4WXDA

Crystal structure of mycobacterium tuberculosis ogt-r37k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSKTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxdA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxdA01
4LLGF 4AVPA 2OD5A 2V1UA 5D6FA 3QP5A 4HDUA 5IT9K 4JQFA 5BOXA 1LEBA 3HTSB 1D8KA 1LJ9A 2EV5A 3Q9SA 1LDKB 5D5WB 1YS7A 5J6XA 4U0YA 2JPCA 2CSOA 3DKWA 4EJVA 3F21A 1BC8C 3RYRA 3WGHA 4ZZLA 3LAPA 2FA5A 4EJTA 2HFHA 3HRSA 1ZG1A 4IHSA 2HKXA 2KIFA 2J5OA 5FFZA 3ROUA 1UB9A 2RC4A 2EFNA 3H92A 1D3YA 2L02A 4UV9A 3JSOA 2UZKA 1WQ2A 2OAZA 5E8IA 1F5TA 1UFMA 2STWA 3DEUA 2H94A 2UXXA 1DP7P 1LEAA 2DW4A 4ESJA 1G6NA 4MEXF 4RGRA 4XSZF 2FQ3A 3FX3A 2XGXA 2HQNA 3LA3A 3ERED 3JW4A 2RGVA 2P4WA 3BWGA 3QRFF 3T1BA 5A2QZ 4WXDA 3KE2A 4AIKA 3MEXA 3KFWX 1IRFA 5HDKA 3E6CC 3SXYA 5DUIA 1XGNA 1YW7A 2AXLA 5ILUA 1OKRA 2IT0A 3QP6A 2LF8A 2RNJA 5TRDA 2C6YA 1IXCA 5CVIA 1RZ4A 2RVCA 5TJJA 5DV5A 2R3SA 2EFWA 4NHJA 4MNUA 3BROA 1F9NA 1BBYA 3GZ5A 3GW2A 3QU3A 4RGXA 5FLXK 4G7HF 4EQQA 4ESFA 1ZLKA 2BEOA 5CLSA 4QLCU 5HLIA 3DXJF 4BH9A 2A5YB 1BIBA 5DCMA 3ZN1A 1TBXA 1O3TA 4G7OF 2FOKA 1RUOA 3R4KA 2DTRA 3FMRA 1V4RA 2DT5A 2PEXA 1IXSB 1E17A 2XAJA 2XAFA 3I53A 5LHIA 2ESHA 4U0VA 4DQ2A 2MH9A 1XMAA 3ZMSA 1YG2A 5L3BA 2K86A 5AIQA 1WRJA 2QQAA 1YO5C 2O3FA 3ZMZA 4A0ZA 1KGSA 4M9ZA 4UVAA 3GWZA 1HW1A 4NB5A 4RAYA 3T5XA 1U5TC 2DAOA 3BY6A 4YFNF 1J5YA 1FNNA 3ZQ7A 2HR3A 2G7UA 2WV0A 2M8EA 3J7AO 5A2QK 3L9FA 4P5OA 4L5IA 1ZRFA 2LDUA 1PUEE 1KU2A 1KYWA 1RIOH 1MKMA 5FGMA 2QWWA 4HX7A 1QZYA 3I0TA 2ZMEB 3F6VA 3M8EA 1HSJA 1W7PB 2JSCA 1R23A 2H6CA 4Q47A 2HS5A 4N0BA 5LGNA 1IN4A 2MA3A 5HVQC 4HV5A 4HF1A 4DNCA 1IW7F 1BI3A 2DQLA 3LWFA 4TV7A 4H0EA 5E8GA 3GUDA 5ICFA 5CVRA 4KT5C 1OYIA 2H6BA 1NHAA 4M71A 1CF7B 1KU3A 3H3UA 5DYMA 4EVIA 2XASA 1ZLJA 2LF7A 3V7RA 2P8TA 4KNYA 2E7XA 3P9KA 4LB6B 3U9GA 1OPCA 1TNTA 3IWZA 2ZNYA 3BJAA 1G3SA 2ISZA 4NQWA 2Q0OA 5DCFA 4UVCA 3MAJA 2F5DA 4CZZA 3F6OA 2K27A 3HOSA 5H6QA 3RDIA 5FFXA 2A3SA 2BV6A 2VE9A 4PZJA 2V79A 1T0FA 2STTA 2VBXA 2WC2A 3TO7A 3OV8A 3GLXA 5DCMB 5BMZA 2CWEA 2Z9OA 1JHHA 1MDMB 4EGYA 5HS8A 1FP1D 2Z33A 1TW2A 2JT1A 2DK8A 1SMYF 4WF2A 2WWYA 3EYYA 3LQRA 1G4DA 1W5SA 1KQ0A 4HOBA 5HLHA 3KP3A 3N97A 1IF1A 2JZYA 4CGZA 1WKMA 5D4RA 2EB7A 1LB2A 4L9JA 5LHHA 2ACJA 3JAMZ 2HTJA 3RKYA 4L0ZB 3WGGA 5LEJA 3FWEA 3C1DA 1HKTA 2VBYA 2F5EA 3VODA 1O3SA 4RB1A 3FXQA 4OIRF 5L3DA 3DV8A 1USSA 2A61A 5H20A 1MD0A 4ZYGA 1TNSA 2MBFA 2NAZA 2HGCA 4AIHA 3HSEA 4HV6A 3F72A 3ZMVA 2RDPA 2VC1A 2JRTA 3CO6C 5CVJA 1B9MA 4BAYA 4BXUA 1FBQA 2EWNA 1EH6A 1L3LA 4LK1F 2NRAC 1GXQA 4PDKA 2FSWA 1OYWA 4EJOA 1SD5A 3HSRA 2XVCA 1FLIA 2P5KA 4MHGA 1XDSA 1ONVA 2ZNZA 1FOKA 2L3DA 4XRFA 4O6JA 3M1EA 3I64A 4O3MA 4Z2YA 3ELKA 4ESBA 4JBAA 4PGGA 1IN5A 4YIIA 3GFIA 4KIGA 1XSDA 2V9VA 5AONA 1O7LA 2EK5A 2PLYA 4GYGA 3VEPA 2A69F 2Y75A 2W57A 1BM9A 4OMYA 4BQAA 4RGUA 3SZTA 4BHBA 3KP2A 2AS5F 2GAUA 1PP7U 3I59B 4WWCA 1ZGJA 3C18A 4P96A 5E1XA 3ZN0A 4LG0B 2M30A 4PGHA 3J80K 3KLOA 4IF4A 2QBYB 5LGUA 1UCRA 2D2WA 2FBHA 4M6XA 1K79A 3V7CA 2NNYA 3EYIA 4WXCA 3LQQA 3KEOA 2PQ8A 4KA4A 3JAMK 1FSEA 4OMZA 1HBXG 3G73A 3SFZA 1B4AA 1O57A 2HKOA 5FLXZ 4L9VA 4KMFA 1KQ8A 4I0AA 4OIPF 3GFMA 3TO9A 1FYMA 1P4WA 2M87A 3WTYC 3R0JA 3VB2A 1SFUA 3GX4X 1S3JA 4GGGA 4LMYA 3ECHA 2K4BA 4MTEA 3TDZC 4YG2F 1P6RA 2L4MA 4A6DA 4Q5SF 3BJOA 2O61A 1GXPA 1Y0UA 3K1PA 2XKPA 3RKXA 2ZFWA 3WE2A 1R1TA 1XSXA 1X3UA 3QU6A 3KETA 1SD6A 3SHFA 2FNAA 4IRGA 4KMUX 1YS6A 1B9NA 4CYDA 4A5MA 4I09A 2HYFA 2OA4A 3RJPA 3KZZA 4HW0A 3JTHA 2CFXA 2XROA 6PAXA 1IAWA 1W5TA 1MDMA 4A6EA 3KEQA 1ZAOA 3IL2A 1K78A 2MC3A 4M9SA 3J80Z 2R7FA 1J2XA 1ZN2A 4LK0F 3U1DA 2QM3A 3C3WA 4YIFA 1F4KA 2F2EA 2BBYA 3NEUA 4IXAA 4LFUA 2GWRA 1EV7A 3SQNA 3L7WA 2W84A 2CQKA 1O3RA 2KKOA 4S05A 2Q2EA 5JR3A 1LVAA 