4WXDA

Crystal structure of mycobacterium tuberculosis ogt-r37k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSKTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxdA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxdA01
5ICEA 2P4WA 1YS6A 3U2RA 5E1XA 1BIBA 5JR3A 1ZLJA 5HDKA 1FBUA 3LA2A 2RC4A 3M9AA 1G3WA 5IT9K 2E7WA 4BXUA 2FF4A 3S2WA 2J5OA 1T38A 4OIRF 5CVIA 4ESFA 3LAJA 5D5WB 5DD4A 2COMA 2ETHA 2YR2A 5HDNA 1HKTA 2M87A 3I64A 3M7GA 3O2PE 5F64A 4BAYA 4LG0B 1IXSB 4P96A 1HQCA 2A68F 2YX4A 5E1ZB 5D5VB 4EM1A 1J7KA 2MD5A 2VE8A 3FMRA 1P2FA 4PCQA 2O61A 4HV6A 2HKOA 4I01A 4LB6B 4OMZA 2XROA 2NNYA 3WTZA 4A5MA 1Y0UA 3J7AO 2M45A 3I59B 1O3RA 4QLCU 3GX4X 1FBSA 5D4RA 1HKSA 2IRFG 4EJOA 1SMTA 3HTSB 2CYYA 3MZYA 5HVQC 4CYDA 2HFHA 4EJVA 4RGUA 5E18F 1T39A 3FX3A 2V1DA 1ZN2A 2GAUA 3DF8A 4P55A 3ZQ7A 4GO1A 5KK1A 4I2OA 1U6GA 2VBZA 4EGYA 3AAFA 2XUBA 3HSFA 5E17F 3C18A 4HDVA 4Q48A 1BBYA 1K6OA 1EV7A 3ZMZA 2XAQA 4HX8A 2IVMA 2E1NA 4UV9A 1XGNA 1ZRCA 3RYRA 1TQIA 2HYGD 2HQRA 1USSA 1YW7A 4N9HA 3HOTA 1HBXG 3SZPA 3QU6A 5LEKA 5A2QZ 1MJBA 1XDSA 4PZJA 3V8LA 4ZYGA 3WTVC 4G9YA 2QWWA 4LLNA 1Z1DA 4N9IA 1FSHA 3BJ6A 1F5TA 3T0YA 2CFXA 3H3ZA 2MH2A 3IHUA 1U5TA 4XSZF 5F1RA 2A61A 4HV5A 4MEXF 4KMUX 1QNTA 1SD5A 4I0AA 1FNNA 4LD5A 2ADUA 4MTDA 3RKWA 5FGMA 3ECHA 3SQNA 3IRRA 2Y48A 4UXNA 5TRDA 5D8KB 3COAC 1R1TA 4LLLA 1W7PB 5DYMA 2ZNZA 3BROA 1FX7A 5LBQA 1S7AA 3RIRA 1WI9A 1TQPA 2HDCA 1IAWA 5L3BA 2ESHA 4BYYA 1BC8C 3M1EA 1MDMA 5K5OA 5DCMB 1HKQA 4MHGA 2H6CA 2V1XA 5L3EA 2O8XA 4WX9A 2IP2A 4G6DA 3N97A 3GYHX 4YIIA 1SD7A 3F8CA 1G3SA 4H0EA 4UHTA 2QLZA 1R5GA 4UVAA 3P7NA 4LK0F 3WGHA 1SMYF 1OKRA 2QUFA 3J80Z 4KT5C 1I6XA 3HIFA 4HZFA 2VOOA 3F6OA 3NQOA 4UVBA 5DUIA 1PP7U 4M73A 1AWCA 5FFXA 1STZA 2UZKA 4WXDA 2ZMEB 3L2CA 1U2WA 1LB2A 3I58A 3V7RA 1PDNC 2JTVA 3ELKA 2A6EF 3GZ6A 3HHGA 5JFRA 4WCGA 2PMHA 2EV6A 3ZN0A 3B73A 2XAGA 2Z99A 4HLYA 2A5YB 1UHWA 2WC2A 5LHIA 2CGPA 3JSPA 4IJAA 1DPRA 3D5LA 1ZARA 3LSTA 3HRSA 1B59A 2KIMA 3DKWA 3F72A 2A07F 1G3TA 4MTEA 3VFZA 2F5CA 2EFPA 2K02A 4RB3C 2NAZA 2IA2A 1EH6A 4U0YA 2ISZA 1E17A 1J75A 5LGUA 1JXSA 1KA8A 1J0RA 2QZ8A 2JPBA 2P5VA 1IF1A 1CF7B 1LNWA 3BP8A 1UB9A 2F5FA 4U0WA 3T8RA 4ZYDA 5E1WA 3ZN1A 1UFMA 3ZP5A 5ICGA 4LJZF 4EJWA 2IT0A 1D8KA 2RNJA 1U78A 3F21A 2X0LA 5D4SA 3IWZA 3ULQB 2ZKZA 2X4HA 1FC3A 4I98B 1IXRC 1BJAA 1L0OC 1FOKA 1O7LA 4KUMA 3DPTA 4PGHA 4CGZA 4P9FA 4ENMA 3ROUA 2XASA 2VODA 1UCRA 2V9VA 2H6BA 4RGRA 3GUDA 2DQRA 3CUQA 3SXYA 4OIPF 1LVAA 1O57A 2ZFWA 4A0ZA 2IA0A 1XSDA 1P4WA 2K86A 2BBYA 2WWYA 1R58A 4G7OF 3F8NA 4IPAA 2DPDA 5L3CA 3RI4A 5FLXZ 5LHGA 2STTA 3WE3A 2ZJ2A 3I59A 5CLSA 2YU3A 5J8FA 5LLQA 1Q1HA 4XBFA 1MKMA 3KLNA 2ZO4A 4DQ2A 4JQFA 5D5UB 3GFLA 3LA7A 2UWMA 4CO8A 4G6QA 2FNPA 1SD6A 3E6BA 2FOKA 3G73A 3GF2A 2KJBA 2PN6A 3KP3A 1Z7UA 2VBYA 3FMQA 3NRVA 1HW5A 3ABUA 5LGTA 4L0YB 2NS0A 3RTRA 2DO7A 3MZHA 1X3UA 4JK1X 2W85A 1O3SA 3V7CA 3FF5A 4TV7A 5FB2A 3KP5A 1OYIA 2RV8A 4I09A 3TKYA 4FX0A 1TTYA 1T0FA 3QP6A 4RS8A 3ZPLA 2EV0A 5L3GA 2CO5A 2EFOA 3GXOA 2L54A 3EUHA 4O6JA 2KJCA 1G4DA 1WWXA 2XKPA 2XGXA 4HQEA 2UXXA 1TQMA 1Z6TA 3E6MA 1P4XA 2FBHA 3B02A 4NHJA 5H6QA 3SHFA 4KNYA 2PLYA 4ASNA 1QO0D 2XIGA 3WGIA 5FFZA 2O03A 1KU3A 4WF2A 3CO6C 3VOEA 4AIHA 3H3UA 3I4PA 1FYKA 4KIFA 3GEZA 3MCZA 4M74A 2RKHA 3BDDA 2ZCWA 5IT3A 5ED4A 1ZRFA 3JAMK 1JHHA 1T6SA 1S8NA 4DNCA 2XVCA 5DV5A 1ZGJA 3ZMUA 2QVOA 4K2EA 1G6NA 1IN5A 4RAYA 1W7PA 3C1DA 4GCVA 3LFKA 3CDHA 1O3TA 3FM3A 1MJ9A 5HS9A 1ZH5A 2IPQX 4YFNF 4HAMA 4EVIA 2XRNA 3DV8A 1KQ8A 2VT2A 1S6LA 4EJTA 1USTA 3HTUA 3JW4A 1GHCA 1DP7P 4G7ZF 5A2QK 5ILVA 2W84A 2IW5A 1ZGAA 2FNAA 2Q0OA 3IWFA 1MZBA 2PFBA 5ILSA 4U88A 3K1MA 3ABTA 3LAPA 3JAMZ 3HSEA 1SFXA 1S29A 4B8XA 3W6JB 2Z9OA 5CJ9A 1ZRDA 2XV4S 1HW1A 4YFXF 2M1BA 1Z05A 4AD9A 3MEXA 2O6GE 5BS6A 3E97A 2YX7A 3KZYA 2PEXA 1F4KA 3Q5FA 2DK8A 1XCVA 2XAFA 1H9GA 4L5IA 3M8EA 2OZUA 5BOXA 3PFIA 4U0VA 4KA4A 4UNOA 1FPQA 1ZG5A 1R22A 4BH9A 3I5UA 1D3YA 2OQRA 4KDPA 5KVRA 1RI7A 4Q47A 2L4MA 1ON2A 3MWMA 3WTYC 4ESBA 4RGSA 2RQPA 2MLKA 2MC3A 3BJAA 1K79A 5K5RA 4R79A 4N0BA 4D0PA 4GYGA 3EQLF 1XCBA 3TQNA 4OMYA 1SD4A 3V8KA 4XSXF 5E8IA 2KIUA 5HDGA 2V1UA 2EV5A 1AOYA 3BZ6A 2DW4A 2GA2A 2O0YA 3EETA 2VOPA 1R1UA 2Z3YA 4AWXB 2PI0A 5HOOA 2O3FA 4ESJA 3LWFA 1K7AA 2QQAA 1YIOA 2L4AA 3ZMSA 5BPIA 2F5EA 1CF7A 2EK5A 2VT3A 1SFUA 3J80K 5J8CA 4HYEA 4KIGA 2FQ3A 1XSVA 4Y15A 2V79A 1I27A 3LQQA 1OMIA 1TLHB 2K7LA 5LEJA 4HLXA 1FLIA 1O3QA 1FP1D 3GFMA 3R4KA 2FMYA 3E5QA 2FEZA 3C7JA 2EB7A 1ZG1A 1J59A 2EA4A 1J5YA 1BI1A 3GVAA 3V4GA 5D5XB 1ODDA 1GVJA 4EQQA 5JVTA 3FHZA 5JI6A 2FA5A 5TJJA 1TW2A 3P9CA 2OU2A 1Z6RA 3HOSA 3QU3A 3E5XA 2L01A 1S3JA 3I53A 4A0YA 4HBLA 3F8MA 2JZYA 2FBIA 2JRTA 2JPCA 4L9VA 1LEBA 2GWRA 1YW8A 3ZMDA 2EFQA 3F22A 1RIOH 4IHSA 3E5UA 4A6EA 3SZTA 4I7HA 2K27A 4KN7X 4O3MA 3KP7A 4LB5A 1CGPA 3K1PA 4BHPA 2DPUA 2QBYB 2HEOA 1I1GA 5HLGA 3IRQA 2GIVA 3TGNA 4UV8A 3KP2A 1FWZA 3GFJA 4BHCA 4WXHA 1TNTA 3WTSC 3WU0A 2Z5UA 4ZH4F 3WTUC 3Q9SA 4QWQA 4WK8F 4BHBA 1K78B 1BOAA 3SFZA 1Z91A 2YPRA 1YW9A 3IKTA 4ETSA 2MA3A 5LGNA 2XAJA 2A6HF 2RGVA 2VONA 4Y13A 2PJPA 1P92A 1IN4A 5J6XA 2DLLA 