2EN7A

Solution structure of the c2h2 type zinc finger (region 495-525) of human zinc finger protein 268
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 495-525) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en7A01
1ZU1A 5KL3A 3EPJA 2EMGA 2ADRA 2EPZA 2EOEA 1UN6B 2EOSA 2EPCA 1ZAAC 4FK5C 2J7JA 4F6NA 1X6FA 2ENAA 2EN8A 2HGHA 2CT1A 2R1FA 2DRPA 1MEYC 1ZR9A 2GHFA 2YTGA 4F6MA 2EM9A 1A1KA 2YRKA 2RPCA 1A1IA 2ELYA 2MDGA 4GZNC 2YSPA 4M9VC 2PRTA 2EOHA 5KL7A 1BBOA 2EN1A 1X3CA 3EPKA 1TF6A 2DLQA 1A1JA 1G2FC 2EMAA 2EM5A 2EPAA 4R2AA 2JP9A 4R2EA 2DLKA 4R2PA 2EN3A 2EOZA 2YTEA 1A1LA 2EM7A 2EMCA 2JPAA 2LV2A 2EM2A 2EOFA 2WBTA 1F2IG 3M99B 3EPLA 3VHTB 2EMWA 2EPPA 1A1HA 1AAYA 5KL4A 2EM8A 5KL6A 2EM0A 2EN7A 2EORA 2EQ0A 2CTDA 2EPXA 3MHHC 2YU5A 1RMDA 1KJKA 2EM6A 2EN6A 1G2DC 4IJDA 2EE8A 2EOIA 2EPUA 4R2RA 2EN4A 3UK3C 2I13A 2EL5A 2WBSA 1WJPA 2EMXA 2EOMA 2YTNA 1JK2A 2EPRA 2LVHA 4X9JA 2EMZA 4WSGA 1TF3A 1UBDC 2ENHA 2EQ3A 1Z1BA 1P47A 1DGCA 2VRDA 1YSAC 2EL6A 2EJ4A 2LCEA 2YTOA 2EMLA 4R2CA 1X6HA 4F2JC 2EMFA 1X5WA 2WBUA 2YTDA 2EQ1A 2DMIA 2RSIA 1TN9A 1A1FA 3EPHA 2D9HA 2LO3A 2YTJA 2YTFA 2YU8A 2YSOA 2MKNA 2EN2A 2YTIA 1JK1A 1YUIA 2EL4A 3MHSC 1BB8A 1YUJA 2EOQA 2NABA 2MKDA 2EMYA 5KL2A 2M9AA 2YTQA 1NCSA 2YRHA 2GLIA 2ELZA 2EMKA 2CSHA 2DGCA 1LLMC 2ENCA 1A1GA 2EP3A 2A25A 2E72A 2YRMA 5KL5A 2EMHA 2EOXA 2EOYA 2EMIA 2EM3A 4R2DA 2EOJA 2BB8A 4IS1C 2WCC3 4R2SA 2EMBA 2EOOA 4R2QA 2EM4A 2LT7A 1X6EA 2YTPA 1B69A
chains in the Genus database with same CATH superfamily
3THOB 5A69A 3C4BA 1HNXE 3EPJA 2EPZA 1YYKA 3ADGA 2JVAA 4MLQA 1IMUA 2EOSA 2L8TA 1QU6A 1ZAAC 4L5NC 4F6NA 1DQ3A 4DR5E 4F6MA 1STUA 2UXCE 3ZOQB 2RPCA 2MDGA 2YSPA 1UILA 1BBOA 2PRTA 4DV5E 2EN1A 2LMZA 1TF6A 4LF5E 2DLQA 2EPAA 5AASA 2LRSA 2DLKA 1A1LA 2EN3A 2JOXA 3BF2A 3HTXA 2WBTA 3M99B 3ADJA 1XMOE 4BBYA 3VHTB 2EMWA 4B3RE 2EM8A 3K6QA 3L00A 2EQ0A 5A6AA 2CTDA 2YU5A 3P1XA 4DR2E 1KJKA 2L33A 2EE8A 2EOIA 1HR0E 4RH8A 1AH5A 2EOMA 5AE3A 2LUQA 2YT4A 1JK2A 