3BJ6A 5CYVA 5ILVA 3GFJA 5F64A 5HS9A 1H9GA 5J8CA 4UV8A 3KLNA 2VT3A 2TDXA 2XRNA 2XHKA 1IZ1A 2VOOA 1P4AA 4YFXF 2FEZA 3LSTA 1FSHA 4M73A 2W85A 5LLQA 3PQJA 1D5VA 2DK5A 3TKYA 2RQPA 1SD7A 4Y15A 5BQTA 3NRVA 1ZG3A 1QO0D 3E5XA 3I4PA 3T8TA 2XAGA 3BZ6A 4FT8A 1KYZA 5ILSA 4B09A 1J75A 4UVBA 3G3ZA 2P7CB 1LDJA 1SFXA 1W7PA 2ZJ2A 3WODF 2DPUA 1TQPA 5CVUA 1DUXC 3R6SA 5EEGA 3GYHX 1R5GA 2Z99A 1WI9A 3C7JA 4HZFA 1DDNA 3FF5A 2NYXA 2A6HF 2PFBA 4KYWA 2MLKA 5JI6A 3TO6A 1RI7A 2EV6A 2EFQA 3CUQB 4HAMA 3V7SA 2VBZA 3ABTA 4P9UA 2F5CA 3TDUC 4HYEA 2EJRA 4KFCA 1QQIA 1QNTA 3RYPA 1QZZA 4HX8A 3F8FA 2QLZA 2P6SA 2O6GE 5D8KB 5CVVA 4GXOA 1BI2A 3F8BA 1H9TA 3S2WA 4EJWA 3FMQA 4HBLA 5E20A 1IN8A 4WCGA 1Z91A 2OZUA 1HKQA 3RTRA 3E5QA 3IWFA 2KRFA 1K6OA 2E1CA 3RPUA 4HX4A 4ENNA 3J81Z 3KZYA 1J7KA 4M6YA 4RS8A 2QQBA 5LBQA 4ZZDA 1YYVA 1CF7A 2KJBA 5LHGA 2LNBA 5D8LB 1U8RA 4AIJA 2MLGA 5ED4A 4U7DA 3GVAA 2HTSA 1YQAA 1U5TA 1EH8A 3F23A 3T0YA 2KJCA 2IP2A 2ZO4A 2Z3YA 2KIUA 1FYLA 4KDPA 2FE3A 4HLXA 2ZMEA 2O0YA 5DUKA 3I71A 3MCZA 2PBIA 2EA4A 1ZRDA 5JHUA 3WTWC 4R8HA 4OIOF 1V3FA 3TQNA 3W6KB 1IRGA 1Z6TA 2RV8A 1XCBA 3I54A 2OQGA 2YPRA 2Q8KA 2D1VA 3V8KA 2O03A 1YW8A 2LKPA 2QUFA 1B59A 2YX7A 2HEOA 3L2CA 3RIRA 2YU3A 3DP7A 4M72A 3L09A 2M5WA 3HSFA 4RAZA 3CO7C 3LA2A 4UHTA 1I5ZA 1TQMA 1ODDA 2GQQA 3WTUC 5BS6A 1MJ9A 1Z05A 2XV4S 4L5JA 3B73A 1XMKA 4ZH4F 2LSOA 2CW0F 2CYYA 2VT2A 2K7LA 3F22A 2IPQX 2IJLA 2F5FA 2VC0A 1SAXA 2HQRA 3WGIA 1I27A 3ISPA 5K5RA 1BOAA 4IHTA 2UWMA 5K5QA 3COAC 5LRSA 3MZYA 5JFRA 1XN7A 1KU7A 1BI1A 1MGTA 1D8JA 1FC3A 1BN5A 3GF2A 1FYKA 3U2RA 4KUMA 3KP4A 1K78B 1KA8A 1S29A 2DU9A 4WXHA 2GIVA 2FNPA 4HA8A 3RPQA 3LAJA 2H09A 2IVMA 1BIAA 4I2OA 3HRTA 4B8XA 3JSPA 1L0OC 2P5VA 3HYIA 4FX0A 2Y48A 1GVJA 1HW2A 1GHCA 4HLYA 3O6BB 1XDUA 3ZPLA 4EGZA 1JGSA 1PDNC 3RKWA 4CO8A 3V8LA 3EDPA 4BYYA 1XCVA 1FX7A 1P4XA 4I02A 3TGNA 4OIQF 2YX4A 2L01A 4I01A 2DBBA 3R61A 3R0AA 3B02A 1E2XA 2PG4A 1HSTA 1HXDA 3IKVA 1ZG5A 4R1HA 3EQLF 5HLGA 4G6DA 3ECOA 5CJ9A 3MZHA 3WTVC 2RN7A 3EETA 1U3EM 4KN7X 3KP5A 4BHPA 1P92A 4F7ZA 3T8RA 4N9HA 1B6AA 3J81K 2A07F 1CGPA 4RB3C 3GO5A 1S7OA 4Y17A 3CTAA 1XB4A 3D0SA 1KU9A 1ZRCA 2OZ6A 3PFIA 2BGCA 2GA1A 1UHWA 1AWCA 1T39A 3MFKA 5D5UB 1FY7A 4L9NA 3V4GA 3WTSC 1ZARA 4ON0A 3PQKA 3QOPA 1TLHB 2E7WA 1T6SA 5KVRA 3LFKA 5IT9Z 5K5OA 5ICGA 3E6MA 4I98B 4LJZF 4GYIA 3P7NA 4U7BA 1YLFA 4IRHA 3REOA 2CG4A 2XAHA 5E1WA 4L0YB 3LA7A 2D45A 3VOEA 4EM0B 1U6GA 3HTUA 1HKSA 2L4AA 2NS0A 1USTA 1REPC 1T38A 2M45A 3CLOA 2JPBA 3M9AA 1H0MA 1IN7A 3I59A 3WTZA 4CDGA 4FHTA 1U78A 5DD8A 1IUYA 5L3FA 2OQRA 4LLNA 5LGTA 2A6EF 3K1NA 1FPQA 5L3EA 3ZMDA 2FRHA 2PN6A 2G9WA 3W6JB 3N4MA 1O3QA 1Q1HA 2YR2A 4XBFA 2Y0MA 5K1YA 1B1BA 1T2KA 5D4SA 2O8XA 3FHZA 4A0YA 3FM3A 4N9IA 3L00A 1BJAA 4MQ9F 1U5TB 5F6FA 4HF0A 4EJUA 1S8NA 2ETHA 2KIMA 3RI4A 4KN4X 2PJPA 2NNNA 3FXUA 3KP7A 1W4MA 4UUVA 1ZH5A 3FZVA 4KIBA 1K7AA 4G94A 2V1DA 1G3YA 3F8MA 3WU1B 4KIFA 3JTGA 2GXBA 2EFOA 3H3ZA 3AAFA 3FXRA 4Q4ZF 3VFZA 5LEKA 3ZMUA 1IXRC 1VTNC 1LQ1A 4G8XA 4D0PA 2QZ8A 4XLPF 3IRRA 1I1SA 4ENMA 3HIFA 4XSXF 1HQCA 3K9TA 1DPUA 4P55A 2P6TA 3HHGA 1DPRA 3DPTA 2Z5UA 1FBUA 1U2WA 3R60A 2CO5A 4K2EA 2V6CA 2DFIA 2XUBA 1OYYA 1HW5A 1MJBA 1J0RA 5FB2A 3E3VA 2FXAA 1YIOA 4CXFA 2V1XA 2GZWA 2YSRA 5IT3A 2WTEA 4MQVA 4XLNF 1XGSA 3CUOA 2IA1A 4ZYDA 1Z7UA 4BNCA 4EM1A 2M1BA 4BHCA 2XAQA 3DF8A 3GZ6A 2FMLA 1JE8A 1FZPB 2FBKA 2A68F 4EV0A 2PI0A 2DPDA 4ASNA 3O2PE 3ZMTA 2D1HA 5JVTA 1RUNA 3HRUA 4LD5A 1Z1DA 4WX9A 2X4HA 1FBSA 1R7JA 4ENJA 1LNWA 2VONA 1YFHA 1I1GA 4MEYF 1UHMA 3FM5A 2L54A 3CDHA 3GFLA 5HS7A 1ZGAA 3K1MA 1R5HA 4O5VA 3I58A 4ENKA 2J5PA 2IRFG 2R7DA 2FMYA 4G7ZF 1XD7A 1FT9A 3NQOA 1ZHFA 1XGMA 3IKTA 5LRRA 4YFKF 5ERIA 2P5LC 2QYOA 2XIGA 4A2UA 3FMSA 2HOEA 2HWVA 1TTYA 3E97A 4L9TA 1JXSA 5FD5A 2QBYA 5H6RA 