7E 2NABA 1PDAA 4BMJA 4DR1E 4TUGA 3AV0A 1A1FA 2HHHE 1P47A 3VYXA 2M1SA 2L3JA 2JVAA 3MHHC 1MEYC 2LRSA 2VQEE 2V86A 2A25A 2R76A 2MC5A 3IWDA 4BCAA 4LF5E 2EMGA 1X3CA 3EPLA 1QU6A 2EPZA
chains in the Genus database with same CATH topology
2ENHA 2EPCA 2EL4A 2EMZA 2RSIA 2EJ4A 2DMIA 2EMLA 2EOZA 1X6EA 2YRMA 1G2DC 2EN3A 2MDGA 1A1HA 2DGCA 3EPLA 2YTIA 1A1GA 1TF3A 2EOYA 1DGCA 3M99B 2YSPA 2J7JA 2MKDA 2EPPA 2EPRA 2YTGA 1NCSA 2EOQA 2YTEA 2EMFA 4R2AA 3EPHA 2EP3A 5KL4A 1TN9A 2ENCA 1ZR9A 4F2JC 1JK1A 1UN6B 2YTOA 2DLKA 1TF6A 1AAYA 2ELZA 4X9JA 1WJPA 3MHSC 1ZU1A 4GZNC 1A1LA 2EM0A 4R2RA 1KJKA 4F6NA 5KL3A 1BB8A 2LV2A 2EM5A 2CT1A 2EMBA 2EMAA 2GLIA 1X6HA 4F6MA 2D9HA 1LLMC 2YTPA 1X6FA 2ELYA 4WSGA 1ZAAC 4M9VC 1B69A 2EPXA 2LCEA 2MKNA 4R2CA 2CSHA 2BB8A 4R2PA 4IJDA 2EM2A 2EM4A 2EM8A 2LO3A 2HGHA 2ADRA 2DLQA 4R2QA 2EL5A 2WBSA 2I13A 2YTJA 2EOOA 2EMCA 1X5WA 4IS1C 1A1KA 2EMXA 2EOIA 2GHFA 2EN1A 2M9AA 2YRHA 2EN2A 1RMDA 2WCC3 2JP9A 2EMYA 2CTDA 4R2SA 2VRDA 2EN8A 5KL7A 2EOMA 2PRTA 2EE8A 1BBOA 2JPAA 2YTDA 2EN6A 3EPKA 1G2FC 2EM3A 2WBUA 2EOFA 2EMWA 2EOEA 2EPAA 2EOHA 1F2IG 1UBDC 1A1IA 2YSOA 2EL6A 3VHTB 2E72A 2RPCA 4R2EA 3UK3C 5KL2A 5KL6A 3EPJA 1JK2A 2EMHA 2EQ3A 4FK5C 2YTNA 1YSAC 2EQ0A 1YUJA 2NABA 2EN7A 2LT7A 1A1JA 2EM9A 2YTQA 2EQ1A 1YUIA 2DRPA 1A1FA 1P47A 2YTFA 2EN4A 2YRKA 2YU8A 2EM7A 2ENAA 3MHHC 1MEYC 2EOXA 2LVHA 2EMIA 5KL5A 1Z1BA 2A25A 1X3CA 2EM6A 4R2DA 2EMKA 2WBTA 2YU5A 2R1FA 2EPUA 2EOSA 2EMGA 2EOJA 2EORA 2EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  2EPC A;  2EL4 A;  2EMZ A;  2RSI A;  2EJ4 A;  2DMI A;  2EML A;  2EOZ A;  1X6E A;  2YRM A;  1G2D C;  2EN3 A;  2MDG A;  1A1H A;  2DGC A;  3EPL A;  2YTI A;  1A1G A;  1TF3 A;  2EOY A;  1DGC A;  3M99 B;  2YSP A;  2J7J A;  2MKD A;  2EPP A;  2EPR A;  2YTG A;  1NCS A;  2EOQ A;  2YTE A;  2EMF A;  4R2A A;  3EPH A;  2EP3 A;  5KL4 A;  1TN9 A;  2ENC A;  1ZR9 A;  4F2J C;  1JK1 A;  1UN6 B;  2YTO A;  2DLK A;  1TF6 A;  1AAY A;  2ELZ A;  4X9J A;  1WJP A;  3MHS C;  1ZU1 A;  4GZN C;  1A1L A;  2EM0 A;  4R2R A;  1KJK A;  4F6N A;  5KL3 A;  1BB8 A;  2LV2 A;  2EM5 A;  2CT1 A;  2EMB A;  2EMA A;  2GLI A;  1X6H A;  4F6M A;  2D9H A;  1LLM