2EN7A

Solution structure of the c2h2 type zinc finger (region 495-525) of human zinc finger protein 268
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 495-525) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en7A01
2EMZA 2RSIA 4IS1C 1A1JA 1UBDC 1ZAAC 2ELYA 4GZNC 2YTGA 2ELZA 3EPHA 1G2DC 2EL6A 1YUIA 2YTEA 1A1KA 2EN6A 2EPCA 2EMKA 2EMYA 2YSPA 2DLKA 2D9HA 1A1IA 4F6MA 2EOQA 2LO3A 2EMHA 2YRKA 2WBSA 1JK2A 2EN4A 2DMIA 2EL5A 2EMLA 2EOSA 1TF6A 4M9VC 2EOEA 2EQ1A 2EPXA 1RMDA 2EN8A 2YU5A 2EN7A 2EM0A 4R2PA 2CT1A 2YTJA 2YTOA 2EOZA 2EMIA 2LCEA 1X3CA 2EOYA 2ENAA 2YTPA 2EPPA 2EN2A 2EM8A 2EMCA 2EM6A 2DLQA 2PRTA 4F6NA 1BBOA 2EM4A 4F2JC 2EPZA 2EN3A 1A1GA 2GHFA 3M99B 2EE8A 2RPCA 1AAYA 3MHSC 1JK1A 1F2IG 2EOOA 2DRPA 2WCC3 1Z1BA 1X6FA 4WSGA 5KL4A 4R2CA 4R2EA 2ENCA 1A1FA 2EM9A 2CSHA 2MDGA 5KL2A 2YRMA 2YTFA 1X6EA 1YSAC 2I13A 2JPAA 2EOFA 1ZR9A 2EM7A 4R2RA 3EPKA 2LT7A 2LVHA 1YUJA 1BB8A 1KJKA 2EMGA 2DGCA 1A1HA 2A25A 2EOIA 2GLIA 2EPAA 2ENHA 2WBTA 2EPUA 1ZU1A 1WJPA 2EN1A 2LV2A 3UK3C 2JP9A 1B69A 2EOXA 2EP3A 2EQ0A 5KL5A 4R2AA 4IJDA 2M9AA 1X6HA 2BB8A 4R2SA 2R1FA 3EPLA 1G2FC 5KL6A 2EM2A 1TF3A 1UN6B 1DGCA 2EOMA 2EMWA 4R2DA 5KL3A 2YU8A 2E72A 2MKDA 2EJ4A 2EMAA 2EPRA 3EPJA 1LLMC 2NABA 1NCSA 2YTDA 2WBUA 2J7JA 2EM3A 2EMBA 2VRDA 2CTDA 2EOHA 4R2QA 1TN9A 4X9JA 3MHHC 2EQ3A 2YTIA 1X5WA 2HGHA 3VHTB 2YTNA 2MKNA 2EL4A 2YSOA 4FK5C 1P47A 1MEYC 2ADRA 2EM5A 2EOJA 2YTQA 2EMFA 2YRHA 5KL7A 2EMXA 2EORA 1A1LA
chains in the Genus database with same CATH superfamily
3JAMC 1EH7A 2EZ6A 2KOUA 3C4TA 5A2QC 4BHBA 4GZNC 3OTOE 2YTGA 1T4NA 4JI4E 2LTRA 3J7AG 1YUIA 5LLQA 1A1KA 1ZBQA 2EMKA 1A1IA 3KWRA 2B7TA 1ZBTA 3T1HE 3IWCA 2EN4A 4M9VC 2EQ1A 1J26A 2LUQA 1STUA 4DR3E 2JOXA 4X8WA 2EN7A 2CT1A 2YTOA 3P1XA 2EOZA 3J7Yp 1WXRA 1BBGA 5AASA 4LF9E 2EPNA 2ENAA 2EN2A 1HNZE 4F6NA 5DNYA 2VE7C 3VYYA 4YY3E 3TQMA 4TUGA 4J8ZA 2GHFA 4X66E 2RPCA 4DR1E 1F2IG 4GEQB 2HC5A 2N3HA 1A1FA 1XNQE 2YTFA 1YSAC 2EWLA 2JPAA 2LT7A 4R2RA 4NZVA 