3CJNA 3HUGA 5HDGA 1ZREA 4Y13A 1QGPA 3ML6A 3F8CA 2ZKZA 3CUQA 5F1RA 2G7HA 3GXOA 5L3GA 3BDDA 2ADUA 4OU0A 2FBIA 3TOAA 2EA2A 2ISYA 3TOBA 4U88A 1S7AA 2IW5A 5D5XB 3KCCA 3IHUA 2HDCA 4IJAA 4QWQA 1WSUA 2VOPA 1ZYRF 2ZBKA 4LGWA 1G3TA 1P2FA 4OOIA 3QPTA 3E5UA 5ICCA 3P9IA 5DEQA 4G9YA 2DO7A 2GXGA 3K2ZA 4I0BA 2FF4A 5BPIA 3ABUA 3QPHA 4S04A 5J8FA 3HRMA 1AOYA 1KQ9A 2ZXJA 1YTYA 1SFEA 2E1NA 1O7FA 2PMUA 2MH2A 1J59A 1YW9A 1SMTA 3SZPA 3E6BA 1STZA 3I5UA 1I6XA 5BPDA 4UXNA 1R00A 3M7GA 4FX4A 1OR7A 1F1ZA 2COMA 2RKHA 4UNOA 2HYGD 3OOPA 1IN6A 2W25A 4AWXB 3WE3A 1R1UA 2VN2A 1TQIA 2DQRA 1R36A 2ZCWA 2QVOA 2PMHA 4EMSA 2BYVE 2VBWA 4A5NA 2K02A 4KICA 2K4JA 4PCQA 5KK1A 4WK8F 1C0WA 2ESNA 2QQ9A 1MJAA 3KP6A 2EV0A 1W7PD 2CGPA 1QPMA 2FU4A 2GA2A 3E6DA 1Z9CA 4E70A 3WTXC 1BC7C 5FD6A 1R1VA 4HQEA 5E17F 4EM2A 1G3WA 4CHUA 4L18B 2XKOA 4AD9A 5HDNA 2QENA 4I7HA 1ULYA 4Q48A 5D6EA 3DPLC 5EEHA 2X0LA 1A04A 1MZBA 3QAHA 1RNLA 2IA0A 5ICEA 4MTDA 1J9IA 4LB5A 4A12A 1ON1A 4R79A 3K0LA 2VODA 2DLLA 1WWXA 3O3KA 3WG9A 1Z6RA 5E18F 3MQ0A 1PP8F 3WU0A 3GEZA 2OBPA 1LDDA 1XGOA 1S6LA 1R58A 3HHHA 3K69A 4GCVA 3F8NA 4HQMA 5DD4A 3BPXA 4JK1X 5L3CA 4ZYHA 2VXZA 1FP2A 1EH7A 1FWZA 4M74A 4LLLA 2EFPA 2IA2A 4HF2A 4RB2C 3MWMA 1R22A 2P7VB 4RB0A 2ELHA 5D5VB 3BOQA 2BE5F 4IPAA 1ON2A 2HZTA 2OU2A 3P9CA 3F3XA 1TW3A 3DFGA 4ZYEA 4P9FA 3HOTA 4RGSA 3BPVA 4GO1A 1OMIA 4LG0A 1T98A 2H27A 3DQVC 4MGRA 2VE8A 5E1ZB 4M9XA 5HOOA 4IVNA 5DDGA 5AIPA 2MD5A 4U0WA 3Q9VA 4HDVA 4A0XA 3ULQB 3D5LA 4OINF 1JHFA 2UXNA 2W24A 3ZP5A 1BI0A 1SD4A 3Q5FA 4G6QA 3IRQA 5FO5A 4IRIA 3BP8A 3V8JA 3IC7A 3WTTC 3M8FA 1QBJA 4CICA 4ETSA 2B0LA 1XSVA 2JTVA 3CUQC 2DI3A 3EUHA
chains in the Genus database with same CATH superfamily
2Y30A 4LLGF 4AVPA 2OD5A 3CCVI 2V1UA 3AV0A 2JJ7A 3F0CA 4C3HJ 2NS7A 3AL0C 1MNEA 2YZTA 5D6FA 3QP5A 4HDUA 5IT9K 4JQFA 3C2HA 3NWSA 3L2RA 5BOXA 2QEXI 1LEBA 1PJTA 2DMQA 4DR1E 3HTSB 4X0GA 1RESA 1D8KA 3A01B 2YPNA 2KMUA 1LJ9A 3MKWB 2EH3A 2EV5A 3Q9SA 1QZEA 1LDKB 1V54H 5D5WB 1YS7A 3HL2A 5J6XA 4U0YA 3E0JB 2JPCA 2CSOA 2VIXA 5KL3A 2DJNA 3DKWA 4EJVA 4OAYA 3F21A 1BC8C 3QOEA 3RYRA 3WGHA 4ZZLA 1NG6A 2GOMA 2ELJA 3PNTA 3LAPA 3BTLA 4R2SA 2LD5A 1SVLA 1K61A 2FA5A 4EJTA 2HFHA 1OCPA 2GIZA 3AUZA 3BR6A 3HRSA 3QG5C 1ZG1A 1DU6A 4IHSA 1IQSA 1ETKA 3GTLJ 2HKXA 2KIFA 2J5OA 2M9HA 5FFZA 1LFUP 2GPIA 3EPHA 1JK2A 3ROUA 3OYIA 1UB9A 1OCRH 3ZQHA 4LF9E 5LD2C 2RC4A 5IXMB 1VQ6I 4F3QA 2EFNA 1F36A 3H92A 3OR2C 1D3YA 2L02A 4UV9A 2CV2A 3S15J 3JSOA 2NVYJ 2YTDA 2UZKA 2E1MC 5FKNA 1WQ2A 2EM3A 2OAZA 3T1YE 4RBOA 1S7EA 1VFCA 5E8IA 4E7ZA 4I99C 5K7ZA 1F5TA 3H0DA 3BG9A 2IS1A 1UFMA 2R5YB 2STWA 2EPAA 3DEUA 2H94A 2UXXA 3MHHC 2DFEA 3H35A 1DP7P 1LEAA 2DB2A 2DW4A 4A3BJ 2LVSA 1JJ6C 4XOPA 4ESJA 1G6NA 1A1LA 4UUSB 4MEXF 4X9JA 4RGRA 1HLVA 4CSWA 3BTIA 4XSZF 2FQ3A 3FX3A 2XGXA 1W36C 3BQZA 1A1KA 2HQNA 2I10A 3TL4X 2DA3A 3LA3A 3ERED 2L6MA 2Y9YA 3JW4A 2RGVA 1Y1VJ 3W2WA 2P4WA 5F27A 3BWGA 3K6GA 1IV8A 1Y0NA 2WA0A 3T1BA 4B47A 4WXDA 5A2QZ 3QRFF 2DODA 3KE2A 4F9BB 4AIKA 3HPGA 3MEXA 2LTRA 3KFWX 3GTPJ 2F4MB 1IRFA 5HDKA 3E6CC 4IQJA 3F6GA 4J19A 4ITVA 3SXYA 2DFHA 5DUIA 2MYSA 4CCLA 1XGNA 1YW7A 3PSFA 2AXLA 4D5CA 5ILUA 2CTDA 3HXLA 1A31A 3OMLA 2A5WA 2MDRA 2KIQA 4TUGA 1OKRA 3IH3A 4XLEA 1JI8A 2IT0A 1CQTA 3QP6A 2LF8A 2RNJA 5TRDA 2C6YA 1IXCA 5CVIA 4CCKA 2EPLX 1RZ4A 4W1UA 3VYRB 2RVCA 5TJJA 3QYEA 5DV5A 2CT1A 2R3SA 2EFWA 4LFAE 2Y9ZA 2HVQA 3MD2A 4NHJA 3ASNH 1VQ4I 2PMZA 4MNUA 3BROA 1TWCJ 1F9NA 1YX3A 2HZDA 2M0CA 2EMLA 4BY1J 2X9DA 3DBLB 1TC3C 1BBYA 5IY5H 1GV5A 3OYHA 3GZ5A 3GW2A 3QU3A 2HQAA 2VPRA 4RGXA 1S72I 4XL9A 2ZJPF 2EJ4A 3KYDB 2Q2EB 5FLXK 2ZJQF 4KISA 4G7HF 2CQXA 2UXDE 2P81A 4EQQA 3HBLA 4ESFA 1TL8A 2CJJA 4DBQA 2ME0A 1ZLKA 2BEOA 5CLSA 4M30A 4LFBE 4QLCU 5HLIA 1TP4A 2PX9A 3DXJF 4BH9A 5M5YJ 1MBGA 