C;  2YTP A;  1X6F A;  2ELY A;  4WSG A;  1ZAA C;  4M9V C;  1B69 A;  2EPX A;  2LCE A;  2MKN A;  4R2C A;  2CSH A;  2BB8 A;  4R2P A;  4IJD A;  2EM2 A;  2EM4 A;  2EM8 A;  2LO3 A;  2HGH A;  2ADR A;  2DLQ A;  4R2Q A;  2EL5 A;  2WBS A;  2I13 A;  2YTJ A;  2EOO A;  2EMC A;  1X5W A;  4IS1 C;  1A1K A;  2EMX A;  2EOI A;  2GHF A;  2EN1 A;  2M9A A;  2YRH A;  2EN2 A;  1RMD A;  2WCC 3;  2JP9 A;  2EMY A;  2CTD A;  4R2S A;  2VRD A;  2EN8 A;  5KL7 A;  2EOM A;  2PRT A;  2EE8 A;  1BBO A;  2JPA A;  2YTD A;  2EN6 A;  3EPK A;  1G2F C;  2EM3 A;  2WBU A;  2EOF A;  2EMW A;  2EOE A;  2EPA A;  2EOH A;  1F2I G;  1UBD C;  1A1I A;  2YSO A;  2EL6 A;  3VHT B;  2E72 A;  2RPC A;  4R2E A;  3UK3 C;  5KL2 A;  5KL6 A;  3EPJ A;  1JK2 A;  2EMH A;  2EQ3 A;  4FK5 C;  2YTN A;  1YSA C;  2EQ0 A;  1YUJ A;  2NAB A;  2EN7 A;  2LT7 A;  1A1J A;  2EM9 A;  2YTQ A;  2EQ1 A;  1YUI A;  2DRP A;  1A1F A;  1P47 A;  2YTF A;  2EN4 A;  2YRK A;  2YU8 A;  2EM7 A;  2ENA A;  3MHH C;  1MEY C;  2EOX A;  2LVH A;  2EMI A;  5KL5 A;  1Z1B A;  2A25 A;  1X3C A;  2EM6 A;  4R2D A;  2EMK A;  2WBT A;  2YU5 A;  2R1F A;  2EPU A;  2EOS A;  2EMG A;  2EOJ A;  2EOR A;  2EPZ A; 
#chains in the Genus database with same CATH topology
 4JI8 E;  4F9C B;  2Q8U A;  4DR7 E;  1PKP A;  2EML A;  2EOZ A;  1HR0 E;  2YRM A;  1G2D C;  2EN3 A;  4WXC A;  3BGH A;  2DGC A;  5LMU E;  2EPK X;  1A1G A;  4F9A B;  2EOY A;  2YSP A;  2MKD A;  1HNX E;  2EPM X;  2EOQ A;  4DR3 E;  1WHQ A;  4JI7 E;  2DLK A;  3C6M A;  2ELZ A;  2FGG A;  2RS7 A;  4B3T E;  1L4S A;  1ZU1 A;  5FLX C;  1BB8 A;  2YPN A;  2EM5 A;  2N3H A;  1X6H A;  1IQS A;  4F6M A;  1LLM C;  4NZV A;  4DMI A;  1X6F A;  1ZAA C;  1B69 A;  2EPO A;  1N33 E;  5LMN E;  4R03 A;  1DQ3 A;  4IJD A;  3LLH A;  1FKA E;  4RH8 A;  4DV5 E;  2HGH A;  2NUG A;  4O24 A;  2V83 A;  4R8O A;  2N3G A;  2L3C A;  4BS9 A;  2EMC A;  4JI3 E;  2L33 A;  2YRH A;  3THO B;  2EN2 A;  5IV8 B;  2WCC 3;  4O5G A;  3ADL A;  2VRD A;  1EH7 A;  2JOB A;  4OOG C;  4F54 A;  4AQY E;  2EZ6 A;  2LTR A;  1IBK E;  4LF9 E;  4ZYG A;  1G2F C;  2WBU A;  2UUC E;  2EOF A;  1F2I G;  2N8X A;  1RQ0 A;  4X62 E;  2KOU A;  2RPC A;  3UK3 C;  