4WXDA

Crystal structure of mycobacterium tuberculosis ogt-r37k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSKTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxdA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxdA01
2MH9A 4Y17A 2JT1A 5ED4A 4GGGA 1I1GA 2RKHA 4L18B 2EFOA 4L5IA 5D5WB 2HYGD 3GO5A 4P96A 1WI9A 5CLSA 2FOKA 1B59A 2HYFA 3WE2A 4WK8F 3F6OA 3H92A 3LA7A 1O3SA 4LLGF 1MDMA 4ZYDA 2MBFA 3TGNA 4G7OF 1RZ4A 4GXOA 1O7FA 1FYMA 3RYRA 4RB0A 5HLIA 2X0LA 1JXSA 2ELHA 4BH9A 5FD6A 5JFRA 2EV5A 4ON0A 2MH2A 4KN7X 4O6JA 1FPQA 4BNCA 1KQ8A 2O61A 2EA4A 4AD9A 1YW9A 5AIQA 5E17F 4CICA 4HQEA 3Q9VA 2QWWA 2R7FA 2GWRA 4IVNA 1OYYA 1YS7A 2VONA 4A6EA 5ILVA 2XVCA 3SZPA 5AIPA 3KE2A 4AIKA 3I0TA 5LRRA 3T8TA 1Z05A 4CGZA 1SD7A 4ZYHA 1O57A 2W85A 1IRGA 1TTYA 4A0ZA 1FOKA 4GYIA 1DPUA 1IN4A 1PDNC 4ENNA 2NYXA 4MTEA 2XGXA 2VOOA 3I54A 2MA3A 5HLHA 1LNWA 3P9KA 3HOSA 4BQAA 2QQBA 3RKWA 4U7DA 3WTYC 1H0MA 5IT9Z 2K4JA 2PFBA 1XB4A 4KMUX 3I5UA 5L3BA 4ESBA 4HF1A 2FA5A 3WTVC 2YU3A 3QP6A 4E70A 1V3FA 3CLOA 2NRAC 5DDGA 1JGSA 2LKPA 1CGPA 1HSTA 1FP2A 2HKOA 1W5SA 3IKVA 3JTGA 4I02A 3TOBA 3C1DA 3K9TA 4YIFA 3ZQ7A 4ZZDA 5FFZA 1JHFA 4DQ2A 1KYZA 1R00A 3M1EA 3MWMA 5E1WA 5D6EA 4FX0A 3VOEA 2ZNZA 1KU3A 1T0FA 2HR3A 1MJ9A 2RVCA 2VE8A 3KP5A 1X3UA 1MDMB 4U88A 3QAHA 3F72A 1T98A 2RN7A 3JAMZ 3K69A 1I1SA 4UV9A 3WU0A 2VODA 2E1CA 5E20A 2ZCWA 5D5VB 2GAUA 2M8EA 3LAJA 4AIHA 3GXOA 4XBFA 1V4RA 1XMKA 3PQJA 3EDPA 2QUFA 2XAQA 1UCRA 3T0YA 1TNSA 2OZUA 1IW7F 3K2ZA 4M9XA 2F5FA 3EETA 2COMA 1BI1A 5TJJA 5DYMA 1J2XA 4IRHA 4LB5A 5LGUA 1KU7A 3LWFA 3H3UA 4RAZA 1XDUA 1STZA 4RB2C 5FFXA 4EQQA 2XKOA 3IHUA 4HW0A 2M45A 4MEYF 1FYLA 2EV6A 2CQKA 2OQGA 1T6SA 2Y75A 3QU3A 3FXQA 3CUQA 3RPQA 4N9IA 5ICGA 4IPAA 4I0BA 4PZJA 5TRDA 2NAZA 4D0PA 4HV6A 2O8XA 1ZRFA 3SZTA 2HZTA 5ICFA 4M74A 2E7WA 2HWVA 3TO7A 1I27A 1R5HA 2PJPA 5DUKA 4BHCA 2ZO4A 2O03A 4CDGA 2XUBA 2K86A 1OR7A 1SMTA 2JTVA 4PGHA 2IRFG 4LLNA 4UUVA 4A5MA 4WWCA 1OMIA 1BC7C 2EA2A 2GXBA 2GA2A 4KNYA 2DT5A 3LFKA 1IAWA 4BHPA 3J81K 4XSXF 4KN4X 1U5TA 3WTUC 1F9NA 2HQNA 1ZG5A 3DP7A 1G3SA 2K02A 2XHKA 1ZREA 2ZJ2A 2EWNA 2DW4A 2XIGA 2VC1A 5H20A 3WU1B 4UV8A 1IF1A 1HXDA 3Q5FA 1WSUA 3MZHA 1ZRCA 3I64A 4ASNA 3RTRA 1YQAA 2Y48A 3KP4A 2EB7A 1PUEE 1IN7A 2DBBA 1FBUA 1OPCA 4WF2A 3HTUA 1HKTA 2YSRA 2ISYA 1ZLKA 3RYPA 3QPHA 1WKMA 4MGRA 3WTTC 2CG4A 3WGHA 4A5NA 1GHCA 4I98B 3S2WA 5CYVA 4R1HA 4M6YA 1O3QA 1R1VA 2VE9A 4O3MA 3LSTA 4HX8A 3MFKA 4EV0A 1PP8F 4P5OA 4HZFA 4AIJA 1B9MA 2V1DA 3IWFA 3ZMDA 2OD5A 4A0YA 1K78A 3LQRA 3F8NA 3J80Z 4F7ZA 3KZZA 1F4KA 3BJOA 1TNTA 2KIUA 2Z5UA 1KGSA 2PQ8A 1BN5A 1YLFA 1ZAOA 4U7BA 5BPDA 2LSOA 3E6CC 1B1BA 2O0YA 3RKXA 4RS8A 5JR3A 2ZKZA 2FMYA 2ESNA 3IL2A 3VB2A 1FYKA 4RAYA 1XMAA 2QQ9A 5CJ9A 3TKYA 4MNUA 5FLXK 4MTDA 2PMUA 2QLZA 4CXFA 3IRQA 1BBYA 3C3WA 1SMYF 3C18A 3CUQB 3ZN1A 1QQIA 4HF0A 4AWXB 2CYYA 2HKXA 4G6DA 4U0WA 1FX7A 2RV8A 1R36A 1QZYA 2HOEA 2XAHA 4ZZLA 2A07F 3ZMTA 1ON1A 3IC7A 3HUGA 4Q4ZF 1H9GA 2F5CA 4M72A 3KP3A 1XGOA 1RIOH 1IN5A 5E18F 3ZPLA 1U3EM 1B4AA 4NB5A 4TV7A 1KA8A 2G7HA 1K6OA 1S8NA 1XSDA 5FO5A 1QGPA 4HDVA 2BBYA 4KIBA 3R61A 4G94A 3FXUA 2BGCA 2H09A 1J5YA 5DV5A 5LEKA 3OOPA 3HRMA 1GXQA 3F8BA 2FF4A 2RNJA 2P7CB 1LEAA 3REOA 3TOAA 1WWXA 1L0OC 1BIBA 5CVJA 5L3CA 3ZMSA 2Q0OA 2HS5A 1F1ZA 3NEUA 4CYDA 3U9GA 2H27A 2UXXA 2HEOA 3ECOA 1P6RA 2WWYA 3BPVA 1K78B 2KIMA 3K0LA 2PEXA 1LB2A 1VTNC 1S7AA 2O6GE 2FE3A 2KRFA 3DEUA 1TW3A 1SD4A 3FF5A 4G8XA 1GXPA 1ON2A 4QLCU 4IF4A 3ERED 2CGPA 1BIAA 2VT2A 4GCVA 1ONVA 5AONA 4ENJA 3BWGA 2EFQA 3FZVA 3WG9A 1J7KA 4PCQA 4R79A 4YFKF 1UB9A 5BPIA 2XASA 2KJCA 4WCGA 4KIFA 4FX4A 1MJAA 4WXDA 1YYVA 1C0WA 2V1UA 5BS6A 4QWQA 1AWCA 1ZGAA 2A6EF 4EGZA 2ISZA 2IA0A 4GYGA 1LDJA 1ZGJA 1Z7UA 4Z2YA 4JBAA 5ICCA 1USSA 1BI3A 4HDUA 3I71A 5J8CA 4OMZA 4WXHA 2D45A 4OOIA 3L9FA 2PI0A 3KZYA 2NNNA 1XN7A 4I0AA 1HSJA 2VBYA 2FNAA 3B02A 4LJZF 1SD6A 4UVBA 5A2QK 3O2PE 2F2EA 4EJUA 2NNYA 3E3VA 4KUMA 4LK0F 4G7ZF 2KKOA 3GVAA 3BY6A 3LA2A 2M1BA 4A12A 2DPDA 2V9VA 4G6QA 3MEXA 2FSWA 5DUIA 2P5KA 1UHWA 2VBZA 4RB3C 4ENKA 3V7CA 3COAC 2DI3A 2FU4A 5J8FA 4HBLA 3RI4A 2RGVA 1G3WA 3CUOA 3L00A 5ILSA 4IRGA 2QYOA 3NQOA 2PBIA 4Y13A 2STWA 1W7PA 3M7GA 2JPBA 4UVCA 2H6BA 3FMQA 3F8FA 2A61A 1BOAA 3GFMA 5HVQC 2X4HA 3JSPA 1DDNA 3KETA 1AOYA 5LGTA 1P4AA 1QNTA 2K7LA 4LG0A 3JTHA 1KQ0A 4LLLA 2VC0A 2W84A 4HF2A 1ZYRF 5BOXA 1TQMA 1XSXA 3KEOA 5JHUA 2KJBA 1IXSB 2E1NA 5E1XA 3QOPA 4L9VA 1HW2A 2JSCA 3GFJA 3KLNA 1U78A 2VBXA 2VXZA 1Y0UA 2DTRA 2IT0A 1FP1D 2TDXA 2LF7A 4JQFA 5DCMA 1XDSA 1MD0A 3R60A 4U0VA 1O3TA 4MHGA 3W6KB 4HQMA 3FMRA 3KFWX 2CW0F 1FNNA 3HHGA 3HRTA 4RGRA 1G3YA 1S6LA 2JRTA 3V7SA 2V79A 2FRHA 4I2OA 2UXNA 4BYYA 1S7OA 3FX3A 2RC4A 3V8JA 1FBSA 2CO5A 1R1UA 2M87A 5KK1A 2QZ8A 3BP8A 5LGNA 5KVRA 5D5XB 4Q5SF 2HTSA 5K5OA 1K7AA 1LVAA 1HQCA 3PQKA 4OIQF 3ML6A 1R22A 4B8XA 2CWEA 2Z3YA 2VOPA 1FLIA 1XGSA 2WV0A 3E5QA 5L3GA 5LHGA 1Q1HA 3BZ6A 3J81Z 3QP5A 2KIFA 1KU2A 3GX4X 3RKYA 5E8IA 3GEZA 5IT3A 3DPLC 5ICEA 3GLXA 3QU6A 3QPTA 2QENA 5F6FA 1I6XA 3ECHA 4HAMA 2H94A 5HDKA 4I09A 3DQVC 3WODF 4UVAA 5CVIA 4HYEA 3VEPA 3F8MA 2D2WA 3FMSA 