2EN7A

Solution structure of the c2h2 type zinc finger (region 495-525) of human zinc finger protein 268
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 495-525) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en7A01
3UK3C 2EM2A 1ZR9A 4R2EA 2E72A 2YTGA 2EMLA 2EP3A 5KL3A 1X5WA 4R2DA 2WCC3 1NCSA 1YUIA 2EL6A 1JK1A 1WJPA 2DGCA 4GZNC 1X6HA 1ZU1A 2DRPA 2J7JA 2YSPA 2YTNA 1UN6B 2ADRA 2EM8A 2A25A 2EOMA 3VHTB 2HGHA 2EMBA 2LVHA 1Z1BA 5KL2A 2NABA 2PRTA 2EM4A 2YRKA 2LV2A 2YTEA 2EQ0A 1BBOA 1X6EA 2EM3A 3EPJA 2EPXA 2CSHA 1A1HA 2WBTA 2D9HA 2BB8A 2EMGA 2ELYA 2YSOA 1A1IA 2DLKA 2YU8A 2EMIA 2CTDA 2EOQA 4R2AA 2EOJA 3M99B 1KJKA 2EN4A 2EOHA 2RPCA 2LO3A 2YU5A 4R2SA 2MKNA 5KL6A 1X6FA 2WBUA 2EOIA 1AAYA 4M9VC 2EN6A 2EM9A 4F6NA 2DMIA 2EMKA 5KL5A 1A1FA 1ZAAC 1G2DC 4R2QA 1A1LA 2EMZA 2MKDA 2EN8A 2M9AA 2ENAA 2ENHA 1G2FC 2YTDA 4F6MA 4F2JC 1JK2A 2EMAA 2ENCA 2EQ1A 2EJ4A 2EOOA 3EPKA 2EM5A 1UBDC 2EL4A 3EPHA 1A1JA 4R2RA 2EMCA 3EPLA 5KL7A 4IJDA 4WSGA 2EMHA 1YSAC 2LCEA 5KL4A 2RSIA 3MHSC 2GLIA 1A1GA 2EMWA 2JP9A 2EOSA 2EPRA 1RMDA 1YUJA 2EMFA 1A1KA 2EPCA 2EN2A 2EOYA 2EM0A 2ELZA 4X9JA 2VRDA 2EOEA 4FK5C 2YRMA 1X3CA 2EN1A 1TN9A 2YTQA 2LT7A 2EOXA 2EM6A 2EMXA 2EM7A 2GHFA 2EPAA 2EOZA 2MDGA 2YTPA 4R2PA 2EOFA 1P47A 2EQ3A 2JPAA 2YTOA 2CT1A 4IS1C 1LLMC 2EPZA 2WBSA 2EN7A 2I13A 1DGCA 4R2CA 2EMYA 2YTIA 3MHHC 1B69A 2EL5A 1TF6A 2YRHA 2EPPA 1TF3A 2R1FA 1F2IG 2EORA 1BB8A 2YTFA 2DLQA 2EPUA 2YTJA 1MEYC 2EN3A 2EE8A
chains in the Genus database with same CATH superfamily
1FKAE 5LMNE 1XMQE 2JYAA 4LFBE 3ADLA 1GQEA 2E72A 2YTGA 2EMLA 2WCC3 1QNTA 2UUCE 5LMUE 4F9AB 1JK1A 1DI2A 4LF8E 1X6HA 1ZU1A 5IT9C 4JV5E 2B3TB 2JVAA 3VHTB 2HGHA 4MLQA 4LU9A 1IBKE 2LVHA 1Z1BA 5KL2A 5IWAE 2JY9A 2YTEA 5A6JA 3EPJA 2EPXA 2UXCE 4DV1E 2WBTA 1FJGE 2LUPB 2BB8A 2ELYA 1A1IA 4TUGA 1RC7A 4R2AA 4BMJA 1IMUA 4Q35B 4YY3E 1IBME 2NUEA 1X47A 1SFEA 2YU5A 3HQ1A 2EOIA 1AAYA 2B7VA 4WXDA 4DV0E 4LFCE 5KL5A 4P78A 1GZ6A 4DV6E 2N3GA 3J80C 2H36X 4LF7E 