3J7YJ 2A5YB 1BIBA 2R7XA 3IP4B 5DCMA 3ZN1A 4B1RA 1TBXA 2TRTA 2KP6A 1O3TA 4ZDOA 4G7OF 2FOKA 1TT5B 2LKSA 3R4KA 1RUOA 2DTRA 1HR0E 1A6IA 2NA2A 3FMRA 1V4RA 1HNXE 2NXNB 4M3FA 3VSKA 2DT5A 2PEXA 1A1GA 1IXSB 2Y31A 1E17A 2XAJA 5A6AA 1QPIA 2XAFA 3I53A 2HI3A 5LHIA 3G71I 4S0HB 3E7LA 4ZC3A 1WI3A 2ESHA 1P9QC 1VNDA 4U0VA 1MSEC 3ZQIA 4DQ2A 2CUFA 2MH9A 1ORKA 1PKPA 2RPCA 1I6HJ 1XMAA 3ZMSA 2F4VE 1YG2A 3HB9A 4XKVA 5TISC 2UXBE 5L3BA 2K86A 5AIQA 1WRJA 2QQAA 2ID6A 1ZELA 4QIWN 1YO5C 2DMTA 2O3FA 3ZOQB 3ZMZA 4A0ZA 1KGSA 2E2HJ 3BQYA 2LJUA 3PIPF 5AE3A 4Y52J 2MKDA 4M9ZA 4UVAA 5M5XJ 4HTGA 3OYLA 3EPKA 3GWZA 1HW1A 3OWTA 5B1AH 4NB5A 4RAYA 1TWFJ 3T5XA 1JKOC 4CCJA 1U5TC 2DAOA 2EN3A 3BY6A 4YFNF 1J5YA 5M3MJ 3SZGA 1FNNA 2M7AA 4PJJA 3ZQ7A 3I3LA 3KEYA 4NDLA 2EL5A 2HR3A 3D5SC 2G7UA 2WV0A 3JCUC 2M8EA 1OCZH 1AU7A 2QGUA 4C2TA 2Y0SN 5GPAA 3J7AO 3B6AA 2OUMA 3B6CA 5A2QK 3L9FA 4P5OA 4L5IA 3K10A 2EM7A 3EPZA 1YJWI 2EM2A 2CPNA 1ZRFA 2F4IA 2LDUA 2ZFUA 3O8HA 2WV1A 4BEHA 1PUEE 2ELZA 5C4XJ 2EOYA 2R1FA 1AKHB 1KU2A 3HDDA 3EUHC 5DS9A 1KYWA 3OY9A 1RIOH 1MKMA 3KZIC 5FGMA 2QWWA 4HX7A 5IYDJ 1QZYA 3I0TA 4RH8A 5A6KA 2ZMEB 1QU3A 4XKWA 3F6VA 4EEFG 1Y8QB 3S3OA 3M8EA 1HSJA 1W7PB 2V88A 1X1PA 2UUBE 3BG3A 2JSCA 1RR7A 4XLHA 2O9LA 1R23A 2H6CA 2KOUA 4Q47A 2HS5A 4N0BA 4KZSA 5LGNA 1IN4A 2LRDA 2E36A 2UUZA 2MA3A 1T4OA 2LE2A 5HVQC 4HV5A 2BHZA 4HF1A 4DNCA 1IW7F 1BI3A 2DQLA 3LWFA 4TV7A 1WVRA 4H0EA 5E8GA 3GUDA 5ICFA 3I4MJ 5CVRA 3LSKA 1SC7A 4KT5C 1OYIA 3OSGA 2EN4A 4J8ZA 2H6BA 1SANA 2LBFA 1NHAA 2I8DA 4M71A 1GTKA 1ZGWA 2WBUA 1YJ9I 1CF7B 3UK3C 1KU3A 3H3UA 5DYMA 4IHYA 4EVIA 2K9MA 2XASA 1ZLJA 2DMPA 2LF7A 3V7RA 2P8TA 4KNYA 2E7XA 1FIAA 2MC4A 3P9KA 4LB6B 1XG1A 3HOZJ 1U8BA 2E2JJ 4V2GA 1G2HA 4BUPA 1PJRA 3K4NA 3CC2I 4HSRA 3U9GA 1OPCA 4RM2A 1TNTA 3IWZA 3DJWA 2ZNYA 3KPHA 2V9KA 1VQ7I 3BJAA 4BQQA 1G3SA 5BR8E 4II3A 2XC7A 2ISZA 4NQWA 2BY3A 2Q0OA 3DBRB 4E7SA 5DCFA 1E3PA 2MD0A 4UVCA 5EZGA 5AE2A 3MAJA 2F5DA 4CZZA 3F6OA 2K27A 3HOSA 5H6QA 2VRDA 3RDIA 1MMGA 3DBHB 5FFXA 2A3SA 3H1CA 2OF7A 2R7ZJ 2BV6A 3HJEA 2VE9A 4PZJA 2V79A 3LSIA 3U1KA 3ZOBA 4V19K 4AYBN 1T0FA 2DJIA 1EA3A 4JI1E 2DFFA 3KX2A 3HGYA 2STTA 1DQ3A 2VBXA 2B7EA 1JUSA 2LYCA 4AC0A 2WC2A 2NVXJ 3ADJA 3TO7A 3Q0VA 3OV8A 2X1CA 3GLXA 5DCMB 1S9HA 4ANJA 5IPAA 5BMZA 4B3AA 2EM0A 2EOQA 3F9KA 2CWEA 2DCEA 2WB1N 4ABZA 2ZJRF 1X3CA 4DZPA 1DGCA 2XF6A 2Z9OA 3AKZA 1JHHA 2BZTA 2WBTA 1B69A 3QYFA 2R7TA 4DV1E 1X1AA 1LVKA 1MDMB 2WAEA 4EGYA 5HS8A 1VQLI 1FP1D 2XPVA 2NVTJ 3L2QA 2Z33A 1NCSA 5F0HA 2K7IA 2DYSH 1TW2A 1A5JA 5FRNA 2JT1A 2DK8A 3AG3H 1SMYF 5ADZA 5KAFC 2DMUA 1BR2A 2E71A 5EG0A 3OS1A 1ZR4A 1TZLA 2KLOA 4UY8I 3HPZA 4WF2A 4DYCA 2JA6J 2HDWA 3DLAA 2WWYA 3EYYA 3LQRA 1G4DA 1W5SA 3SEZA 2RQLA 1KQ0A 4HOBA 5HLHA 3KP3A 3N97A 4D1QA 2KISA 1IF1A 2LUQA 4D7MA 2JZYA 1XMOE 3I4NJ 4DR4E 4CGZA 1N77A 1D0ZA 2JR1A 1WKMA 5GAGJ 3VYTB 5D4RA 2EB7A 4L9JA 5LHHA 3GLLA 2ACJA 3JAMZ 1LB2A 4GKJE 2HTJA 3C6KA 1SAUA 3RKYA 2EM9A 4L0ZB 3WGGA 5LEJA 3C6MA 3FWEA 1X2NA 3C1DA 1HKTA 3OYNA 2VBYA 2F5EA 2YU9J 1Y39A 3VODA 1XS9A 1YE9A 3FK7A 4KWYA 4M6VA 1QVTA 1O3SA 4RB1A 2EBIA 1ZK8A 1G59A 1B72B 2RSIA 1ETWA 3FXQA 4OIRF 1BB8A 5L3DA 1QHGA 1X1BA 1YUJA 3DV8A 1FTZA 4HG2A 3BBGA 2B3TB 1USSA 2A61A 5H20A 1MD0A 2E19A 1UAAA 2LV2A 1YIJI 2L2MA 4ZYGA 2X1DA 1TNSA 2MBFA 2NAZA 2M0MA 3CCYA 2HGCA 4AIHA 2FUG2 4CA0A 2N8XA 4JX4A 4HPQA 4JP0A 2UUAE 3HSEA 4UB6C 1U9OA 2RS6A 4HV6A 3F72A 3ZMVA 3THOB 3EQ1A 1MMAA 2RDPA 2VC1A 2FTXB 2VQCA 2JRTA 4MFEA 3CO6C 3HKZA 1LFPA 1LLMC 1YPNA 2PMZN 5EZHA 2ICWG 3JRGA 4BBRJ 2QKLB 1BR4A 4XMYA 5CVJA 1FEXA 1B9MA 4BAYA 2K9QA 4BXUA 1FBQA 3MMYB 2EWNA 2WB1A 2EINH 1ETOA 2FOWA 5JVGF 1EH6A 1L3LA 3I56I 3HOWJ 4LK1F 1YSAC 2L3CA 1IJWC 2NRAC 5E3MA 1GXQA 2YRMA 4PDKA 2FSWA 2I5UA 2VKDA 1OYWA 2NOJB 3A0HC 1A35A 