2LUQ A;  5A69 A;  5KL2 A;  2UXD E;  1EH6 A;  3J7Y p;  2LUP B;  2EMH A;  4FK5 C;  1YSA C;  3ZOQ B;  4LF6 E;  3ADG A;  2EN7 A;  4BHB A;  4ZYH A;  2YTQ A;  2EQ1 A;  1QNT A;  1STU A;  1YUI A;  2YTF A;  2EN4 A;  3HXL A;  5AC5 A;  5CFF E;  2EOX A;  2LVH A;  2EMI A;  2VE7 C;  1BBG A;  2EM6 A;  3OTO E;  2GPI A;  3HQ1 A;  4O43 A;  2R1F A;  2BB8 A;  2EOJ A;  2V85 A;  4JI0 E;  5T6J A;  2EL4 A;  2EMZ A;  4JYA E;  4NHR A;  1T4O A;  3HPS A;  4P7D A;  1X6E A;  4DR6 E;  2M7Q A;  2B7T A;  1TF3 A;  3DJW A;  3QG5 C;  4GKK E;  3BID A;  5IXM B;  2MDR A;  2V8Q B;  2ODR C;  2YTE A;  2EP3 A;  5KL4 A;  2CPN A;  3AUZ A;  2L8T A;  1ZR9 A;  2HJJ A;  4F2J C;  4B3S E;  2YTO A;  1IMU A;  2UU9 E;  1XNR E;  2V89 A;  2YZT A;  4M2Z A;  1FJG E;  2DSY A;  1WJP A;  3MHS C;  4WFT A;  3OML A;  1UIL A;  2EMB A;  2L2M A;  2L2N A;  3C4B A;  3BF2 A;  2LE2 A;  4P78 A;  2V87 A;  4NXM E;  3LML A;  4B3R E;  2ELY A;  4DV1 E;  2LCE A;  3F6H A;  4R2P A;  1ZBQ A;  4KHP E;  4WX9 A;  2LO3 A;  4LTY A;  2ADR A;  4YY3 E;  2EL5 A;  2WBS A;  1XMQ E;  4DR2 E;  3J80 C;  2I13 A;  1EKZ A;  1YPN A;  3IWB A;  3ECR A;  1A1K A;  2NA2 A;  2EOI A;  4JI1 E;  2M9A A;  4HTG A;  2NUF A;  2L2K B;  5IWA E;  1RMD A;  3EQ1 A;  2EMY A;  2CTD A;  1N36 E;  4R2S A;  2LMZ A;  5KL7 A;  1UHZ A;  2EOM A;  3BBG A;  3H09 A;  4F9B B;  1BBO A;  2JPA A;  1KYQ A;  3EPK A;  3HTX A;  5LL6 R;  2EM3 A;  4J8Z A;  2EL6 A;  3FIG A;  4DV2 E;  2E72 A;  4LFC E;  4L8N A;  4Q35 B;  3JTZ A;  2YTN A;  4DUZ E;  5LLQ A;  1YUJ A;  5AE1 A;  5ADZ A;  2JOX A;  5DNY A;  4I8O A;  2LT7 A;  2YT4 A;  1XMO E;  2EM9 A;  2JY9 A;  3VK6 A;  4MLV A;  2HC5 A;  2YRK A;  2YU8 A;  2ENA A;  1GTK A;  2UXB E;  1Z1B A;  5KL5 A;  1T4N A;  3JAM C;  1AH5 A;  2L6M A;  4R2D A;  2RS6 A;  5AAS A;  1J26 A;  2WBT A;  2H36 X;  2EPU A;  3KWR A;  2EOR A;  2ENH A;  4DV6 E;  2L92 A;  2NUE A;  1PJQ A;  5A6K A;  5IT9 C;  1J5E E;  2MDG A;  3KZZ A;  1A1H A;  2M4I A;  2B3T B;  2J7J A;  2KON A;  4X64 E;  2EPP A;  1PJT A;  2YTG A;  3L00 A;  5AE2 A;  4BC9 A;  2EWL A;  1XNQ E;  2RSM A;  2ENC A;  1PJS A;  1N3G A;  2JWO A;  4X8W A;  4DR4 E;  4JI5 E;  1X48 A;  1GQE A;  5BR8 