3C4BA 4LF4E 1HR0E 5A6BD 2EQ1A 2V85A 2EJ4A 4GKKE 2EM5A 2BBGA 3EPHA 4WXCA 4DR1E 5CFFE 4JI5E 2UXBE 2LTSA 2ODRD 4JI7E 2ZM6E 4IJDA 4WSGA 2L2MA 5BR8E 1YSAC 1SR9A 3ECRA 4J8ZA 2RSIA 5KL4A 2GLIA 2EMWA 2JP9A 2GPIA 2EPRA 4JYAE 2EMFA 4DR3E 1UILA 2EN2A 1PJTA 2RSMA 1X3CA 2YRMA 4DR4E 2K4VA 4LF6E 1HNXE 2G7HA 1RQ0A 3F6GA 1XNQE 2EOXA 2L92A 4ZYEA 2FGGA 3BBGA 5T6JA 2LJHA 2EQ3A 1X49A 2B7TA 2CT1A 4IS1C 2EN7A 2I13A 2I9IA 2HC5A 5A6KA 5A2QC 4KZSA 3BF2A 3MHHC 1KYQA 1B69A 4WFTA 2L3CA 5AASA 4YHHE 1TF3A 4DUZE 2JWOA 2DLQA 3MSWA 4BHBA 4LTYA 3UK3C 3T1HE 3AUZA 2YZTA 2N3HA 4R8OA 2EM2A 1ZR9A 4LF5E 3ADJA 4R2EA 3J81C 1IBLE 2HJJA 4DR7E 1HNWE 2K7IA 1YYWA 4MLVA 2UXDE 4GZNC 4O4KA 2J7JA 1WXRA 5TSEA 1UN6B 4TUIA 4K0KE 2A25A 2NABA 1T4LB 4DV4E 2L2KB 2YPNA 3QG5C 1WHQA 1WRJA 2L8TA 2D9HA 2YSOA 3THOB 3C6KA 4X62E 2EMIA 2EOQA 4M30A 2LO3A 1YFHA 4R2SA 2DSYA 2WBUA 1ZAAC 2DMIA 2EMKA 2KHXA 4L5NC 4X64E 3J7Yp 4R2QA 2LMZA 2V87A 1HNZE 2ENAA 2ENHA 4NXNE 4AQYE 4BHCA 5AE3A 2JOXA 3JU0A 2EMAA 4M0VA 2UUBE 4I8OA 5AE1A 4DUYE 4N4RB 2EOOA 4R2RA 2JR1A 2F8BA 3EPLA 4WYQB 1N3GA 2EMHA 4O5GA 2MC5A 2LCEA 2RQLA 2LBSB 1YUJA 1AH5A 3DF6A 2ODRC 2FTXB 1A1KA 4RHBB 2VQEE 2CPNA 4R03A 4LF9E 2EPNA 3KZYA 4ZYGA 2FV4B 1EH7A 2VE7C 1TN9A 2EWLA 3KWRA 2EM6A 3VK6A 4DR2E 2EPAA 2EOZA 3THNA 2YT4A 2YTOA 2DMYA 2JOBA 4WPYA 1LLMC 2EPZA 2WBSA 4WSPA 3VYXA 4R2CA 2EMYA 2YTIA 2LJUA 4JI1E 3KZZA 2YRHA 2EPPA 3FIGA 4BCAA 1BB8A 4ZYHA 2DB2A 3L00A 4KWYA 4F54A 1EH8A 2EE8A 2KOUA 5A69A 2MC6A 2EP3A 5KL3A 4R2DA 1X5WA 3VYYA 1YUIA 1WJPA 1WHNA 2M1SA 2ADRA 2EM8A 2V88A 1PJQA 5AC4A 4JI2E 2EMBA 2PRTA 1J26A 2EM4A 3DJWA 4X8WA 2LV2A 1BBOA 1X6EA 2EM3A 2RS7A 2WZOA 1I94E 1MGTA 2VQFE 3LLHA 4OX9E 2MDRA 3F6HA 3C6MA 2DLKA 4X65E 2CTDA 2RS6A 1ZBQA 2EOHA 2L2NA 1PKPA 2M4IA 1X6FA 3J7AG 1L4SA 2EM9A 5A6AA 3BIDA 2N8XA 2EN8A 4GEQB 4RH8A 4DR5E 2LUQA 4BC7A 2YTDA 2EPMX 1JK2A 4GKJE 1N36E 1IQSA 2ENCA 2V8QB 3OMLA 3TQMA 3EPKA 2R76A 1A1JA 2NA2A 3MHSC 2V83A 2EOSA 4B3SE 4Q28A 4OOGC 2EPCA 4DV2E 2EM0A 