2IA2A 3CO6C 4EM1A 1PP7U 4OIPF 3GYHX 2QQAA 4HX4A 1W7PB 3PFIA 1HKQA 4CHUA 2P5VA 1S3JA 4ENMA 5FGMA 4B09A 4G9YA 1R23A 3GFIA 4LG0B 1MZBA 4ZYEA 3GW2A 2HDCA 5F64A 5DEQA 1USTA 4RGSA 4FHTA 4LD5A 3FXRA 4N9HA 2FBKA 3RPUA 3GF2A 2FBIA 3F6VA 3AAFA 1R5GA 1E2XA 1BJAA 2P6TA 3M8FA 1BC8C 1K79A 3HTSB 1ZN2A 2M5WA 2GXGA 3VODA 2OA4A 2Z9OA 4HX7A 3GWZA 5HOOA 2FMLA 4LK1F 4FT8A 3FWEA 3HSEA 4L0YB 2XAGA 3HYIA 3F23A 5L3FA 3L09A 1TW2A 5EEHA 3V7RA 4KYWA 2STTA 3BDDA 3CUQC 4A2UA 3B73A 5FLXZ 1O7LA 5K5QA 1HW5A 3P7NA 2W57A 2A68F 1FWZA 4MQ9F 1DP7P 2GA1A 5D4RA 2B0LA 4WXCA 5LLQA 2QM3A 3HSFA 5HS8A 1ZHFA 1P4XA 3E6MA 3WGGA 4M6XA 3U2RA 2EFWA 2P5LC 1FT9A 4YFNF 3MCZA 4UXNA 5DCFA 3WGIA 1U5TC 3LQQA 1BI0A 1QPMA 2DU9A 1DPRA 1LDDA 3SQNA 5L3DA 2P6SA 1IXCA 2ZFWA 1TBXA 6PAXA 3P9IA 1Z91A 1ZG3A 1LDKB 2DK8A 1FSHA 1FY7A 2XAFA 2QVOA 4HLXA 1U5TB 4YIIA 2LF8A 1U2WA 1FSEA 5D8KB 3TO9A 5H6QA 3DV8A 1D8KA 3ELKA 3ZMVA 1ULYA 4ETSA 4IHTA 4RB1A 4HOBA 4KICA 1KQ9A 4OINF 3JW4A 1YW7A 4ESJA 3WTXC 2OQRA 3DF8A 3KP6A 2BV6A 2Z99A 3E5XA 2EV0A 2DO7A 4EJWA 2ACJA 2ZNYA 1TQPA 3BOQA 2IA1A 3KLOA 3TDZC 3FHZA 1S29A 1B9NA 4H0EA 1XCVA 2MD5A 3SHFA 2VBWA 1YG2A 4PGGA 1R58A 4ESFA 5CVUA 3IWZA 1W4MA 2C6YA 3DKWA 2OBPA 1TLHB 3KCCA 2V1XA 4BHBA 4PDKA 1CF7A 4R8HA 3P9CA 2QBYA 3HRUA 4HLYA 2Y0MA 3V4GA 5K5RA 1Z6RA 1IZ1A 2XRNA 3ISPA 3J7AO 2JPCA 4KFCA 3K1PA 1YW8A 3TQNA 5BQTA 1O3RA 1YTYA 2XKPA 3QRFF 2EK5A 3GZ5A 4P9UA 3N4MA 1G4DA 1D5VA 2VN2A 5J6XA 3ZMZA 4ZYGA 5DD4A 1T38A 2YR2A 3ABUA 1B6AA 3R6SA 2ZXJA 1LQ1A 3K1NA 3EYIA 5D5UB 1RUNA 1RI7A 3DFGA 1TQIA 4L9JA 1P92A 1ZLJA 3F8CA 3T8RA 2IVMA 2YPRA 4EJOA 1SFUA 3N97A 5A2QZ 3T1BA 4EMSA 4AVPA 1A04A 4RGXA 5D6FA 4S05A 3RJPA 1J59A 3WTSC 3TO6A 1FZPB 4LB6B 3W6JB 4HV5A 5DD8A 2MC3A 3I4PA 2IW5A 1MKMA 2Q2EA 3HOTA 2DLLA 1IN6A 4YG2F 3G3ZA 1Z1DA 2UZKA 2ZMEA 1Z9CA 3GFLA 3O6BB 5K1YA 2IJLA 3EYYA 2XAJA 2E7XA 5CVRA 3VFZA 3HIFA 3V8KA 3ZP5A 2AXLA 3DPTA 2D1HA 5IT9K 3FM5A 2H6CA 4XLNF 1EH8A 4BAYA 4IRIA 2ESHA 1UHMA 1SFXA 1IRFA 1EH6A 3I53A 1HKSA 1SAXA 1SFEA 4EJVA 1D8JA 1U6GA 3LA3A 1RNLA 2OU2A 1ODDA 4XLPF 1ZH5A 4GO1A 2YX7A 1CF7B 4I01A 4BXUA 2BE5F 4M9SA 2RDPA 2HFHA 2QBYB 1XD7A 3WTWC 3CO7C 1U8RA 1YIOA 5JI6A 3H3ZA 3T5XA 2P8TA 5F1RA 4EM2A 2IP2A 2W25A 4MQVA 2CSOA 4IJAA 2A5YB 4Y15A 3WE3A 2K4BA 1J0RA 1QBJA 4LFUA 2BYVE 5LEJA 3GZ6A 3EUHA 1QZZA 2G9WA 2L01A 1SD5A 1MGTA 5E1ZB 4L9NA 5L3EA 2HGCA 1J9IA 4U0YA 3JAMK 2J5PA 1P4WA 3HRSA 4CO8A 3M8EA 3ZN0A 2O3FA 2FQ3A 4Q47A 4L9TA 1J75A 2HTJA 2EFPA 2V6CA 4O5VA 4EJTA 1IN8A 1L3LA 2PMHA 3K1MA 1I5ZA 3F22A 3F21A 2EFNA 3MQ0A 3SXYA 5JVTA 1EH7A 2Z33A 2LDUA 3DXJF 2ZBKA 3U1DA 2DK5A 2YX4A 4L0ZB 4P9FA 1W5TA 1YS6A 2BEOA 4JK1X 3O3KA 4XRFA 1HW1A 2IPQX 1JE8A 1WRJA 1KU9A 3EQLF 2R3SA 3IRRA 1YO5C 4IXAA 3ZMUA 1DUXC 1REPC 5LRSA 1XGNA 4EM0B 2PN6A 2DFIA 5HS7A 2JZYA 2ZMEB 3D0SA 2ETHA 1LEBA 2DPUA 2GQQA 4MEXF 5EEGA 3L7WA 4OIRF 1G6NA 2P7VB 3ULQB 4Q48A 2PG4A 4KIGA 2HQRA 4OU0A 4EGYA 4K2EA 3JSOA 5D8LB 2L54A 3BJ6A 3R0JA 2Q8KA 1OYWA 3I58A 3OV8A 1BM9A 1FC3A 3E97A 2FEZA 2A3SA 5LBQA 3HHHA 1HBXG 3FM3A 2D1VA 2L4AA 2NS0A 1LJ9A 3R4KA 2OAZA 3KP7A 1T2KA 2AS5F 1JHHA 3BROA 4NHJA 5CVVA 4A0XA 4UNOA 2GIVA 1R7JA 1NHAA 4LMYA 3M9AA 1ZRDA 5ERIA 3E6BA 2DAOA 5DCMB 1BI2A 1XCBA 2ADUA 3I59A 3RDIA 2LNBA 1P2FA 4ZH4F 3KP2A 5FD5A 1ZARA 1EV7A 4M73A 5HDNA 2A69F 3F3XA 3MZYA 2K27A 2F5EA 2FNPA 1QO0D 3HSRA 4DNCA 3J80K 2P4WA 2F5DA 2G7UA 1FBQA 1IXRC 3BJAA 4G7HF 2W24A 1D3YA 4EVIA 3IKTA 2OZ6A 3L2CA 2CFXA 3BPXA 1XGMA 4KT5C 5BMZA 1OKRA 1Z6TA 3C7JA 3CJNA 4N0BA 2R7DA 3CTAA 3GUDA 5H6RA 3SFZA 5ILUA 3D5LA 1R1TA 1ZG1A 3ABTA 4XSZF 4A6DA 1H9TA 4IHSA 2L3DA 3CDHA 5E8GA 5LHIA 3G73A 4NQWA 4OIOF 2FBHA 4CZZA 4RGUA 4M9ZA 3LAPA 4I7HA 1RUOA 2M30A 2WC2A 1UFMA 4WX9A 3ROUA 1T39A 3KEQA 2VT3A 2PLYA 2EJRA 4KDPA 4UHTA 1E17A 1W7PD 4M71A 1MJBA 4LGWA 1WQ2A 5HS9A 2RQPA 4L5JA 4P55A 3NRVA 4YFXF 1OYIA 1IUYA 4KA4A 3MAJA 2L02A 3WTZA 2UWMA 2A6HF 2WTEA 2J5OA 3TDUC 2L4MA 5D4SA 3E6DA 3E5UA 2GZWA 4HA8A 2MLGA 1F5TA 1G3TA 5HDGA 1XSVA 2XV4S 5LHHA 2DQLA 2MLKA 2XROA 4KMFA 2DQRA 4S04A 3Q9SA 1KYWA 5HLGA 5FB2A 3I59B 1GVJA 4OMYA 2FXAA 3RIRA 1YFHA 3V8LA 3R0AA
chains in the Genus database with same CATH superfamily
2MH9A 1J26A 1WCMJ 3AFHA 5IV8B 4Y17A 2JSPA 4B3AA 2JT1A 5ED4A 1ETWA 4GGGA 2ICWG 5AE2A 2EM9A 1UILA 1I1GA 2RKHA 2X6WA 3AG1H 5IWAE 4L18B 2EFOA 5M5XJ 3JRBA 4L5IA 2FJ1A 5D5WB 4JI1E 3BF2A 2HYGD 3GO5A 3Q0VA 4P96A 2EOIA 1G2FC 2VLAA 1WI9A 2QF7A 1VQLI 5CLSA 2FOKA 1EKEA 1A1HA 1S72I 1I3AA 1B59A 2XF5A 2HYFA 3WE2A 3T1HE 4WK8F 3F6OA 1FIAA 1X19A 3A03A 3H92A 3LA7A 5FKOA 1O3SA 4P78A 4R2SA 4LLGF 1MDMA 4DV7E 1YUIA 4BJTA 4X65E 4ZYDA 2MBFA 3TGNA 4G7OF 1RZ4A 1ZBQA 4GXOA 2RNGA 1MH3A 1O7FA 2DMIA 1FYMA 3ESWB 1GLNA 1NK3P 2LP0A 3RYRA 5EF6A 1IC8A 2VI6A 4RB0A 5HLIA 1WJAA 2X0LA 1JXSA 1D1BA 3S17J 2ELHA 4BH9A 2XGCA 5FD6A 1NEIA 4RA2A 5JFRA 2EV5A 2KHMA 2LVSA 2MABA 2MH2A 4ON0A 4KN7X 4CA0A 2B7TA 3BIDA 3DBHB 4O6JA 1FPQA 2NVQJ 2BVLA 1IO2A 4BNCA 1KQ8A 2L5QA 2O61A 2EA4A 4AD9A 1YW9A 5AIQA 5E17F 2EQRA 2K3FA 3CP8A 3A01B 2V26A 4NQWB 4CICA 2HZDA 1GQEA 4HQEA 3VWBA 3Q9VA 2IBDA 2QWWA 2AHQA 3SJMA 2R7FA 2GWRA 4R2DA 