4WFTA 2B7TA 2V86A 1FKAE 2E1MA 4WSGA 1TF3A 1NEIA 3JU0A 1Z1BA 2NUFA 3BIDA 1YSAC 3F6HA 2EL6A 4Q28A 4DMIA 2FGGA 2UUBE 3VYXA 3THNA 4BC7A 1X6HA 4BC9A 1MGTA 1YZ9A 3HQ1A 4DV2E 4NXNE 4DV6E 2V8QB 1PDAA 1IQSA 2CPNA 4WSPA 5IXMB 2YTFA 2YU8A 4X66E 1IBME 2EN2A 2V88A 1KYQA 3QG5C 1JK1A 5AC4A 1O0WA 3BGHA 1T38A 2EOQA 2NABA 3KWRA 4BCAA 3JAMC 2Q8UA 2K7IA 2YTQA 2ELZA 2EMKA 2E5LE 2EPMX 2V83A 2VQFE 1LLMC 4DKKA 2HHHE 2EP3A 5F3WA 3H09A 1J26A 2EMHA 2FV4B 2EOYA 1PKPA 4TUIA 2EM3A 2EOJA 4R2SA 2EOOA 3VK6A 4LFCE 3T1YE 4R2QA 2WZOA 4WYQB 2L6MA 2JY9A 4LF8E 2EMGA 2EPKX 1WHNA 1N33E 1YPNA 2KHXA 2IHR1 2DMYA 2CT1A 2R1FA 1WHQA 1MEYC 2GHFA 2I9IA 2NA2A 2EM9A 3AUZA 2YRKA 4JI4E 4NXME 1PJSA 4GZNC 2RSMA 5AC5A 4M9VC 2EOHA 2LJUA 3FIGA 4DR3E 2EMAA 4O24A 5ADZA 5A6BA 4WXDA 4DR6E 2LTRA 2EMCA 3C6MA 1N36E 4GKJE 4LF4E 2EOFA 4M30A 3EPLA 2M7QA 2EPPA 1A1HA 5KL6A 2EM0A 1L4SA 3MHHC 1RMDA 2EM6A 3RMPA 5IV8B 1G2DC 2EPUA 2EZ6A 4JV5E 2EMXA 4DV3E 2L2NA 2YTNA 3AV0A 4X9JA 1EH6A 2EPLX 2UXBE 1YFHA 2EMZA 4LU9A 5LMUE 3MSWA 1UBDC 2V85A 1X49A 5TSEA 5LL6R 2HJJA 4B3TE 3J7AG 2EJ4A 4X8WA 1I94E 3DJWA 4R2CA 2L2KB 4F2JC 1X5WA 3F6GA 2EQ1A 2RSIA 1A1FA 3EPHA 4P7DA 2LO3A 2YZTA 2UU9E 2YSOA 1RQ0A 4OOGC 4F9AB 1YUIA 1YUJA 2ZM6E 2ODRD 4JI5E 2LTSA 5A6JA 3KZYA 2GLIA 4JI3E 3IWBA 1GQEA 3C6KA 4LF9E 1WXRA 2RQLA 5A6BD 3ADIA 2EOXA 4R2DA 4HEIA 2BB8A 1T39A 1HNZE 2EMBA 3JTZA 2EM4A 2RS6A 2JWOA 2EWLA 4RHBB 1B69A 1ZU1A 5AE1A 4X65E 2L3JA 4KHPE 4LFAE 2EOEA 2LUPB 4FK5C 1PJTA 2J7JA 1X6FA 2DRPA 4J8ZA 5FLXC 2N8XA 1A1KA 1A1IA 2JR1A 2EPNA 2G7HA 5KL7A 1X3CA 3EPKA 1A1JA 1G2FC 2EM5A 4F9CB 4R2PA 2EOZA 2YTEA 4LF6E 2EM7A 2L2MA 1IBLE 2JPAA 2N3GA 2EM2A 2KONA 4O5GA 3VYYA 4MLVA 4P78A 1GZ6A 4YY3E 5KL4A 4NZVA 2EN7A 2EORA 2VE7C 2MC5A 1UHZA 3HXLA 4YHHE 2GPIA 2LBSB 2YWQA 2EN6A 4X62E 2M4IA 3KZZA 2UXDE 2EN4A 2M1SA 4F9BB 2EL5A 2WBSA 1WJPA 4DUYE 2JXPA 4ZYGA 2EPRA 2LVHA 2EPOA 2LJHA 5T6JA 2ENHA 2MC6A 1P47A 4JI7E 1DGCA 2UUCE 2VRDA 4O43A 3J81C 1IQOA 3ADLA 2YTOA 2EMLA 4BMJA 