E;  4WSP A;  4X9J A;  2E1M A;  4LF8 E;  1SR9 A;  2EM0 A;  2LJU A;  4R2R A;  1KJK A;  4F6N A;  5KL3 A;  4LFA E;  2CT1 A;  2VF1 A;  3T1H E;  5F3W A;  4BHC A;  2FTX B;  2GLI A;  4WYQ B;  5A6B D;  2D9H A;  4JI2 E;  1X49 A;  3JU0 A;  4M9V C;  1YYK A;  1HNW E;  3T1Y E;  2RQL A;  2MKN A;  4R2C A;  2E5L E;  5A6J A;  2EM2 A;  4DUY E;  1IBM E;  4M0V A;  2EM4 A;  2EM8 A;  2IHR 1;  2EPN A;  2KHX A;  1SFE A;  1T4L B;  2YTJ A;  2EOO A;  2YWQ A;  1X5W A;  4HEI A;  4IS1 C;  1MGT A;  5AE3 A;  4JI6 E;  1GZ6 A;  2GHF A;  2EPL X;  4DV4 E;  2JP9 A;  1WXR A;  2DB2 A;  4LFB E;  2PRT A;  2EE8 A;  1HNZ E;  2UUB E;  2JYA A;  2YTD A;  2EN6 A;  2FV4 B;  5AC4 A;  2EMW A;  2EOE A;  2EOH A;  4N4R B;  1UBD C;  1A1I A;  4X66 E;  4O4K A;  1O0W A;  3VHT B;  2UXC E;  4R2E A;  3EPJ A;  1JK2 A;  3RMP A;  2LTS A;  4B3M E;  1IBL E;  2I9I A;  3J7A G;  1X47 A;  2RTX A;  1NEI A;  1A1J A;  3THN A;  2DRP A;  4X65 E;  1T39 A;  1WHN A;  2EM7 A;  4DV3 E;  4RHB B;  2JR1 A;  4LU9 A;  3ADI A;  4GEQ B;  2EMK A;  2B7V A;  2YU5 A;  2VQF E;  2EOS A;  4WSG A;  4TUI A;  5A6A A;  1T38 A;  2EPC A;  2RSI A;  2EJ4 A;  2DMI A;  2DIX A;  3HPZ A;  4Q28 A;  2YTI A;  2K7I A;  1DGC A;  3M99 B;  2EPR A;  4K0K E;  3MSW A;  4YHH E;  4WXD A;  1NCS A;  5A2Q C;  2UUA E;  2EMF A;  4DKK A;  4R2A A;  3EPH A;  4M30 A;  1TN9 A;  3F6G A;  2DMY A;  1JK1 A;  1UN6 B;  1EH8 A;  4BBY A;  1TF6 A;  1YZ9 A;  1AAY A;  2BBG A;  2F8B A;  4DR5 E;  3K6Q A;  4BC7 A;  1YYW A;  4GZN C;  1A1L A;  1WRJ A;  5A6B A;  1RC7 A;  2LV2 A;  3VYY A;  3IWC A;  2EMA A;  2ODR D;  2ZM6 E;  2YTP A;  5TSE A;  4OX9 E;  3TQM A;  4GKJ E;  2EPX A;  1I94 E;  2F4V E;  2CSH A;  2LJH A;  4KZS A;  2JXP A;  4LF7 E;  2V88 A;  2DLQ A;  4R2Q A;  2G7H A;  3ADJ A;  4L5N C;  2B9D A;  2EMX A;  2EN1 A;  3C4T A;  4MLQ A;  4NXN E;  4KWY A;  3P1X A;  2K4V A;  2EN8 A;  3DF6 A;  1N32 E;  1N34 E;  4ZYE A;  4ZYD A;  4WPY A;  3J81 C;  1YFH A;  2MC6 A;  1IQO A;  2EPA A;  3KZY A;  2YSO A;  4JI4 E;  4LF4 E;  1ZBT A;  3C6K A;  5KL6 A;  4JV5 E;  2EQ3 A;  2LBS B;  2WZO A;  1DI2 A;  1YYO A;  4DV0 E;  2EQ0 A;  4DV7 E;  2NAB A;  1PDA A;  4BMJ A;  4DR1 E;  4TUG A;  3AV0 A;  1A1F A;  2HHH E;  1P47 A;  3VYX A;  2M1S A;  2L3J A;  2JVA A;  3MHH C;  1MEY C;  2LRS A;  2VQE E;  2V86 A;  2A25 A;  2R76 A;  2MC5 A;  3IWD A;  4BCA A;  4LF5 E;  2EMG A;  1X3C A;  3EPL A;  1QU6 A;  2EPZ A; 