2EQ3A 1V5FA 4QPQA 2Y69H 2MFZA 4IVNA 2I8DA 5M3FJ 1OYYA 1YS7A 3S3MA 2VONA 4A6EA 5ILVA 2XVCA 5EYRA 2I9IA 3GTOJ 3H3VK 1G59A 3SZPA 1O4XA 1B72B 4BGDA 2LC2A 2VKVA 5AIPA 5DNYA 4XLHA 1Z3YA 3KE2A 1Z21A 3I0TA 4AIKA 4M9VC 5LRRA 3T8TA 1Z05A 3VSKA 2MGQA 4CGZA 1SD7A 1FOYA 2IGOA 2QQ8A 1SVOA 3CCYA 4ZYHA 2ZXWH 1A35A 3HKZA 1O57A 3OOUA 2W85A 1IRGA 1TTYA 1A1KA 4A0ZA 1ETVA 4NNJA 1FOKA 4GYIA 1XPXA 1DPUA 2X1EA 4MFDA 1IN4A 4PJNA 1PDNC 4ENNA 3IH4A 1SVMA 3BCAA 4HEIA 2JPAA 3ADLA 4LFBE 2NYXA 4ABZA 4B3TE 1YZ9A 4MTEA 2XGXA 2EZ6A 2VOOA 3I54A 3QYFA 5IYDJ 3OYMA 2HC5A 2HHHE 2MA3A 1BB8A 5HLHA 1LNWA 3P9KA 4C3JJ 4XORA 4LG3A 3HOSA 4BQAA 3IWDA 1VQOI 3RMPA 2L9SA 2QQBA 3RKWA 4U7DA 3WTYC 3FIGA 3IH2A 1IV8A 3I56I 1H0MA 4X9JA 4F54A 4GZNC 4Y33A 5IT9Z 5FKKA 2IS4A 3MKZA 2EMXA 2K4JA 2PFBA 3RPUD 1UMQA 1XB4A 1MIJA 1YYOA 4KMUX 3I5UA 5L3BA 4ESBA 1TP4A 4R2RA 4O5GA 1I94E 4HF1A 5J1UA 2GIZA 2D9HA 2FA5A 3I4MJ 5KAIC 1W0TA 2VQHA 3B6AA 1TWHJ 2W82A 4YY3E 1A31A 3WTVC 2ODRD 4F9CB 3EQ1A 4DV0E 2EOXA 2YU3A 2CW7A 3QP6A 2GOMA 3G1OA 1T8IA 4E70A 4HTGA 1V3FA 3K70D 1YIJI 2OJED 3CLOA 2YUSA 2ZB9A 4X66E 2NRAC 5DDGA 1JGSA 2LKPA 4FETA 3LSIA 1CGPA 3L2WA 4R03A 4IQJA 5F0HA 3G4SI 1HSTA 2BZTA 4N4RB 1FP2A 2EOQA 1U9OA 2HKOA 3M99B 1BW6A 1W5SA 3IKVA 4ZC3A 4Y7NJ 3HZJA 1RR7A 3JTGA 4I02A 4F92B 3HG9A 3LSPA 2WBSA 1IUFA 4A3KJ 5IT9C 3TOBA 2CSHA 3OR1C 1YI2I 2I13A 3C1DA 3K9TA 1X47A 4YIFA 3ZQ7A 4LF5E 5K7HA 4ZZDA 2LH9A 5FFZA 1JHFA 4DQ2A 1KYZA 2R7UA 1R00A 3M1EA 3MWMA 5E1WA 3WHCA 5D6EA 3G71I 1XG1A 4FX0A 5C3EJ 1YX5A 3VOEA 2ZNZA 1KU3A 1T0FA 1WJDA 1R71A 2K9MA 2HR3A 1MJ9A 3GZNB 2RVCA 2VE8A 3KP5A 1X3UA 3PUBA 4XL9A 2M8GX 4U88A 3QAHA 4UB8C 1MDMB 1ZKGA 2EPAA 3F72A 3TBIA 1T98A 4D5FA 2RN7A 2VJIA 3JAMZ 3K69A 1I1SA 4UV9A 3WU0A 4XRMA 2VODA 2R1FA 2F4IA 2EPNA 4UUTA 2E1CA 5E20A 4ITVA 2ZCWA 2WAQN 5D5VB 5C4JJ 5M5WJ 2OF7A 2V4JC 5J1YA 3MZ8A 2X1CA 2GAUA 3CC4I 2M8EA 1GUUA 3PO3J 3LAJA 3HC7A 4AIHA 5IP6A 2L7FP 3GXOA 4XBFA 1ETYA 1V4RA 4R2CA 1Z0XA 1KZHA 1XMKA 4FE4A 5F0FA 3PQJA 3EDPA 1UBDC 4KT6A 3E1SA 2EM8A 3HPSA 2QUFA 1X6FA 1VQ7I 2EQ0A 2XAQA 1UCRA 2NXNB 3T0YA 1TNSA 4JX5A 4E4HA 2OZUA 1IW7F 3K2ZA 4M9XA 2F5FA 2R7OA 3EETA 2COMA 1ETXA 1DQ3A 5A6AA 1BI1A 2V1NA 1JK1A 5TJJA 1IDYA 5DYMA 1J2XA 4WSGA 2DJIA 3HL2A 1JUPA 4IRHA 4LB5A 4IJDA 1AA7A 2O9LA 5LGUA 2EN1A 1KU7A 4X62E 2GLIA 1I6HJ 2JUGA 1NTCA 3VYRB 3LWFA 4A3DJ 1LFBA 1BA5A 2YTJA 2RSMA 3H3UA 3DCFA 4RAZA 3CMMA 3FBNB 3OS1A 3S2HJ 3JAMC 1XDUA 2K3PA 2EMZA 1F2IG 2ELJA 1STZA 3AV0A 4LTYA 4RB2C 5FFXA 4EQQA 1MMSA 4BDZA 2MKDA 2XKOA 3IHUA 4HW0A 2EPZA 1X4OA 1IBLE 2M45A 4MEYF 1FYLA 2EV6A 3TL4X 2CQKA 2OQGA 1T6SA 2TCTA 2Y75A 3QU3A 3OYHA 2JUCA 1R49A 2LOOA 2Y9YA 3FXQA 3CUQA 3RPQA 4N9IA 2MYSA 4E7JA 5ICGA 4IPAA 4I0BA 4PZJA 5TRDA 2NAZA 4D0PA 4HV6A 2O8XA 2OPTA 1ZRFA 4E7ZA 3SZTA 2HZTA 1P7IA 3LSHA 5ICFA 3BG7A 4M74A 1WJEA 1ZU1A 2WAEA 3CESA 2E7WA 2HWVA 3TO7A 1I27A 1R5HA 4CCJA 1A36A 2L2MA 4B3ME 2WCC3 1EKZA 2PJPA 5DUKA 1Y8QB 3M1CA 4BHCA 4DYQA 5C44J 2H1LA 2ZO4A 2FTXB 2HDWA 3LMLA 2O03A 2CV2A 5GPAA 4CDGA 2XUBA 3ZQQA 2M9HA 2ELYA 5KL7A 5EDNA 2K86A 1OR7A 1SMTA 2JTVA 3K4BA 4PGHA 2IRFG 2IXSA 4LLNA 4A5MA 4UUVA 4WWCA 2VUMJ 3S15J 1OMIA 2K40A 1BC7C 2EA2A 2GXBA 2GA2A 4KNYA 3CLQA 3H35A 2DT5A 3LFKA 4MO7A 4BHPA 1IAWA 3J81K 1JUMA 4XSXF 1Z1BA 4KN4X 1U5TA 3WTUC 1F9NA 3BR1A 2HQNA 2JWOA 1ZG5A 3HOVJ 3DP7A 4DBRA 1G3SA 2K02A 2XHKA 1HNWE 1ZREA 2ZJ2A 2N8XA 2EWNA 2DW4A 2XIGA 2VC1A 5H20A 3WU1B 2F4OB 4UV8A 1IF1A 1HXDA 1ZAAC 3OYGA 2EN7A 1TC3C 3A02A 4NUBA 3Q5FA 1WSUA 3MZHA 1RR8C 1ZRCA 4M2ZA 1A5JA 1WJFA 3THNA 5LFAA 2VPRA 3I64A 3C6KA 4ASNA 2VJ5A 3RTRA 1YQAA 2Y48A 3KP4A 3OYAA 2F6CA 3F0CA 2E5NA 2EB7A 2WB1N 3WG7H 3S3OA 1PUEE 3NARA 1IN7A 5E3NA 4DV1E 5EG0A 2DBBA 1FBUA 1OPCA 4WF2A 2GXAA 2DYSH 3EUHC 1MEYC 2NUEA 4JI2E 1UZCA 2EOMA 4OWRB 3HTUA 2JYAA 1W5CC 1PYVA 1QU3A 4RAFA 1HKTA 2V9PA 2YSRA 2RQLA 1SR9A 5TISC 4ANJA 2DLKA 3ZGKA 2ISYA 1BW5A 1F36A 3TW7A 1Y0NA 1ZLKA 2ID6A 3RYPA 3QPHA 4LOCA 3VYXA 1WKMA 4MGRA 3WTTC 3C6MA 2CG4A 2R93J 3WGHA 4A5NA 1GHCA 4I98B 3S2WA 5CYVA 4R1HA 3AKZA 4M6YA 1O3QA 4BE0A 2QKLB 1R1VA 2RS6A 5CQGA 3SDGA 2VE9A 4O3MA 2JY9A 3LSTA 4B3RE 3EPJA 1FTTA 4HX8A 1YRNA 4FE7A 3MFKA 2ZJPF 2V86A 4AYBN 2DDAA 2E72A 2Q8UA 3ABKH 4TUGA 4EV0A 1PP8F 1VQMI 4IEJA 1HLVA 2VPLA 4P5OA 4HZFA 4AIJA 2R5YA 5FRMA 2YTGA 3BT9A 1FTZA 2DA5A 4DGWB 1B9MA 4FCYA 2NA2A 2V1DA 3IWFA 2IHR1 1K6YA 1WHQA 3ZMDA 2OD5A 4A0YA 1K78A 3LQRA 3F8NA 2JA8J 3J80Z 4F7ZA 1JI8A 3QQAA 1DGCA 3KZZA 1F4KA 3BJOA 1A6IA 1TNTA 2KIUA 2E34A 2Z5UA 3WU2C 5FLMJ 1KGSA 3FK6A 4O4KA 2GOXB 3HPGA 2PQ8A 5EEAA 2K85A 5GTIC 3AG4H 1BN5A 1YLFA 1ZAOA 4U7BA 4IKFA 3OWTA 3ZCOA 5BPDA 1WI3A 4Q35B 1ENHA 4F2JC 2LSOA 1YSAC 4IHYA 2EPCA 3E6CC 2LJHA 2HI3A 2CT1A 1B1BA 2O0YA 3RKXA 4RS8A 2V83A 5JR3A 2ZKZA 2FMYA 2ESNA 4JI3E 2X6XA 4CCLA 3IL2A 2YZTA 5KL5A 3VB2A 4BL0B 1FYKA 4RAYA 2EOSA 2M4GA 1XMAA 2QQ9A 5CJ9A 3FXLA 3TKYA 4MNUA 2LKXA 2EN4A 1YYWA 2ECBA 2VQCA 2R7XA 5FLXK 3D5RC 2EOJA 4MTDA 4A3BJ 2PMUA 2LUPB 2LRDA 2QLZA 4PJJA 1X1AA 4CZCA 4CXFA 1XMOE 3BTCA 3IRQA 4DUYE 4AC0A 1BBYA 2ELZA 3DPUA 3C3WA 1XMXA 3NWSA 1SMYF 1IQSA 3C18A 3UR3C 3CUQB 3ZN1A 4LFAE 5T6JA 1QQIA 3J80C 4HF0A 4AWXB 1XMQE 2M7AA 1MNMC 2CYYA 3VHTB 2HKXA 4G6DA 2ENAA 2KL4A 2DLQA 4U0WA 3OSGA 1FX7A 4XLFA 1RPWA 2RV8A 2O5RA 4IHXA 1ZBTA 1DU6A 1R36A 4BY7J 4WSPA 1QZYA 3HPZA 4R2QA 3LNQA 3CCJI 3FDYA 4DW6A 2X85A 2HOEA 1VQPI 2EN3A 2XAHA 4ZZLA 5GTHC 2A07F 2EL4A 3ZMTA 2EOZA 1ON1A 3IC7A 4XIDA 3HUGA 3S1QJ 2H36X 2YTOA 4Q4ZF 2YU9J 1H9GA 2F5CA 4F3QA 4M72A 3KP3A 2MD0A 2Y0SA 1XGOA 3IWCA 1RIOH 3K4MA 3SZGA 4C3IJ 1IN5A 1WPKA 3ZQFA 5E18F 2HDDA 3ZPLA 1ERDA 1YJ9I 1U3EM 1YPNA 1A1IA 4XKBA 2Y2ZA 2KDOA 2HQAA 1G2DC 1B4AA 4BBYA 3ONQA 2TRTA 1TWFJ 4NB5A 3BR0A 3GTQJ 5GAGJ 4TV7A 3Q0WA 2H8WA 2EPRA 2M1SA 3CJQB 2VIXA 1KA8A 2G7HA 3CCUI 5IYCJ 1OFCX 4UY8I 1JGGA 1K6OA 3M8JA 3GTPJ 1UAAA 4A3IJ 2KHXA 3CP2A 1S8NA 1VQNI 1XSDA 5FO5A 1MW7A 3HOWJ 4GKJE 2MDGA 2DMYA 3HOXJ 1QGPA 2R0QC 5EG0B 4HDVA 2BBYA 2B63J 4DZJA 4KIBA 4DOZA 3R61A 4JX6A 4PK4A 2BW3A 1QA6A 3D5SC 3ZQCA 4G94A 2E2IJ 3K10A 3FXUA 3IAM2 3D1NI 2KOUA 1SANA 2BGCA 2H09A 1J5YA 2LJUA 4BXXJ 2H8RA 2M0MA 5DV5A 3L2VA 3S14J 3F6GA 3JRGA 5LEKA 3OOPA 3HRMA 3LSKA 1GXQA 2V85A 3F8BA 2FF4A 2RNJA 1MH4A 4XR6A 2PJRA 2P7CB 3KPHA 2CW8A 4DKKA 1WHNA 1LEAA 2DMTA 2LY2A 5KAFC 3REOA 3TOAA 1WWXA 1L0OC 4D7NA 1BIBA 5CVJA 4S0HB 5L3CA 4IX7A 3H9QA 4AUXA 1YRNB 5F04A 3C4BA 4OX9E 4FASD 3K4NA 1H88C 2V9KA 4B3XA 3ZMSA 2Q0OA 2HS5A 1F1ZA 3S1MJ 1PVEA 4C2MJ 4BDYA 2JA7J 3NEUA 4CYDA 3U9GA 2R5YB 4ZJZA 2H27A 3Q3SA 2UXXA 2HEOA 1WZ2A 2FV4B 1N33E 3ECOA 1PJQA 1P6RA 3MVPA 2WWYA 2HVRA 3BPVA 1K78B 1IMUA 2KIMA 4JV5E 3K0LA 2DFEA 5DM7F 2DA2A 2PEXA 2ENHA 5EZGA 3S16J 1LB2A 2VQLA 2I10A 1VTNC 1S7AA 1UJ8A 2EPFA 3RKQA 2YRMA 2O6GE 2VKHA 2FE3A 5AC5A 3DEUA 2KRFA 1TW3A 1SD4A 2QCOA 2N3HA 4IOAF 1X49A 3FF5A 2EL6A 2L3CA 4G8XA 1GXPA 1ON2A 4QLCU 4IF4A 2EM4A 1LFUP 2Y31A 3ERED 4FTHA 1GV2A 4AM3A 1RQ0A 4IZZA 2CGPA 3HBLA 1BIAA 2L9NA 4MFEA 2VT2A 2JXPA 4GCVA 1ONVA 5AONA 4ENJA 2HOTA 3CCEI 3BWGA 2Z2SB 3S2DJ 2EFQA 3FZVA 4PJ0C 2K9LA 3WG9A 5FKMA 2IAIA 2AQEA 1ZTRA 3K4KA 3OSFA 1J7KA 2B7EA 4PCQA 1RETA 3KX2A 3A2KA 4R79A 2EMWA 4YFKF 3JTZA 1YITI 3F9KA 1UB9A 5BPIA 4DR5E 2XASA 2KJCA 3CF2A 2EPXA 5LMUE 2E2JJ 4WCGA 4FQGA 1EJ9A 4KIFA 4FX4A 1MMAA 1EF4A 1MJAA 2ME6A 4WXDA 1YOVB 1YYVA 4BQNA 3OYFA 1C0WA 2V1UA 2LY1A 5BS6A 4IHWA 1WJBA 3ZOQB 3LSRA 3OYIA 4ZDLA 4QWQA 4KJZA 1AWCA 4DIQA 4Y3OA 5A6JA 1ZGAA 2DMNA 2A6EF 4EGZA 3MHSC 2ISZA 1Z67A 2IA0A 4GYGA 1LUJB 1LDJA 4QPOA 1ZGJA 1MBGA 1Z7UA 4Z2YA 1VQ4I 2YT4A 2M3AA 4JBAA 5ICCA 4XKCA 1JT6A 1MNEA 1USSA 1BI3A 3WHBA 3HUGB 5HLTA 1OCPA 4HDUA 2FUG2 2L92A 2UUBE 1G8XA 3I71A 3VPRA 5F3WA 5J8CA 4D9JA 3QG5C 4OMZA 1IRZA 3CF5F 4WXHA 2V8QB 2LCEA 2D45A 3BTIA 4BS9A 4CCOA 4OOIA 4HNVA 2BY3A 3G1MA 1R6RA 1MBFA 2JWTA 1Q1VA 3L9FA 5KHDA 4LF6E 2PI0A 5LD2C 3KZYA 5LMNE 5CPRB 2NNNA 1XN7A 4I0AA 1JK2A 1HSJA 1X6HA 1ETOA 1ORKA 2FNAA 2VBYA 3B02A 4LJZF 1SD6A 2BHZA 4UVBA 4KZSA 5BR8E 5A2QK 3LOCA 1MBJA 2X1DA 3O2PE 3V42A 2F2EA 4HSRA 4EJUA 2NNYA 3MSWA 4LIVA 2VQEE 2E1OA 3E3VA 4XRSA 3C2GA 3OL4A 5F0CA 2VQGA 1STUA 2FGGA 4KUMA 3PNYA 4LK0F 4G7ZF 2KKOA 2YWQA 1A1FA 1FMVA 3GVAA 1WVRA 3JCUC 4DYRA 1ZR2A 1NK2P 3BY6A 3H5NA 3LA2A 1FIPA 2JOBA 4KWYA 2LFBA 4IOCF 3AL0C 5CKTA 2M1BA 1HDPA 2F4VE 2DMUA 4A12A 3PL8A 4XOTA 2DPDA 2V9VA 2HVQA 3HGGA 3HKZN 4G6QA 3IAS2 3MEXA 4B1RA 2FSWA 4NXNE 3VSLA 4B4CA 2YTQA 4YIRX 1TT5B 5DUIA 5AE1A 2P5KA 3N05A 1UHWA 2VBZA 4RB3C 2W1OA 4AU7A 5KL2A 4OOGC 4ENKA 3V7CA 3KIOA 1DQUA 1E3HA 2PJRB 3RQ4A 2VRDA 3C4TA 3AL0B 1OLTA 2DI3A 3COAC 2FU4A 5J8FA 2DOFA 3SEZA 3DTEA 1F43A 3ZOBA 3TP0A 2XC7A 4NZVA 4W97A 3W3CA 1Y56A 4D1QA 4V2GA 4HBLA 3BTLA 2ECCA 3RI4A 3SEQA 2RGVA 1G3WA 1UELB 4B44A 4HNUA 4NXME 3CUOA 4BKXA 3I4NJ 1X4PA 2DA1A 2OTLI 3DWLE 3L00A 5ILSA 3HPHA 4I99C 3A0HC 3LSJA 1HF0A 1VQ8I 5FLVA 3DEEA 1X3ZB 4IRGA 2QYOA 3CD6I 3NQOA 2PBIA 4Y13A 4XN3A 5IY5H 2STWA 1W7PA 3M7GA 2JPBA 4UVCA 2UXCE 2H6BA 2EE8A 3H9GA 3FMQA 3F8FA 2A61A 3LLHA 1BOAA 3GFMA 2X6OA 5B1AH 5HVQC 5J4VA 2X4HA 3JSPA 2G0EA 2HNHA 4BU2A 3KETA 1DDNA 3GTMJ 1AOYA 5LGTA 4MIMA 1P4AA 2LK2A 1QNTA 2K7LA 1N78A 4V2FA 4LG0A 3JTHA 4P7DA 1KQ0A 3BQZA 4LLLA 3PM1A 2WBMA 1A1GA 2E19A 2DFHA 2VC0A 2W84A 4HF2A 1ZYRF 3PJRA 5GP9A 2J7JA 2CU7A 1A1JA 5BOXA 4GDFA 3AUZA 4DR4E 1TQMA 1WXRA 1XSXA 3OMYA 1G2HA 3KEOA 1P7JA 4A3LJ 5JHUA 2KJBA 1IXSB 2E1NA 5E1XA 3QOPA 1MBHA 4L9VA 3OYNA 2LTPA 1HW2A 2QSGX 2JSCA 3GFJA 5M3MJ 3KLNA 4NBQA 1U78A 5E3OA 2VBXA 2VXZA 5A6BD 2WBUA 2W7NA 2XB0X 2L33A 3QYEA 4DJAA 2E5LE 4J19A 1Y0UA 1S5LC 4NC7A 2DOEA 2DTRA 4NHRA 4J01A 2IT0A 2BY1A 4M0VA 1YX3A 1FP1D 2TDXA 2AXTC 2LF7A 4JQFA 1CQTA 1T08B 1QVTA 1XDSA 5DCMA 4B48A 2ZSHB 2VQFE 2UU9E 1MD0A 4CSWA 3K4CA 2DT7B 3R60A 3M4OJ 2IGKA 4U0VA 1O3TA 4MHGA 4I6ZA 3K7AJ 3I55I 3E0JB 3EPZA 3W6KB 2YTIA 4HQMA 1D0XA 4Y52J 2KFDA 1X5WA 3M07A 2X6YA 3FMRA 3KFWX 3DLAA 1YYKA 2CW0F 1FNNA 2RTXA 3HHGA 3HRTA 4RGRA 4JI7E 1RRJA 1EA3A 1G3YA 1OJLA 2CMPA 2ID3A 3CDIA 4JI8E 5IOZA 2LVHA 1S6LA 2JRTA 3V7SA 2V79A 1I50J 2UXBE 2FRHA 3ZRGA 4I2OA 2Y9ZA 3QODA 2UXNA 4BYYA 4I8OA 1S7OA 5TSEA 3FX3A 2RC4A 2KZVA 2L3JA 3V8JA 1FBSA 3BBGA 2FOWA 2CO5A 3OMLA 1R1UA 2M87A 5KK1A 1APLC 1SEUA 2F48A 3CCLI 3QPSA 2QZ8A 3BZKA 4F9AB 3BP8A 4RMNA 5M5YJ 5LGNA 