2VRDA 5LLQA 2EN1A 5F3WA 2EZ6A 4DMIA 5A6BA 2LT7A 1O0WA 4JI4E 2EM7A 2EPLX 1IQOA 2MDGA 2EPOA 2YTPA 2UUAE 2E5LE 3AV0A 2L6MA 2LE2A 1DQ3A 5AC5A 3JAMC 2EL5A 2L3JA 1TF6A 3HPZA 2R1FA 1F2IG 2EORA 4DV5E 2KONA 4NHRA 1MEYC 2EN3A 4WX9A 4KHPE 2DIXA 3IWDA 5AE2A 3ADGA 4F9CB 1T4NA 1NCSA 4M2ZA 2EL6A 2DGCA 2DRPA 4NXME 2E1MA 5FLXC 2YSPA 2YTNA 4L8NA 4DKKA 4B3RE 2EOMA 1XMOE 4JI6E 1PDAA 2YRKA 4B3ME 2EPKX 4BS9A 2VF1A 2EQ0A 4JI8E 2CSHA 1A1HA 2B9DA 2EMGA 4DV7E 3HTXA 3IWCA 2LTRA 2YU8A 2EOJA 3M99B 1KJKA 2EN4A 1ZBTA 2RPCA 4JI3E 3P1XA 5DNYA 3H09A 1STUA 2MKNA 1EH6A 2JXPA 5KL6A 4M9VC 2EN6A 4F6NA 1A1FA 1G2DC 3T1YE 4P7DA 1A1LA 2EMZA 1QU6A 4BC9A 2MKDA 1T38A 2Q8UA 2M9AA 1N34E 1G2FC 4HEIA 4F6MA 1BBGA 4O24A 4F2JC 4LFAE 3BGHA 2IHR1 4B3TE 5ADZA 3HXLA 3RMPA 1UBDC 2EL4A 1J5EE 2HHHE 2M7QA 4NZVA 2EMCA 1GTKA 3JTZA 4X66E 1PJSA 2V86A 5KL7A 2V89A 4F9BB 4ZYDA 1XNRE 4DV3E 1A1GA 2NUGA 1YPNA 1RMDA 1N33E 4HTGA 1N32E 1T4OA 4JI0E 2EOYA 2ELZA 5IXMB 4X9JA 2EOEA 2RTXA 3LMLA 4FK5C 1NEIA 2YTQA 1YYKA 2F4VE 4DR6E 3ZOQB 2UU9E 2LRSA 2EMXA 5LL6R 1YYOA 1YZ9A 2GHFA 4R2PA 1P47A 2EOFA 2JPAA 3IWBA 2NUFA 1EKZA 3ADIA 1DGCA 1T39A 1UHZA 4BBYA 3K6QA 5IV8B 3EQ1A 4O43A 2L33A 1X48A 2YTFA 2EPUA 3HPSA 2YWQA 2YTJA 3C4TA 3OTOE
chains in the Genus database with same CATH topology
3UK3C 2EM2A 1ZR9A 4R2EA 2E72A 2YTGA 2EMLA 2EP3A 5KL3A 1X5WA 4R2DA 2WCC3 1NCSA 1YUIA 2EL6A 1JK1A 1WJPA 2DGCA 4GZNC 1X6HA 1ZU1A 2DRPA 2J7JA 2YSPA 2YTNA 1UN6B 2ADRA 2EM8A 2A25A 2EOMA 3VHTB 2HGHA 2EMBA 2LVHA 1Z1BA 5KL2A 2NABA 2PRTA 2EM4A 2YRKA 2LV2A 2YTEA 2EQ0A 1BBOA 1X6EA 2EM3A 3EPJA 2EPXA 2CSHA 1A1HA 2WBTA 2D9HA 2BB8A 2EMGA 2ELYA 2YSOA 1A1IA 2DLKA 2YU8A 2EMIA 2CTDA 2EOQA 4R2AA 2EOJA 3M99B 1KJKA 2EN4A 2EOHA 2RPCA 2LO3A 2YU5A 4R2SA 2MKNA 5KL6A 1X6FA 2WBUA 2EOIA 1AAYA 4M9VC 2EN6A 2EM9A 4F6NA 2DMIA 2EMKA 5KL5A 1A1FA 1ZAAC 1G2DC 4R2QA 1A1LA 2EMZA 2MKDA 2EN8A 2M9AA 2ENAA 2ENHA 1G2FC 2YTDA 4F6MA 4F2JC 1JK2A 2EMAA 2ENCA 2EQ1A 2EJ4A 2EOOA 3EPKA 2EM5A 1UBDC 2EL4A 3EPHA 