3OOPA 3OV8A 4IVNA 4KICA 1U5TB 4EM2A 3GWZA 3BPVA 1RZ4A 2DT5A 4L9TA 1QGPA 2W24A 1XGSA 1HSTA 3CJNA 1XMAA 5ERIA 2OQGA 2W57A 3QPTA 4ENJA 2FMLA 1MD0A 1KQ9A 1TBXA 2OAZA 3CTAA 2C6YA 3KE2A 2HS5A 3HUGA 1YS7A 2P5LC 3KEQA 3WTTC 1U8RA 5FLXK 4B09A 4ZZDA 1IZ1A 2F2EA 3BJOA 4WWCA 3R6SA 3ISPA 1H9TA 4I02A 5HS8A 1PUEE 2FSWA 4UVCA 5CVJA 1B9NA 1YQAA 3VB2A 5CYVA 3TOAA 4E70A 1BM9A 1F1ZA 1ZAOA 1JHFA 2LNBA 3WU1B 4OOIA 1XDUA 4KN4X 3Q9VA 2ESNA 1WSUA 2PG4A 1WQ2A 1IW7F 1UHMA 4KMFA 2E7XA 1W7PD 4LG0A 1LDJA 2HTSA 4IRGA 4I0BA 4NQWA 1WKMA 4BQAA 2ACJA 4RGXA 2G7UA 2XKOA 4GGGA 3TDUC 4NB5A 1OPCA 4MQ9F 1NHAA 1DDNA 2ZXJA 3BOQA 2ELHA 2K4JA 4U7BA 3L09A 2RN7A 5CVVA 4RB2C 4MGRA 3E6CC 1IN6A 3RPQA 3F6VA 2HOEA 2ZBKA 4WXCA 2P7CB 4ZYEA 1MJAA 5ICCA 3BY6A 3REOA 2QQ9A 4Q4ZF 2IA1A 2HWVA 3IL2A 4YFKF 4A0XA 4HQMA 3N4MA 1RNLA 2P7VB 1OYYA 2DK5A 4KIBA 3EYIA 2KIFA 4GXOA 4CZZA 1FSEA 1ZHFA 3J81K 3NEUA 2TDXA 2Q8KA 4OIOF 4L9NA 1DPUA 2P8TA 3RPUA 3G3ZA 3R61A 1U5TC 1B6AA 1IN8A 4FHTA 3GLXA 1KU7A 2GZWA 3K69A 2RVCA 2BE5F 1P4AA 5DUKA 3RYPA 3HYIA 3TOBA 1I1SA 3K2ZA 1KYZA 5DDGA 1QZZA 3P9IA 1T2KA 5EEHA 2M8EA 1FYLA 1P6RA 4A2UA 4Z2YA 1VTNC 4P5OA 2UXNA 4R1HA 3FXQA 3H92A 4EJUA 3K0LA 3J81Z 3MFKA 1IRGA 3VEPA 3U9GA 3VODA 1JE8A 3JSOA 3R0JA 1HSJA 3ECOA 5DD8A 3DXJF 1EH8A 3I71A 5H20A 1MGTA 2VN2A 3EDPA 1V3FA 3C3WA 1IXCA 3TO6A 1YG2A 4G94A 1BIAA 2PQ8A 3P9KA 3F3XA 1E2XA 3CUQB 2FXAA 2STWA 1QBJA 3PQKA 3HSRA 4HF0A 1XMKA 4MEYF 5E20A 2J5PA 1XGOA 5DCMA 3K1NA 4S04A 1XN7A 3EYYA 2FRHA 2HZTA 2K4BA 1KYWA 5IT9Z 1EH7A 1KQ0A 3GFIA 4AVPA 4OU0A 1WRJA 2R7DA 3L7WA 1O7FA 4L5JA 1B9MA 2R7FA 3TO7A 1SAXA 4O5VA 2GXGA 1LDDA 3KEOA 5DCFA 2WTEA 2HGCA 4HA8A 4FX4A 5AONA 2FE3A 4HX4A 2HYFA 3IKVA 5ILUA 2WV0A 5LRSA 3MQ0A 3KETA 2ZNYA 3RKYA 3ML6A 4M9SA 3CLOA 1V4RA 5EEGA 6PAXA 2IJLA 2VE9A 4S05A 2GXBA 2MBFA 4L0ZB 3TDZC 2VC0A 2QBYA 3BWGA 3KLOA 2ZMEA 4YIFA 3T5XA 4ENNA 1BN5A 2G7HA 4MQVA 4LGWA 2EA2A 4A12A 2QQBA 4M9ZA 1TW3A 5D8LB 2QM3A 1K78A 5LHHA 5CVRA 5DEQA 3QAHA 4EV0A 2YSRA 1D8JA 2R3SA 4HF1A 1R1VA 3LQRA 4HOBA 1RUNA 1XSXA 3CO7C 3U1DA 2VBXA 1H0MA 2HKXA 3F23A 1JGSA 3O3KA 4PDKA 2A3SA 1G3YA 2D45A 4IRIA 2PMUA 1IRFA 3ZMVA 4OIQF 4EMSA 3KFWX 4CICA 4A6DA 4HF2A 1KU9A 3HRTA 3BPXA 1OR7A 4LLGF 4XLNF 4IXAA 5K5QA 3L00A 3ZMTA 3T1BA 4R8HA 4LK1F 3FM5A 3CUQC 3V8JA 1Z9CA 3MAJA 4UUVA 1R5HA 2GQQA 2HTJA 4FT8A 3O6BB 4JBAA 1DUXC 2KRFA 3E3VA 1R36A 2CSOA 3HHHA 4AIJA 5D6FA 2QYOA 5K1YA 4Q5SF 1QPMA 4L9JA 3WGGA 3FMSA 3JTHA 5L3FA 1YTYA 3LA3A 4IHTA 2HQNA 1TNSA 5BQTA 1T98A 5F6FA 2Q2EA 3TO9A 2ISYA 2BGCA 2CG4A 1BI3A 1ZG3A 2CW0F 1L3LA 3E6DA 4GYIA 1RUOA 2AXLA 3FXRA 1BI2A 1YLFA 2FU4A 2GA1A 3KP6A 4M72A 1I5ZA 3IC7A 3FXUA 4LFUA 1W5SA 3F8FA 1FBQA 4ON0A 2VC1A 3RDIA 4RB1A 1KGSA 2DBBA 4P9UA 3DP7A 4CHUA 4EGZA 5CVUA 2A69F 4MNUA 4BNCA 4EM0B 2MLGA 3QRFF 2DAOA 1REPC 3JTGA 2NRAC 2PBIA 3WTXC 4LMYA 3HRMA 3HRUA 1PP8F 1FYMA 2BV6A 4HX7A 4Y17A 3CUOA 1FY7A 4RB0A 2DQLA 5FD6A 1FP2A 1D5VA 2V6CA 2BYVE 2LF7A 2P5KA 5ICFA 4M6YA 3GZ5A 2JT1A 5D6EA 1ZREA 3KP4A 2M30A 4XLPF 5AIPA 2BEOA 2LKPA 3GW2A 3QP5A 1B4AA 4HDUA 4ZZLA 5BPDA 3FWEA 1HW2A 1R00A 4CDGA 2OBPA 3ERED 3WG9A 1LDKB 1GXQA 4HW0A 2CWEA 4CXFA 2KKOA 1LEAA 5FD5A 1XD7A 2VXZA 4A5NA 1J9IA 1A04A 2HR3A 2XAHA 2AS5F 1B1BA 1XB4A 2H09A 4KYWA 1MDMB 2L02A 1ZYRF 1GXPA 4F7ZA 2L3DA 3DQVC 2OA4A 2D1HA 3FZVA 3R60A 3D0SA 5HLIA 4G7HF 4KFCA 1U3EM 2G9WA 2DFIA 1ON1A 1XGMA 3QOPA 4M71A 2F5DA 5LRRA 2P6SA 1FT9A 1QQIA 2LDUA 4ZYHA 2NYXA 2Y75A 5FO5A 4OINF 1KU2A 2EWNA 2D2WA 5H6RA 5BMZA 2QENA 1SFEA 2B0LA 1OYWA 2LSOA 2H27A 3T8TA 5HS7A 1J2XA 3F8BA 2JSCA 2EFWA 2W25A 2FBKA 3RKXA 2DTRA 2MH9A 3RJPA 3DFGA 5AIQA 1IUYA 2EFNA 1S7OA 1LQ1A 1LJ9A 3W6KB 3I0TA 4RAZA 2Z33A 3K9TA 1C0WA 3R0AA 3WE2A 4ENKA 3V7SA 3WODF 2DU9A 2H94A 3DPLC 5HLHA 4G8XA 3KCCA 5L3DA 3GO5A 3PQJA 1YFHA 2DI3A 4IF4A 1F9NA 4U7DA 1FZPB 4M6XA 2EJRA 2M5WA 2D1VA 2VBWA 1R7JA 4AIKA 4XRFA 1ONVA 4M9XA 1BC7C 1IN7A 2XHKA 2LF8A 3QPHA 1W4MA 1W5TA 1ULYA 1ZLKA 1YYVA 1YO5C 4PGGA 1HXDA 2NNNA 3L9FA 2P6TA 1R23A 4L18B 5JHUA 3KZZA 3DEUA 5E8GA 3M8FA 2OZ6A 1BI0A 2CQKA 4IRHA 1QZYA 2OD5A 3I54A 4YG2F 2Y0MA 2E1CA 3WTWC 2RDPA
chains in the Genus database with same CATH superfamily
5ICEA 2P4WA 5C4JJ 3C4BA 3GLLA 4JI4E 1YS6A 2LVHA 1U8BA 3U2RA 3EUKL 4XKWA 2QEXI 4XN0A 1IQSA 5E1XA 1BIBA 5JR3A 1ZLJA 2YTPA 1WJDA 5HDKA 4LTYA 1FBUA 1VQ7I 3LA2A 2RC4A 2L2MA 3M9AA 1P9QC 1WPKA 2K9LA 2EPAA 1D0ZA 2E35A 2I9IA 1G3WA 4RLQA 2VE7C 5AASA 5IT9K 2E7WA 4BXUA 2YZTA 1QZEA 2IBDA 2K9NA 2Y0SA 3HOVJ 2EMKA 4F6MA 2FF4A 3S2WA 1WHUA 2K4VA 4MLVA 2DFFA 2J5OA 1T38A 4D7NA 5LMNE 2XB0X 2V9KA 2X85A 4OIRF 2DCEA 4XR6A 5CVIA 1UILA 5J1RA 2ZFUA 4ESFA 5J4YA 3LAJA 1J5EE 5D5WB 5DD4A 3S2DJ 1HC8A 1O0WA 3ESWB 2UUCE 3PNTA 4RA2A 2COMA 3OYHA 2ETHA 2YR2A 3N05A 1RMDA 3MD2A 2EM5A 3VK6A 5HDNA 1HKTA 2M87A 3I64A 2YRMA 3M7GA 3O2PE 5F64A 3OYFA 3BQYA 4BAYA 4LG0B 1IXSB 1MSFC 4P96A 1HQCA 2A68F 2GIZA 2YX4A 3IAM2 1RKWA 2EOQA 5E1ZB 5D5VB 4EM1A 1J7KA 1UMQA 1MH3A 2MD5A 3I4MJ 4DR7E 4NQWB 2X6WA 2VE8A 1H89C 3FMRA 1WJBA 4C3JJ 4IHWA 3VYXA 1P2FA 4PCQA 2F4MB 3AUZA 4BL0B 2JA6J 4HV6A 2HKOA 3B6CA 4I01A 4FE7A 4LB6B 4OMZA 