1J09A 5KVRA 3S93A 5D5XB 2Z1DA 4Q5SF 3DTKA 2KIQA 5IP7J 5HNHA 3PIPF 2HTSA 2CUFA 4C2UA 5K5OA 2YTDA 1K7AA 1FOWA 4G12A 1X1PA 1LVAA 1IRXA 3DU5A 3ABLH 1HQCA 1POGA 3PQKA 1K61A 4OIQF 2LYCA 2ZXHA 1B69A 2XB5A 1T4LB 3ML6A 2B7VA 3J7ZI 1R22A 3HOZJ 2VE7C 2DYRH 2CWEA 2Z3YA 4B8XA 2VOPA 1V55H 1XGSA 1FLIA 2JA6J 2IGMA 4K0KE 1YE9A 1GDTA 2WV0A 3TEDA 2XSDC 3JU0A 4OAZA 3E5QA 2KRHA 1ZR4A 5L3GA 3VK6A 1PKPA 5LHGA 3G6EI 1BR2A 3O8HA 1DP3A 1Q1HA 3BZ6A 1XNRE 4O24A 4CCMA 2M34A 5HNFA 5IPAA 3J81Z 3DF6A 2UUCE 3QP5A 2FD5A 2KIFA 1KU2A 3FXJA 3RKYA 1QHHD 3OS2A 3GX4X 1W36C 1AKHA 5E8IA 2WY8Q 3GEZA 5IT3A 1Y39A 4LF9E 2EPPA 3DPLC 2KT0A 3GLXA 5ICEA 2LBSB 3QU6A 3RZDJ 5IP9J 2X48A 3QPTA 3W2VA 4YHHE 2QENA 5F6FA 3OYDA 3A1YA 3OL3A 5LL6R 2RPCA 1I6XA 2JN6A 1K83J 4XK4A 3P5JA 2XPUA 2XSJC 2VJ4A 3ECHA 4HAMA 2H94A 3O8GA 5HDKA 4I09A 1NG7A 1H8AC 2OCCH 3DQVC 3WODF 2NVXJ 4UVAA 5CVIA 4HYEA 3VEPA 3A0BC 3K4LA 5K7ZA 3F8MA 2D2WA 3FMSA 2IA2A 3CO6C 4HEA2 2EM7A 4EM1A 1ZELA 1PP7U 2MC4A 4KITB 1MMGA 3GYHX 2QQAA 4P1WA 2QGUA 4HX4A 4OIPF 1W7PB 2KMUA 1T0FC 3PFIA 4FISA 2EM0A 2YU8A 1HKQA 3BGHA 3J7AG 3MKYB 4XLAA 4II3A 4CHUA 1FMWA 2P5VA 1S3JA 4ENMA 1TT0A 1JJ6C 5FGMA 4B09A 2L0KA 1VQ9I 2D5VA 1OCTC 2EILH 1D1AA 2CFOA 4G9YA 1R23A 5JLXA 3GFIA 2EZKA 4JI4E 4LG0B 4A3GJ 1MZBA 3J81C 1Y8RB 1QU6A 1OISA 3GW2A 4ZYEA 2HDCA 5F64A 4M30A 4BE1A 4AVZA 3BG9A 5DEQA 1USTA 1AHDP 5EGOA 3LFUA 5J1RA 4RGSA 4FHTA 4BEHA 2L6MA 1GT0C 4LD5A 3FXRA 4N9HA 2FBKA 3RPUA 2JVAA 4LF7E 3GF2A 2LMZA 2YU5A 2FBIA 2IGNA 2DIXA 4PFPA 2XPVA 3F6VA 3ZR8X 3MD2A 3AAFA 2V88A 1R5GA 1E2XA 1BJAA 1RESA 2DDBA 4XLCA 3U21A 4F91B 2P6TA 2BOLA 3EUKL 3M8FA 1VFCA 4A93J 2NS7A 1BC8C 3OIQA 1K79A 1V5GA 2JRMA 3HTSB 1ZN2A 2M5WA 3CDLA 4H4KC 4WFTA 1KYQA 2GXGA 4KISA 1JT0A 3VODA 2R76A 1RKWA 5TGTA 2OA4A 2Z9OA 4HX7A 1Z7LA 2ENCA 3GWZA 2EM6A 5HOOA 2FMLA 4LK1F 4FT8A 1GV5A 3JRAA 5FRNA 4E7HA 1VF9A 3FWEA 3HSEA 2PMZA 3CZ6A 4L0YB 1U9NA 2XAGA 3HYIA 2BVMA 4X1EA 3Q0UA 3F23A 5L3FA 3L09A 4JOMA 4LIUA 4J8ZA 1TW2A 2WADA 5EEHA 3V7RA 2EMHA 4KYWA 3KYDB 2STTA 2HU9A 3HQ1A 2W00A 2RS7A 3BDDA 3CUQC 4A2UA 2MG4A 1BJZA 5E3MA 2EQ1A 3B73A 1M1EB 5FLXZ 1Y1WJ 3LL7A 4YRVA 1O7LA 4PSXA 2IS1A 5K5QA 1HW5A 2PMZN 2JVHA 2W57A 3P7NA 4NDLA 2A68F 1FWZA 2F4MB 4MQ9F 4E6KG 3DLLF 1DP7P 2MC5A 2GA1A 5D4RA 2B0LA 1BR4A 1LKXA 2CV1A 4WXCA 1TL8A 5LLQA 3ASNH 3FHNA 4HPQA 4F55A 3NAUA 2QM3A 3BC8A 3FXKA 4U87A 3HSFA 5HS8A 2UUAE 5GADJ 1ZHFA 2WY7Q 1P4XA 1T95A 1VQKI 4D5CA 3E6MA 1OR7C 4M6XA 3WGGA 1XX5A 4M3FA 3U2RA 4E7IA 2XRLA 5ADZA 2EFWA 4XONA 3S8PA 2EMIA 2P5LC 1FT9A 4YFNF 2L9RA 3GCMA 2Y30A 3GLLA 3MCZA 2M7BA 4UXNA 5DCFA 3WGIA 2RAEA 2W4SA 1A1LA 1RC9A 1U5TC 3DTIA 3LQQA 3KZIC 1BI0A 1QPMA 1T33A 4QIWN 2DU9A 1DPRA 1LDDA 3SQNA 3W6VA 5L3DA 4N4NB 2Z16A 2P6SA 1N77A 1IXCA 2ZFWA 1TBXA 3JRIA 6PAXA 3P9IA 1Z91A 1ZG3A 5FLXC 4J00A 1LDKB 2DK8A 2EM2A 1FSHA 2LREA 1FJGE 1W1WE 2R7RA 1AKHB 3A01A 1FY7A 2XAFA 3JRDA 4RBOA 2QVOA 1V5EA 4B3SE 2DA4A 2UV1A 4HLXA 1PDAA 1U5TB 4LITA 4YIIA 3PSFA 2LF8A 2OCEA 3KYLA 1U2WA 2KLOA 2OTJI 2ZM6E 3LSMA 1FSEA 5D8KB 2DMPA 1ZQ3P 4X8WA 4QTRA 3TO9A 1YUJA 5H6QA 1XC5A 3DV8A 2LMDA 4EEFG 1D8KA 2Y0SN 3ELKA 1H89C 3EPKA 3ZMVA 1ULYA 1OCRH 1I3QJ 3CMYA 2VASA 4ETSA 3BR2A 3H36A 3OYJA 4IHTA 2K4VA 4RB1A 2YTPA 4HOBA 4KICA 3DU6A 4XICA 4XMYA 1WH5A 1KQ9A 2JK3A 1PJRA 4OINF 1WJPA 3JW4A 2CH0A 4YELA 1YW7A 4A3CJ 4ESJA 3WTXC 2OQRA 3DF8A 3S3NA 2EM5A 4DR2E 5JHFA 1D1CA 3KP6A 4NC6A 2L8TA 4CCNA 1WGXA 2MC6A 1KONA 3LSGA 3CC2I 4X64E 2BV6A 2Z99A 3E5XA 4KHPE 2EPUA 2EV0A 2VB6A 2HYJA 2DO7A 4EJWA 2EMKA 2ACJA 2ZNYA 5EGOB 1TQPA 3BOQA 3MHHC 2IA1A 3KLOA 2EIJH 3TDZC 1S29A 3FHZA 4BEHB 1VNDA 1B9NA 1JKQC 1BOBA 4H0EA 1XCVA 3K70C 4BQOA 1B8IA 4WPYA 2MD5A 3HOYJ 4NC8A 2VBWA 1YG2A 3SHFA 4PGGA 1RMDA 4W1UA 3CCMI 2EMFA 1RC7A 3BG5A 1R58A 3PNVA 3EUAA 4ESFA 2EJ4A 2EPOA 2JOXA 5CVUA 5J40A 1BBGA 2E36A 3IWZA 3CQZJ 2M9AA 2GLOA 1W0UA 4R8OA 1W4MA 4M6VA 1TN9A 2C6YA 2AQFA 3G2BA 3DKWA 4BUPA 2OBPA 1TLHB 3RSNA 1JKRC 3KCCA 3ZQIA 1TWGJ 2V1XA 4BHBA 2JMWA 4EATA 2EP3A 4PDKA 4BBSJ 4HRIA 1CF7A 2HVSA 1UN6B 2QSHX 4R8HA 1SFOJ 3P9CA 4BC9A 2QBYA 3W2AA 2CJJA 3HRUA 3BG3A 4HLYA 2Y0MA 3IP4B 3V4GA 5K5RA 2UXDE 2EL5A 1Z6RA 2WA0A 3GTKJ 1DGWY 2KQRA 1IZ1A 1T56A 2XRNA 2B3TB 3ISPA 4B47A 3J7AO 2R7ZJ 2JPCA 1QVUA 4KFCA 3K1PA 4PJLA 1MBKA 2F8BA 1YW8A 2ADRA 1WHUA 3TQNA 5BQTA 3DBRB 4ZTFA 1O3RA 5CFFE 2LY9A 3THOB 4XRSG 2XKPA 1YTYA 2LRSA 2YSPA 3QRFF 1NG6A 1QZEA 5FROA 2EN6A 2X9DA 2ELKA 2EK5A 1O0WA 3EPHA 2P0WA 4YEJA 3GZ5A 3UNGC 4P9UA 3N4MA 1G4DA 2R7SA 1LVKA 1D5VA 4PJMA 4X0GA 4D7MA 4DUZE 2DODA 2XPWA 2VN2A 5J6XA 1N34E 4LFCE 3ZMZA 4ZYGA 1YHQI 2ME0A 4OAYA 5CQEA 5DD4A 4RHBB 3RZOJ 1T38A 2YR2A 4BQQA 4L5EA 4UB6C 3PSIA 3ABUA 1B6AA 3R6SA 3S1NJ 1IV6A 4DZPA 1N3GA 2RQQA 2X51A 2ZXJA 1LQ1A 5BNGA 1N32E 3K1NA 5EJCA 3EYIA 1JKOC 1OQYA 5D5UB 1RUNA 1RI7A 3DFGA 1ZGWA 1TQIA 4A3MJ 3ZXSA 1BL0A 4RM2A 3L2UA 4L9JA 1YJWI 2IS2A 2NVYJ 1P92A 1E3PA 1ZLJA 4HSTA 3F8CA 2V87A 2CUEA 2DA3A 3OYBA 1FEXA 1JUSA 3T8RA 1HNXE 2IVMA 2YPRA 4M3EA 1OCCH 4CCKA 4EJOA 1AH5A 4FK5C 3M3YJ 4ZDPA 1SFUA 3UKGA 1Y1VJ 3W2WA 3N97A 3J7AY 5A2QZ 2YTNA 3T1BA 2HGHA 4EMSA 1DU0A 