4OX9E 2EMFA 1ZBTA 4HTGA 2YTDA 3J80C 1TN9A 1QNTA 3HPSA 4JI6E 4DR7E 2YTIA 1N34E 4NHRA 4JI2E 2EL4A 5BR8E 1X48A 4TUGA 4DV0E 4R8OA 5KL2A 3BBGA 1NCSA 1DI2A 2BBGA 2CSHA 2DGCA 4M2ZA 2R76A 2ENCA 2VF1A 1T4OA 1A1GA 2F8BA 2LE2A 5KL5A 1PJQA 5IWAE 1J5EE 1YYOA 1N3GA 1WRJA 4DV4E 4N4RB 4AQYE 2DIXA 5A2QC 2LT7A 2JOBA 4I8OA 5KL3A 3T1HE 2ADRA 1UN6B 1YYWA 4KWYA 4BHBA 2EPCA 4L8NA 4F54A 4KZSA 1EH8A 3J7Yp 2ENAA 2EN8A 2HGHA 2JYAA 2RS7A 4GEQB 2H36X 1ZR9A 2YTGA 3HPZA 4ZYEA 2L3CA 2MDRA 1XNRE 2ELYA 3LMLA 2B7VA 4ZYDA 2V89A 4R2AA 4LFBE 2JP9A 4R2EA 3OTOE 2LV2A 4K0KE 5DNYA 1F2IG 1IBKE 4WPYA 2K4VA 4ZYHA 4JI0E 2F4VE 1RC7A 1AAYA 4JYAE 3IWCA 1BBGA 4BS9A 2EPXA 3TQMA 4JI8E 4B3ME 2N3HA 5LLQA 4DUZE 5IT9C 4IJDA 4R2RA 2VQEE 3UK3C 3IWDA 2I13A 2UUAE 4Q35B 1FJGE 5CFFE 3ECRA 2EQ3A 1T4LB 1T4NA 1X47A 3DF6A 2LCEA 4DV1E 4R03A 4GKKE 2WBUA 4B3SE 2DMIA 2B3TB 2DSYA 1GTKA 2DB2A 3EQ1A 2D9HA 4DR1E 2YTJA 4WX9A 2MKNA 4LTYA 4LF7E 5AE2A 2NUGA 1XNQE 2V87A 3MHSC 1BB8A 2MKDA 2EMYA 4WXCA 2M9AA 2YPNA 2RTXA 4X64E 2KOUA 1EKZA 2YRHA 4JI1E 1N32E 4DR4E 1SFEA 2FTXB 4O4KA 4BHCA 1XMQE 1ZBQA 2HC5A 2A25A 2E72A 2YRMA 4M0VA 3OMLA 2EMIA 2NUEA 1EH7A 2L92A 5LMNE 2B9DA 1SR9A 3LLHA 2WCC3 4IS1C 1HNWE 2ODRC 3C4TA 5A6KA 4DV7E 1X6EA 2YTPA
chains in the Genus database with same CATH topology
1ZU1A 5KL3A 3EPJA 2EMGA 2ADRA 2EPZA 2EOEA 1UN6B 2EOSA 2EPCA 1ZAAC 4FK5C 2J7JA 4F6NA 1X6FA 2ENAA 2EN8A 2HGHA 2CT1A 2R1FA 2DRPA 1MEYC 1ZR9A 2GHFA 2YTGA 4F6MA 2EM9A 1A1KA 2YRKA 2RPCA 1A1IA 2ELYA 2MDGA 4GZNC 2YSPA 4M9VC 2PRTA 2EOHA 5KL7A 1BBOA 2EN1A 1X3CA 3EPKA 1TF6A 2DLQA 1A1JA 1G2FC 2EMAA 2EM5A 2EPAA 4R2AA 2JP9A 4R2EA 2DLKA 4R2PA 2EN3A 2EOZA 2YTEA 1A1LA 2EM7A 2EMCA 2JPAA 2LV2A 2EM2A 2EOFA 2WBTA 1F2IG 3M99B 3EPLA 3VHTB 2EMWA 2EPPA 1A1HA 1AAYA 5KL4A 2EM8A 5KL6A 2EM0A 2EN7A 2EORA 2EQ0A 2CTDA 2EPXA 3MHHC 2YU5A 1RMDA 1KJKA 2EM6A 2EN6A 1G2DC 4IJDA 2EE8A 2EOIA 2EPUA 4R2RA 2EN4A 3UK3C 2I13A 2EL5A 2WBSA 1WJPA 2EMXA 2EOMA 2YTNA 1JK2A 2EPRA 2LVHA 4X9JA 2EMZA 