1YUJA 4B3SE 1KJKA 2LRSA 4R03A 2EPAA 2RS7A 2LBSB 1T38A 1HR0E 1YPNA 1T4OA 1NEIA 2M9AA 1WHQA 1G2FC 1TF3A 4BCAA 5KL3A 1IMUA 3EPJA 4F9BB 2WBUA 1YZ9A 1J5EE 2EMBA 1X47A 1XNRE 1N34E 1PJSA 2CTDA 1KYQA 3MHHC 2EQ3A 5LL6R 1UILA 4O24A 4FK5C 4BHCA 3OMLA 3ADJA 4JI3E 3J81C 2V87A 5AE3A 5T6JA 3BIDA 2EMXA 2V86A 5KL7A 2RSIA 4IS1C 1A1JA 1ZAAC 4F54A 3HPZA 1X49A 5IXMB 4YHHE 1EKZA 2B7VA 4JV5E 1T4LB 4Q28A 2EL6A 2YSPA 2UXDE 2LJUA 2JR1A 2Q8UA 4LFBE 2R76A 1IBKE 4L8NA 1SR9A 2IHR1 4O4KA 4DV2E 2EPXA 3L00A 4X64E 5AE1A 4DR5E 2EM0A 4R2PA 2LTSA 2YTJA 2EMIA 1GTKA 1X3CA 1EH6A 5IWAE 3VYXA 2DLQA 4MLQA 4DR6E 3DJWA 3HTXA 2EPZA 2L33A 3M99B 2FTXB 1RQ0A 2DRPA 1Z1BA 4LTYA 1L4SA 5KL4A 2RS6A 4R2CA 2RQLA 4R2EA 2ENCA 3AUZA 2V88A 1X48A 2MDGA 2YRMA 2ODRD 1X6EA 2EPMX 2LMZA 2I13A 1ZR9A 4DUZE 2NUEA 2V83A 3EPKA 1UHZA 2LVHA 1BB8A 3BF2A 4WXDA 2EPOA 4ZYEA 2DB2A 2B3TB 2F4VE 2EOIA 2GLIA 2WBTA 2ENHA 2EPUA 2LV2A 1QNTA 1WJPA 2EN1A 1B69A 2EOXA 3THOB 2FGGA 3THNA 3EPLA 3MSWA 2EM2A 5A6BD 5FLXC 2L2NA 3LMLA 4MLVA 5AC4A 2EJ4A 2EMAA 1EH8A 2VF1A 4WSPA 2RSMA 1LLMC 2HJJA 2NABA 5AC5A 5AE2A 4RH8A 2RTXA 2LUPB 2N3GA 2I9IA 5IV8B 2H36X 1O0WA 2EM3A 4RHBB 2VRDA 4LU9A 4X65E 1GQEA 2MC5A 2EOHA 2YZTA 4ZYDA 4X9JA 4LF8E 4O5GA 2HGHA 2DSYA 2L3JA 1MEYC 3RMPA 3T1YE 2YRHA 4BC7A 4DV1E 2EPKX 4WFTA 2JOBA 2M1SA 3JTZA 5A6JA 4WX9A 2V85A 1A1LA 4B3TE 1WHNA 1WRJA 2ELYA 2NUGA 4O43A 4GKJE 3EQ1A 4KZSA 4BC9A 2L8TA 2YTEA 3K6QA 4DV0E 2EMYA 3LLHA 2DLKA 4OX9E 2D9HA 3H09A 2HHHE 2EOQA 2LO3A 2EMHA 2G7HA 3IWBA 5CFFE 2WBSA 2KHXA 3J80C 3AV0A 1JK2A 2DMIA 2EL5A 2M4IA 1TF6A 1N32E 2EOEA 2YU5A 2JVAA 1RMDA 1FKAE 1IQOA 4WPYA 2LE2A 2LCEA 4LF4E 4X62E 4LF5E 4NXNE 4DR7E 3F6GA 3QG5C 4NHRA 5IT9C 4F9AB 2DMYA 2JYAA 3ZOQB 3MHSC 1JK1A 2WCC3 1N3GA 1X6FA 2B9DA 4JI7E 3VK6A 2JXPA 2EM9A 2CSHA 5KL2A 3BGHA 2F8BA 2ZM6E 1PJQA 2GPIA 5A69A 4OOGC 2EM7A 5A6AA 1RC7A 4JYAE 2EMGA 1N33E 1YYWA 4DV5E 2ODRC 5ADZA 2YT4A 3C6KA 2JP9A 3KZYA 2JY9A 2UUCE 2UUAE 4B3RE 5KL5A 4IJDA 4R2SA 4LF7E 2YPNA 4DV3E 