4EJOA 3CJQB 2RAEA 3RSNA 4PK4A 3FHNA 4A3GJ 2YS9A 4MLQA 1SD5A 2L9VA 2M3AA 3JRHA 1HDDC 4RMNA 3HSRA 3ECRA 4XN3A 4IL6C 2JPAA 3PL8A 3S93A 2E5ZA 2DA7A 2E1MA 2XVCA 1FLIA 2F48A 1ETXA 2P5KA 4MHGA 1WJCA 1XDSA 1ONVA 2CUZA 2ZMEC 2ZNZA 1DI2A 4N4NB 2L3DA 3VYUB 1H88C 1FOKA 1WJDA 3ERMA 4Y33A 2KZVA 2EPOA 2JOBA 4XRFA 3THNA 4O6JA 3DLLF 4IO9F 3S16J 4XRSG 3FIWA 3M1EA 3JREA 3I64A 4O3MA 1ZU1A 1Y8RB 4Z2YA 3ELKA 4ESBA 1V5EA 3ZRGA 1EJ9A 5A6JA 4DV4E 3CC4I 4JBAA 2YTQA 4PGGA 3LSMA 1IN5A 4YIIA 3GFIA 4KIGA 2X6YA 2W82A 1BW6A 3V42A 1XSDA 2N8GA 2V9VA 5AONA 1O7LA 4F9CB 2EK5A 4DV2E 2PLYA 1T4LB 2VKEA 3H9JA 4GYGA 3VEPA 1X47A 2A69F 2IGKA 2EMHA 2OV7A 4LF6E 1DU0A 4XR6A 2W7NA 1FJGE 2Y75A 3PNVA 5JLXA 2W57A 1BM9A 4OMYA 4BQAA 2ODRC 2YRHA 3DWLE 3CJTB 3OYJA 2PRTA 4RLQA 2FGGA 5M5WJ 1A36A 4BXXJ 4RGUA 3SZTA 4H4KC 1YYOA 3DPUA 4BHBA 3KP2A 2AS5F 2GAUA 1PP7U 2LG4A 4ZJZA 3I59B 4DR2E 4WWCA 4FTHA 1ZGJA 3IWCA 3C18A 2DN0A 1YI2I 3OIPA 4P96A 1OJLA 5E1XA 2O5RA 3ZN0A 4A3EJ 3TP0A 3Q3SA 4LG0B 3JRCA 2IS6A 2M30A 4PGHA 3J80K 3KLOA 3FDYA 4IF4A 2QBYB 5LGUA 1WJFA 1UCRA 2K4VA 5KCMA 2DRPA 4DUZE 1TWGJ 3TQMA 2D2WA 2FBHA 4LITA 4M6XA 3VYYA 3ONQA 3ADLA 1I39A 4K0KE 1K79A 3V7CA 1X6FA 2NNYA 2WY7Q 3LSRA 2OC6A 3EYIA 4WXCA 3FXKA 1RQ0A 3LQQA 3KEOA 2PQ8A 2YUSA 4KA4A 3GCMA 2W4SA 3JAMK 4PFPA 2X85A 1FSEA 4XK4A 4EATA 5FLXC 4LF5E 4UB8C 3S17J 2CFOA 4OMZA 2KFDA 2V9PA 1HBXG 2NS8A 3UKGA 2EOMA 4BL0B 2A25A 5JHFA 3G73A 3SFZA 4JV5E 1B4AA 1O57A 2EN1A 4I8OA 2HKOA 2QCOA 5FLXZ 2WBSA 2BY1A 1WFXA 2AO9A 5C4JJ 2XF5A 4L9VA 5GP9A 1W36D 3LOCA 4KMFA 1H8AC 1KQ8A 4PUSA 1BOBA 4I0AA 4OIPF 2ENHA 2EIJH 3GFMA 5FKKA 3TO9A 1P4WA 2M87A 4DIQA 3WTYC 3R0JA 4BDZA 1FYMA 1Y1WJ 4Q28A 3EUAA 4BCAA 2DA6A 3CCRI 1RPWA 2V4JC 3VB2A 1SFUA 3OTOE 4LF7E 2EMAA 2F8BA 2J7JA 3OYGA 2DGCA 4E7HA 2BXZA 3X2QH 3GX4X 1S3JA 4GGGA 4LMYA 1MSFC 2XSDC 3ECHA 1IBLE 1POGA 2K4BA 3IH2A 4MTEA 3GMEA 3S32A 1P6RA 3TDZC 4YG2F 2E34A 4JI0E 4M3DA 3J7Yp 2L4MA 4YIRX 4NC7A 2ZM6E 2Q1ZB 1AA7A 4A6DA 1Z0XA 2G0EA 2VKVA 3BJOA 4Q5SF 2O61A 1GXPA 1Y0UA 4J00A 4DV7E 3K1PA 2XKPA 3RKXA 4X1EA 2L9NA 1R5ID 3PO2J 2ZFWA 2YU5A 1JT6A 1N25A 3FXMA 3OYDA 1UILA 4DV5E 3WE2A 1YJNI 1WJBA 2GBYA 2LY9A 4B43A 1BW5A 1R1TA 1XMQE 2V26A 2BW3A 1XSXA 1AHDP 2R7SA 2EORA 1X5WA 4FISA 2EPXA 1X3UA 4PFOA 4DZJA 2L2KB 3QU6A 2NOGA 3KETA 2DT6A 1SD6A 3W3CA 3SHFA 2FNAA 2ZSHB 4IRGA 4KMUX 1JT0A 1YYKA 1YS6A 1B9NA 4CYDA 4A5MA 1B8IB 2AHQA 4I09A 2HYFA 3MN2A 2OA4A 3LSGA 1SFOJ 5JLWA 3RKQA 3S14J 5EG0B 2HYJA 3K4LA 2CU7A 1T33A 4A3DJ 3RJPA 3RQ4A 5F0CA 2EPUA 4E6KG 3KZZA 4HW0A 3D5RC 2FX0A 2CFXA 3JTHA 2XROA 1JKPC 2R7OA 6PAXA 3EPJA 1IAWA 3SJMA 5IOZA 1W5TA 2A05A 1MDMA 1MBHA 3BTJA 1G2FC 4A6EA 3KEQA 2YTGA 1ZAOA 3IL2A 3A4CA 5T6JA 1K78A 4C9YA 2MC3A 4M9SA 3JR9A 2GHFA 3U21A 1GZ6A 3J80Z 3EPLA 2R7FA 1J2XA 2EZLA 1GLNA 1ZN2A 4RAFA 4LK0F 3U1DA 3H9QA 4O24A 2V86A 2QM3A 3C3WA 4YIFA 1ZR9A 1F4KA 5EGOA 2KDZA 1P7IA 3KWRA 2F2EA 2BBYA 3K4BA 4DOZA 3NEUA 4IXAA 1A1JA 4LFUA 4DJAA 2GWRA 1EV7A 2LY1A 2X6OA 2H36X 3SQNA 3L7WA 2KHMA 4M3BA 3VYSB 2MGQA 3OYEA 2W84A 4E7LA 1A6QA 2CQKA 3J7ZI 1O3RA 1TN9A 4A3FJ 4AUXA 2DTZA 4A3JJ 2KKOA 2LT7A 4S05A 4XKBA 2Q2EA 5JR3A 1LVAA 2F4OB 4M9VC 2H1LA 3BJ6A 3SDGA 3QPSA 5CYVA 5ILVA 4O4KA 3GFJA 5F64A 4BACA 3I55I 5HS9A 3G4SI 1H9GA 5J8CA 4UV8A 4C30A 3KLNA 1JKQC 2YSPA 5EYRA 2FJ1A 4C2UA 2VT3A 2I13A 2TDXA 2XRNA 2XHKA 3CDIA 1JGGA 1IZ1A 2JYAA 2VOOA 3MVPA 4BQOA 1P4AA 5GADJ 2YTNA 3HC7A 4YFXF 2EIKH 4QPOA 1K6YA 2FEZA 2ID3A 3LSTA 3JRIA 1FSHA 2N3HA 4P7DA 4M73A 2HOSA 3CP2A 3HKZN 1X19A 2W85A 1DGWY 5LLQA 2DOFA 3PQJA 1D5VA 2DK5A 3TKYA 2RQPA 1SD7A 2ECBA 2KT0A 3HM5A 4LF4E 3QPLA 2M34A 2HXOA 4Y15A 5BQTA 3NRVA 1O0WA 2B7VA 1I3QJ 1ZG3A 4NBQA 1QO0D 1XMXA 3E5XA 3I4PA 2NUGA 1GT0C 3T8TA 2DIXA 1A1HA 3ADIA 2XAGA 3BZ6A 5C3EJ 4DBRA 4FT8A 