4IKFA 3RQ4A 2EMLA 2I5UA 2XF5A 2XROA 2NNYA 4IZZA 1MNEA 3WTZA 4A5MA 4DGWB 1Y0UA 3J7AO 1K4SA 2KISA 3JRAA 3SJMA 4OAZA 2M45A 4BGDA 5EG0B 3I59B 1X2MA 4IHVA 1O3RA 1T4NA 1X2NA 1AH5A 4QLCU 3GX4X 2Y0SN 3W3CA 4BJTA 1FBSA 1ORKA 5D4RA 1HKSA 2IRFG 4EJOA 5A6AA 1SMTA 1M1EB 3HPSA 5DTDA 3HTSB 2CT1A 2V89A 2CYYA 3MZYA 2DRPA 5HVQC 3JU0A 4CYDA 4FK5C 2HFHA 4EJVA 4RGUA 4E7SA 5E18F 3FX3A 1T39A 1PDAA 3HOZJ 2V1DA 2HGHA 2LMZA 1ZN2A 2GAUA 2JK3A 2LLKA 1X6HA 3DF8A 4X6AJ 1WJFA 4P55A 4XLCA 3H9JA 4IX7A 2JA7J 1JKPC 1HNXE 2DN0A 3ZQ7A 4Y3OA 3B6AA 4GO1A 5KK1A 1AU7A 4I2OA 3SZGA 4IOAF 1B72B 1U6GA 2VBZA 3AG2H 5AC5A 1PUFA 4EGYA 3AAFA 4D9JA 3JTZA 1LVKA 1FJGE 1GLNA 2PRTA 2RREA 3S1RJ 2XUBA 5K7FA 2DOAA 2ME6A 1X1AA 3HSFA 5E17F 3C18A 3KPHA 4CH7A 4HDVA 2LUQA 2L3CA 3T1YE 4CYCB 4Q48A 1BBYA 1K6OA 4C2TA 1X3CA 3K6QA 1EV7A 2IGNA 1HCRA 1V55H 3ZMZA 4Y4RA 2ZJRF 2XAQA 4W97A 4HX8A 2IVMA 3UNGC 3OWTA 1R4NB 4JI3E 1WJAA 4QSHA 1VQNI 2E1MA 2JSPA 4XORA 3F6GA 2E72A 2KT0A 2OJED 2E1NA 3LL7A 4UV9A 1XMOE 2M2EA 4YIRX 1XGNA 3PL8A 4RLFA 4WSGA 1ZRCA 5CQGA 4LF9E 3LOCA 1TQIA 3RYRA 4E7IA 2VL8A 1OCOH 1BA5A 2KOUA 2HYGD 3BR6A 2VF1A 2HQRA 4XM3A 1USSA 2EILH 1Y39A 1W36D 1YW7A 2DA4A 1BR4A 1JJ8C 4N9HA 3HOTA 1HBXG 3SZPA 4DV3E 3QU6A 4XLHA 5LEKA 5A2QZ 3CDLA 2V87A 4W1UA 2X9DA 1FKAE 3OR2C 1MJBA 1XDSA 4DR3E 3HZJA 4PZJA 3V8LA 4ZYGA 4G9YA 3WTVC 2QWWA 3L2RA 3ZQCA 4LLNA 4BXXJ 4F52A 1SC7A 2CSHA 1Z1DA 3H35A 4N9IA 3OIOA 1OFCX 2V86A 1FSHA 3BJ6A 1F5TA 2F4VE 2IHR1 3T0YA 2OF7A 2CFXA 3BR5A 3H3ZA 2MH2A 2B7TA 3IHUA 1FOWA 1U5TA 4XSZF 4ZDPA 2I10A 1P47A 2E2JJ 2LY2A 5F1RA 1VQ4I 2OCCH 2A61A 3DPUA 4HV5A 4MEXF 4I6ZA 4KMUX 4DJAA 4JI5E 5IP6A 3K7AJ 4AU7A 3BTLA 1QNTA 1SD5A 3PNYA 1FNNA 4I0AA 2ADUA 2KDOA 4LD5A 1MMNA 2Y2ZA 5FRNA 2ADRA 4MTDA 2QF7A 3RKWA 4BQQA 3VYYA 5FGMA 3FKIJ 3ECHA 3J7Yp 3SQNA 5B1BH 4RBOA 3IRRA 2JA8J 2Y48A 4UXNA 3QG5C 5LMUE 5TRDA 1FEXA 1K83J 3ABLH 5D8KB 1WHQA 3COAC 2EQ0A 3MSWA 5IWAE 1R1TA 4LLLA 4E7HA 1W7PB 2OCEA 5DYMA 4XLFA 3CMYA 2ZNZA 5FKOA 2Z2SB 3BROA 4XRSG 1UN6B 2GOXB 4PFPA 1HR0E 5KL2A 1FX7A 5LBQA 5EDNA 2JPAA 1Z21A 4WPYA 2DFHA 1S7AA 3RIRA 3HGYA 4R2QA 4YY3E 1WI9A 5DM7F 2N3GA 3E7LA 4JX6A 1RR7A 1TQPA 4PFOA 2HDCA 2EZKA 1IAWA 1S5LC 5L3BA 1Y0NA 3D5RC 2ESHA 3ZQGA 4BYYA 1BC8C 2EINH 2TRTA 5KCMA 5J40A 3M1EA 1MDMA 2RSMA 1D1BA 2CQ7A 1YIJI 5K5OA 5DCMB 1H8AC 5AE1A 2VI6A 1RRJA 4Q28A 2ZC2A 1HKQA 4MHGA 3GZNB 4U87A 1LUJB 2H6CA 3RCOA 3NWTA 3S8PA 2R93J 1TWGJ 2V1XA 3TQMA 5L3EA 2LY9A 2NUEA 2O8XA 2Z1DA 2DODA 2DSYA 4WX9A 2M9AA 2IP2A 4HSTA 2HC5A 4M3BA 3LSIA 4G6DA 3N97A 2NA2A 3H0GJ 4BS9A 3BG7A 1R6RA 4X9JA 3GYHX 1T4LB 5EEAA 2EMXA 4YIIA 1SD7A 1MEYC 1A1JA 3PIOF 3F8CA 1G3SA 5EF6A 4UHTA 4H0EA 1D0XA 2QLZA 4NNJA 1TL8A 2EM4A 1R5GA 2VQLA 3G4SI 2N8XA 4XONA 1X1BA 4UVAA 2WB1N 4F3QA 3P7NA 1R71A 2ZSHB 2ECCA 4IQ4A 3S93A 4LK0F 3WGHA 4C2UA 1SMYF 1OKRA 1JI8A 5LFAA 5KL7A 2QUFA 2EN7A 3BG5A 3J80Z 4KT5C 1I6XA 1JTXA 3HIFA 2ELJA 3OYNA 4HZFA 2V88A 1YHQI 2W7NA 2VOOA 5FKMA 2R92J 1ZU1A 3A4CA 3F6OA 2BB8A 3NQOA 1A1LA 2DA6A 2ZXWH 2DLKA 4UVBA 4XIDA 3ECRA 2DFEA 4G12A 1G2FC 5B5EC 3CF5F 1N34E 5DUIA 3DEEA 4RHBB 1PP7U 2MW8A 4M73A 4BJ6C 1AWCA 1Z77A 5FFXA 1JK1A 1STZA 4D5CA 2HVQA 5F27A 2UZKA 3A03A 2GLOA 3Q0VA 3U1KA 2NUGA 5CQEA 2W1OA 1V54H 4WXDA 5KAFC 2M4IA 2ZMEB 3L2CA 1U2WA 1LB2A 3I58A 3V7RA 1PDNC 2YSOA 5FLMJ 1IRXA 2JTVA 1GQEA 1T0FC 2UUBE 4KHPE 1R49A 3VWBA 4CCOA 2EQ3A 2ME0A 3ELKA 2A6EF 3GZ6A 3HHGA 2D9HA 2JN6A 5JFRA 3LMMA 2PMHA 2H1LA 3PUBA 4WCGA 3HPGA 2EV6A 3EUHC 3ZN0A 5M5WJ 1HLVA 2O61A 3B73A 1TWFJ 2XAGA 2Z99A 3TP0A 4HLYA 4BBYA 2LRDA 2A5YB 2EOOA 1ETWA 1UHWA 2BHZA 2WC2A 4DBQA 4ITVA 4OAYA 2G0EA 3T1HE 5F3WA 3ZQFA 4DIQA 5LHIA 2CGPA 4IJAA 3JSPA 2EOXA 1ZGWA 1OCTC 1DPRA 3D5LA 3PO3J 1OLTA 1ZARA 3LSTA 3HRSA 1B59A 2WBUA 2KIMA 2X6OA 3DKWA 4XQFA 3F72A 1K4TA 1N33E 9ANTA 2A07F 2IS6A 1G3TA 2VPRA 2EL5A 4MTEA 3VFZA 2E36A 2ELKA 2F5CA 2EFPA 2BVMA 3FIWA 1FOXA 3LSJA 4B3SE 2K02A 2GM4A 2EMGA 2DMUA 1S9HA 2EPUA 5E3LA 4RB3C 4GKJE 2NAZA 2IA2A 1EH6A 2COBA 4U0YA 4R2RA 2MD0A 2ISZA 1E17A 3S3OA 1J75A 3EQ1A 1IDZA 5LGUA 1JXSA 2EPPA 1KA8A 2JVAA 2EMZA 1J0RA 2QZ8A 2EQ1A 2JPBA 3SEQA 3ZCOA 2P5VA 4N4RB 2VKVA 1IF1A 1CF7B 2P81A 1LNWA 3ASNH 3BP8A 1JT0A 4R2CA 4A3MJ 4IHXA 1MBJA 3G71I 1JK2A 1LLMC 1S72I 3H0DA 1UB9A 2F5FA 4U0WA 3ZQIA 2CS3A 4LF8E 3T8RA 2M9HA 4ZYDA 2N3HA 5E1WA 2R5YB 5C4XJ 2R7SA 3ZN1A 2IS4A 1UFMA 2JRMA 3IP4B 1Z0XA 2ELYA 4C3HJ 1FTZA 1ETKA 3ZP5A 5ICGA 4LJZF 2EMBA 4GDFA 3VYSB 4YHHE 3THNA 3QYEA 5JLXA 4EJWA 1VQMI 2A6TA 3CESA 2IT0A 1X58A 5A69A 1BW6A 3FHNA 2EPRA 1D8KA 2RNJA 1U78A 3VPRA 3F21A 3H5RA 3CJTB 3OS2A 2X0LA 1G59A 4RDUA 3HEFA 3FBIB 5D4SA 5J4VA 2X6YA 3IWZA 2K7IA 2WAEA 1ETVA 4I76A 3ULQB 1N3GA 2ZKZA 2X4HA 1V5EA 4YRVA 2AQEA 1SAUA 1D0YA 3BR2A 1FC3A 4I98B 1IXRC 1BJAA 1L0OC 1FOKA 3IWBA 1FOYA 1O7LA 1X49A 4O4KA 1IO2A 2WY7Q 4KUMA 1TN9A 3DPTA 5A2QC 3EPJA 2ECBA 4PGHA 4ABZA 4CGZA 4NBQA 2XF6A 1P7IA 4P9FA 3ROUA 2XASA 3K70C 4ENMA 2J7JA 2VODA 3K4KA 3SYTA 1LE8B 1IV8A 2L9NA 1FMWA 3BCBA 1UCRA 4X0GA 2V9VA 1RC7A 2H6BA 2Q2EB 4RGRA 4RAGA 3GUDA 3OTOE 3RMPA 1E0EA 1YYOA 2DQRA 4J19A 3CMEI 4F91B 2M1SA 2Q1ZB 3CUQA 3SXYA 