4TUIA 1DGCA 4WYQB 2E72A 2MKDA 2DIXA 2FV4B 4DKKA 3JU0A 2J7JA 4P7DA 2JWOA 1YFHA 4LFCE 4R2QA 1YYKA 4HEIA 4JI2E 1IBME 4GKKE 3VHTB 2YTNA 1I94E 2EL4A 2MKNA 1XMQE 2M7QA 1P47A 2KONA 1PKPA 2ADRA 2EM5A 2K4VA 2YWQA 2YTQA 4M30A 2UU9E 1PJTA 4ZYHA 3KZZA 4KHPE 4BBYA 2EMZA 1UBDC 3DF6A 4JI8E 2ELZA 4DUYE 3EPHA 1G2DC 4DMIA 2EN6A 2EPCA 2MDRA 3BBGA 2L92A 4F6MA 2E5LE 2VQFE 1IBLE 2NA2A 2YRKA 4KWYA 4JI0E 4AQYE 1XMOE 1N36E 2EMLA 2EOSA 3IWDA 1QU6A 2EN8A 4JI5E 5A6KA 3ADLA 3HQ1A 2L2MA 2EOYA 4DV4E 3HPSA 2YTPA 2EPPA 2EM8A 2LJHA 2EMCA 2EM6A 2PRTA 5LMUE 1BBOA 2EM4A 4F2JC 1HNWE 2EN3A 1A1GA 4N4RB 2EE8A 2WZOA 1AAYA 2UXCE 2EOOA 4HTGA 5F3WA 1YYOA 4Q35B 4WSGA 2V8QB 2N8XA 4F9CB 4JI1E 2CPNA 5TSEA 4DR2E 1MGTA 3F6HA 4WXCA 4DR4E 2EOFA 3ADGA 4BS9A 3ADIA 2DGCA 1A1HA 2A25A 1ZU1A 3UK3C 4BMJA 2EP3A 2EQ0A 2L6MA 2V89A 4R2AA 2MC6A 1X6HA 2BB8A 2R1FA 5KL6A 1UN6B 3C4BA 2EOMA 4I8OA 2EMWA 5BR8E 3C6MA 4R2DA 1PDAA 2YU8A 1FJGE 3ECRA 4P78A 2EPRA 1SFEA 4LFAE 2YTDA 1NCSA 1DI2A 4L5NC 2EPLX 2VQEE 4M0VA 4LF6E 5LMNE 4DV7E 1IQSA 1TN9A 2NUFA 5A6BA 1AH5A 2YTIA 1T39A 1X5WA 4NXME 2UUBE 4DV6E 2L2KB 4ZYGA 1HNXE 2YSOA 4B3ME 3FIGA 3HXLA 2UXBE 2BBGA 4JI6E 4M2ZA 2EOJA 2EMFA 1GZ6A 2E1MA 2K7IA 4R8OA 2L3CA 2EORA 1DQ3A 4K0KE
chains in the Genus database with same CATH topology
2EMZA 2RSIA 4IS1C 1A1JA 1UBDC 1ZAAC 2ELYA 4GZNC 2YTGA 2ELZA 3EPHA 1G2DC 2EL6A 1YUIA 2YTEA 1A1KA 2EN6A 2EPCA 2EMKA 2EMYA 2YSPA 2DLKA 2D9HA 1A1IA 4F6MA 2EOQA 2LO3A 2EMHA 2YRKA 2WBSA 1JK2A 2EN4A 2DMIA 2EL5A 2EMLA 2EOSA 1TF6A 4M9VC 2EOEA 2EQ1A 2EPXA 1RMDA 2EN8A 2YU5A 2EN7A 2EM0A 4R2PA 2CT1A 2YTJA 2YTOA 2EOZA 2EMIA 2LCEA 1X3CA 2EOYA 2ENAA 2YTPA 2EPPA 2EN2A 2EM8A 2EMCA 2EM6A 2DLQA 2PRTA 4F6NA 1BBOA 2EM4A 4F2JC 2EPZA 2EN3A 1A1GA 2GHFA 3M99B 2EE8A 2RPCA 1AAYA 3MHSC 1JK1A 1F2IG 2EOOA 2DRPA 2WCC3 1Z1BA 1X6FA 4WSGA 5KL4A 4R2CA 4R2EA 2ENCA 1A1FA 2EM9A 2CSHA 2MDGA 5KL2A 2YRMA 2YTFA 1X6EA 1YSAC 2I13A 2JPAA 2EOFA 1ZR9A 2EM7A 4R2RA 3EPKA 2LT7A 2LVHA 1YUJA 1BB8A 1KJKA 