3CMEI 2X51A 2DDAA 3K6QA 1KYZA 2XPWA 5ILSA 1BA5A 3ESWB 4B09A 5J47A 1J75A 4UVBA 2JQ7A 3G3ZA 2KPMA 1UG0A 1MBFA 1LDJA 1SFXA 3G1LA 1W7PA 3IV5A 2P7CB 1YRNA 2ZJ2A 4JI5E 3WODF 1E3HA 3CJRB 2DPUA 2MFZA 4AIDA 1TQPA 3ZR8X 5CFFE 1MH3A 1YHQI 3BGHA 1IRZA 1WHUA 5CVUA 1DUXC 1A1IA 2KZGA 3VPRA 2GLIA 3R6SA 4FE4A 5EEGA 3GYHX 3A1YA 1R5GA 3TP3A 2F6CA 2UUCE 3W6VA 2RQQA 2Z99A 1WI9A 1JUMA 1I50J 2NABA 2RNGA 3C7JA 1UG2A 4HZFA 1X6EA 1DDNA 2XB0X 2LOOA 1IBME 3FF5A 2NYXA 2A6HF 2BW3B 2PFBA 2CRGA 4KYWA 2VF1A 3AG1H 2MLKA 2E1OA 3DKYA 2AQFA 3TO6A 5JI6A 1RI7A 2EV6A 4F91B 2EFQA 4BY7J 3CUQB 4NXME 4HAMA 9ANTA 4XIDA 2MKNA 4OX9E 3ZXSA 1OCCH 3V7SA 2DMNA 2VBZA 3ABTA 4P9UA 3FBIB 1HA8A 1V55H 3PUBA 4KT6A 2F5CA 4BBSJ 3L2WA 5GAHJ 3TDUC 2KQRA 1PVEA 4CCMA 4F2JC 2YRKA 3VHTB 2V83A 2L9RA 2E2IJ 4HYEA 2EJRA 4KFCA 3BTCA 5FLVA 5IWAE 1LE8A 1QQIA 1QNTA 3RYPA 1QZZA 4HX8A 4IKFA 3F8FA 1WJPA 2QLZA 4JX5A 2P6SA 2O6GE 5D8KB 3HG9A 5CVVA 2YTFA 4GXOA 1BI2A 3F8BA 5F08A 2L7FP 5C44J 3S2WA 1H9TA 3IH4A 3CCUI 3ZGKA 3S8PA 4EJWA 3OL4A 3C2BA 3FMQA 3NAUA 3LL7A 1W0TA 4HBLA 4F6MA 3HUGB 3KIOA 5E20A 1IN8A 3AG4H 5J1YA 4WCGA 1MMSA 2CS3A 2RSMA 1QVUA 1LFBA 1Z91A 2OZUA 3BF2A 1HKQA 3RTRA 4DR6E 3E5QA 2V89A 3IWFA 1J26A 2KRFA 4BXFA 2L5QA 1PJQA 1K6OA 1BL0A 3IUOA 2E1CA 2OPTA 3CLQA 3RPUA 1ACIA 2IHR1 2EOSA 1JK1A 3BR5A 3E1SA 4HX4A 2Q8UA 4DR5E 4ENNA 3J81Z 3KZYA 4DR3E 1UELB 2V1NA 3K4JA 1J7KA 2LREA 4BJ5C 4M6YA 4FCYA 4RS8A 3ABKH 2M7QA 2QQBA 2Y2ZA 4ZZDA 1YYVA 5LBQA 1CF7A 2KJBA 5LHGA 4BE0A 2LNBA 5D8LB 1U8RA 1UHSA 4AIJA 2CUJA 2MLGA 1HCRA 4NC6A 5ED4A 4U7DA 5EJCA 1G8XA 3GVAA 3OOUA 2ADRA 5AE1A 3N05A 2HTSA 1YQAA 4QPQA 1U9NA 1U5TA 1EH8A 3F23A 2JVAA 4KHPE 2VL8A 5KAIC 3NARA 3T0YA 3PUFA 4A3MJ 2KJCA 1QHHD 2IP2A 2ZO4A 1VQMI 1HNZE 2Z3YA 2K9NA 2HU9A 4MLOA 2KIUA 4CUGA 2ME6A 2A6TA 1FYLA 4KDPA 2FE3A 4HLXA 2ZMEA 1V5GA 3BR3A 2O0YA 5DUKA 4BS9A 3I71A 3MCZA 4ZTJA 1FOYA 2PBIA 3CMMA 1NK3P 2EA4A 1IG7A 1ZRDA 2I9IA 1N34E 5JHUA 3WTWC 3Q0UA 2L8TA 3L2UA 1ITYA 1I94E 4R8HA 2EPRA 4OIOF 4DMIA 1SFKA 2MC6A 3IWDA 3GTGJ 1V3FA 3C2GA 4G12A 1Z67A 3TQNA 3W6KB 4GKKE 3J80C 3M07A 2GM4A 1IRGA 2R5ZB 1QA6A 2VASA 1Z1BA 1Z6TA 2RV8A 4M2ZA 3VDXA 3OYMA 1XCBA 3TEDA 1GV2A 3I54A 5HNHA 4NC8A 2OQGA 1BJZA 2YPRA 4PJLA 2Q8KA 4R2PA 2X48A 2D1VA 1ZAAC 3H5NA 3V8KA 3LSHA 2QF7A 1ZKGA 1X48A 2O03A 4AU7A 2BY2A 3BG7A 1OLTA 1YW8A 1I3AA 2EIMH 4GDFA 2JA7J 3OYKA 2LKPA 2QUFA 2EPPA 1B59A 2Z16A 4XOTA 2YX7A 4A3CJ 2HEOA 3HGGA 3L2CA 3FKIJ 2X6XA 3RIRA 2YU3A 5A6BA 1WHQA 3DP7A 3FKJA 2M4KA 1EF4A 5B1BH 3TW6A 4E7JA 3H0GJ 4M72A 3L09A 2M5WA 3HSFA 2IS4A 1W1WE 4BU2A 2OCCH 4RAZA 3CO7C 3S1QJ 4OAZA 4GZNC 1IRXA 4XN0A 3BLYA 3LA2A 3K4CA 4UHTA 4E4HA 1I5ZA 2XAUA 1G2DC 1TQMA 1ODDA 3PIOF 2HPIA 2PJRB 2GQQA 2EQ3A 3WTUC 5KL7A 3DEEA 1MJ9A 4PJ0C 5BS6A 2YTEA 2XRLA 5FKLA 2LC2A 2ZB9A 1Z05A 5B66C 2XV4S 4L5JA 1WJ5A 2R7UA 2YTJA 5LMNE 3CQZJ 2JXPA 2EPKX 3B73A 1XMKA 4ZH4F 4A3IJ 2NVUB 5F3WA 2LSOA 2CW0F 2CYYA 2VT2A 2K7LA 3F22A 2R7QA 3BZCA 5M3FJ 4PJNA 2IPQX 4X6AJ 3A2KA 5FKMA 2IJLA 2F5FA 2M4GA 4X8WA 4ZDLA 2VC0A 2CQ7A 1SAXA 2HQRA 1RC7A 3WGIA 1I27A 3S1RJ 4F93B 2L2NA 2CH0A 1JTXA 1DP3A 1FMWA 4WSGA 3ISPA 2ZXIA 4X66E 3RMPA 1TT0A 4V2FA 3CD6I 5K5RA 1BOAA 4IHTA 2UWMA 3Q0WA 1MBJA 1K4TA 3HOYJ 2VKHA 3RZOJ 3M4OJ 4N4RB 5K5QA 3COAC 3C4BA 5LRSA 2QSGX 2CSHA 1RR8C 5KHDA 3FXOA 5FLMJ 3BR0A 3MZYA 5JFRA 1XN7A 1MIJA 2FQ4A 3ZCOA 1AKHA 1KU7A 1BI1A 5FJ8J 1MGTA 2VQLA 3OYFA 1D8JA 1FC3A 1BN5A 2IGMA 1VQKI 3GF2A 3SYTA 1FYKA 3U2RA 4KUMA 3KP4A 3OIOA 1K78B 1KA8A 2JN6A 1MNDA 1S29A 2F5VA 4FETA 4ZYAA 2DU9A 2L2OA 1ZBQA 4WXHA 1TF6A 2EOXA 2GIVA 1KJKA 1IO2A 4AQYE 2JRMA 2EMBA 2FNPA 4HA8A 4DW6A 3H3VK 1R4MB 2JMWA 1MBKA 3HZJA 3K4MA 4CZCA 3L2VA 1FKAE 4DR7E 1NK2P 4F6NA 5E3NA 3RPQA 1D1AA 3LAJA 4IJDA 2H09A 2IVMA 2OJED 5EF6A 4L8NA 1BIAA 3HRTA 