1A1JA 4R2RA 2EMCA 3EPLA 5KL7A 4IJDA 4WSGA 2EMHA 1YSAC 2LCEA 5KL4A 2RSIA 3MHSC 2GLIA 1A1GA 2EMWA 2JP9A 2EOSA 2EPRA 1RMDA 1YUJA 2EMFA 1A1KA 2EPCA 2EN2A 2EOYA 2EM0A 2ELZA 4X9JA 2VRDA 2EOEA 4FK5C 2YRMA 1X3CA 2EN1A 1TN9A 2YTQA 2LT7A 2EOXA 2EM6A 2EMXA 2EM7A 2GHFA 2EPAA 2EOZA 2MDGA 2YTPA 4R2PA 2EOFA 1P47A 2EQ3A 2JPAA 2YTOA 2CT1A 4IS1C 1LLMC 2EPZA 2WBSA 2EN7A 2I13A 1DGCA 4R2CA 2EMYA 2YTIA 3MHHC 1B69A 2EL5A 1TF6A 2YRHA 2EPPA 1TF3A 2R1FA 1F2IG 2EORA 1BB8A 2YTFA 2DLQA 2EPUA 2YTJA 1MEYC 2EN3A 2EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UK3 C;  2EM2 A;  1ZR9 A;  4R2E A;  2E72 A;  2YTG A;  2EML A;  2EP3 A;  5KL3 A;  1X5W A;  4R2D A;  2WCC 3;  1NCS A;  1YUI A;  2EL6 A;  1JK1 A;  1WJP A;  2DGC A;  4GZN C;  1X6H A;  1ZU1 A;  2DRP A;  2J7J A;  2YSP A;  2YTN A;  1UN6 B;  2ADR A;  2EM8 A;  2A25 A;  2EOM A;  3VHT B;  2HGH A;  2EMB A;  2LVH A;  1Z1B A;  5KL2 A;  2NAB A;  2PRT A;  2EM4 A;  2YRK A;  2LV2 A;  2YTE A;  2EQ0 A;  1BBO A;  1X6E A;  2EM3 A;  3EPJ A;  2EPX A;  2CSH A;  1A1H A;  2WBT A;  2D9H A;  2BB8 A;  2EMG A;  2ELY A;  2YSO A;  1A1I A;  2DLK A;  2YU8 A;  2EMI A;  2CTD A;  2EOQ A;  4R2A A;  2EOJ A;  3M99 B;  1KJK A;  2EN4 A;  2EOH A;  2RPC A;  2LO3 A;  2YU5 A;  4R2S A;  2MKN A;  5KL6 A;  1X6F A;  2WBU A;  2EOI A;  1AAY A;  4M9V C;  2EN6 A;  2EM9 A;  4F6N A;  2DMI A;  2EMK A;  5KL5 A;  1A1F A;  1ZAA C;  1G2D C;  4R2Q A;  1A1L A;  2EMZ A;  2MKD A;  2EN8 A;  2M9A A;  2ENA A;  2ENH A;  1G2F C;  2YTD A;  4F6M A;  4F2J C;  1JK2 A;  2EMA A;  2ENC A;  2EQ1 A;  2EJ4 A;  2EOO A;  3EPK A;  2EM5 A;  1UBD C;  2EL4 A;  3EPH A;  1A1J A;  4R2R A;  2EMC A;  3EPL A;  5KL7 A;  4IJD A;  4WSG A;  2EMH A;  1YSA C;  2LCE A;  5KL4 A;  2RSI A;  3MHS C;  2GLI A;  1A1G A;  2EMW A;  2JP9 A;  2EOS A;  2EPR A;  1RMD A;  1YUJ A;  2EMF A;  1A1K A;  2EPC A;  2EN2 A;  2EOY A;  2EM0 A;  2ELZ A;  4X9J A;  2VRD A;  2EOE A;  4FK5 C;  2YRM A;  1X3C A;  2EN1 A;  1TN9 A;  2YTQ A;  2LT7 