4WSGA 1TF3A 1UBDC 2ENHA 2EQ3A 1Z1BA 1P47A 1DGCA 2VRDA 1YSAC 2EL6A 2EJ4A 2LCEA 2YTOA 2EMLA 4R2CA 1X6HA 4F2JC 2EMFA 1X5WA 2WBUA 2YTDA 2EQ1A 2DMIA 2RSIA 1TN9A 1A1FA 3EPHA 2D9HA 2LO3A 2YTJA 2YTFA 2YU8A 2YSOA 2MKNA 2EN2A 2YTIA 1JK1A 1YUIA 2EL4A 3MHSC 1BB8A 1YUJA 2EOQA 2NABA 2MKDA 2EMYA 5KL2A 2M9AA 2YTQA 1NCSA 2YRHA 2GLIA 2ELZA 2EMKA 2CSHA 2DGCA 1LLMC 2ENCA 1A1GA 2EP3A 2A25A 2E72A 2YRMA 5KL5A 2EMHA 2EOXA 2EOYA 2EMIA 2EM3A 4R2DA 2EOJA 2BB8A 4IS1C 2WCC3 4R2SA 2EMBA 2EOOA 4R2QA 2EM4A 2LT7A 1X6EA 2YTPA 1B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  5KL3 A;  3EPJ A;  2EMG A;  2ADR A;  2EPZ A;  2EOE A;  1UN6 B;  2EOS A;  2EPC A;  1ZAA C;  4FK5 C;  2J7J A;  4F6N A;  1X6F A;  2ENA A;  2EN8 A;  2HGH A;  2CT1 A;  2R1F A;  2DRP A;  1MEY C;  1ZR9 A;  2GHF A;  2YTG A;  4F6M A;  2EM9 A;  1A1K A;  2YRK A;  2RPC A;  1A1I A;  2ELY A;  2MDG A;  4GZN C;  2YSP A;  4M9V C;  2PRT A;  2EOH A;  5KL7 A;  1BBO A;  2EN1 A;  1X3C A;  3EPK A;  1TF6 A;  2DLQ A;  1A1J A;  1G2F C;  2EMA A;  2EM5 A;  2EPA A;  4R2A A;  2JP9 A;  4R2E A;  2DLK A;  4R2P A;  2EN3 A;  2EOZ A;  2YTE A;  1A1L A;  2EM7 A;  2EMC A;  2JPA A;  2LV2 A;  2EM2 A;  2EOF A;  2WBT A;  1F2I G;  3M99 B;  3EPL A;  3VHT B;  2EMW A;  2EPP A;  1A1H A;  1AAY A;  5KL4 A;  2EM8 A;  5KL6 A;  2EM0 A;  2EN7 A;  2EOR A;  2EQ0 A;  2CTD A;  2EPX A;  3MHH C;  2YU5 A;  1RMD A;  1KJK A;  2EM6 A;  2EN6 A;  1G2D C;  4IJD A;  2EE8 A;  2EOI A;  2EPU A;  4R2R A;  2EN4 A;  3UK3 C;  2I13 A;  2EL5 A;  2WBS A;  1WJP A;  2EMX A;  2EOM A;  2YTN A;  1JK2 A;  2EPR A;  2LVH A;  4X9J A;  2EMZ A;  4WSG A;  1TF3 A;  1UBD C;  2ENH A;  2EQ3 A;  1Z1B A;  1P47 A;  1DGC A;  2VRD A;  1YSA C;  2EL6 A;  2EJ4 A;  2LCE A;  2YTO A;  2EML A;  4R2C A;  1X6H A;  4F2J C;  2EMF A;  1X5W A;  2WBU A;  2YTD A;  2EQ1 A;  2DMI A;  2RSI A;  1TN9 A;  1A1F A;  3EPH A;  2D9H A;  2LO3 A;  2YTJ A;  2YTF A;  2YU8 A;  2YSO A;  2MKN A;  2EN2 A;  2YTI A;  1JK1 A;  1YUI A;  