3TMOA 4AVPA 4A3EJ 2VJJA 4BJ6C 3L2QA 1LFPA 3DBLB 1A04A 4RGXA 5D6FA 1WJ5A 1K4TA 4S05A 3MN2A 3RJPA 3B6CA 3PIOF 1J59A 2KP6A 2WBTA 2VL8A 4LU9A 3WTSC 1ACIA 3TO6A 2DFFA 5KNLA 1FZPB 2JJ7A 2R7QA 4LB6B 1FOXA 2JR1A 2COBA 2E71A 2CS3A 2ZC2A 3H5AA 4M3GA 3W6JB 4F6NA 3J7YJ 1JTXA 4HV5A 5DD8A 4Z6YA 5JLWA 2BW3B 2MC3A 2WV1A 3I4PA 1N75A 2IW5A 4Y4RA 3HXLA 4LF8E 2BXYA 2ZFUA 1XS9A 1MKMA 2Q2EA 3HOTA 2CPNA 3C2HA 4LF4E 1X1BA 2DLLA 1IN6A 1U0JA 4YG2F 2DN0A 2CUJA 2ZXIA 3G3ZA 4BJ5C 4PSWA 2MKNA 1Z1DA 2MSYA 2XDVA 3K2AA 2UZKA 2ZMEA 4XQFA 4BACA 1Z9CA 3GFLA 1J5EE 3OR2C 5A2QC 3O6BB 3IUOA 5K1YA 4GKKE 2IJLA 1B8IB 3EYYA 2XAJA 2E7XA 5CVRA 3VFZA 3ADGA 3HIFA 2LD5A 3V8KA 2JP9A 3ZP5A 2AXLA 2MW8A 3H9JA 2A25A 4GFBA 5GAEJ 1Z3XA 3DPTA 2D1HA 5IT9K 1HDDC 3FM5A 3UK3C 2H6CA 4XLNF 1EH8A 2KZGA 3VYUB 4UUSA 5HODA 4BAYA 5IOYA 4F93B 2DOAA 4IRIA 4RLFA 1T4NA 2ESHA 1UHMA 1SFXA 2YRKA 3HJEA 1IRFA 3GTJJ 1SVLA 4XN0A 1EH6A 3ASOH 1HKSA 3I53A 4II2A 1SAXA 3SDBA 5KL6A 1N36E 5C4XJ 3OTOE 2LBFA 4IL6C 1SFEA 4EJVA 4A3JJ 1D8JA 4XM3A 1U6GA 3LA3A 2GPIA 1TF6A 4BC7A 5J4YA 1RNLA 2OU2A 1ODDA 4XLPF 1ZH5A 2V89A 4O43A 4DR6E 1KJKA 2VKEA 4GO1A 2A5WA 2YX7A 3IH3A 1CF7B 4I01A 4BXUA 2BE5F 4M9SA 2RDPA 2EIKH 2HFHA 2YS9A 1XD7A 3OYKA 3WTWC 3CO7C 2QBYB 2N8GA 2R7VA 2P81A 1U8RA 2LT7A 1YIOA 5JI6A 3H3ZA 3T5XA 2QEXI 2P8TA 4JP0A 1MNDA 5F1RA 4EM2A 2K9NA 2IP2A 5E79C 1ETQA 1HR0E 2W25A 5F08A 2MDRA 3DJWA 2UUZA 2YRHA 4MQVA 3X2QH 2OC6A 3JRHA 1GZ6A 2CSOA 4ZDOA 4IJAA 2KONA 3FIWA 2LV2A 1V54H 2DA7A 5F27A 2A5YB 4HG2A 3L2RA 2XGEA 4Y15A 2E1MA 2EN8A 3WE3A 1OCZH 2K4BA 2WAQA 1MSEC 1J0RA 3P1XA 3RQIA 5E3LA 1QBJA 4LFUA 2CRGA 2BYVE 2DB2A 5LEJA 3GZ6A 2R4GA 1NH3A 2HOSA 3EUHA 2E35A 4CUGA 1QZZA 2G9WA 2L01A 1SD5A 2M4IA 1UG2A 3H0GJ 3S1RJ 1IBME 2KPMA 1MGTA 3H0DA 3F6HA 5E1ZB 2K5CA 4L9NA 5L3EA 2HGCA 2V7FA 3CCVI 2VF1A 2EZLA 3PO2J 5IYBJ 1J9IA 4U0YA 2IEKA 3E7LA 4JYAE 3JAMK 2J5PA 1UG0A 2GHFA 2EMAA 5KL4A 1P4WA 2BY2A 3HRSA 2L7ZA 3M8EA 4CO8A 3DKXA 2R92J 2EOHA 3OS0A 3ZN0A 1AU7A 1JJ8C 1PJSA 1IQOA 2HXOA 1JTYA 5DM6F 2OUMA 2O3FA 1S9HA 1LPQA 2EMCA 1TWCJ 2YTEA 1SFKA 2FQ3A 3QWLA 4JX4A 4Q47A 2R5ZA 3JR9A 1ETKA 4L9TA 1J75A 2HTJA 4E7SA 2EFPA 4IHVA 1QHGA 2V6CA 1RKTA 4O5VA 4EJTA 2LTRA 1DI2A 4DV6E 1IN8A 2L2OA 3GBGA 3BR5A 1L3LA 3T1YE 2JVGA 2DRPA 2PMHA 2R7TA 1D0YA 2VKDA 2CUZA 2XAUA 2N3GA 3K1MA 1I5ZA 4MLVA 2XGDA 5DS9A 1TF3A 2QSFX 3F22A 3F21A 2L2NA 2EFNA 3MQ0A 3FKJA 5B66C 2K9SA 3SXYA 5B1BH 5JVTA 2BHYA 1EH7A 2Z33A 4XOPA 2EOFA 3FXMA 2EZIA 2LDUA 1MBEA 3CJTB 3DXJF 2ZBKA 4C3HJ 2CV0A 3U1DA 2DK5A 5B5EC 4DV5E 2EM3A 3H1CA 5EZHA 2YX4A 3ERMA 2EMBA 1A6QA 4L0ZB 4AIDA 4BXFA 2KISA 4P9FA 2HPIA 1W5TA 4C2TA 1YS6A 1UHZA 1L4SA 2BEOA 4JK1X 1T4OA 2XF6A 3O3KA 2ZMEC 3VYTB 4XRFA 1HW1A 2IPQX 4IO9F 1QPIA 4L5NC 1JE8A 3HTXA 4E7LA 2OV7A 2WAFA 1WRJA 1KU9A 3G1LA 2YTFA 4DV3E 3EQLF 4DMIA 2R3SA 3IRRA 2ZJRF 2BB8A 2ZJQF 4G6TB 3U1KA 1MMNA 1P9QC 1YO5C 4IXAA 3ZMUA 2Q2EB 3CC7I 4RAGA 1DUXC 2DJNA 2ZSIB 3LMMA 1X2NA 3S32A 4RDUA 5LRSA 1REPC 1XGNA 2LO3A 4EM0B 4Q28A 2KRCA 1BR1A 2PN6A 2DFIA 5HS7A 4R2PA 2LE2A 2JZYA 1K4SA 2EBIA 3JREA 2ZMEB 4JI5E 2PX9A 4XKWA 2WZOA 3D0SA 3BR3A 2ETHA 1LEBA 1VZ0A 1E0EA 2DPUA 2YSOA 5AE3A 3ADJA 2FQ4A 2O7OA 2GQQA 5H2FC 4ZTJA 4MEXF 2EPLX 3PFYA 1IGNA 1LE8A 3JRCA 2BY0A 5EEGA 3BZCA 3L7WA 4OIRF 4CH7A 2HPMA 2WB1A 4UUSB 3EPLA 1G6NA 2P7VB 3BLYA 3ULQB 4Q48A 3CMAI 5AC4A 2PRTA 2PG4A 2GBYA 4KIGA 4C30A 5KL3A 3FK7A 5GPCA 2EOEA 2I5UA 2HQRA 4MLOA 4RLQA 2LBFB 4OU0A 3I3LA 4EGYA 4K2EA 1TWAJ 4R2AA 3DKYA 3JSOA 4BCAA 3ABMH 1IBKE 2CQXA 4MLQA 5D8LB 4JI0E 2E1MC 2L54A 2B9SA 1X58A 3BJ6A 3R0JA 1WJCA 2Q8KA 1OYWA 3I58A 5J47A 3CCQI 1JKPC 4GEQB 2W48A 3OV8A 4N4OB 1IDZA 3FISA 3TP3A 1BM9A 1FC3A 3MKLA 2NOJB 3E97A 2HQ5A 2R7WA 4DV4E 2FEZA 2A3SA 4C9YA 2A6TA 5LBQA 3HHHA 4RM3A 4E7KA 3BTJA 1HBXG 3ZQHA 4JI6E 3OYLA 2NVTJ 2DGCA 3OYCA 4B43A 4AYBA 3I9V2 2QA4I 3QPLA 3FM3A 9ANTA 2EMGA 2CQQA 2D1VA 2L4AA 2NS0A 1E3OC 5FJ8J 1IG7A 1LJ9A 3HGYA 3QYBA 3R4KA 2E1MB 2OAZA 1PUFA 3KP7A 1ZK8A 1T2KA 2AS5F 3OY9A 1JHHA 2DMQA 3BROA 4NHJA 1ITYA 3HM5A 3HDDA 5CVVA 4A0XA 1R9TJ 4UNOA 2GIVA 1PJTA 2H1KA 1R7JA 1NHAA 4LMYA 4XKVA 3M9AA 1ZRDA 5J3LA 5ERIA 5B3SH 1SC7A 2L2KB 3E6BA 5IXMB 2DAOA 1P47A 2HXIA 5DCMB 1BI2A 1XCBA 1FKAE 1HOMA 2ADUA 3I59A 2V6EA 2LTSA 3RDIA 1UHSA 2LNBA 1LLMC 4BE2A 1P2FA 4ZH4F 1Z77A 3KP2A 5FD5A 2DT6A 4CYCA 1ZARA 4A3FJ 4PUSA 3RCOA 3MKWB 1EV7A 4M73A 1X1DA 2EINH 5HDNA 2A69F 3F3XA 5A69A 2BXZA 2K27A 3MZYA 5FKLA 2EH3A 1QRYA 2F5EA 2FNPA 1R5ID 2DXIA 3PNTA 3KWRA 1WH7A 4TUIA 1QO0D 2JA2A 2EWLA 1NCSA 3HSRA 4DNCA 3J80K 2R5ZB 1AAYA 2P4WA 2F5DA 4M3BA 2G7UA 3BG6A 3JRFA 2HJJA 4F52A 3K6GA 1FBQA 1IXRC 3BJAA 4G7HF 2RSIA 4DV2E 1MMDA 2W24A 4A69C 4PFOA 1D0ZA 1D3YA 4EVIA 3OYEA 1GVDA 3IKTA 2EOYA 2OZ6A 3L2CA 4L8NA 2NABA 2CFXA 3IV5A 3BPXA 1XGMA 4KT5C 2CQNA 5KCMA 4DYCA 2F5VA 5BMZA 3TW6A 2M2EA 2GM4A 1HNZE 1OKRA 2LKSA 4DR3E 3BQYA 3ADIA 1Z6TA 3C7JA 1X2MA 4XNFA 3CJNA 4N0BA 1HA8A 5A6BA 3TQMA 4I76A 2R7DA 1XTAA 2XF7A 3OIOA 1GTKA 3MMYB 4X6AJ 4RH8A 3CTAA 3GUDA 3SYTA 4DR7E 5K7FA 3VYSB 2DSYA 3KYCB 3ECRA 2M4KA 5H6RA 2M7QA 3SFZA 2EIMH 5ILUA 2E2HJ 1SAUA 1X3CA 3D5LA 2LLKA 