2EMGA 2DGCA 1A1HA 2A25A 2EOIA 2GLIA 2EPAA 2ENHA 2WBTA 2EPUA 1ZU1A 1WJPA 2EN1A 2LV2A 3UK3C 2JP9A 1B69A 2EOXA 2EP3A 2EQ0A 5KL5A 4R2AA 4IJDA 2M9AA 1X6HA 2BB8A 4R2SA 2R1FA 3EPLA 1G2FC 5KL6A 2EM2A 1TF3A 1UN6B 1DGCA 2EOMA 2EMWA 4R2DA 5KL3A 2YU8A 2E72A 2MKDA 2EJ4A 2EMAA 2EPRA 3EPJA 1LLMC 2NABA 1NCSA 2YTDA 2WBUA 2J7JA 2EM3A 2EMBA 2VRDA 2CTDA 2EOHA 4R2QA 1TN9A 4X9JA 3MHHC 2EQ3A 2YTIA 1X5WA 2HGHA 3VHTB 2YTNA 2MKNA 2EL4A 2YSOA 4FK5C 1P47A 1MEYC 2ADRA 2EM5A 2EOJA 2YTQA 2EMFA 2YRHA 5KL7A 2EMXA 2EORA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMZ A;  2RSI A;  4IS1 C;  1A1J A;  1UBD C;  1ZAA C;  2ELY A;  4GZN C;  2YTG A;  2ELZ A;  3EPH A;  1G2D C;  2EL6 A;  1YUI A;  2YTE A;  1A1K A;  2EN6 A;  2EPC A;  2EMK A;  2EMY A;  2YSP A;  2DLK A;  2D9H A;  1A1I A;  4F6M A;  2EOQ A;  2LO3 A;  2EMH A;  2YRK A;  2WBS A;  1JK2 A;  2EN4 A;  2DMI A;  2EL5 A;  2EML A;  2EOS A;  1TF6 A;  4M9V C;  2EOE A;  2EQ1 A;  2EPX A;  1RMD A;  2EN8 A;  2YU5 A;  2EN7 A;  2EM0 A;  4R2P A;  2CT1 A;  2YTJ A;  2YTO A;  2EOZ A;  2EMI A;  2LCE A;  1X3C A;  2EOY A;  2ENA A;  2YTP A;  2EPP A;  2EN2 A;  2EM8 A;  2EMC A;  2EM6 A;  2DLQ A;  2PRT A;  4F6N A;  1BBO A;  2EM4 A;  4F2J C;  2EPZ A;  2EN3 A;  1A1G A;  2GHF A;  3M99 B;  2EE8 A;  2RPC A;  1AAY A;  3MHS C;  1JK1 A;  1F2I G;  2EOO A;  2DRP A;  2WCC 3;  1Z1B A;  1X6F A;  4WSG A;  5KL4 A;  4R2C A;  4R2E A;  2ENC A;  1A1F A;  2EM9 A;  2CSH A;  2MDG A;  5KL2 A;  2YRM A;  2YTF A;  1X6E A;  1YSA C;  2I13 A;  2JPA A;  2EOF A;  1ZR9 A;  2EM7 A;  4R2R A;  3EPK A;  2LT7 A;  2LVH A;  1YUJ A;  1BB8 A;  1KJK A;  2EMG A;  2DGC A;  1A1H A;  2A25 A;  2EOI A;  2GLI A;  2EPA A;  2ENH A;  2WBT A;  2EPU A;  1ZU1 A;  1WJP A;  2EN1 A;  2LV2 A;  3UK3 C;  2JP9 A;  1B69 A;  2EOX A;  2EP3 A;  2EQ0 A;  5KL5 A;  4R2A A;  4IJD A;  2M9A A;  1X6H A;  2BB8 A;  4R2S A;  2R1F A;  3EPL A;  1G2F C;  5KL6 A;  2EM2 A;  1TF3 A;  1UN6 B;  1DGC A;  2EOM A;  2EMW A;  4R2D A;  5KL3 