2EL4 A;  3MHS C;  1BB8 A;  1YUJ A;  2EOQ A;  2NAB A;  2MKD A;  2EMY A;  5KL2 A;  2M9A A;  2YTQ A;  1NCS A;  2YRH A;  2GLI A;  2ELZ A;  2EMK A;  2CSH A;  2DGC A;  1LLM C;  2ENC A;  1A1G A;  2EP3 A;  2A25 A;  2E72 A;  2YRM A;  5KL5 A;  2EMH A;  2EOX A;  2EOY A;  2EMI A;  2EM3 A;  4R2D A;  2EOJ A;  2BB8 A;  4IS1 C;  2WCC 3;  4R2S A;  2EMB A;  2EOO A;  4R2Q A;  2EM4 A;  2LT7 A;  1X6E A;  2YTP A;  1B69 A; 
#chains in the Genus database with same CATH topology
 3THO B;  5A69 A;  3C4B A;  1HNX E;  3EPJ A;  2EPZ A;  1YYK A;  3ADG A;  2JVA A;  4MLQ A;  1IMU A;  2EOS A;  2L8T A;  1QU6 A;  1ZAA C;  4L5N C;  4F6N A;  1DQ3 A;  4DR5 E;  4F6M A;  1STU A;  2UXC E;  3ZOQ B;  2RPC A;  2MDG A;  2YSP A;  1UIL A;  1BBO A;  2PRT A;  4DV5 E;  2EN1 A;  2LMZ A;  1TF6 A;  4LF5 E;  2DLQ A;  2EPA A;  5AAS A;  2LRS A;  2DLK A;  1A1L A;  2EN3 A;  2JOX A;  3BF2 A;  3HTX A;  2WBT A;  3M99 B;  3ADJ A;  1XMO E;  4BBY A;  3VHT B;  2EMW A;  4B3R E;  2EM8 A;  3K6Q A;  3L00 A;  2EQ0 A;  5A6A A;  2CTD A;  2YU5 A;  3P1X A;  4DR2 E;  1KJK A;  2L33 A;  2EE8 A;  2EOI A;  1HR0 E;  4RH8 A;  1AH5 A;  2EOM A;  5AE3 A;  2LUQ A;  2YT4 A;  1JK2 A;  4WFT A;  2B7T A;  2V86 A;  1FKA E;  2E1M A;  4WSG A;  1TF3 A;  1NEI A;  3JU0 A;  1Z1B A;  2NUF A;  3BID A;  1YSA C;  3F6H A;  2EL6 A;  4Q28 A;  4DMI A;  2FGG A;  2UUB E;  3VYX A;  3THN A;  4BC7 A;  1X6H A;  4BC9 A;  1MGT A;  1YZ9 A;  3HQ1 A;  4DV2 E;  4NXN E;  4DV6 E;  2V8Q B;  1PDA A;  1IQS A;  2CPN A;  4WSP A;  5IXM B;  2YTF A;  2YU8 A;  4X66 E;  1IBM E;  2EN2 A;  2V88 A;  1KYQ A;  3QG5 C;  1JK1 A;  5AC4 A;  1O0W A;  3BGH A;  1T38 A;  2EOQ A;  2NAB A;  3KWR A;  4BCA A;  3JAM C;  2Q8U A;  2K7I A;  2YTQ A;  2ELZ A;  2EMK A;  2E5L E;  2EPM X;  2V83 A;  2VQF E;  1LLM C;  4DKK A;  2HHH E;  2EP3 A;  5F3W A;  3H09 A;  1J26 A;  2EMH A;  2FV4 B;  2EOY A;  1PKP A;  4TUI A;  2EM3 A;  2EOJ A;  4R2S A;  2EOO A;  3VK6 A;  4LFC E;  3T1Y E;  4R2Q A;  2WZO A;  4WYQ B;  2L6M A;  2JY9 A;  4LF8 E;  2EMG A;  2EPK X;  1WHN A;  1N33 E;  1YPN A;  2KHX A;  2IHR 1;  2DMY A;  2CT1 A;  2R1F A;  1WHQ A;  1MEY C;  2GHF A;  2I9I A;  2NA2 A;  2EM9 A;  3AUZ A;  2YRK A;  4JI4 E;  4NXM E;  1PJS A;  4GZN C;  2RSM A;  5AC5 A;  4M9V C;  2EOH A;  2LJU A;  3FIG A;  4DR3 E;  2EMA A;  4O24 A;  5ADZ A;  5A6B A;  4WXD A;  4DR6 E;  2LTR A;  2EMC A;  3C6M A;  1N36 E;  4GKJ E;  4LF4 E;  2EOF A;  4M30 A;  3EPL A;  2M7Q A;  2EPP A;  1A1H A;  5KL6 A;  2EM0 A;  1L4S A;  3MHH C;  1RMD A;  2EM6 A;  3RMP A;  5IV8 B;  1G2D C;  2EPU A;  2EZ6 A;  4JV5 E;  2EMX A;  4DV3 E;  2L2N A;  2YTN A;  3AV0 A;  4X9J A;  1EH6 A;  2EPL X;  2UXB E;  1YFH A;  2EMZ A;  4LU9 A;  5LMU E;  3MSW A;  1UBD C;  2V85 A;  1X49 A;  5TSE A;  5LL6 R;  2HJJ A;  4B3T E;  3J7A G;  2EJ4 A;  4X8W A;  1I94 E;  3DJW A;  4R2C A;  2L2K B;  4F2J C;  1X5W A;  3F6G A;  2EQ1 A;  2RSI A;  1A1F A;  3EPH A;  4P7D A;  2LO3 A;  2YZT A;  2UU9 E;  2YSO A;  1RQ0 A;  4OOG C;  4F9A B;  1YUI A;  1YUJ A;  2ZM6 E;  2ODR D;  4JI5 E;  2LTS A;  5A6J A;  3KZY A;  2GLI A;  4JI3 E;  3IWB A;  1GQE A;  3C6K A;  4LF9 E;  1WXR A;  2RQL A;  5A6B D;  3ADI A;  2EOX A;  4R2D A;  4HEI A;  2BB8 A;  1T39 A;  1HNZ E;  2EMB A;  3JTZ A;  2EM4 A;  2RS6 A;  2JWO A;  2EWL A;  4RHB B;  1B69 A;  1ZU1 A;  5AE1 A;  4X65 E;  2L3J A;  4KHP E;  4LFA E;  2EOE A;  2LUP B;  4FK5 C;  1PJT A;  2J7J A;  1X6F A;  2DRP A;  4J8Z A;  5FLX C;  2N8X A;  1A1K A;  1A1I A;  2JR1 A;  2EPN A;  2G7H A;  5KL7 A;  1X3C A;  3EPK A;  1A1J A;  1G2F C;  2EM5 A;  4F9C B;  4R2P A;  2EOZ A;  2YTE A;  4LF6 E;  2EM7 A;  2L2M A;  1IBL E;  2JPA A;  2N3G A;  2EM2 A;  2KON A;  4O5G A;  3VYY A;  4MLV A;  4P78 A;  1GZ6 A;  4YY3 E;  5KL4 A;  4NZV A;  2EN7 A;  2EOR A;  2VE7 C;  2MC5 A;  1UHZ A;  3HXL A;  4YHH E;  2GPI A;  2LBS B;  2YWQ A;  2EN6 A;  4X62 E;  2M4I A;  3KZZ A;  2UXD E;  2EN4 A;  2M1S A;  4F9B B;  2EL5 A;  2WBS A;  1WJP A;  4DUY E;  2JXP A;  4ZYG A;  