A;  2EOX A;  2EM6 A;  2EMX A;  2EM7 A;  2GHF A;  2EPA A;  2EOZ A;  2MDG A;  2YTP A;  4R2P A;  2EOF A;  1P47 A;  2EQ3 A;  2JPA A;  2YTO A;  2CT1 A;  4IS1 C;  1LLM C;  2EPZ A;  2WBS A;  2EN7 A;  2I13 A;  1DGC A;  4R2C A;  2EMY A;  2YTI A;  3MHH C;  1B69 A;  2EL5 A;  1TF6 A;  2YRH A;  2EPP A;  1TF3 A;  2R1F A;  1F2I G;  2EOR A;  1BB8 A;  2YTF A;  2DLQ A;  2EPU A;  2YTJ A;  1MEY C;  2EN3 A;  2EE8 A; 
#chains in the Genus database with same CATH topology
 1FKA E;  5LMN E;  1XMQ E;  2JYA A;  4LFB E;  3ADL A;  1GQE A;  2E72 A;  2YTG A;  2EML A;  2WCC 3;  1QNT A;  2UUC E;  5LMU E;  4F9A B;  1JK1 A;  1DI2 A;  4LF8 E;  1X6H A;  1ZU1 A;  5IT9 C;  4JV5 E;  2B3T B;  2JVA A;  3VHT B;  2HGH A;  4MLQ A;  4LU9 A;  1IBK E;  2LVH A;  1Z1B A;  5KL2 A;  5IWA E;  2JY9 A;  2YTE A;  5A6J A;  3EPJ A;  2EPX A;  2UXC E;  4DV1 E;  2WBT A;  1FJG E;  2LUP B;  2BB8 A;  2ELY A;  1A1I A;  4TUG A;  1RC7 A;  4R2A A;  4BMJ A;  1IMU A;  4Q35 B;  4YY3 E;  1IBM E;  2NUE A;  1X47 A;  1SFE A;  2YU5 A;  3HQ1 A;  2EOI A;  1AAY A;  2B7V A;  4WXD A;  4DV0 E;  4LFC E;  5KL5 A;  4P78 A;  1GZ6 A;  4DV6 E;  2N3G A;  3J80 C;  2H36 X;  4LF7 E;  3C4B A;  4LF4 E;  1HR0 E;  5A6B D;  2EQ1 A;  2V85 A;  2EJ4 A;  4GKK E;  2EM5 A;  2BBG A;  3EPH A;  4WXC A;  4DR1 E;  5CFF E;  4JI5 E;  2UXB E;  2LTS A;  2ODR D;  4JI7 E;  2ZM6 E;  4IJD A;  4WSG A;  2L2M A;  5BR8 E;  1YSA C;  1SR9 A;  3ECR A;  4J8Z A;  2RSI A;  5KL4 A;  2GLI A;  2EMW A;  2JP9 A;  2GPI A;  2EPR A;  4JYA E;  2EMF A;  4DR3 E;  1UIL A;  2EN2 A;  1PJT A;  2RSM A;  1X3C A;  2YRM A;  4DR4 E;  2K4V A;  4LF6 E;  1HNX E;  2G7H A;  1RQ0 A;  3F6G A;  1XNQ E;  2EOX A;  2L92 A;  4ZYE A;  2FGG A;  3BBG A;  5T6J A;  2LJH A;  2EQ3 A;  1X49 A;  2B7T A;  2CT1 A;  4IS1 C;  2EN7 A;  2I13 A;  2I9I A;  2HC5 A;  5A6K A;  5A2Q C;  4KZS A;  3BF2 A;  3MHH C;  1KYQ A;  1B69 A;  4WFT A;  2L3C A;  5AAS A;  4YHH E;  1TF3 A;  4DUZ E;  2JWO A;  2DLQ A;  3MSW A;  4BHB A;  