4ZYAA 2K7IA 1R1TA 1ZG1A 3A4CA 3L1PA 3ABTA 3BCBA 2NVUB 2EMYA 3ZQGA 1VQ6I 4XSZF 4A6DA 3H09A 1H9TA 4IHSA 4R2EA 2L3DA 2DTZA 2AO9A 3CDHA 5E8GA 2KDZA 2VXDA 3J7Yp 5LHIA 2NS8A 4DBQA 2L9VA 3G73A 2DCEA 4NQWA 2CQ7A 1YJNI 4OIOF 3ZQLA 3BR6A 3CJRB 2EOOA 2FBHA 2EPKX 1TZLA 4CZZA 4RGUA 3FXOA 1X1CA 3CCRI 3HOUJ 2NUFA 2NUGA 4M9ZA 3LAPA 4I7HA 2EPMX 4IS1C 2L7KA 4DR1E 2QKMB 1RUOA 4BBRJ 1BBOA 2M0CA 3IWBA 4HNTA 1VI0A 1B72A 2M30A 2WC2A 4XLEA 2YPNA 1UFMA 2E5ZA 2EN2A 1LE8B 4WX9A 1HCRA 3ROUA 3KEYA 2EMLA 4JYKA 1T39A 4WYQB 2LR8A 3HEFA 3KEQA 2VT3A 3QOEA 1XNQE 2PLYA 5AASA 3AG2H 1W36D 2RREA 5DTDA 2EZHA 3H5RA 3NWTA 2EJRA 4KDPA 4UHTA 5JVGF 1E17A 1W7PD 4M71A 1MJBA 4LGWA 3CCSI 2Q1ZB 1MSFC 2EORA 1WQ2A 5HS9A 5F1JA 4M3DA 3OIPA 4V19K 3K4JA 2RQPA 1HC8A 4L5JA 3GMEA 4P55A 2ODRC 1X3WB 3NRVA 4YFXF 1OYIA 1IUYA 1OCOH 5FKNA 4KA4A 3MAJA 4GRIA 2L02A 3WTZA 2NOGA 4AQYE 3PUFA 2CTDA 2UWMA 2A6HF 1X6EA 3K6QA 1U8BA 1WFXA 1FJLA 3CMEI 2WTEA 2J5OA 2E60A 3TDUC 2DA6A 2L4MA 3AG3H 5D4SA 3E6DA 3E5UA 2A05A 2GZWA 1PUFB 3HB9A 1R4NB 4IQ4A 1DGRM 1X48A 4BMJA 4HA8A 2FX0A 2MLGA 3FKIJ 2LG4A 1G3TA 5GAHJ 1F5TA 4QSHA 1VQ5I 4F9BB 2K9QA 1XSVA 1N25A 2XV4S 2DQLA 5HDGA 2L7MP 5LHHA 3C2BA 1IJWC 2MLKA 4BY1J 2LUQA 2XROA 4KMFA 2DQRA 3VYYA 2O8KA 2HOAA 3VDXA 1Y6IA 4S04A 3Q9SA 1ZR9A 2B9DA 1KYWA 1S7EA 5HLGA 3GTGJ 5FB2A 3I59B 1I39A 2JA5J 1D5YA 1GVJA 2JQ7A 3DEWA 4OMYA 2FXAA 3RIRA 3SFIA 4CYCB 1YFHA 2BBGA 3GTLJ 5A6KA 4F6MA 2IS6A 3FBIB 3V8LA 3R0AA 1R4MB
chains in the Genus database with same CATH topology
2MH9A 4Y17A 2JT1A 5ED4A 4GGGA 1I1GA 2RKHA 4L18B 2EFOA 4L5IA 5D5WB 2HYGD 3GO5A 4P96A 1WI9A 5CLSA 2FOKA 1B59A 2HYFA 3WE2A 4WK8F 3F6OA 3H92A 3LA7A 1O3SA 4LLGF 1MDMA 4ZYDA 2MBFA 3TGNA 4G7OF 1RZ4A 4GXOA 1O7FA 1FYMA 3RYRA 4RB0A 5HLIA 2X0LA 1JXSA 2ELHA 4BH9A 5FD6A 5JFRA 2EV5A 4ON0A 2MH2A 4KN7X 4O6JA 1FPQA 4BNCA 1KQ8A 2O61A 2EA4A 4AD9A 1YW9A 5AIQA 5E17F 4CICA 4HQEA 3Q9VA 2QWWA 2R7FA 2GWRA 4IVNA 1OYYA 1YS7A 2VONA 4A6EA 5ILVA 2XVCA 3SZPA 5AIPA 3KE2A 4AIKA 3I0TA 5LRRA 3T8TA 1Z05A 4CGZA 1SD7A 4ZYHA 1O57A 2W85A 1IRGA 1TTYA 4A0ZA 1FOKA 4GYIA 1DPUA 1IN4A 1PDNC 4ENNA 2NYXA 4MTEA 2XGXA 2VOOA 3I54A 2MA3A 5HLHA 1LNWA 3P9KA 3HOSA 4BQAA 2QQBA 3RKWA 4U7DA 3WTYC 1H0MA 5IT9Z 2K4JA 2PFBA 1XB4A 4KMUX 3I5UA 5L3BA 4ESBA 4HF1A 2FA5A 3WTVC 2YU3A 3QP6A 4E70A 1V3FA 3CLOA 2NRAC 5DDGA 1JGSA 2LKPA 1CGPA 1HSTA 1FP2A 2HKOA 1W5SA 3IKVA 3JTGA 4I02A 3TOBA 3C1DA 3K9TA 4YIFA 3ZQ7A 4ZZDA 5FFZA 1JHFA 4DQ2A 1KYZA 1R00A 3M1EA 3MWMA 5E1WA 5D6EA 4FX0A 3VOEA 2ZNZA 1KU3A 1T0FA 2HR3A 1MJ9A 2RVCA 2VE8A 3KP5A 1X3UA 1MDMB 4U88A 3QAHA 3F72A 1T98A 2RN7A 3JAMZ 3K69A 1I1SA 4UV9A 3WU0A 2VODA 2E1CA 5E20A 2ZCWA 5D5VB 2GAUA 2M8EA 3LAJA 4AIHA 3GXOA 4XBFA 1V4RA 1XMKA 3PQJA 3EDPA 2QUFA 2XAQA 1UCRA 3T0YA 1TNSA 2OZUA 1IW7F 3K2ZA 4M9XA 2F5FA 3EETA 2COMA 1BI1A 5TJJA 5DYMA 1J2XA 4IRHA 4LB5A 5LGUA 1KU7A 3LWFA 3H3UA 4RAZA 1XDUA 1STZA 4RB2C 5FFXA 4EQQA 2XKOA 3IHUA 4HW0A 2M45A 4MEYF 1FYLA 2EV6A 2CQKA 2OQGA 1T6SA 2Y75A 3QU3A 3FXQA 3CUQA 3RPQA 4N9IA 5ICGA 4IPAA 4I0BA 4PZJA 5TRDA 2NAZA 4D0PA 4HV6A 2O8XA 1ZRFA 3SZTA 2HZTA 5ICFA 4M74A 2E7WA 2HWVA 3TO7A 1I27A 1R5HA 2PJPA 5DUKA 4BHCA 2ZO4A 2O03A 4CDGA 2XUBA 2K86A 1OR7A 1SMTA 2JTVA 4PGHA 2IRFG 4LLNA 4UUVA 4A5MA 4WWCA 1OMIA 1BC7C 2EA2A 2GXBA 2GA2A 4KNYA 2DT5A 3LFKA 1IAWA 4BHPA 3J81K 4XSXF 4KN4X 1U5TA 3WTUC 1F9NA 2HQNA 1ZG5A 3DP7A 1G3SA 2K02A 2XHKA 1ZREA 2ZJ2A 2EWNA 2DW4A 2XIGA 2VC1A 5H20A 3WU1B 4UV8A 1IF1A 1HXDA 3Q5FA 1WSUA 3MZHA 1ZRCA 3I64A 4ASNA 3RTRA 1YQAA 2Y48A 3KP4A 2EB7A 1PUEE 1IN7A 2DBBA 1FBUA 1OPCA 4WF2A 3HTUA 1HKTA 2YSRA 2ISYA 1ZLKA 3RYPA 3QPHA 1WKMA 4MGRA 3WTTC 2CG4A 3WGHA 4A5NA 1GHCA 4I98B 3S2WA 5CYVA 4R1HA 4M6YA 1O3QA 1R1VA 2VE9A 4O3MA 3LSTA 4HX8A 3MFKA 4EV0A 1PP8F 4P5OA 4HZFA 4AIJA 1B9MA 2V1DA 3IWFA 3ZMDA 2OD5A 4A0YA 1K78A 3LQRA 3F8NA 3J80Z 4F7ZA 3KZZA 1F4KA 3BJOA 1TNTA 2KIUA 2Z5UA 1KGSA 2PQ8A 1BN5A 1YLFA 1ZAOA 4U7BA 5BPDA 2LSOA 3E6CC 1B1BA 2O0YA 3RKXA 4RS8A 5JR3A 2ZKZA 2FMYA 2ESNA 3IL2A 3VB2A 1FYKA 4RAYA 1XMAA 2QQ9A 5CJ9A 3TKYA 4MNUA 5FLXK 4MTDA 2PMUA 2QLZA 4CXFA 3IRQA 1BBYA 3C3WA 1SMYF 3C18A 3CUQB 3ZN1A 1QQIA 4HF0A 4AWXB 2CYYA 2HKXA 4G6DA 4U0WA 1FX7A 2RV8A 1R36A 1QZYA 2HOEA 2XAHA 4ZZLA 2A07F 3ZMTA 1ON1A 3IC7A 3HUGA 4Q4ZF 1H9GA 2F5CA 4M72A 3KP3A 1XGOA 1RIOH 1IN5A 5E18F 3ZPLA 1U3EM 1B4AA 4NB5A 4TV7A 1KA8A 2G7HA 1K6OA 1S8NA 1XSDA 5FO5A 1QGPA 4HDVA 2BBYA 4KIBA 3R61A 4G94A 3FXUA 2BGCA 2H09A 1J5YA 5DV5A 5LEKA 3OOPA 3HRMA 1GXQA 3F8BA 2FF4A 2RNJA 2P7CB 1LEAA 3REOA 3TOAA 1WWXA 1L0OC 1BIBA 5CVJA 5L3CA 3ZMSA 2Q0OA 2HS5A 1F1ZA 3NEUA 4CYDA 3U9GA 2H27A 2UXXA 2HEOA 3ECOA 1P6RA 2WWYA 3BPVA 1K78B 2KIMA 3K0LA 2PEXA 1LB2A 1VTNC 1S7AA 2O6GE 2FE3A 2KRFA 3DEUA 1TW3A 1SD4A 3FF5A 4G8XA 1GXPA 1ON2A 4QLCU 4IF4A 3ERED 2CGPA 1BIAA 2VT2A 4GCVA 1ONVA 5AONA 4ENJA 3BWGA 2EFQA 3FZVA 3WG9A 1J7KA 4PCQA 4R79A 4YFKF 1UB9A 5BPIA 2XASA 2KJCA 4WCGA 4KIFA 4FX4A 1MJAA 4WXDA 1YYVA 1C0WA 2V1UA 5BS6A 4QWQA 1AWCA 1ZGAA 2A6EF 4EGZA 2ISZA 2IA0A 4GYGA 1LDJA 1ZGJA 1Z7UA 4Z2YA 4JBAA 5ICCA 1USSA 1BI3A 4HDUA 3I71A 5J8CA 4OMZA 4WXHA 2D45A 4OOIA 3L9FA 2PI0A 