2EPR A;  2LVH A;  2EPO A;  2LJH A;  5T6J A;  2ENH A;  2MC6 A;  1P47 A;  4JI7 E;  1DGC A;  2UUC E;  2VRD A;  4O43 A;  3J81 C;  1IQO A;  3ADL A;  2YTO A;  2EML A;  4BMJ A;  4OX9 E;  2EMF A;  1ZBT A;  4HTG A;  2YTD A;  3J80 C;  1TN9 A;  1QNT A;  3HPS A;  4JI6 E;  4DR7 E;  2YTI A;  1N34 E;  4NHR A;  4JI2 E;  2EL4 A;  5BR8 E;  1X48 A;  4TUG A;  4DV0 E;  4R8O A;  5KL2 A;  3BBG A;  1NCS A;  1DI2 A;  2BBG A;  2CSH A;  2DGC A;  4M2Z A;  2R76 A;  2ENC A;  2VF1 A;  1T4O A;  1A1G A;  2F8B A;  2LE2 A;  5KL5 A;  1PJQ A;  5IWA E;  1J5E E;  1YYO A;  1N3G A;  1WRJ A;  4DV4 E;  4N4R B;  4AQY E;  2DIX A;  5A2Q C;  2LT7 A;  2JOB A;  4I8O A;  5KL3 A;  3T1H E;  2ADR A;  1UN6 B;  1YYW A;  4KWY A;  4BHB A;  2EPC A;  4L8N A;  4F54 A;  4KZS A;  1EH8 A;  3J7Y p;  2ENA A;  2EN8 A;  2HGH A;  2JYA A;  2RS7 A;  4GEQ B;  2H36 X;  1ZR9 A;  2YTG A;  3HPZ A;  4ZYE A;  2L3C A;  2MDR A;  1XNR E;  2ELY A;  3LML A;  2B7V A;  4ZYD A;  2V89 A;  4R2A A;  4LFB E;  2JP9 A;  4R2E A;  3OTO E;  2LV2 A;  4K0K E;  5DNY A;  1F2I G;  1IBK E;  4WPY A;  2K4V A;  4ZYH A;  4JI0 E;  2F4V E;  1RC7 A;  1AAY A;  4JYA E;  3IWC A;  1BBG A;  4BS9 A;  2EPX A;  3TQM A;  4JI8 E;  4B3M E;  2N3H A;  5LLQ A;  4DUZ E;  5IT9 C;  4IJD A;  4R2R A;  2VQE E;  3UK3 C;  3IWD A;  2I13 A;  2UUA E;  4Q35 B;  1FJG E;  5CFF E;  3ECR A;  2EQ3 A;  1T4L B;  1T4N A;  1X47 A;  3DF6 A;  2LCE A;  4DV1 E;  4R03 A;  4GKK E;  2WBU A;  4B3S E;  2DMI A;  2B3T B;  2DSY A;  1GTK A;  2DB2 A;  3EQ1 A;  2D9H A;  4DR1 E;  2YTJ A;  4WX9 A;  2MKN A;  4LTY A;  4LF7 E;  5AE2 A;  2NUG A;  1XNQ E;  2V87 A;  3MHS C;  1BB8 A;  2MKD A;  2EMY A;  4WXC A;  2M9A A;  2YPN A;  2RTX A;  4X64 E;  2KOU A;  1EKZ A;  2YRH A;  4JI1 E;  1N32 E;  4DR4 E;  1SFE A;  2FTX B;  4O4K A;  4BHC A;  1XMQ E;  1ZBQ A;  2HC5 A;  2A25 A;  2E72 A;  2YRM A;  4M0V A;  3OML A;  2EMI A;  2NUE A;  1EH7 A;  2L92 A;  5LMN E;  2B9D A;  1SR9 A;  3LLH A;  2WCC 3;  4IS1 C;  1HNW E;  2ODR