4LTY A;  3UK3 C;  3T1H E;  3AUZ A;  2YZT A;  2N3H A;  4R8O A;  2EM2 A;  1ZR9 A;  4LF5 E;  3ADJ A;  4R2E A;  3J81 C;  1IBL E;  2HJJ A;  4DR7 E;  1HNW E;  2K7I A;  1YYW A;  4MLV A;  2UXD E;  4GZN C;  4O4K A;  2J7J A;  1WXR A;  5TSE A;  1UN6 B;  4TUI A;  4K0K E;  2A25 A;  2NAB A;  1T4L B;  4DV4 E;  2L2K B;  2YPN A;  3QG5 C;  1WHQ A;  1WRJ A;  2L8T A;  2D9H A;  2YSO A;  3THO B;  3C6K A;  4X62 E;  2EMI A;  2EOQ A;  4M30 A;  2LO3 A;  1YFH A;  4R2S A;  2DSY A;  2WBU A;  1ZAA C;  2DMI A;  2EMK A;  2KHX A;  4L5N C;  4X64 E;  3J7Y p;  4R2Q A;  2LMZ A;  2V87 A;  1HNZ E;  2ENA A;  2ENH A;  4NXN E;  4AQY E;  4BHC A;  5AE3 A;  2JOX A;  3JU0 A;  2EMA A;  4M0V A;  2UUB E;  4I8O A;  5AE1 A;  4DUY E;  4N4R B;  2EOO A;  4R2R A;  2JR1 A;  2F8B A;  3EPL A;  4WYQ B;  1N3G A;  2EMH A;  4O5G A;  2MC5 A;  2LCE A;  2RQL A;  2LBS B;  1YUJ A;  1AH5 A;  3DF6 A;  2ODR C;  2FTX B;  1A1K A;  4RHB B;  2VQE E;  2CPN A;  4R03 A;  4LF9 E;  2EPN A;  3KZY A;  4ZYG A;  2FV4 B;  1EH7 A;  2VE7 C;  1TN9 A;  2EWL A;  3KWR A;  2EM6 A;  3VK6 A;  4DR2 E;  2EPA A;  2EOZ A;  3THN A;  2YT4 A;  2YTO A;  2DMY A;  2JOB A;  4WPY A;  1LLM C;  2EPZ A;  2WBS A;  4WSP A;  3VYX A;  4R2C A;  2EMY A;  2YTI A;  2LJU A;  4JI1 E;  3KZZ A;  2YRH A;  2EPP A;  3FIG A;  4BCA A;  1BB8 A;  4ZYH A;  2DB2 A;  3L00 A;  4KWY A;  4F54 A;  1EH8 A;  2EE8 A;  2KOU A;  5A69 A;  2MC6 A;  2EP3 A;  5KL3 A;  4R2D A;  1X5W A;  3VYY A;  1YUI A;  1WJP A;  1WHN A;  2M1S A;  2ADR A;  2EM8 A;  2V88 A;  1PJQ A;  5AC4 A;  4JI2 E;  2EMB A;  2PRT A;  1J26 A;  2EM4 A;  3DJW A;  4X8W A;  2LV2 A;  1BBO A;  1X6E A;  2EM3 A;  2RS7 A;  2WZO A;  1I94 E;  1MGT A;  2VQF E;  3LLH A;  4OX9 E;  2MDR A;  3F6H A;  3C6M A;  2DLK A;  4X65 E;  2CTD A;  2RS6 A;  1ZBQ A;  2EOH A;  2L2N A;  1PKP A;  2M4I A;  1X6F A;  3J7A G;  1L4S A;  2EM9 A;  5A6A A;  3BID A;  2N8X A;  2EN8 A;  4GEQ B;  4RH8 A;  4DR5 E;  2LUQ A;  4BC7 A;  2YTD A;  2EPM X;  1JK2 A;  4GKJ E;  