3KZYA 2NNNA 1XN7A 4I0AA 1HSJA 2VBYA 2FNAA 3B02A 4LJZF 1SD6A 4UVBA 5A2QK 3O2PE 2F2EA 4EJUA 2NNYA 3E3VA 4KUMA 4LK0F 4G7ZF 2KKOA 3GVAA 3BY6A 3LA2A 2M1BA 4A12A 2DPDA 2V9VA 4G6QA 3MEXA 2FSWA 5DUIA 2P5KA 1UHWA 2VBZA 4RB3C 4ENKA 3V7CA 3COAC 2DI3A 2FU4A 5J8FA 4HBLA 3RI4A 2RGVA 1G3WA 3CUOA 3L00A 5ILSA 4IRGA 2QYOA 3NQOA 2PBIA 4Y13A 2STWA 1W7PA 3M7GA 2JPBA 4UVCA 2H6BA 3FMQA 3F8FA 2A61A 1BOAA 3GFMA 5HVQC 2X4HA 3JSPA 1DDNA 3KETA 1AOYA 5LGTA 1P4AA 1QNTA 2K7LA 4LG0A 3JTHA 1KQ0A 4LLLA 2VC0A 2W84A 4HF2A 1ZYRF 5BOXA 1TQMA 1XSXA 3KEOA 5JHUA 2KJBA 1IXSB 2E1NA 5E1XA 3QOPA 4L9VA 1HW2A 2JSCA 3GFJA 3KLNA 1U78A 2VBXA 2VXZA 1Y0UA 2DTRA 2IT0A 1FP1D 2TDXA 2LF7A 4JQFA 5DCMA 1XDSA 1MD0A 3R60A 4U0VA 1O3TA 4MHGA 3W6KB 4HQMA 3FMRA 3KFWX 2CW0F 1FNNA 3HHGA 3HRTA 4RGRA 1G3YA 1S6LA 2JRTA 3V7SA 2V79A 2FRHA 4I2OA 2UXNA 4BYYA 1S7OA 3FX3A 2RC4A 3V8JA 1FBSA 2CO5A 1R1UA 2M87A 5KK1A 2QZ8A 3BP8A 5LGNA 5KVRA 5D5XB 4Q5SF 2HTSA 5K5OA 1K7AA 1LVAA 1HQCA 3PQKA 4OIQF 3ML6A 1R22A 4B8XA 2CWEA 2Z3YA 2VOPA 1FLIA 1XGSA 2WV0A 3E5QA 5L3GA 5LHGA 1Q1HA 3BZ6A 3J81Z 3QP5A 2KIFA 1KU2A 3GX4X 3RKYA 5E8IA 3GEZA 5IT3A 3DPLC 5ICEA 3GLXA 3QU6A 3QPTA 2QENA 5F6FA 1I6XA 3ECHA 4HAMA 2H94A 5HDKA 4I09A 3DQVC 3WODF 4UVAA 5CVIA 4HYEA 3VEPA 3F8MA 2D2WA 3FMSA 2IA2A 3CO6C 4EM1A 1PP7U 4OIPF 3GYHX 2QQAA 4HX4A 1W7PB 3PFIA 1HKQA 4CHUA 2P5VA 1S3JA 4ENMA 5FGMA 4B09A 4G9YA 1R23A 3GFIA 4LG0B 1MZBA 4ZYEA 3GW2A 2HDCA 5F64A 5DEQA 1USTA 4RGSA 4FHTA 4LD5A 3FXRA 4N9HA 2FBKA 3RPUA 3GF2A 2FBIA 3F6VA 3AAFA 1R5GA 1E2XA 1BJAA 2P6TA 3M8FA 1BC8C 1K79A 3HTSB 1ZN2A 2M5WA 2GXGA 3VODA 2OA4A 2Z9OA 4HX7A 3GWZA 5HOOA 2FMLA 4LK1F 4FT8A 3FWEA 3HSEA 4L0YB 2XAGA 3HYIA 3F23A 5L3FA 3L09A 1TW2A 5EEHA 3V7RA 4KYWA 2STTA 3BDDA 3CUQC 4A2UA 3B73A 5FLXZ 1O7LA 5K5QA 1HW5A 3P7NA 2W57A 2A68F 1FWZA 4MQ9F 1DP7P 2GA1A 5D4RA 2B0LA 4WXCA 5LLQA 2QM3A 3HSFA 5HS8A 1ZHFA 1P4XA 3E6MA 3WGGA 4M6XA 3U2RA 2EFWA 2P5LC 1FT9A 4YFNF 3MCZA 4UXNA 5DCFA 3WGIA 1U5TC 3LQQA 1BI0A 1QPMA 2DU9A 1DPRA 1LDDA 3SQNA 5L3DA 2P6SA 1IXCA 2ZFWA 1TBXA 6PAXA 3P9IA 1Z91A 1ZG3A 1LDKB 2DK8A 1FSHA 1FY7A 2XAFA 2QVOA 4HLXA 1U5TB 4YIIA 2LF8A 1U2WA 1FSEA 5D8KB 3TO9A 5H6QA 3DV8A 1D8KA 3ELKA 3ZMVA 1ULYA 4ETSA 4IHTA 4RB1A 4HOBA 4KICA 1KQ9A 4OINF 3JW4A 1YW7A 4ESJA 3WTXC 2OQRA 3DF8A 3KP6A 2BV6A 2Z99A 3E5XA 2EV0A 2DO7A 4EJWA 2ACJA 2ZNYA 1TQPA 3BOQA 2IA1A 3KLOA 3TDZC 3FHZA 1S29A 1B9NA 4H0EA 1XCVA 2MD5A 3SHFA 2VBWA 1YG2A 4PGGA 1R58A 4ESFA 5CVUA 3IWZA 1W4MA 2C6YA 3DKWA 2OBPA 1TLHB 3KCCA 2V1XA 4BHBA 4PDKA 1CF7A 4R8HA 3P9CA 2QBYA 3HRUA 4HLYA 2Y0MA 3V4GA 5K5RA 1Z6RA 1IZ1A 2XRNA 3ISPA 3J7AO 2JPCA 4KFCA 3K1PA 1YW8A 3TQNA 5BQTA 1O3RA 1YTYA 2XKPA 3QRFF 2EK5A 3GZ5A 4P9UA 3N4MA 1G4DA 1D5VA 2VN2A 5J6XA 3ZMZA 4ZYGA 5DD4A 1T38A 2YR2A 3ABUA 1B6AA 3R6SA 2ZXJA 1LQ1A 3K1NA 3EYIA 5D5UB 1RUNA 1RI7A 3DFGA 1TQIA 4L9JA 1P92A 1ZLJA 3F8CA 3T8RA 2IVMA 2YPRA 4EJOA 1SFUA 3N97A 5A2QZ 3T1BA 4EMSA 4AVPA 1A04A 4RGXA 5D6FA 4S05A 3RJPA 1J59A 3WTSC 3TO6A 1FZPB 4LB6B 3W6JB 4HV5A 5DD8A 2MC3A 3I4PA 2IW5A 1MKMA 2Q2EA 3HOTA 2DLLA 1IN6A 4YG2F 3G3ZA 1Z1DA 2UZKA 2ZMEA 1Z9CA 3GFLA 3O6BB 5K1YA 2IJLA 3EYYA 2XAJA 2E7XA 5CVRA 3VFZA 3HIFA 3V8KA 3ZP5A 2AXLA 3DPTA 2D1HA 5IT9K 3FM5A 2H6CA 4XLNF 1EH8A 4BAYA 4IRIA 2ESHA 1UHMA 1SFXA 1IRFA 1EH6A 3I53A 1HKSA 1SAXA 1SFEA 4EJVA 1D8JA 1U6GA 3LA3A 1RNLA 2OU2A 1ODDA 4XLPF 1ZH5A 4GO1A 2YX7A 1CF7B 4I01A 4BXUA 2BE5F 4M9SA 2RDPA 2HFHA 2QBYB 1XD7A 3WTWC 3CO7C 1U8RA 1YIOA 5JI6A 3H3ZA 3T5XA 2P8TA 5F1RA 4EM2A 2IP2A 2W25A 4MQVA 2CSOA 4IJAA 2A5YB 4Y15A 3WE3A 2K4BA 1J0RA 1QBJA 4LFUA 2BYVE 5LEJA 3GZ6A 3EUHA 1QZZA 2G9WA 2L01A 1SD5A 1MGTA 5E1ZB 4L9NA 5L3EA 2HGCA 1J9IA 4U0YA 3JAMK 2J5PA 1P4WA 3HRSA 4CO8A 3M8EA 3ZN0A 2O3FA 2FQ3A 4Q47A 4L9TA 1J75A 2HTJA 2EFPA 2V6CA 4O5VA 4EJTA 1IN8A 1L3LA 2PMHA 3K1MA 1I5ZA 3F22A 3F21A 2EFNA 3MQ0A 3SXYA 5JVTA 1EH7A 2Z33A 2LDUA 3DXJF 2ZBKA 3U1DA 2DK5A 2YX4A 4L0ZB 4P9FA 1W5TA 1YS6A 2BEOA 4JK1X 3O3KA 4XRFA 1HW1A 2IPQX 1JE8A 1WRJA 1KU9A 3EQLF 2R3SA 3IRRA 1YO5C 4IXAA 3ZMUA 1DUXC 1REPC 5LRSA 1XGNA 4EM0B 2PN6A 2DFIA 5HS7A 2JZYA 2ZMEB 3D0SA 2ETHA 1LEBA 2DPUA 2GQQA 4MEXF 5EEGA 3L7WA 4OIRF 1G6NA 2P7VB 3ULQB 4Q48A 2PG4A 4KIGA 2HQRA 4OU0A 4EGYA 4K2EA 3JSOA 5D8LB 2L54A 3BJ6A 3R0JA 2Q8KA 1OYWA 3I58A 3OV8A 1BM9A 1FC3A 3E97A 2FEZA 2A3SA 5LBQA 3HHHA 1HBXG 3FM3A 2D1VA 2L4AA 2NS0A 1LJ9A 3R4KA 2OAZA 3KP7A 1T2KA 2AS5F 1JHHA 3BROA 4NHJA 5CVVA 4A0XA 4UNOA 2GIVA 1R7JA 1NHAA 4LMYA 3M9AA 1ZRDA 5ERIA 3E6BA 2DAOA 5DCMB 1BI2A 1XCBA 2ADUA 3I59A 3RDIA 2LNBA 1P2FA 4ZH4F 3KP2A 5FD5A 1ZARA 1EV7A 4M73A 5HDNA 2A69F 3F3XA 3MZYA 2K27A 2F5EA 2FNPA 1QO0D 3HSRA 4DNCA 3J80K 2P4WA 2F5DA 2G7UA 1FBQA 1IXRC 3BJAA 4G7HF 2W24A 1D3YA 4EVIA 3IKTA 2OZ6A 3L2CA 2CFXA 3BPXA 1XGMA 4KT5C 5BMZA 1OKRA 1Z6TA 3C7JA 3CJNA 4N0BA 2R7DA 3CTAA 3GUDA 5H6RA 3SFZA 5ILUA 3D5LA 1R1TA 1ZG1A 3ABTA 4XSZF 4A6DA 1H9TA 4IHSA 2L3DA 3CDHA 5E8GA 5LHIA 3G73A 4NQWA 4OIOF 2FBHA 4CZZA 4RGUA 4M9ZA 3LAPA 4I7HA 1RUOA 2M30A 2WC2A 1UFMA 4WX9A 3ROUA 1T39A 3KEQA 2VT3A 2PLYA 2EJRA 4KDPA 4UHTA 1E17A 1W7PD 4M71A 1MJBA 4LGWA 1WQ2A 5HS9A 2RQPA 4L5JA 4P55A