A;  2YU8 A;  2E72 A;  2MKD A;  2EJ4 A;  2EMA A;  2EPR A;  3EPJ A;  1LLM C;  2NAB A;  1NCS A;  2YTD A;  2WBU A;  2J7J A;  2EM3 A;  2EMB A;  2VRD A;  2CTD A;  2EOH A;  4R2Q A;  1TN9 A;  4X9J A;  3MHH C;  2EQ3 A;  2YTI A;  1X5W A;  2HGH A;  3VHT B;  2YTN A;  2MKN A;  2EL4 A;  2YSO A;  4FK5 C;  1P47 A;  1MEY C;  2ADR A;  2EM5 A;  2EOJ A;  2YTQ A;  2EMF A;  2YRH A;  5KL7 A;  2EMX A;  2EOR A;  1A1L A; 
#chains in the Genus database with same CATH topology
 3JAM C;  1EH7 A;  2EZ6 A;  2KOU A;  3C4T A;  5A2Q C;  4BHB A;  4GZN C;  3OTO E;  2YTG A;  1T4N A;  4JI4 E;  2LTR A;  3J7A G;  1YUI A;  5LLQ A;  1A1K A;  1ZBQ A;  2EMK A;  1A1I A;  3KWR A;  2B7T A;  1ZBT A;  3T1H E;  3IWC A;  2EN4 A;  4M9V C;  2EQ1 A;  1J26 A;  2LUQ A;  1STU A;  4DR3 E;  2JOX A;  4X8W A;  2EN7 A;  2CT1 A;  2YTO A;  3P1X A;  2EOZ A;  3J7Y p;  1WXR A;  1BBG A;  5AAS A;  4LF9 E;  2EPN A;  2ENA A;  2EN2 A;  1HNZ E;  4F6N A;  5DNY A;  2VE7 C;  3VYY A;  4YY3 E;  3TQM A;  4TUG A;  4J8Z A;  2GHF A;  4X66 E;  2RPC A;  4DR1 E;  1F2I G;  4GEQ B;  2HC5 A;  2N3H A;  1A1F A;  1XNQ E;  2YTF A;  1YSA C;  2EWL A;  2JPA A;  2LT7 A;  4R2R A;  4NZV A;  1YUJ A;  4B3S E;  1KJK A;  2LRS A;  4R03 A;  2EPA A;  2RS7 A;  2LBS B;  1T38 A;  1HR0 E;  1YPN A;  1T4O A;  1NEI A;  2M9A A;  1WHQ A;  1G2F C;  1TF3 A;  4BCA A;  5KL3 A;  1IMU A;  3EPJ A;  4F9B B;  2WBU A;  1YZ9 A;  1J5E E;  2EMB A;  1X47 A;  1XNR E;  1N34 E;  1PJS A;  2CTD A;  1KYQ A;  3MHH C;  2EQ3 A;  5LL6 R;  1UIL A;  4O24 A;  4FK5 C;  4BHC A;  3OML A;  3ADJ A;  4JI3 E;  3J81 C;  2V87 A;  5AE3 A;  5T6J A;  3BID A;  2EMX A;  2V86 A;  5KL7 A;  2RSI A;  4IS1 C;  1A1J A;  1ZAA C;  4F54 A;  3HPZ A;  1X49 A;  5IXM B;  4YHH E;  1EKZ A;  2B7V A;  4JV5 E;  1T4L B;  4Q28 A;  2EL6 A;  2YSP A;  2UXD E;  2LJU A;  2JR1 A;  2Q8U A;  4LFB E;  2R76 A;  1IBK E;  4L8N A;  1SR9 A;  2IHR 1;  4O4K A;  4DV2 E;  2EPX A;  3L00 A;  4X64 E;  5AE1 A;  4DR5 E;  2EM0 A;  4R2P A;  