1N36 E;  1IQS A;  2ENC A;  2V8Q B;  3OML A;  3TQM A;  3EPK A;  2R76 A;  1A1J A;  2NA2 A;  3MHS C;  2V83 A;  2EOS A;  4B3S E;  4Q28 A;  4OOG C;  2EPC A;  4DV2 E;  2EM0 A;  2VRD A;  5LLQ A;  2EN1 A;  5F3W A;  2EZ6 A;  4DMI A;  5A6B A;  2LT7 A;  1O0W A;  4JI4 E;  2EM7 A;  2EPL X;  1IQO A;  2MDG A;  2EPO A;  2YTP A;  2UUA E;  2E5L E;  3AV0 A;  2L6M A;  2LE2 A;  1DQ3 A;  5AC5 A;  3JAM C;  2EL5 A;  2L3J A;  1TF6 A;  3HPZ A;  2R1F A;  1F2I G;  2EOR A;  4DV5 E;  2KON A;  4NHR A;  1MEY C;  2EN3 A;  4WX9 A;  4KHP E;  2DIX A;  3IWD A;  5AE2 A;  3ADG A;  4F9C B;  1T4N A;  1NCS A;  4M2Z A;  2EL6 A;  2DGC A;  2DRP A;  4NXM E;  2E1M A;  5FLX C;  2YSP A;  2YTN A;  4L8N A;  4DKK A;  4B3R E;  2EOM A;  1XMO E;  4JI6 E;  1PDA A;  2YRK A;  4B3M E;  2EPK X;  4BS9 A;  2VF1 A;  2EQ0 A;  4JI8 E;  2CSH A;  1A1H A;  2B9D A;  2EMG A;  4DV7 E;  3HTX A;  3IWC A;  2LTR A;  2YU8 A;  2EOJ A;  3M99 B;  1KJK A;  2EN4 A;  1ZBT A;  2RPC A;  4JI3 E;  3P1X A;  5DNY A;  3H09 A;  1STU A;  2MKN A;  1EH6 A;  2JXP A;  5KL6 A;  4M9V C;  2EN6 A;  4F6N A;  1A1F A;  1G2D C;  3T1Y E;  4P7D A;  1A1L A;  2EMZ A;  1QU6 A;  4BC9 A;  2MKD A;  1T38 A;  2Q8U A;  2M9A A;  1N34 E;  1G2F C;  4HEI A;  4F6M A;  1BBG A;  4O24 A;  4F2J C;  4LFA E;  3BGH A;  2IHR 1;  4B3T E;  5ADZ A;  3HXL A;  3RMP A;  1UBD C;  2EL4 A;  1J5E E;  2HHH E;  2M7Q A;  4NZV A;  2EMC A;  1GTK A;  3JTZ A;  4X66 E;  1PJS A;  2V86 A;  5KL7 A;  2V89 A;  4F9B B;  4ZYD A;  1XNR E;  4DV3 E;  1A1G A;  2NUG A;  1YPN A;  1RMD A;  1N33 E;  4HTG A;  1N32 E;  1T4O A;  4JI0 E;  2EOY A;  2ELZ A;  5IXM B;  4X9J A;  2EOE A;  2RTX A;  3LML A;  4FK5 C;  1NEI A;  2YTQ A;  1YYK A;  2F4V E;  4DR6 E;  3ZOQ B;  2UU9 E;  2LRS A;  2EMX A;  5LL6 R;  1YYO A;  1YZ9 A;  2GHF A;  4R2P A;  1P47 A;  2EOF A;  2JPA A;  3IWB A;  2NUF A;  1EKZ A;  3ADI A;  1DGC A;  1T39 A;  1UHZ A;  4BBY A;  3K6Q A;  5IV8 B;  3EQ1 A;  4O43 A;  2L33 A;  1X48 A;  2YTF A;  2EPU A;  3HPS A;  2YWQ A;  2YTJ A;  3C4T A;  3OTO E; 