4OIPF 5GPAA 1LVAA 1O57A 2OTJI 4JP0A 2N8GA 2ZFWA 3QODA 4A0ZA 2IA0A 1XSDA 1P4WA 2L7ZA 2K86A 3BF2A 2JVGA 2BBYA 2WWYA 5HLTA 3S2HJ 3DJWA 2DT7B 1ZELA 4F6NA 1R58A 3QYFA 4G7OF 3F8NA 4IPAA 4XMYA 4A3KJ 2EOJA 2DPDA 3H09A 4X66E 5HNHA 1Y56A 2LTSA 5L3CA 4JX4A 2F4OB 5FLXZ 3RI4A 4R2AA 2M8GX 2XAUA 3IH4A 4M6VA 3ADIA 2DA7A 5LHGA 2STTA 3K4JA 5A6BD 3WE3A 2ZJ2A 3I59A 5CLSA 4R2SA 1P7JA 5GAHJ 2MGQA 2YU3A 5J8FA 2DT6A 2FD5A 4HSRA 1R4MB 1B69A 1RETA 3EPLA 4NC7A 1YJ9I 5LLQA 1Q1HA 4XBFA 1PJQA 2ZMEC 2KQRA 1MKMA 2CUJA 2ZO4A 3KLNA 2RS6A 3FKJA 3HDDA 3QOEA 2B3TB 4DQ2A 3HOUJ 4JQFA 2M4GA 2QCOA 4V2GA 5D5UB 3GFLA 3LA7A 2UWMA 3TBIA 4CO8A 3IWCA 4FTHA 4G6QA 1KONA 1X3ZB 4B3RE 2FNPA 2L9VA 1SD6A 4BDYA 2E1OA 5E3NA 2ODRD 3E6BA 3CQZJ 2CJJA 1NG6A 5FKLA 2FOKA 3G73A 3GF2A 2KJBA 3VYTB 2EMWA 4A3GJ 1JUSA 2PN6A 3KP3A 1Z7UA 2EE8A 1XMQE 2VBYA 3FMQA 4IHYA 2E71A 2R7TA 4XRMA 4UUTA 3HL2A 3NRVA 1LFBA 1WJ5A 1HW5A 2ZSIB 3ABUA 5IYBJ 5LGTA 4L0YB 2QSGX 2NS0A 2HPIA 4CYCA 2CQNA 4L5NC 2MC6A 3RTRA 2DO7A 4V19K 4M3EA 1OCCH 3MZHA 2E19A 2CV0A 1X3UA 1VNDA 4JK1X 2CUEA 2W85A 4HG2A 2UXDE 1MBFA 1O3SA 2ZXHA 5A6JA 3GTOJ 4X65E 2ZXIA 2JUGA 3V7CA 2JP9A 2CW8A 3FDYA 3FF5A 4TV7A 3ONQA 3ZQHA 3CMAI 3DLLF 5FB2A 1X4OA 2IEKA 2UXCE 3KP5A 1OYIA 2RV8A 1V5GA 4I09A 3TKYA 1YITI 4N4NB 5AE3A 3BTIA 4FX0A 3HQ1A 4UB6C 4C3IJ 1TTYA 1T0FA 3QP6A 4BY1J 2V85A 4RS8A 3ZPLA 1E3OC 4DV7E 2XPWA 2EV0A 3HUGB 4F9CB 5L3GA 2CO5A 4DR1E 2EFOA 3A1YA 3PNVA 3GXOA 2L54A 3EUHA 4O6JA 2KJCA 2K9QA 4DV6E 2EN2A 2VJ4A 1G4DA 1WWXA 4F54A 2LCEA 2XKPA 2XGXA 5AE2A 1RC9A 4HQEA 2UXXA 4XOTA 2DMQA 1TQMA 1Z6TA 3J80C 2VIXA 1RQ0A 2GPIA 2JXPA 2XGEA 3E6MA 3S32A 3CCLI 2CTDA 3OIPA 2KHMA 1P4XA 2FBHA 3B02A 4NHJA 1GDTA 5H6QA 3SHFA 5EGOB 4KNYA 2LKSA 2PLYA 4ASNA 1QO0D 2BW3B 5FROA 3GTPJ 2XIGA 3WGIA 1XG1A 5FFZA 2O03A 4CCKA 4A3IJ 4R2DA 1KU3A 3S17J 4WF2A 3CO6C 3VOEA 2NVQJ 3K6GA 4AIHA 3H3UA 3I4PA 2L0KA 1FYKA 2DXIA 2V4JC 4KIFA 1ZR4A 4BDZA 3GEZA 3MCZA 4M74A 2RKHA 3BDDA 4M0VA 2ZCWA 5IT3A 5ED4A 2QKLB 4D1QA 3S15J 2BXZA 1ZRFA 4P7DA 3JAMK 2HOSA 2E5LE 1JHHA 2FX0A 1T6SA 1S8NA 1IDYA 4DNCA 3VYUB 2CH0A 1YUJA 4ZDLA 2XVCA 5DV5A 1ZGJA 3AKZA 3LSMA 5F0CA 4WSPA 3ZMUA 2QVOA 4K2EA 2XGCA 1G6NA 3W2AA 1IN5A 4RAYA 5FKNA 1W7PA 3C1DA 2L7MP 4GCVA 5IYCJ 3LFKA 3K4BA 3HGGA 3CDHA 1YRNB 2FGGA 1O3TA 2YT4A 3SDBA 3FM3A 1MJ9A 4LF5E 4M3GA 1CQTA 1BBGA 5HS9A 2L2NA 4AQYE 1ZH5A 2IPQX 4RM3A 2EM3A 4YFNF 1X1PA 4HAMA 3OYLA 4EVIA 2XRNA 3NARA 4M3DA 3DV8A 1KQ8A 1UZCA 2XDVA 4AUXA 2VT2A 1OQYA 1S6LA 4X1EA 2EPXA 4DV5E 4EJTA 1USTA 1A6IA 3QPSA 2WY8Q 3HOWJ 3HTUA 3RZOJ 4Y33A 4DKKA 1PYVA 1SEUA 2RSIA 4GZNC 1T8IA 3JW4A 1MBGA 1GHCA 5A6BA 1DP7P 4G7ZF 2X51A 5ADZA 1QRYA 4AVZA 5A2QK 1QVTA 5ILVA 2W84A 2IW5A 1ZGAA 2FNAA 2H36X 2LKXA 4XNFA 2Q0OA 3IWFA 3EUAA 4MLOA 1MZBA 3GTKJ 2PFBA 5ILSA 3DU6A 4U88A 2YSPA 3K1MA 3ABTA 2ZM6E 3LAPA 3W2WA 3JAMZ 3HKZA 1X19A 5GADJ 1K6YA 3HSEA 1MBHA 1SFXA 2JVHA 1S29A 1YE9A 4B8XA 2LK2A 2F6CA 2CQXA 3W6JB 5GAGJ 4UUSA 2Z9OA 3OL3A 2HDWA 2OUMA 4LG3A 2DMIA 5CJ9A 5IPAA 3HPHA 1ZRDA 2XV4S 2EPZA 2W82A 4PJ0C 2A5WA 1LFUP 3OYAA 2K9SA 1HW1A 2M0MA 2M1BA 4YFXF 3S1QJ 5HNFA 4E7LA 1Z05A 4AD9A 2YTDA 3A0BC 3MEXA 1JUPA 2O6GE 5BS6A 2DB2A 2YTQA 1FIAA 3E97A 2YX7A 2HYJA 3KZYA 4JX5A 2PEXA 1F4KA 1WJCA 3Q5FA 2DK8A 1SR9A 1XCVA 2XAFA 4XLEA 2R1FA 1H9GA 4L5IA 2EMYA 2NOJB 1WCMJ 2K9MA 1I3QJ 3M8EA 2OZUA 1UAAA 2KZVA 5TGTA 5BOXA 1MIJA 5B3SH 1F43A 3PFIA 4U0VA 3W2VA 1IMUA 2H8RA 3CF2A 3AG1H 1E3HA 4KA4A 4UNOA 4GFBA 4DZPA 2MG4A 1FPQA 1ZG5A 2X48A 2NOGA 1FIPA 1R22A 1AAYA 5TISC 1G2DC 2E2IJ 4AM3A 1PKPA 4BH9A 3I5UA 1D3YA 4CCLA 2OQRA 3FXOA 3PIPF 4KDPA 2LRSA 2YU8A 5KVRA 1RI7A 2X1CA 4Q47A 4X8WA 2L4MA 1ON2A 2AQFA 3MWMA 4NXME 3WTYC 4ESBA 2OC6A 4RGSA 2RQPA 2MLKA 2MC3A 3BJAA 4R2EA 1K79A 5K5RA 3DWLE 4R79A 4N0BA 1MNMC 5FLXC 2ENHA 4CUGA 1DI2A 1SANA 4D0PA 1PVEA 4GYGA 3RZDJ 3EQLF 4ZYAA 1XCBA 4DZJA 1POGA 3TQNA 4OMYA 1SD4A 3V8KA 4AC0A 3L2VA 5KHDA 2CW7A 3BC8A 4R03A 5LL6R 4XSXF 4FASD 5E8IA 2XSDC 2DA5A 3CCJI 2OV7A 2KIUA 2LH9A 4KJZA 5HDGA 3LSRA 2V1UA 1NEIA 1JT6A 2EV5A 3BQZA 4PSWA 1AOYA 3BZ6A 2DW4A 2GA2A 2O0YA 3EETA 2VLAA 3K4CA 2VOPA 2W4SA 1R1UA 2Z3YA 3LSGA 4AWXB 5HOOA 2O3FA 2PI0A 3VDXA 4DR4E 4ESJA 2IGKA 2EOMA 3LWFA 1K7AA 2QQAA 4DYRA 1YIOA 2JA2A 3OYJA 2L4AA 3ZMSA 4NUBA 1STUA 4Q35B 5BPIA 1SVOA 2F5EA 2Q8UA 2WBMA 2F4IA 2EZLA 1CF7A 2EK5A 2KRHA 2WAFA 2R7QA 2EM8A 2VT3A 5F1JA 1SFUA 3J80K 5J8CA 2HQAA 3S14J 4C30A 4A3EJ 4LIUA 2X1DA 2LOOA 4HYEA 4KIGA 2FQ3A 1XSVA 4Y15A 3S1MJ 1YJNI 2EMIA 1NTCA 3FK6A 4RAFA 2EN8A 2HOAA 2LR8A 2V79A 4M30A 1I27A 1BB8A 3LQQA 1OMIA 1TLHB 2K7LA 1QPIA 1BJZA 5LEJA 4HLXA 1FLIA 1ZR9A 1O3QA 1FP1D 3GFMA 3R4KA 2FMYA 3E5QA 3FXMA 3S3NA 2FEZA 1E3PA 2DOFA 4XKCA 2V83A 5IV8B 3EPZA 3C7JA 3ADJA 3UR3C 4D5FA 1ZAAC 2EB7A 5F08A 5GTHC 1ZG1A 2YTNA 5B1AH 1J59A 1YUIA 2EA4A 1J5YA 1BI1A 3GVAA 4B48A 3V4GA 5D5XB 4IL6C 3OYMA 1ODDA 1GVJA 4EQQA 4B47A 4E7JA 3GTQJ 1WHNA 5JVTA 1TWHJ 3FHZA 5B66C 4PSXA 5JI6A 1IG7A 2FA5A 1R5ID 5TJJA 1TW2A 2BY1A 2VQGA 3P9CA 2OU2A 1Z6RA 3HOSA 4E7KA 2QSHX 2EOFA 2HI3A 3QU3A 4MLQA 3E5XA 3I3LA 2L01A 1S3JA 3I53A 4HNVA 4S0HB 3DKXA 4A0YA 3G6EI 1ZQ3P 3HOYJ 