4I2OA 4B8XA 3JSPA 1L0OC 2P5VA 3BR2A 3HYIA 4IZZA 3M99B 3JRFA 4FX0A 2X6WA 2Y48A 2VB6A 1GVJA 2DDBA 2KRCA 5H2FC 5IP6A 1HW2A 2GXAA 1GHCA 4HLYA 2YT4A 4LFCE 2VJJA 3O6BB 3W2AA 3OYBA 2R76A 4BMJA 1XDUA 4KITB 3ZPLA 1GQEA 1E0EA 4JI3E 4EGZA 1JGSA 1PDNC 2EN7A 5F0FA 3RKWA 2LFBA 2ZSIB 5A69A 1MMNA 3LSJA 3PNYA 3M1CA 1WCMJ 4CO8A 4A93J 1XNRE 3V8LA 2Y69H 5HNFA 2EOOA 3EDPA 4BYYA 5CPRB 4HEA2 4YELA 1XCVA 2EN6A 1FX7A 4PSXA 4W97A 4CCNA 3K70C 1P4XA 3MZ8A 3PM1A 4I02A 3RCOA 4IOAF 2R0QC 2EM5A 3FIGA 4A3LJ 3TGNA 4HSTA 4OIQF 1IDYA 2YX4A 2IS2A 2L01A 4I01A 2DBBA 1Y6IA 3R61A 4XICA 1QU6A 3BCBA 3R0AA 3H5RA 4A3KJ 1MBEA 2KL4A 2XSJC 2E1MB 3B02A 1E2XA 2V87A 2PG4A 1R49A 2EMCA 3FXJA 2D5VA 1R9TJ 2LH9A 5K7HA 1HSTA 4WFTA 1HXDA 3IKVA 1ZG5A 4R1HA 1PYVA 4B4CA 2IGOA 3EQLF 2BBGA 1FIPA 2EPNA 3DF6A 5HLGA 1IQOA 2DYRH 4LOCA 1OCOH 2R93J 4G6DA 3ECOA 5CJ9A 3MZHA 3WTVC 2RN7A 4CH7A 3QODA 3JTZA 3ABLH 2VJ4A 3EETA 4MLVA 2HOTA 1X1CA 2KRHA 4JI2E 2EZKA 1U3EM 1O4XA 2K3PA 4FQGA 4KN7X 3ABMH 3KP5A 4BHPA 1XPXA 1P92A 1ETYA 3K70D 4F7ZA 4XLFA 3T8RA 4N9HA 3DTEA 1B6AA 4BJ6C 2ODRD 3J81K 2A07F 3M8JA 4BE1A 3JU0A 1CGPA 1J5EE 3K4KA 1T56A 4RB3C 2HJJA 1MMDA 2BVLA 3GO5A 1IBKE 4YY3E 1S7OA 4Y17A 5KL2A 4IOCF 3CTAA 1XB4A 3BZKA 3D0SA 1KU9A 1ZRCA 4X65E 2OZ6A 3CMYA 3PFIA 2BGCA 3QQAA 2EOJA 2GA1A 4NXNE 3G1OA 3ASOH 1UHWA 4XRSA 2JSPA 4KJZA 1OFCX 3VSLA 2M9AA 1AWCA 4CYCB 3CCEI 1T39A 1BR1A 4R2DA 2KONA 2HNHA 4RLFA 1FY7A 4L9NA 5D5UB 3V4GA 3WTSC 3LFUA 3MFKA 3MKYB 2V85A 1ZARA 4ON0A 4RA2A 2EOZA 2WCC3 3OL3A 3OIQA 4BC7A 4B3XA 3PQKA 4YHHE 3QOPA 2LTPA 1TLHB 2K5CA 2E7WA 1T6SA 1PDAA 5KVRA 3LFKA 5CQEA 2XDVA 2H8RA 5IT9Z 4IHWA 2PJRA 5K5OA 5ICGA 3E6MA 4MIMA 2MSYA 2B9DA 4I98B 4F54A 5FRMA 4LJZF 4GYIA 2QA4I 3P7NA 4U7BA 1Z3XA 1YLFA 4IRHA 3REOA 2L92A 4JX6A 4IS1C 3C4TA 4C3JJ 2CUEA 2CG4A 2JUCA 2IEKA 2XAHA 3RPUD 5GAEJ 3S1MJ 4M0VA 4B3TE 5E1WA 1IUFA 3GZNB 1VQ5I 2D45A 3LA7A 4L0YB 3VOEA 1VQNI 2E5LE 4EM0B 1U6GA 2ZC2A 2AXTC 3HTUA 2WADA 2RS7A 1HKSA 2L4AA 2NS0A 1USTA 1SVOA 1REPC 1T38A 4TUIA 2M45A 2DT7B 3CLOA 1IGNA 2JPBA 1STUA 4NZVA 3M9AA 5GTIC 1H0MA 1IN7A 2HPMA 2ENCA 3GBGA 3I59A 3O8GA 3WTZA 1SR9A 1J09A 4C3IJ 4XQFA 4CDGA 4FHTA 3BG6A 1U78A 5DD8A 1IUYA 5L3FA 2FD5A 2OQRA 1NEIA 4LLNA 5LGTA 2A6EF 1Q1VA 2W00A 3K1NA 3K2AA 4NQWB 1FPQA 5L3EA 2Y0SA 2ELYA 2EMWA 2V6EA 2XGCA 2HOAA 3DTKA 4B48A 4Y4RA 3ZMDA 2FRHA 1YYWA 2PN6A 1VI0A 2O7OA 3CDLA 4D9JA 5HLTA 2LJHA 2G9WA 3OS2A 2EE8A 3W6JB 2YTOA 3N4MA 1OISA 2L33A 1O3QA 4Y7NJ 3CC7I 1Q1HA 4BGDA 3A02A 2HVSA 3IAM2 2W48A 1N75A 2YR2A 4AM3A 4DYRA 1LPQA 4XBFA 5IP9J 3KYCB 4Y3OA 2EZIA 3BR1A 2UXCE 2DLKA 2Y0MA 3S3MA 5K1YA 3P1XA 1B1BA 3BG5A 4R2AA 1T2KA 5D4SA 5KL6A 2O8XA 1ZQ3P 3CMAI 3FHZA 2NUFA 3J7AY 4A0YA 3FM3A 2K40A 4N9IA 3L00A 1BJAA 4MQ9F 3GTQJ 3K7AJ 4B3RE 1D1CA 1U5TB 1SEUA 5F6FA 4HF0A 4EJUA 4I6ZA 2EN8A 1S8NA 3ZQLA 2JY9A 4G6TB 2EN2A 2ETHA 2XF7A 2KIMA 2YWQA 3A01A 3RI4A 4GRIA 4KN4X 2PJPA 2EOIA 2NNNA 3FXUA 2FV4B 3KP7A 1NH3A 1W4MA 5IYCJ 4UUVA 4BKXA 1ETQA 1ZH5A 3M3YJ 3A03A 3FZVA 4KIBA 2VPLA 3VYXA 2WAQN 2DA4A 2DA5A 2VQFE 1N32E 4X64E 1YZ9A 1X6HA 4B3ME 1TF3A 5J1RA 1K7AA 4G94A 2V1DA 4IQ4A 1G3YA 1FOXA 3F8MA 3WU1B 4KIFA 3JTGA 1RMDA 5DNYA 4LU9A 3NWTA 2GXBA 1MH4A 2EFOA 3H3ZA 3AAFA 3FXRA 4Q4ZF 2CQQA 3VFZA 4PSWA 4BQNA 2JK3A 5LEKA 2KHXA 4IHVA 4N4OB 1X3WB 2B63J 4OWRB 3DU6A 3WU2C 2HVRA 3ZMUA 1IXRC 3OR1C 1VTNC 1IMUA 3P5JA 1LQ1A 2EM6A 4G8XA 4D0PA 2QZ8A 5IT9C 2QSFX 4XLPF 1PJSA 3IRRA 2LLKA 5CKTA 4F52A 1PUFA 3OS0A 2VQHA 2TCTA 2QSHX 4ENMA 1I1SA 3HIFA 4XSXF 1HQCA 3MSWA 3K9TA 1DPUA 2MG4A 4P55A 4RHBB 2JA2A 2P6TA 5B3SH 3H5AA 1BBGA 2LP0A 3CZ6A 3HHGA 3VK6A 1DPRA 4X62E 3DPTA 2Z5UA 1FBUA 1U2WA 2BHYA 3G6EI 3CCJI 4O5GA 1N33E 3R60A 4HNVA 2CO5A 4K2EA 2V6CA 2DFIA 5IP7J 2XUBA 3CCQI 1OYYA 1HW5A 1MJBA 1J0RA 2EL4A 1OCTC 