#chains in the Genus database with same CATH homology
 3UK3 C;  2EM2 A;  1ZR9 A;  4R2E A;  2E72 A;  2YTG A;  2EML A;  2EP3 A;  5KL3 A;  1X5W A;  4R2D A;  2WCC 3;  1NCS A;  1YUI A;  2EL6 A;  1JK1 A;  1WJP A;  2DGC A;  4GZN C;  1X6H A;  1ZU1 A;  2DRP A;  2J7J A;  2YSP A;  2YTN A;  1UN6 B;  2ADR A;  2EM8 A;  2A25 A;  2EOM A;  3VHT B;  2HGH A;  2EMB A;  2LVH A;  1Z1B A;  5KL2 A;  2NAB A;  2PRT A;  2EM4 A;  2YRK A;  2LV2 A;  2YTE A;  2EQ0 A;  1BBO A;  1X6E A;  2EM3 A;  3EPJ A;  2EPX A;  2CSH A;  1A1H A;  2WBT A;  2D9H A;  2BB8 A;  2EMG A;  2ELY A;  2YSO A;  1A1I A;  2DLK A;  2YU8 A;  2EMI A;  2CTD A;  2EOQ A;  4R2A A;  2EOJ A;  3M99 B;  1KJK A;  2EN4 A;  2EOH A;  2RPC A;  2LO3 A;  2YU5 A;  4R2S A;  2MKN A;  5KL6 A;  1X6F A;  2WBU A;  2EOI A;  1AAY A;  4M9V C;  2EN6 A;  2EM9 A;  4F6N A;  2DMI A;  2EMK A;  5KL5 A;  1A1F A;  1ZAA C;  1G2D C;  4R2Q A;  1A1L A;  2EMZ A;  2MKD A;  2EN8 A;  2M9A A;  2ENA A;  2ENH A;  1G2F C;  2YTD A;  4F6M A;  4F2J C;  1JK2 A;  2EMA A;  2ENC A;  2EQ1 A;  2EJ4 A;  2EOO A;  3EPK A;  2EM5 A;  1UBD C;  2EL4 A;  3EPH A;  1A1J A;  4R2R A;  2EMC A;  3EPL A;  5KL7 A;  4IJD A;  4WSG A;  2EMH A;  1YSA C;  2LCE A;  5KL4 A;  2RSI A;  3MHS C;  2GLI A;  1A1G A;  2EMW A;  2JP9 A;  2EOS A;  2EPR A;  1RMD A;  1YUJ A;  2EMF A;  1A1K A;  2EPC A;  2EN2 A;  2EOY A;  2EM0 A;  2ELZ A;  4X9J A;  2VRD A;  2EOE A;  4FK5 C;  2YRM A;  1X3C A;  2EN1 A;  1TN9 A;  2YTQ A;  2LT7 A;  2EOX A;  2EM6 A;  2EMX A;  2EM7 A;  2GHF A;  2EPA A;  2EOZ A;  2MDG A;  2YTP A;  4R2P A;  2EOF A;  1P47 A;  2EQ3 A;  2JPA A;  2YTO A;  2CT1 A;  4IS1 C;  1LLM C;  2EPZ A;  2WBS A;  2EN7 A;  2I13 A;  1DGC A;  4R2C A;  2EMY A;  2YTI A;  3MHH C;  1B69 A;  2EL5 A;  1TF6 A;  2YRH A;  2EPP A;  1TF3 A;  2R1F A;  1F2I G;  2EOR A;  1BB8 A;  2YTF A;  2DLQ A;  2EPU A;  2YTJ A;  1MEY C;  2EN3 A;  2EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...