1VQOI 2M4KA 3F8MA 4HBLA 5M3FJ 2JZYA 4OWRB 2FBIA 2JRTA 4IJDA 2JPCA 4A3LJ 2DMNA 4BU2A 4L9VA 4PJLA 2GWRA 2KLOA 3O8GA 1PUFB 1LEBA 3DF6A 1LE8A 2ID6A 1YW8A 3ZMDA 5F0FA 1HDDC 3KX2A 2LYCA 2EFQA 3F22A 1RIOH 1TF3A 4IHSA 5EZGA 3E5UA 4X64E 4A6EA 1LPQA 5EJCA 2MKNA 3SZTA 1WZ2A 4I7HA 3KZIC 3OYEA 2K27A 4XRSA 4KN7X 4O3MA 3CCVI 1MBEA 3KP7A 4LB5A 1X48A 2H8WA 3VYRB 1CGPA 1XC5A 4EATA 4UY8I 3K1PA 4BHPA 2DPUA 2QBYB 5BR8E 2HEOA 1I1GA 5HLGA 4F9AB 2WADA 3IRQA 5CFFE 2GIVA 2K3PA 2KDZA 5JVGF 1T08B 3TGNA 4UV8A 4B3TE 3KP2A 2E1MB 1FWZA 2EPFA 1X3WB 3GFJA 3C6KA 4BHCA 4WXHA 5K7ZA 1TNTA 3IAS2 3IWDA 5FJ8J 3LFUA 1AA7A 2XB5A 3WU0A 3WTSC 2Z5UA 4ZH4F 3G2BA 3WTUC 1AHDP 3Q9SA 4QWQA 4WK8F 2AXTC 2L9SA 4BHBA 4I99C 1K78B 3MVPA 1UJ8A 4BACA 3GTGJ 2UV1A 2HZDA 1VQKI 3DCFA 2VPLA 4LFBE 4F92B 4JYAE 1BOAA 3SFZA 1AKHA 2EOSA 1Z91A 2YPRA 1YW9A 3IKTA 2KPMA 4ETSA 2R7WA 4HEIA 3I4NJ 1VZ0A 2MA3A 5LGNA 3OYDA 5IY5H 5FLVA 1TC3C 2H1KA 2XAJA 2A6HF 1WGXA 3HXLA 2RGVA 4PJMA 5CPRB 1GV5A 2VONA 1N32E 4Y13A 2PJPA 1P92A 2MSYA 1IN4A 3CLQA 1A31A 3CC4I 2WAQA 5J6XA 3CCQI 5M3MJ 2DLLA 3OOPA 3RPUD 3OV8A 3NWSA 4IVNA 1Y8QB 4KICA 2BY2A 1VQLI 4Y7NJ 3CCUI 1TT5B 4F55A 1U5TB 4EM2A 3GWZA 4LU9A 4CA0A 3TL4X 3PJRA 3BPVA 5E3MA 2L7KA 1RZ4A 1MMAA 4BUPA 3KYLA 2DT5A 4L9TA 4G6TB 1QGPA 3JRGA 2W24A 3BGHA 1ZTRA 1XGSA 3WHCA 5J1YA 2VKHA 3OSFA 1PJRA 2MC4A 1HSTA 2KRCA 3CJNA 1D1CA 4XOPA 3DBHB 2V7FA 1XMAA 2EMCA 1WH5A 5ERIA 2OQGA 2W57A 3A0HC 3QPTA 3C2GA 4ENJA 2FMLA 1RR8C 1JKRC 1MD0A 4IQJA 1KQ9A 1TBXA 3BIDA 1FMVA 3JAMC 1EKZA 3KWRA 5GAEJ 1Z3XA 4BBRJ 1JKQC 5IOZA 1B8IA 2A25A 2OAZA 3CTAA 3P5JA 2C6YA 3KE2A 2YPNA 3QPLA 2HS5A 3HUGA 2EM7A 1YS7A 2P5LC 3KEQA 2M7AA 2L33A 2LD5A 1WJEA 3WTTC 1U8RA 4XK4A 5FLXK 4B09A 1JGGA 4ZZDA 4NC6A 4ZJZA 1IZ1A 3HJEA 2F2EA 1WFXA 3BJOA 3G1LA 2L8TA 2WAQN 4WWCA 3R6SA 3ISPA 2DYRH 3L2WA 1H9TA 4I02A 5HS8A 2NS8A 4QPOA 1PUEE 2FSWA 2EZHA 4UVCA 5CVJA 1B9NA 2HVRA 4WFTA 1YQAA 2D5VA 3VB2A 1UBDC 2DJIA 1RPWA 5CYVA 3TOAA 2BW3A 1BM9A 1RESA 4E70A 4BE2A 1F1ZA 2HNHA 1ZAOA 1JHFA 5GTIC 2LNBA 4BQOA 5JHFA 3JREA 3WU1B 2NVTJ 2LFBA 2HPMA 4OOIA 1XDUA 3DLAA 2XPUA 4LFAE 2HXIA 2EM0A 4KN4X 1I50J 3Q9VA 2ESNA 1VQPI 2YRHA 2BHYA 1ENHA 1WSUA 1X4PA 3ADLA 3CCMI 3F0CA 2PG4A 1HNWE 1WQ2A 1IW7F 3UKGA 1UHMA 1X1DA 3OL4A 2E7XA 1W7PD 4LG0A 4KMFA 1WJPA 1LDJA 3L2UA 2HTSA 4IRGA 4I0BA 1UELB 4FE4A 2DDAA 2BY0A 2R76A 2NVXJ 1D1AA 3ZR8X 4NQWA 1WKMA 1A5JA 2IGMA 1T4OA 4TUIA 3I9V2 4BQAA 4A3DJ 2EM2A 2ACJA 3K4MA 3CP8A 2KIQA 4RGXA 4CCMA 5H2FC 3OYGA 5EZHA 4YELA 2G7UA 2XKOA 4GGGA 1Q1VA 3TDUC 1JUMA 4BC7A 4NB5A 2VB6A 3GTJJ 1OPCA 1N77A 4MQ9F 2EPCA 1NHAA 2ID3A 2JYAA 1YX5A 3BG9A 1DDNA 1JKOC 3GCMA 5EG0A 2EN4A 1TF6A 2ZXJA 3BOQA 2ELHA 1Z3YA 2K4JA 4U7BA 3L09A 2RN7A 2PX9A 3HG9A 2JUCA 5CVVA 1VFCA 4BY7J 1X1CA 3JRBA 4RB2C 4MGRA 2WV1A 3E6CC 1IN6A 4II3A 4F9BB 3H3VK 2E1MC 2YTEA 3L1PA 3RPQA 3F6VA 2HOEA 4B43A 3ERMA 2ZBKA 3M99B 4WXCA 2P7CB 2LJUA 2EMAA 2EBIA 4ZYEA 1GZ6A 1MJAA 3CZ6A 1JJ6C 5ICCA 3JRHA 3BY6A 3REOA 2QQ9A 4Q4ZF 2IA1A 4L5EA 2HWVA 5J1UA 3IL2A 4YFKF 2JOBA 4A0XA 3OOUA 1B72A 4HQMA 3L2QA 2JQ7A 1TP4A 3ZOBA 1BOBA 4BQNA 3N4MA 2EPMX 1RNLA 2P7VB 4QTRA 4FCYA 3BTCA 1OYYA 2DK5A 4BEHB 3OR1C 4LF6E 3CCEI 3MMYB 4KIBA 2IS1A 1IQOA 3EYIA 1YX3A 2KIFA 4GXOA 4CZZA 1FSEA 1ZHFA 3J81K 4DMIA 3CDIA 1F2IG 3PO2J 3NEUA 2ELZA 2HVSA 2TDXA 4XN3A 3PUFA 1KJKA 2Q8KA 2B9SA 4OIOF 2RQQA 3BT9A 3MKWB 2LREA 2AO9A 4L9NA 1D5YA 2YWQA 1DPUA 2P8TA 1IGNA 2EWLA 5K7HA 3OS1A 4DV2E 2KZGA 3RPUA 2CV2A 3BG6A 3G3ZA 4K0KE 3R61A 2V26A 5M5YJ 2FV4B 1U5TC 1B6AA 3LLHA 4DUZE 1IN8A 4QPQA 4FHTA 3GLXA 2VQEE 4JI2E 2YTOA 2EOEA 4N4OB 4RH8A 1KU7A 1XMXA 2GZWA 3K69A 4BJ5C 2RVCA 4JYKA 3TW6A 2BE5F 2QQ8A 1P4AA 5DUKA 2DMYA 1OR7C 3RYPA 2R5ZB 2BY3A 1IV6A 2XPVA 3HYIA 2R7XA 2LV2A 1WVRA 4ZTFA 2XGDA 3TOBA 1U0JA 2DA3A 3MZ8A 1I1SA 4E4HA 3A01B 3PSIA 2UUZA 3MKYB 3H36A 5CKTA 3K2ZA 3EPHA 1KYZA 3HC7A 4CZCA 5DDGA 2Y9ZA 1VQ5I 2RQLA 1XNQE 2NABA 2YU9J 3HTXA 4R8OA 3J7ZI 1QZZA 3P9IA 1T2KA 3KYCB 5DS9A 5EEHA 1XPXA 2M8EA 2YS9A 1FYLA 1P6RA 2DYSH 4A2UA 1BBOA 4Z2YA 1T33A 2Z16A 1VTNC 4P5OA 3QWLA 1SFKA 1I94E 2UXNA 4R1HA 3FXQA 4BBSJ 3HOXJ 1F36A 2K5CA 3H9QA 3H92A 3QYBA 3F6HA 4DV0E 3BBGA 2NVYJ 3GBGA 4ZTJA 4EJUA 3K0LA 1OCRH 1I3AA 3FBNB 3J81Z 3MFKA 1IUFA 4PUSA 1IRGA 1IBLE 3VEPA 3U9GA 2YRKA 1N75A 2XC7A 4NZVA 2EQRA 3VODA 1JE8A 1Y1WJ 2E60A 3JSOA 4M3FA 1QA6A 1VQ9I 1IRZA 3R0JA 1HSJA 3ECOA 5DD8A 3DXJF 1EH8A 3I71A 5H20A 1XNRE 1MGTA 1UG0A 2VN2A 3H5NA 3EDPA 1V3FA 3C3WA 1IXCA 3TO6A 1YG2A 3M07A 4XKVA 3IH3A 2LVSA 2CPNA 4G94A 1BIAA 1ZR2A 1ACIA 4A3FJ 2ZB9A 2PQ8A 1QVUA 3OIQA 1G2HA 1JTYA 3P9KA 1Y1VJ 3TMOA 4F2JC 2DMTA 4LOCA 1OCZH 1UG2A 4GRIA 3S16J 3F3XA 4HPQA 4B1RA 4A3BJ 1E2XA 3CUQB 2FXAA 2STWA 1QBJA 3HBLA 3PQKA 2LTRA 3AFHA 3HSRA 2EOYA 3ADGA 2UUAE 4HF0A 3I55I 1XMKA 1ERDA 4MEYF 2JJ7A 5E20A 2J5PA 2M3AA 2EMHA 2MKDA 1WXRA 1EF4A 1XGOA 5DCMA 1UHZA 3SFIA 4P78A 2FOWA 4RM2A 4LF7E 3K1NA 4S04A 1TWCJ 2GXAA 1XN7A 4OOGC 1YPNA 3EYYA 2EP3A 4II2A 2FRHA 2HZTA 2K3FA 3BR1A 4DR2E 4DOZA 2PJRB 1APLC 1YOVB 4HNTA 2K4BA 1KYWA 5IT9Z 1EH7A 4DW6A 2R7RA 1KQ0A 3GFIA 1U9OA 2EH3A 3O8HA 4AVPA 2L3JA 1GV2A 