2LTS A;  2YTJ A;  2EMI A;  1GTK A;  1X3C A;  1EH6 A;  5IWA E;  3VYX A;  2DLQ A;  4MLQ A;  4DR6 E;  3DJW A;  3HTX A;  2EPZ A;  2L33 A;  3M99 B;  2FTX B;  1RQ0 A;  2DRP A;  1Z1B A;  4LTY A;  1L4S A;  5KL4 A;  2RS6 A;  4R2C A;  2RQL A;  4R2E A;  2ENC A;  3AUZ A;  2V88 A;  1X48 A;  2MDG A;  2YRM A;  2ODR D;  1X6E A;  2EPM X;  2LMZ A;  2I13 A;  1ZR9 A;  4DUZ E;  2NUE A;  2V83 A;  3EPK A;  1UHZ A;  2LVH A;  1BB8 A;  3BF2 A;  4WXD A;  2EPO A;  4ZYE A;  2DB2 A;  2B3T B;  2F4V E;  2EOI A;  2GLI A;  2WBT A;  2ENH A;  2EPU A;  2LV2 A;  1QNT A;  1WJP A;  2EN1 A;  1B69 A;  2EOX A;  3THO B;  2FGG A;  3THN A;  3EPL A;  3MSW A;  2EM2 A;  5A6B D;  5FLX C;  2L2N A;  3LML A;  4MLV A;  5AC4 A;  2EJ4 A;  2EMA A;  1EH8 A;  2VF1 A;  4WSP A;  2RSM A;  1LLM C;  2HJJ A;  2NAB A;  5AC5 A;  5AE2 A;  4RH8 A;  2RTX A;  2LUP B;  2N3G A;  2I9I A;  5IV8 B;  2H36 X;  1O0W A;  2EM3 A;  4RHB B;  2VRD A;  4LU9 A;  4X65 E;  1GQE A;  2MC5 A;  2EOH A;  2YZT A;  4ZYD A;  4X9J A;  4LF8 E;  4O5G A;  2HGH A;  2DSY A;  2L3J A;  1MEY C;  3RMP A;  3T1Y E;  2YRH A;  4BC7 A;  4DV1 E;  2EPK X;  4WFT A;  2JOB A;  2M1S A;  3JTZ A;  5A6J A;  4WX9 A;  2V85 A;  1A1L A;  4B3T E;  1WHN A;  1WRJ A;  2ELY A;  2NUG A;  4O43 A;  4GKJ E;  3EQ1 A;  4KZS A;  4BC9 A;  2L8T A;  2YTE A;  3K6Q A;  4DV0 E;  2EMY A;  3LLH A;  2DLK A;  4OX9 E;  2D9H A;  3H09 A;  2HHH E;  2EOQ A;  2LO3 A;  2EMH A;  2G7H A;  3IWB A;  5CFF E;  2WBS A;  2KHX A;  3J80 C;  3AV0 A;  1JK2 A;  2DMI A;  2EL5 A;  2M4I A;  1TF6 A;  1N32 E;  2EOE A;  2YU5 A;  2JVA A;  1RMD A;  1FKA E;  1IQO A;  4WPY A;  2LE2 A;  2LCE A;  4LF4 E;  4X62 E;  4LF5 E;  4NXN E;  4DR7 E;  3F6G A;  3QG5 C;  4NHR A;  5IT9 C;  4F9A B;  2DMY A;  2JYA A;  3ZOQ B;  3MHS C;  1JK1 A;  2WCC 3;  1N3G A;  1X6F A;  2B9D A;  4JI7 E;  3VK6 A;  2JXP A;  2EM9 A;  2CSH A;  5KL2 A;  3BGH A;  2F8B A;  2ZM6 E;  1PJQ A;  2GPI A;  5A69 A;  4OOG C;  2EM7 A;  5A6A A;  1RC7 A;  4JYA E;  2EMG