#chains in the Genus database with same CATH homology
 2ENH A;  2EPC A;  2EL4 A;  2EMZ A;  2RSI A;  2EJ4 A;  2DMI A;  2EML A;  2EOZ A;  1X6E A;  2YRM A;  1G2D C;  2EN3 A;  2MDG A;  1A1H A;  2DGC A;  3EPL A;  2YTI A;  1A1G A;  1TF3 A;  2EOY A;  1DGC A;  3M99 B;  2YSP A;  2J7J A;  2MKD A;  2EPP A;  2EPR A;  2YTG A;  1NCS A;  2EOQ A;  2YTE A;  2EMF A;  4R2A A;  3EPH A;  2EP3 A;  5KL4 A;  1TN9 A;  2ENC A;  1ZR9 A;  4F2J C;  1JK1 A;  1UN6 B;  2YTO A;  2DLK A;  1TF6 A;  1AAY A;  2ELZ A;  4X9J A;  1WJP A;  3MHS C;  1ZU1 A;  4GZN C;  1A1L A;  2EM0 A;  4R2R A;  1KJK A;  4F6N A;  5KL3 A;  1BB8 A;  2LV2 A;  2EM5 A;  2CT1 A;  2EMB A;  2EMA A;  2GLI A;  1X6H A;  4F6M A;  2D9H A;  1LLM C;  2YTP A;  1X6F A;  2ELY A;  4WSG A;  1ZAA C;  4M9V C;  1B69 A;  2EPX A;  2LCE A;  2MKN A;  4R2C A;  2CSH A;  2BB8 A;  4R2P A;  4IJD A;  2EM2 A;  2EM4 A;  2EM8 A;  2LO3 A;  2HGH A;  2ADR A;  2DLQ A;  4R2Q A;  2EL5 A;  2WBS A;  2I13 A;  2YTJ A;  2EOO A;  2EMC A;  1X5W A;  4IS1 C;  1A1K A;  2EMX A;  2EOI A;  2GHF A;  2EN1 A;  2M9A A;  2YRH A;  2EN2 A;  1RMD A;  2WCC 3;  2JP9 A;  2EMY A;  2CTD A;  4R2S A;  2VRD A;  2EN8 A;  5KL7 A;  2EOM A;  2PRT A;  2EE8 A;  1BBO A;  2JPA A;  2YTD A;  2EN6 A;  3EPK A;  1G2F C;  2EM3 A;  2WBU A;  2EOF A;  2EMW A;  2EOE A;  2EPA A;  2EOH A;  1F2I G;  1UBD C;  1A1I A;  2YSO A;  2EL6 A;  3VHT B;  2E72 A;  2RPC A;  4R2E A;  3UK3 C;  5KL2 A;  5KL6 A;  3EPJ A;  1JK2 A;  2EMH A;  2EQ3 A;  4FK5 C;  2YTN A;  1YSA C;  2EQ0 A;  1YUJ A;  2NAB A;  2EN7 A;  2LT7 A;  1A1J A;  2EM9 A;  2YTQ A;  2EQ1 A;  1YUI A;  2DRP A;  1A1F A;  1P47 A;  2YTF A;  2EN4 A;  2YRK A;  2YU8 A;  2EM7 A;  2ENA A;  3MHH C;  1MEY C;  2EOX A;  2LVH A;  2EMI A;  5KL5 A;  1Z1B A;  2A25 A;  1X3C A;  2EM6 A;  4R2D A;  2EMK A;  2WBT A;  2YU5 A;  2R1F A;  2EPU A;  2EOS A;  2EMG A;  2EOJ A;  2EOR A;  2EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...