2Y30A 1Z1BA 1DGCA 4OU0A 3OYKA 1WRJA 3CC7I 2R7DA 3L7WA 1O7FA 1NK3P 4L5JA 2VQFE 1B9MA 2R7FA 1WH7A 3TO7A 1A1IA 2EPLX 3H5AA 4JI7E 1HNZE 1SAXA 4O5VA 3JR9A 3H1CA 2GXGA 1LDDA 1SVMA 3KEOA 5DCFA 3OSGA 2WTEA 4CSWA 4JI1E 2HGCA 4HA8A 1W36C 3SEZA 4FX4A 5AONA 1NH3A 4B44A 3DEWA 1FJLA 2YTGA 2VQCA 2CUZA 2KONA 2FE3A 2HXOA 4HX4A 4OX9E 2HYFA 3IKVA 4KT6A 5ILUA 2WV0A 2RAEA 2R0QC 1A35A 2DJNA 5LRSA 1J09A 3MQ0A 3KETA 2HQ5A 3CMMA 4ZDOA 3BR3A 5KNLA 2VKEA 2ZNYA 3RKYA 3ML6A 4M9SA 4DR6E 3CLOA 1V4RA 5EEGA 5GPCA 3S3MA 2IJLA 2VE9A 6PAXA 2LUPB 5HODA 4S05A 2GXBA 2CV1A 1R9TJ 2LY1A 2MBFA 1A1GA 3BR0A 4L0ZB 2EOIA 4R2PA 3TDZC 2VC0A 1NCSA 2HOTA 4KISA 2QBYA 3BWGA 1VI0A 3PFYA 5IP7J 2V1NA 3KLOA 1OJLA 2ZMEA 4YIFA 3T5XA 4ENNA 5IP9J 1BN5A 2BOLA 1BR1A 2LP0A 2LBFB 2G7HA 4MQVA 1XX5A 4TUGA 1Y8RB 2LTPA 3Q3SA 4LGWA 3ZQQA 5BNGA 2P0WA 1ITYA 2EA2A 3HKZN 1YI2I 1IC8A 3BG3A 2DGCA 4A12A 1IBKE 2QQBA 1MMGA 2KP6A 4M9ZA 2CQQA 1TW3A 4BMJA 5D8LB 2QM3A 1ETXA 3TP3A 1K78A 1X6FA 1ZBTA 5LHHA 1MW7A 3E0JB 5CVRA 5DEQA 2F5VA 3QAHA 3MN2A 4EV0A 1VF9A 2M7BA 4WYQB 2OPTA 2YSRA 1D8JA 2CRGA 2R3SA 1GVDA 2VRDA 4JI8E 5F04A 1G8XA 2DOEA 5IYDJ 1IBME 4HF1A 1R1VA 3DTIA 3K4LA 3LQRA 3KEYA 2F8BA 4HOBA 1RUNA 4Y52J 2E5ZA 4PK4A 4DV4E 4UB8C 1XSXA 1W5CC 3CO7C 1OCPA 3U1DA 3C2BA 2VBXA 1ETYA 1KZHA 1H0MA 3BZCA 4A3CJ 2GLIA 2HKXA 4DYCA 3F23A 1JGSA 3O3KA 2EPNA 4KWYA 2L2KB 4BCAA 4PDKA 2A3SA 1Z7LA 2HDDA 1G3YA 4B3AA 1A36A 4FETA 2LMDA 2PMUA 3LSPA 2D45A 1IRFA 1TT0A 4IRIA 3ZMVA 2VXDA 4DBRA 3Q0UA 4OIQF 2VJJA 3CCYA 4EMSA 3KFWX 4CICA 4A6DA 1W0TA 2YTJA 4DUYE 3LSHA 4QIWN 3MKZA 2K85A 3SDGA 4HF2A 1DP3A 3TW7A 2Y9YA 2VJIA 1KU9A 3HRTA 3BPXA 2R7VA 2ENAA 1OR7A 4LLGF 1A1KA 2GOMA 2ICWG 1DGRM 3BCAA 3CJRB 5AC4A 4XLNF 4IXAA 1L4SA 3X2QH 2UXBE 3FIGA 1LFPA 4XICA 1Z67A 5K5QA 3L00A 1U9NA 3CCSI 1N78A 1HF0A 3H9GA 1RKTA 4RMNA 3ZMTA 2HJJA 2E2HJ 2R5YA 2EZIA 2EN1A 2IGOA 3AV0A 3T1BA 4LF4E 2WBSA 3AG4H 4HEA2 4R8HA 4LK1F 2LBSB 2M0CA 2XF7A 2WB1A 3G1MA 1HA8A 3FM5A 3ZRGA 5E3OA 1MSEC 1QU6A 2X6XA 3DTKA 3CUQC 3A02A 3MHSC 4M9VC 3HPZA 1YZ9A 3V8JA 1BW5A 3F9KA 2O8KA 3ZGKA 1Z9CA 3MAJA 3AL0B 3K4NA 4UUVA 4O24A 1R5HA 2GQQA 2HTJA 4FT8A 2EIKH 1BL0A 3O6BB 4IS1C 2QSFX 2W48A 1YYKA 4JBAA 1DUXC 4NHRA 4BE0A 2KRFA 1N36E 4MO7A 1HOMA 4DV1E 2LC2A 3J7AG 2LG4A 3E3VA 1QHHD 2GBYA 3W6VA 1R36A 3E1SA 4BE1A 2EL6A 2CSOA 3HHHA 2XSJC 3CJQB 4AIJA 5D6FA 3WG7H 2QYOA 5K1YA 4Q5SF 2CMPA 1QPMA 4L9JA 4B4CA 3CCRI 4IO9F 3WGGA 3GTMJ 2YTFA 3FMSA 3JTHA 5L3FA 3LSKA 3S1NJ 3DBRB 1YTYA 4FISA 2B7EA 3LA3A 5KL4A 2VKDA 4IHTA 2HQNA 1TNSA 5T6JA 2OTLI 5BQTA 1T98A 4JI6E 5F6FA 2Q2EA 1YYWA 1SVLA 3TO9A 2FTXB 2ISYA 4UUSB 2BGCA 2CG4A 3FXLA 1O4XA 1BI3A 1ZG3A 2CW0F 2B9DA 3OS0A 3DTEA 3MHHC 2WA0A 3JRDA 1DQ3A 5IOYA 1Y6IA 2IS2A 1L3LA 2IXSA 2FJ1A 3E6DA 5IXMB 1NG7A 4GYIA 1RUOA 2WCC3 2AXLA 2AHQA 3J81C 3FXRA 1BI2A 2M7QA 1LKXA 5C3EJ 2JY9A 1YLFA 2FU4A 2GA1A 3KP6A 4M72A 1I5ZA 3IC7A 3M4OJ 2JOXA 2O7OA 3FXUA 3BLYA 2R7ZJ 4LFUA 3IH2A 2QGUA 1W5SA 3F8FA 4J00A 1FBQA 1VQ8I 3DKYA 2O5RA 1GTKA 4ON0A 1DU0A 2L7FP 2R4GA 4EEFG 2VC1A 3RDIA 4RB1A 1KGSA 3WHBA 2DBBA 1A1FA 4P9UA 3K2AA 3DP7A 4CHUA 4JV5E 4EGZA 5CVUA 3VSKA 2NVUB 2A69F 3OYCA 2MYSA 4MNUA 3C4TA 4BNCA 2L2OA 4EM0B 2MLGA 1H88C 2LT7A 4E6KG 4C2MJ 3QRFF 2DAOA 1REPC 3JTGA 2NRAC 4AYBA 2V8QB 2MABA 1X6EA 3FXJA 4BXFA 3IV5A 3TEDA 2PBIA 2MC5A 3WTXC 4YEJA 3Q0WA 5M5XJ 4LMYA 2GHFA 3HRMA 3OYIA 3NAUA 2JWOA 2V6EA 2MFZA 3G1OA 3WU2C 1ZKGA 3UK3C 2YUSA 3HRUA 2CU7A 1PP8F 1QU3A 3J7YJ 2BV6A 1FYMA 2JMWA 5A6KA 4HX7A 2QKMB 4Y17A 2X1EA 3CUOA 2EN6A 1FY7A 1IJWC 2NS7A 3FISA 4RB0A 2HU9A 4BEHA 2DQLA 5FD6A 1FP2A 4KITB 2MDRA 1D5VA 4PJNA 5LD2C 2V6CA 2BYVE 2LF7A 3A2KA 1DQUA 2P5KA 2R7UA 5ICFA 2EPKX 3D1NI 4M6YA 3CD6I 4BC9A 3GZ5A 2EM9A 2L6MA 2LE2A 3CC2I 2JT1A 2EL4A 5D6EA 3OMYA 2M34A 3AG3H 1ZREA 4M2ZA 5F0HA 4A69C 4J01A 4KZSA 2EMFA 2F48A 4HRIA 3KP4A 2M30A 2R7OA 4F93B 2EJ4A 4XLPF 2ZJQF 5AIPA 2RNGA 5IT9C 2BEOA 4E7ZA 3OYBA 2LKPA 3GW2A 3QP5A 1B4AA 4ANJA 4HDUA 1XS9A 2E5NA 1BR2A 5J3LA 4ZZLA 4P1WA 2K40A 4GEQB 4A3JJ 1UHSA 1NK2P 5BPDA 3FWEA 2R5ZA 2O9LA 4H4KC 1HW2A 1MMSA 1R00A 1I39A 2MDGA 3OMLA 4CDGA 3D5SC 2YTIA 4AYBN 2YU5A 2OBPA 3ERED 3A01A 3VSLA 3WG9A 1LDKB 1GXQA 4HW0A 2CWEA 3MKLA 4CXFA 2KKOA 3BZKA 2RS7A 1LEAA 3V42A 5FD5A 1XD7A 2VXZA 4A5NA 1J9IA 4L8NA 1A04A 1A6QA 2HR3A 1DU6A 3RKQA 2XAHA 3PSFA 2AS5F 3ZQLA 4HTGA 1B1BA 1XB4A 3P1XA 2H09A 3QQAA 2VASA 5EGOA 4B3ME 1GT0C 4KYWA 3RQIA 1MDMB 1T56A 2L02A 1ZYRF 3J7AY 2DTZA 3HM5A 1GXPA 4F7ZA 3GTLJ 2L3DA 3DQVC 4AIDA 1SFOJ 2OA4A 3AL0C 1X47A 2D1HA 3K10A 3FZVA 1W0UA 3R60A 3D0SA 4ZC3A 4O5GA 3BTJA 3VHTB 3LNQA 2XRLA 5HLIA 2FQ4A 2KL4A 4G7HF 4KFCA 4JOMA 4Z6YA 1XTAA 1U3EM 1WI3A 2G9WA 2DFIA 1ON1A 3THOB 1XGMA 3QOPA 5KAIC 1V5FA 4M71A 1TWAJ 2F5DA 5LRRA 1OISA 3KYDB 2P6SA 4DYQA 1FT9A 1QQIA 1W1WE 2LDUA 5C44J 2I13A 4HNUA 4GKKE 4ZYHA 4CCJA 2NYXA 3KIOA 1ZK8A 3FK7A 5FKKA 1VQ6I 2FUG2 2Y75A 2Y69H 3DBLB 2EM6A 3JCUC 5FO5A 4IEJA 5KL5A 2VUMJ 4OINF 1KU2A 1PJSA 2Y31A 2BVLA 2EWNA 1S7EA 3U21A 4MIMA 2PMZA 3EPKA 2BBGA 2D2WA 5H6RA 5BMZA 5KL6A 2QENA 1SFEA 5DNYA 2B0LA 1OYWA 2LSOA 1YRNA 2H27A 2EIMH 2EORA 2RTXA 2VJ5A 5TSEA 