A;  1N33 E;  1YYW A;  4DV5 E;  2ODR C;  5ADZ A;  2YT4 A;  3C6K A;  2JP9 A;  3KZY A;  2JY9 A;  2UUC E;  2UUA E;  4B3R E;  5KL5 A;  4IJD A;  4R2S A;  4LF7 E;  2YPN A;  4DV3 E;  4TUI A;  1DGC A;  4WYQ B;  2E72 A;  2MKD A;  2DIX A;  2FV4 B;  4DKK A;  3JU0 A;  2J7J A;  4P7D A;  2JWO A;  1YFH A;  4LFC E;  4R2Q A;  1YYK A;  4HEI A;  4JI2 E;  1IBM E;  4GKK E;  3VHT B;  2YTN A;  1I94 E;  2EL4 A;  2MKN A;  1XMQ E;  2M7Q A;  1P47 A;  2KON A;  1PKP A;  2ADR A;  2EM5 A;  2K4V A;  2YWQ A;  2YTQ A;  4M30 A;  2UU9 E;  1PJT A;  4ZYH A;  3KZZ A;  4KHP E;  4BBY A;  2EMZ A;  1UBD C;  3DF6 A;  4JI8 E;  2ELZ A;  4DUY E;  3EPH A;  1G2D C;  4DMI A;  2EN6 A;  2EPC A;  2MDR A;  3BBG A;  2L92 A;  4F6M A;  2E5L E;  2VQF E;  1IBL E;  2NA2 A;  2YRK A;  4KWY A;  4JI0 E;  4AQY E;  1XMO E;  1N36 E;  2EML A;  2EOS A;  3IWD A;  1QU6 A;  2EN8 A;  4JI5 E;  5A6K A;  3ADL A;  3HQ1 A;  2L2M A;  2EOY A;  4DV4 E;  3HPS A;  2YTP A;  2EPP A;  2EM8 A;  2LJH A;  2EMC A;  2EM6 A;  2PRT A;  5LMU E;  1BBO A;  2EM4 A;  4F2J C;  1HNW E;  2EN3 A;  1A1G A;  4N4R B;  2EE8 A;  2WZO A;  1AAY A;  2UXC E;  2EOO A;  4HTG A;  5F3W A;  1YYO A;  4Q35 B;  4WSG A;  2V8Q B;  2N8X A;  4F9C B;  4JI1 E;  2CPN A;  5TSE A;  4DR2 E;  1MGT A;  3F6H A;  4WXC A;  4DR4 E;  2EOF A;  3ADG A;  4BS9 A;  3ADI A;  2DGC A;  1A1H A;  2A25 A;  1ZU1 A;  3UK3 C;  4BMJ A;  2EP3 A;  2EQ0 A;  2L6M A;  2V89 A;  4R2A A;  2MC6 A;  1X6H A;  2BB8 A;  2R1F A;  5KL6 A;  1UN6 B;  3C4B A;  2EOM A;  4I8O A;  2EMW A;  5BR8 E;  3C6M A;  4R2D A;  1PDA A;  2YU8 A;  1FJG E;  3ECR A;  4P78 A;  2EPR A;  1SFE A;  4LFA E;  2YTD A;  1NCS A;  1DI2 A;  4L5N C;  2EPL X;  2VQE E;  4M0V A;  4LF6 E;  5LMN E;  4DV7 E;  1IQS A;  1TN9 A;  2NUF A;  5A6B A;  1AH5 A;  2YTI A;  1T39 A;  1X5W A;  4NXM E;  2UUB E;  4DV6 E;  2L2K B;  4ZYG A;  1HNX E;  2YSO A;  4B3M E;  3FIG A;  3HXL A;  2UXB E;  2BBG A;  4JI6 E;  4M2Z A;  2EOJ A;  2EMF A;  1GZ6 A;  2E1M A;  2K7I A;  4R8O A;  2L3C A;  2EOR A;  1DQ3 A;  4K0K E; 