C;  3C4T A;  5A6K A;  4DV7 E;  1X6E A;  2YTP A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  5KL3 A;  3EPJ A;  2EMG A;  2ADR A;  2EPZ A;  2EOE A;  1UN6 B;  2EOS A;  2EPC A;  1ZAA C;  4FK5 C;  2J7J A;  4F6N A;  1X6F A;  2ENA A;  2EN8 A;  2HGH A;  2CT1 A;  2R1F A;  2DRP A;  1MEY C;  1ZR9 A;  2GHF A;  2YTG A;  4F6M A;  2EM9 A;  1A1K A;  2YRK A;  2RPC A;  1A1I A;  2ELY A;  2MDG A;  4GZN C;  2YSP A;  4M9V C;  2PRT A;  2EOH A;  5KL7 A;  1BBO A;  2EN1 A;  1X3C A;  3EPK A;  1TF6 A;  2DLQ A;  1A1J A;  1G2F C;  2EMA A;  2EM5 A;  2EPA A;  4R2A A;  2JP9 A;  4R2E A;  2DLK A;  4R2P A;  2EN3 A;  2EOZ A;  2YTE A;  1A1L A;  2EM7 A;  2EMC A;  2JPA A;  2LV2 A;  2EM2 A;  2EOF A;  2WBT A;  1F2I G;  3M99 B;  3EPL A;  3VHT B;  2EMW A;  2EPP A;  1A1H A;  1AAY A;  5KL4 A;  2EM8 A;  5KL6 A;  2EM0 A;  2EN7 A;  2EOR A;  2EQ0 A;  2CTD A;  2EPX A;  3MHH C;  2YU5 A;  1RMD A;  1KJK A;  2EM6 A;  2EN6 A;  1G2D C;  4IJD A;  2EE8 A;  2EOI A;  2EPU A;  4R2R A;  2EN4 A;  3UK3 C;  2I13 A;  2EL5 A;  2WBS A;  1WJP A;  2EMX A;  2EOM A;  2YTN A;  1JK2 A;  2EPR A;  2LVH A;  4X9J A;  2EMZ A;  4WSG A;  1TF3 A;  1UBD C;  2ENH A;  2EQ3 A;  1Z1B A;  1P47 A;  1DGC A;  2VRD A;  1YSA C;  2EL6 A;  2EJ4 A;  2LCE A;  2YTO A;  2EML A;  4R2C A;  1X6H A;  4F2J C;  2EMF A;  1X5W A;  2WBU A;  2YTD A;  2EQ1 A;  2DMI A;  2RSI A;  1TN9 A;  1A1F A;  3EPH A;  2D9H A;  2LO3 A;  2YTJ A;  2YTF A;  2YU8 A;  2YSO A;  2MKN A;  2EN2 A;  2YTI A;  1JK1 A;  1YUI A;  2EL4 A;  3MHS C;  1BB8 A;  1YUJ A;  2EOQ A;  2NAB A;  2MKD A;  2EMY A;  5KL2 A;  2M9A A;  2YTQ A;  1NCS A;  2YRH A;  2GLI A;  2ELZ A;  2EMK A;  2CSH A;  2DGC A;  1LLM C;  2ENC A;  1A1G A;  2EP3 A;  2A25 A;  2E72 A;  2YRM A;  5KL5 A;  2EMH A;  2EOX A;  2EOY A;  2EMI A;  2EM3 A;  4R2D A;  2EOJ A;  2BB8 A;  4IS1 C;  2WCC 3;  4R2S A;  2EMB A;  2EOO A;  4R2Q A;  2EM4 A;  2LT7 A;  1X6E A;  2YTP A;  1B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...