1MH4A 3T8TA 2L5QA 5HS7A 1J2XA 2HHHE 2ODRC 3F8BA 3I56I 5EYRA 2JSCA 4A93J 3HB9A 2EFWA 2W25A 2VQHA 2ENCA 4LIVA 4V2FA 2FBKA 3RKXA 2DTRA 2KFDA 2MH9A 3RJPA 3PM1A 2E34A 3DFGA 5AIQA 2RPCA 1A1HA 2BZTA 2L92A 1IUYA 4IOCF 2DIXA 3M1CA 2KHXA 2EFNA 1J26A 1FTTA 1S7OA 4JI0E 1EA3A 2DMPA 1T95A 4C9YA 2V9PA 1LQ1A 4X62E 1ETOA 1LJ9A 4LITA 1KYQA 2WZOA 3W6KB 3I0TA 2PJRA 2NXNB 4BKXA 3K70D 4RAZA 2Z33A 4NDLA 5J47A 2W00A 3FXKA 3CP2A 3K9TA 1C0WA 1HDPA 3R0AA 3WE2A 4ENKA 3V7SA 3WODF 1N25A 4D7MA 1DGWY 1X5WA 2DU9A 2EZ6A 1EJ9A 3RSNA 2H94A 1ZBQA 1YSAC 1GUUA 3DPLC 5HLHA 2UU9E 4G8XA 2PMZN 3KCCA 4O43A 5L3DA 3GO5A 1YJWI 4NC8A 2TCTA 3PQJA 2L9RA 1YFHA 3DU5A 1AKHB 2DI3A 4IF4A 1F9NA 4DR5E 1MBKA 4XKBA 5JLWA 4U7DA 4M6XA 3JRCA 1FZPB 2B7VA 2EJRA 2M5WA 2IAIA 2DDBA 2D1VA 2NUFA 3JRFA 2VBWA 1R7JA 1I6HJ 2I8DA 4AIKA 4XRFA 2EPOA 1ONVA 2ZJPF 4M9XA 3ASOH 1BC7C 1IN7A 2KMUA 4NXNE 3JRIA 2XHKA 5DM6F 4B3XA 3M3YJ 3LMLA 5KL3A 2QA4I 2DA2A 2LO3A 2LF8A 3QPHA 1W4MA 3OY9A 5FRMA 3M8JA 1W5TA 3ABMH 1ETQA 1PJTA 1ULYA 4LFCE 1ZLKA 5E79C 2LJHA 1YYVA 1K61A 2EOHA 4MFEA 4PGGA 1YO5C 1MNDA 2DLQA 4I8OA 4FQGA 5GP9A 1HXDA 2JWTA 2NNNA 3L9FA 2A05A 2P6TA 3ABKH 2JR1A 1R23A 4L18B 2WBTA 4CCNA 5JHUA 2B63J 4J8ZA 3KZZA 2CFOA 2JA5J 3DEUA 1EKEA 3C6MA 5E8GA 3ZOQB 3M8FA 2OZ6A 4XLAA 1BI0A 2CQKA 2BXYA 2DA1A 4IRHA 1QHGA 4MFDA 1TZLA 2EN3A 1QZYA 2OD5A 3GMEA 3I54A 4YG2F 4XL9A 3ZXSA 2LBFA 1MMDA 2CUFA 2Y0MA 3C2HA 2EIJH 2E1CA 3WTWC 1B8IB 2EOZA 2RDPA 3IUOA 4PJJA
chains in the Genus database with same CATH topology
5ICEA 2P4WA 1YS6A 3U2RA 5E1XA 1BIBA 5JR3A 1ZLJA 5HDKA 1FBUA 3LA2A 2RC4A 3M9AA 1G3WA 5IT9K 2E7WA 4BXUA 2FF4A 3S2WA 2J5OA 1T38A 4OIRF 5CVIA 4ESFA 3LAJA 5D5WB 5DD4A 2COMA 2ETHA 2YR2A 5HDNA 1HKTA 2M87A 3I64A 3M7GA 3O2PE 5F64A 4BAYA 4LG0B 1IXSB 4P96A 1HQCA 2A68F 2YX4A 5E1ZB 5D5VB 4EM1A 1J7KA 2MD5A 2VE8A 3FMRA 1P2FA 4PCQA 2O61A 4HV6A 2HKOA 4I01A 4LB6B 4OMZA 2XROA 2NNYA 3WTZA 4A5MA 1Y0UA 3J7AO 2M45A 3I59B 1O3RA 4QLCU 3GX4X 1FBSA 5D4RA 1HKSA 2IRFG 4EJOA 1SMTA 3HTSB 2CYYA 3MZYA 5HVQC 4CYDA 2HFHA 4EJVA 4RGUA 5E18F 1T39A 3FX3A 2V1DA 1ZN2A 2GAUA 3DF8A 4P55A 3ZQ7A 4GO1A 5KK1A 4I2OA 1U6GA 2VBZA 4EGYA 3AAFA 2XUBA 3HSFA 5E17F 3C18A 4HDVA 4Q48A 1BBYA 1K6OA 1EV7A 3ZMZA 2XAQA 4HX8A 2IVMA 2E1NA 4UV9A 1XGNA 1ZRCA 3RYRA 1TQIA 2HYGD 2HQRA 1USSA 1YW7A 4N9HA 3HOTA 1HBXG 3SZPA 3QU6A 5LEKA 5A2QZ 1MJBA 1XDSA 4PZJA 3V8LA 4ZYGA 3WTVC 4G9YA 2QWWA 4LLNA 1Z1DA 4N9IA 1FSHA 3BJ6A 1F5TA 3T0YA 2CFXA 3H3ZA 2MH2A 3IHUA 1U5TA 4XSZF 5F1RA 2A61A 4HV5A 4MEXF 4KMUX 1QNTA 1SD5A 4I0AA 1FNNA 4LD5A 2ADUA 4MTDA 3RKWA 5FGMA 3ECHA 3SQNA 3IRRA 2Y48A 4UXNA 5TRDA 5D8KB 3COAC 1R1TA 4LLLA 1W7PB 5DYMA 2ZNZA 3BROA 1FX7A 5LBQA 1S7AA 3RIRA 1WI9A 1TQPA 2HDCA 1IAWA 5L3BA 2ESHA 4BYYA 1BC8C 3M1EA 1MDMA 5K5OA 5DCMB 1HKQA 4MHGA 2H6CA 2V1XA 5L3EA 2O8XA 4WX9A 2IP2A 4G6DA 3N97A 3GYHX 4YIIA 1SD7A 3F8CA 1G3SA 4H0EA 4UHTA 2QLZA 1R5GA 4UVAA 3P7NA 4LK0F 3WGHA 1SMYF 1OKRA 2QUFA 3J80Z 4KT5C 1I6XA 3HIFA 4HZFA 2VOOA 3F6OA 3NQOA 4UVBA 5DUIA 1PP7U 4M73A 1AWCA 5FFXA 1STZA 2UZKA 4WXDA 2ZMEB 3L2CA 1U2WA 1LB2A 3I58A 3V7RA 1PDNC 2JTVA 3ELKA 2A6EF 3GZ6A 3HHGA 5JFRA 4WCGA 2PMHA 2EV6A 3ZN0A 3B73A 2XAGA 2Z99A 4HLYA 2A5YB 1UHWA 2WC2A 5LHIA 2CGPA 3JSPA 4IJAA 1DPRA 3D5LA 1ZARA 3LSTA 3HRSA 1B59A 2KIMA 3DKWA 3F72A 2A07F 1G3TA 4MTEA 3VFZA 2F5CA 2EFPA 2K02A 4RB3C 2NAZA 2IA2A 1EH6A 4U0YA 2ISZA 1E17A 1J75A 5LGUA 1JXSA 1KA8A 1J0RA 2QZ8A 2JPBA 2P5VA 1IF1A 1CF7B 1LNWA 3BP8A 1UB9A 2F5FA 4U0WA 3T8RA 4ZYDA 5E1WA 3ZN1A 1UFMA 3ZP5A 5ICGA 4LJZF 4EJWA 2IT0A 1D8KA 2RNJA 1U78A 3F21A 2X0LA 5D4SA 3IWZA 3ULQB 2ZKZA 2X4HA 1FC3A 4I98B 1IXRC 1BJAA 1L0OC 1FOKA 1O7LA 4KUMA 3DPTA 4PGHA 4CGZA 4P9FA 4ENMA 3ROUA 2XASA 2VODA 1UCRA 2V9VA 2H6BA 4RGRA 3GUDA 2DQRA 3CUQA 3SXYA 4OIPF 1LVAA 1O57A 2ZFWA 4A0ZA 2IA0A 1XSDA 1P4WA 2K86A 2BBYA 2WWYA 1R58A 4G7OF 3F8NA 4IPAA 2DPDA 5L3CA 3RI4A 5FLXZ 5LHGA 2STTA 3WE3A 2ZJ2A 3I59A 5CLSA 2YU3A 5J8FA 5LLQA 1Q1HA 4XBFA 1MKMA 3KLNA 2ZO4A 4DQ2A 4JQFA 5D5UB 3GFLA 3LA7A 2UWMA 4CO8A 4G6QA 2FNPA 1SD6A 3E6BA 2FOKA 3G73A 3GF2A 2KJBA 2PN6A 3KP3A 1Z7UA 2VBYA 3FMQA 3NRVA 1HW5A 3ABUA 5LGTA 4L0YB 2NS0A 3RTRA 2DO7A 3MZHA 1X3UA 4JK1X 2W85A 1O3SA 3V7CA 3FF5A 4TV7A 5FB2A 3KP5A 1OYIA 2RV8A 4I09A 3TKYA 4FX0A 1TTYA 1T0FA 3QP6A 4RS8A 3ZPLA 2EV0A 5L3GA 2CO5A 2EFOA 3GXOA 2L54A 3EUHA 4O6JA 2KJCA 1G4DA 1WWXA 2XKPA 2XGXA 4HQEA 2UXXA 1TQMA 1Z6TA 3E6MA 1P4XA 2FBHA 3B02A 4NHJA 5H6QA 3SHFA 4KNYA 2PLYA 4ASNA 1QO0D 2XIGA 3WGIA 5FFZA 2O03A 1KU3A 4WF2A 3CO6C 3VOEA 4AIHA 3H3UA 3I4PA 1FYKA 4KIFA 3GEZA 3MCZA 4M74A 2RKHA 3BDDA 2ZCWA 5IT3A 5ED4A 1ZRFA 3JAMK 1JHHA 1T6SA 1S8NA 4DNCA 2XVCA 5DV5A 1ZGJA 3ZMUA 2QVOA 4K2EA 1G6NA 1IN5A 4RAYA 1W7PA 3C1DA 4GCVA 3LFKA 3CDHA 1O3TA 3FM3A 1MJ9A 5HS9A 1ZH5A 2IPQX 4YFNF 4HAMA 4EVIA 2XRNA 3DV8A 1KQ8A 2VT2A 1S6LA 4EJTA 1USTA 3HTUA 3JW4A 1GHCA 1DP7P 4G7ZF 5A2QK 5ILVA 2W84A 2IW5A 1ZGAA 2FNAA 2Q0OA 3IWFA 1MZBA 2PFBA 5ILSA 4U88A 3K1MA 3ABTA 3LAPA 3JAMZ 3HSEA 1SFXA 1S29A 4B8XA 3W6JB 2Z9OA 5CJ9A 1ZRDA 2XV4S 1HW1A 4YFXF 2M1BA 1Z05A 4AD9A 3MEXA 2O6GE 5BS6A 3E97A 2YX7A 3KZYA 2PEXA 1F4KA 3Q5FA 