#chains in the Genus database with same CATH homology
 2EMZ A;  2RSI A;  4IS1 C;  1A1J A;  1UBD C;  1ZAA C;  2ELY A;  4GZN C;  2YTG A;  2ELZ A;  3EPH A;  1G2D C;  2EL6 A;  1YUI A;  2YTE A;  1A1K A;  2EN6 A;  2EPC A;  2EMK A;  2EMY A;  2YSP A;  2DLK A;  2D9H A;  1A1I A;  4F6M A;  2EOQ A;  2LO3 A;  2EMH A;  2YRK A;  2WBS A;  1JK2 A;  2EN4 A;  2DMI A;  2EL5 A;  2EML A;  2EOS A;  1TF6 A;  4M9V C;  2EOE A;  2EQ1 A;  2EPX A;  1RMD A;  2EN8 A;  2YU5 A;  2EN7 A;  2EM0 A;  4R2P A;  2CT1 A;  2YTJ A;  2YTO A;  2EOZ A;  2EMI A;  2LCE A;  1X3C A;  2EOY A;  2ENA A;  2YTP A;  2EPP A;  2EN2 A;  2EM8 A;  2EMC A;  2EM6 A;  2DLQ A;  2PRT A;  4F6N A;  1BBO A;  2EM4 A;  4F2J C;  2EPZ A;  2EN3 A;  1A1G A;  2GHF A;  3M99 B;  2EE8 A;  2RPC A;  1AAY A;  3MHS C;  1JK1 A;  1F2I G;  2EOO A;  2DRP A;  2WCC 3;  1Z1B A;  1X6F A;  4WSG A;  5KL4 A;  4R2C A;  4R2E A;  2ENC A;  1A1F A;  2EM9 A;  2CSH A;  2MDG A;  5KL2 A;  2YRM A;  2YTF A;  1X6E A;  1YSA C;  2I13 A;  2JPA A;  2EOF A;  1ZR9 A;  2EM7 A;  4R2R A;  3EPK A;  2LT7 A;  2LVH A;  1YUJ A;  1BB8 A;  1KJK A;  2EMG A;  2DGC A;  1A1H A;  2A25 A;  2EOI A;  2GLI A;  2EPA A;  2ENH A;  2WBT A;  2EPU A;  1ZU1 A;  1WJP A;  2EN1 A;  2LV2 A;  3UK3 C;  2JP9 A;  1B69 A;  2EOX A;  2EP3 A;  2EQ0 A;  5KL5 A;  4R2A A;  4IJD A;  2M9A A;  1X6H A;  2BB8 A;  4R2S A;  2R1F A;  3EPL A;  1G2F C;  5KL6 A;  2EM2 A;  1TF3 A;  1UN6 B;  1DGC A;  2EOM A;  2EMW A;  4R2D A;  5KL3 A;  2YU8 A;  2E72 A;  2MKD A;  2EJ4 A;  2EMA A;  2EPR A;  3EPJ A;  1LLM C;  2NAB A;  1NCS A;  2YTD A;  2WBU A;  2J7J A;  2EM3 A;  2EMB A;  2VRD A;  2CTD A;  2EOH A;  4R2Q A;  1TN9 A;  4X9J A;  3MHH C;  2EQ3 A;  2YTI A;  1X5W A;  2HGH A;  3VHT B;  2YTN A;  2MKN A;  2EL4 A;  2YSO A;  4FK5 C;  1P47 A;  1MEY C;  2ADR A;  2EM5 A;  2EOJ A;  2YTQ A;  2EMF A;  2YRH A;  5KL7 A;  2EMX A;  2EOR A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...