2DK8A 1XCVA 2XAFA 1H9GA 4L5IA 3M8EA 2OZUA 5BOXA 3PFIA 4U0VA 4KA4A 4UNOA 1FPQA 1ZG5A 1R22A 4BH9A 3I5UA 1D3YA 2OQRA 4KDPA 5KVRA 1RI7A 4Q47A 2L4MA 1ON2A 3MWMA 3WTYC 4ESBA 4RGSA 2RQPA 2MLKA 2MC3A 3BJAA 1K79A 5K5RA 4R79A 4N0BA 4D0PA 4GYGA 3EQLF 1XCBA 3TQNA 4OMYA 1SD4A 3V8KA 4XSXF 5E8IA 2KIUA 5HDGA 2V1UA 2EV5A 1AOYA 3BZ6A 2DW4A 2GA2A 2O0YA 3EETA 2VOPA 1R1UA 2Z3YA 4AWXB 2PI0A 5HOOA 2O3FA 4ESJA 3LWFA 1K7AA 2QQAA 1YIOA 2L4AA 3ZMSA 5BPIA 2F5EA 1CF7A 2EK5A 2VT3A 1SFUA 3J80K 5J8CA 4HYEA 4KIGA 2FQ3A 1XSVA 4Y15A 2V79A 1I27A 3LQQA 1OMIA 1TLHB 2K7LA 5LEJA 4HLXA 1FLIA 1O3QA 1FP1D 3GFMA 3R4KA 2FMYA 3E5QA 2FEZA 3C7JA 2EB7A 1ZG1A 1J59A 2EA4A 1J5YA 1BI1A 3GVAA 3V4GA 5D5XB 1ODDA 1GVJA 4EQQA 5JVTA 3FHZA 5JI6A 2FA5A 5TJJA 1TW2A 3P9CA 2OU2A 1Z6RA 3HOSA 3QU3A 3E5XA 2L01A 1S3JA 3I53A 4A0YA 4HBLA 3F8MA 2JZYA 2FBIA 2JRTA 2JPCA 4L9VA 1LEBA 2GWRA 1YW8A 3ZMDA 2EFQA 3F22A 1RIOH 4IHSA 3E5UA 4A6EA 3SZTA 4I7HA 2K27A 4KN7X 4O3MA 3KP7A 4LB5A 1CGPA 3K1PA 4BHPA 2DPUA 2QBYB 2HEOA 1I1GA 5HLGA 3IRQA 2GIVA 3TGNA 4UV8A 3KP2A 1FWZA 3GFJA 4BHCA 4WXHA 1TNTA 3WTSC 3WU0A 2Z5UA 4ZH4F 3WTUC 3Q9SA 4QWQA 4WK8F 4BHBA 1K78B 1BOAA 3SFZA 1Z91A 2YPRA 1YW9A 3IKTA 4ETSA 2MA3A 5LGNA 2XAJA 2A6HF 2RGVA 2VONA 4Y13A 2PJPA 1P92A 1IN4A 5J6XA 2DLLA 3OOPA 3OV8A 4IVNA 4KICA 1U5TB 4EM2A 3GWZA 3BPVA 1RZ4A 2DT5A 4L9TA 1QGPA 2W24A 1XGSA 1HSTA 3CJNA 1XMAA 5ERIA 2OQGA 2W57A 3QPTA 4ENJA 2FMLA 1MD0A 1KQ9A 1TBXA 2OAZA 3CTAA 2C6YA 3KE2A 2HS5A 3HUGA 1YS7A 2P5LC 3KEQA 3WTTC 1U8RA 5FLXK 4B09A 4ZZDA 1IZ1A 2F2EA 3BJOA 4WWCA 3R6SA 3ISPA 1H9TA 4I02A 5HS8A 1PUEE 2FSWA 4UVCA 5CVJA 1B9NA 1YQAA 3VB2A 5CYVA 3TOAA 4E70A 1BM9A 1F1ZA 1ZAOA 1JHFA 2LNBA 3WU1B 4OOIA 1XDUA 4KN4X 3Q9VA 2ESNA 1WSUA 2PG4A 1WQ2A 1IW7F 1UHMA 4KMFA 2E7XA 1W7PD 4LG0A 1LDJA 2HTSA 4IRGA 4I0BA 4NQWA 1WKMA 4BQAA 2ACJA 4RGXA 2G7UA 2XKOA 4GGGA 3TDUC 4NB5A 1OPCA 4MQ9F 1NHAA 1DDNA 2ZXJA 3BOQA 2ELHA 2K4JA 4U7BA 3L09A 2RN7A 5CVVA 4RB2C 4MGRA 3E6CC 1IN6A 3RPQA 3F6VA 2HOEA 2ZBKA 4WXCA 2P7CB 4ZYEA 1MJAA 5ICCA 3BY6A 3REOA 2QQ9A 4Q4ZF 2IA1A 2HWVA 3IL2A 4YFKF 4A0XA 4HQMA 3N4MA 1RNLA 2P7VB 1OYYA 2DK5A 4KIBA 3EYIA 2KIFA 4GXOA 4CZZA 1FSEA 1ZHFA 3J81K 3NEUA 2TDXA 2Q8KA 4OIOF 4L9NA 1DPUA 2P8TA 3RPUA 3G3ZA 3R61A 1U5TC 1B6AA 1IN8A 4FHTA 3GLXA 1KU7A 2GZWA 3K69A 2RVCA 2BE5F 1P4AA 5DUKA 3RYPA 3HYIA 3TOBA 1I1SA 3K2ZA 1KYZA 5DDGA 1QZZA 3P9IA 1T2KA 5EEHA 2M8EA 1FYLA 1P6RA 4A2UA 4Z2YA 1VTNC 4P5OA 2UXNA 4R1HA 3FXQA 3H92A 4EJUA 3K0LA 3J81Z 3MFKA 1IRGA 3VEPA 3U9GA 3VODA 1JE8A 3JSOA 3R0JA 1HSJA 3ECOA 5DD8A 3DXJF 1EH8A 3I71A 5H20A 1MGTA 2VN2A 3EDPA 1V3FA 3C3WA 1IXCA 3TO6A 1YG2A 4G94A 1BIAA 2PQ8A 3P9KA 3F3XA 1E2XA 3CUQB 2FXAA 2STWA 1QBJA 3PQKA 3HSRA 4HF0A 1XMKA 4MEYF 5E20A 2J5PA 1XGOA 5DCMA 3K1NA 4S04A 1XN7A 3EYYA 2FRHA 2HZTA 2K4BA 1KYWA 5IT9Z 1EH7A 1KQ0A 3GFIA 4AVPA 4OU0A 1WRJA 2R7DA 3L7WA 1O7FA 4L5JA 1B9MA 2R7FA 3TO7A 1SAXA 4O5VA 2GXGA 1LDDA 3KEOA 5DCFA 2WTEA 2HGCA 4HA8A 4FX4A 5AONA 2FE3A 4HX4A 2HYFA 3IKVA 5ILUA 2WV0A 5LRSA 3MQ0A 3KETA 2ZNYA 3RKYA 3ML6A 4M9SA 3CLOA 1V4RA 5EEGA 6PAXA 2IJLA 2VE9A 4S05A 2GXBA 2MBFA 4L0ZB 3TDZC 2VC0A 2QBYA 3BWGA 3KLOA 2ZMEA 4YIFA 3T5XA 4ENNA 1BN5A 2G7HA 4MQVA 4LGWA 2EA2A 4A12A 2QQBA 4M9ZA 1TW3A 5D8LB 2QM3A 1K78A 5LHHA 5CVRA 5DEQA 3QAHA 4EV0A 2YSRA 1D8JA 2R3SA 4HF1A 1R1VA 3LQRA 4HOBA 1RUNA 1XSXA 3CO7C 3U1DA 2VBXA 1H0MA 2HKXA 3F23A 1JGSA 3O3KA 4PDKA 2A3SA 1G3YA 2D45A 4IRIA 2PMUA 1IRFA 3ZMVA 4OIQF 4EMSA 3KFWX 4CICA 4A6DA 4HF2A 1KU9A 3HRTA 3BPXA 1OR7A 4LLGF 4XLNF 4IXAA 5K5QA 3L00A 3ZMTA 3T1BA 4R8HA 4LK1F 3FM5A 3CUQC 3V8JA 1Z9CA 3MAJA 4UUVA 1R5HA 2GQQA 2HTJA 4FT8A 3O6BB 4JBAA 1DUXC 2KRFA 3E3VA 1R36A 2CSOA 3HHHA 4AIJA 5D6FA 2QYOA 5K1YA 4Q5SF 1QPMA 4L9JA 3WGGA 3FMSA 3JTHA 5L3FA 1YTYA 3LA3A 4IHTA 2HQNA 1TNSA 5BQTA 1T98A 5F6FA 2Q2EA 3TO9A 2ISYA 2BGCA 2CG4A 1BI3A 1ZG3A 2CW0F 1L3LA 3E6DA 4GYIA 1RUOA 2AXLA 3FXRA 1BI2A 1YLFA 2FU4A 2GA1A 3KP6A 4M72A 1I5ZA 3IC7A 3FXUA 4LFUA 1W5SA 3F8FA 1FBQA 4ON0A 2VC1A 3RDIA 4RB1A 1KGSA 2DBBA 4P9UA 3DP7A 4CHUA 4EGZA 5CVUA 2A69F 4MNUA 4BNCA 4EM0B 2MLGA 3QRFF 2DAOA 1REPC 3JTGA 2NRAC 2PBIA 3WTXC 4LMYA 3HRMA 3HRUA 1PP8F 1FYMA 2BV6A 4HX7A 4Y17A 3CUOA 1FY7A 4RB0A 2DQLA 5FD6A 1FP2A 1D5VA 2V6CA 2BYVE 2LF7A 2P5KA 5ICFA 4M6YA 3GZ5A 2JT1A 5D6EA 1ZREA 3KP4A 2M30A 4XLPF 5AIPA 2BEOA 2LKPA 3GW2A 3QP5A 1B4AA 4HDUA 4ZZLA 5BPDA 3FWEA 1HW2A 1R00A 4CDGA 2OBPA 3ERED 3WG9A 1LDKB 1GXQA 4HW0A 2CWEA 4CXFA 2KKOA 1LEAA 5FD5A 1XD7A 2VXZA 4A5NA 1J9IA 1A04A 2HR3A 2XAHA 2AS5F 1B1BA 1XB4A 2H09A 4KYWA 1MDMB 2L02A 1ZYRF 1GXPA 4F7ZA 2L3DA 3DQVC 2OA4A 2D1HA 3FZVA 3R60A 3D0SA 5HLIA 4G7HF 4KFCA 1U3EM 2G9WA 2DFIA 1ON1A 1XGMA 3QOPA 4M71A 2F5DA 5LRRA 2P6SA 1FT9A 1QQIA 2LDUA 4ZYHA 2NYXA 2Y75A 5FO5A 4OINF 1KU2A 2EWNA 2D2WA 5H6RA 5BMZA 2QENA 1SFEA 2B0LA 1OYWA 2LSOA 2H27A 3T8TA 5HS7A 1J2XA 3F8BA 2JSCA 2EFWA 2W25A 2FBKA 3RKXA 2DTRA 2MH9A 3RJPA 3DFGA 5AIQA 1IUYA 2EFNA 1S7OA 1LQ1A 1LJ9A 3W6KB 3I0TA 4RAZA 2Z33A 3K9TA 1C0WA 3R0AA 3WE2A 4ENKA 3V7SA 3WODF 2DU9A 2H94A 3DPLC 5HLHA 4G8XA 3KCCA 5L3DA 3GO5A 3PQJA 1YFHA 2DI3A 4IF4A 1F9NA 4U7DA 1FZPB 4M6X