5FB2A 4ZTFA 2MW8A 1RKTA 3E3VA 5EEAA 2MC5A 1R6RA 5K7FA 1VQ8I 2JA5J 3SEQA 2OTLI 2YSOA 3HQ1A 2FXAA 1YIOA 4CXFA 1LE8B 4R2RA 1YUIA 3SDBA 2V7FA 2V1XA 4CCOA 2EILH 1F43A 2VJIA 2GZWA 2YSRA 3OYAA 1ZR2A 2M2EA 3BT9A 3H9GA 5IT3A 3RZDJ 1D0XA 1TWHJ 2JVGA 2WTEA 4MQVA 4XLNF 1GVDA 3GTMJ 1XGSA 2EPFA 3CUOA 2EMYA 2IA1A 3H36A 4RM3A 1X4OA 5E3LA 4ZYDA 5GTHC 2XGDA 3BC8A 1Z7UA 4BNCA 4EM1A 2M1BA 1MEYC 1DQUA 4BHCA 5J3LA 2VE7C 2K85A 2XAQA 3DF8A 2FMLA 4DGWB 3GZ6A 2HHHE 1DGRM 1JE8A 3ZQCA 1FZPB 4HRIA 2FBKA 2EOFA 3DCFA 2DA2A 2A68F 2WAQA 1D0YA 4HNTA 4EV0A 1W5CC 3GTJJ 2PI0A 2L7KA 2LKXA 2DPDA 5LL6R 4ASNA 3O2PE 3ZMTA 1HOMA 2LCEA 2AQEA 3IAS2 2MDGA 3ADGA 4BC9A 2D1HA 4GFBA 4XLAA 4LG3A 5JVTA 1RUNA 2H1KA 3OYCA 3HRUA 2R7VA 4FE7A 4LD5A 3DKXA 1Z1DA 4II2A 4WX9A 2CV0A 1HC8A 2X4HA 2OCEA 1FBSA 1R7JA 5FKOA 4ENJA 1N78A 4XKCA 1LNWA 4GEQB 5DTDA 2VONA 5LMUE 1UZCA 1YFHA 2BB8A 4HEIA 1I1GA 5EDNA 1Z77A 2E72A 4P1WA 4Z6YA 2WAFA 2LBFB 1F2IG 4L5EA 4MEYF 3FISA 2D9HA 4HNUA 2M7BA 2EOHA 1UHMA 2L7MP 3FM5A 2EPCA 2L54A 3CDHA 3GFLA 5HS7A 5BNGA 3ZQGA 3LLHA 1ZGAA 3K1MA 1P47A 3S1NJ 3FBNB 2V8QB 1R5HA 4O5VA 2M8GX 1EKZA 3FK6A 3CF2A 1OR7C 3I58A 4ENKA 2J5PA 4OOGC 3PO3J 2IRFG 2R7DA 4JI8E 2FMYA 4L5NC 4G7ZF 3ZQFA 2NUEA 1S5LC 3HPSA 2P0WA 1ZBTA 1XD7A 1FT9A 2EOEA 2EMZA 3NQOA 4JI6E 1ZHFA 3QWLA 1XGMA 3IKTA 2NVQJ 4ZDPA 2DXIA 4RAGA 5LRRA 4YFKF 1VZ0A 1XC5A 2WBMA 5ERIA 2M1SA 1AH5A 1FTTA 4NHRA 4JI4E 2P5LC 2QYOA 2L9SA 1X4PA 2XIGA 5IOYA 3ZQQA 2B7TA 4A2UA 1UJ8A 3FMSA 2HOEA 4AVZA 2UU9E 2HWVA 2VUMJ 1TTYA 3E97A 1JUPA 2VQGA 3F6HA 2BY0A 4L9TA 2LK2A 1JXSA 4A69C 2R7WA 2EMFA 5FD5A 2CW8A 5DM7F 2QBYA 4F55A 5H6RA 3CJNA 3HUGA 5HDGA 1WHNA 1GDTA 1ZREA 4Y13A 1QGPA 3ML6A 4Q35B 3I9V2 1XX5A 3F8CA 2ZKZA 3CUQA 1RC9A 2DOAA 2K3FA 5F1RA 2G7HA 2YU8A 2JP9A 2JA8J 3G1MA 3GXOA 1JJ8C 2W1OA 5L3GA 2R7RA 1TWAJ 1T4NA 3BDDA 2ADUA 4OU0A 1R71A 2COBA 2FBIA 4R2EA 1UN6B 3TOAA 2EA2A 2ISYA 1D1BA 3TOBA 4I76A 4U88A 1S7AA 2IW5A 1P7JA 1LKXA 4CYCA 5D5XB 4F92B 1KYQA 2CMPA 1B72A 2K9LA 1KZHA 4YRVA 3KCCA 3IHUA 2HDCA 5J1UA 3S3NA 2ZXWH 4C2MJ 4IJAA 2WZOA 4FK5C 4QWQA 1WSUA 2VOPA 1BBOA 1EKEA 1ZYRF 1HF0A 2ZBKA 4BE2A 4LGWA 4AYBA 1YOVB 2LVHA 2L7ZA 1G3TA 1KONA 1ERDA 1P2FA 2YTPA 1T95A 2HGHA 4OOIA 2Z2SB 3E5UA 3QPTA 2WY8Q 3UNGC 5ICCA 3P9IA 3WHCA 1JTYA 4XORA 4XLCA 2EL6A 5DEQA 2HQ5A 4G9YA 1QRYA 2DO7A 2GXGA 3K2ZA 3MKLA 2DLQA 1VQOI 4I0BA 2FF4A 3G2BA 4E7IA 5BPIA 3ABUA 2LBSB 2R5YA 4FASD 3QPHA 4S04A 2DA1A 5J8FA 2KDOA 3HRMA 3OMYA 1AOYA 1KQ9A 4IEJA 1X58A 2ZXJA 1UHZA 4WPYA 1HDPA 1YTYA 3PSIA 1SFEA 5AC5A 2R92J 2E1NA 4R2QA 1Y56A 3PFYA 1RETA 3BIDA 4PJMA 1O7FA 2PMUA 2MH2A 1J59A 1YRNB 1YW9A 5J40A 3KYLA 2EMIA 1SMTA 1Z21A 3SZPA 1NTCA 2IAIA 1WGXA 3AFHA 1K83J 3E6BA 4R2CA 1STZA 3I5UA 1I6XA 1M1EB 5BPDA 1T0FC 4UXNA 2GLOA 2CW7A 2LMDA 1R00A 1FMVA 3M7GA 4FX4A 2EPMX 5E79C 1ZTRA 5A6BD 4IHXA 1OR7A 1F1ZA 1OQYA 2COMA 3HOVJ 4F9AB 2RKHA 2EM8A 4UNOA 3HOXJ 2HYGD 1IV6A 2E35A 1IN6A 2IGNA 1YX5A 3OOPA 4M3GA 4MO7A 2W25A 1X2MA 2CQNA 4AWXB 3WE3A 5IYBJ 2RTXA 1R1UA 5TGTA 4O43A 1VF9A 5J4VA 2VN2A 1TQIA 2DQRA 1R36A 2ZCWA 3TBIA 4JOMA 2QVOA 2B9SA 1MW7A 1FOWA 2PMHA 4EMSA 3S2HJ 2LUPB 2BYVE 2VBWA 2JUGA 3HOUJ 1PUFB 4XNFA 4LTYA 5F04A 4A5NA 2K02A 4KICA 4RDUA 3TW7A 3A0BC 2DMYA 3HTXA 5DM6F 4MFDA 3DEWA 3S2DJ 2HXIA 4R8OA 2K4JA 1Z3YA 4PCQA 1D5YA 1AAYA 2LTSA 2MABA 3PJRA 1LUJB 5KK1A 2BOLA 4WK8F 1C0WA 4YEJA 3JRAA 2ESNA 2QQ9A 1ETVA 3TMOA 2DMIA 1MJAA 3KP6A 2BVMA 2VI6A 2E60A 4U87A 4DUYE 2EV0A 2Z1DA 2O8KA 2QQ8A 1N36E 3LSPA 1W7PD 3WHBA 3CCSI 2CGPA 1QPMA 1XTAA 2FU4A 2GA2A 5FROA 1IC8A 2OTJI 3E6DA 1NG7A 1Z7LA 1UMQA 1Z9CA 4E70A 5EGOB 3WTXC 5KL4A 2EM4A 1BC7C 3QYBA 3WG7H 1WJAA 2XPUA 2JWTA 1B8IA 4QSHA 4R03A 3FXLA 5FD6A 1R1VA 2EQ0A 4HQEA 5E17F 2R4GA 4EM2A 1G3WA 1VQPI 4CHUA 2QKMB 1VQ9I 4L18B 2XKOA 4DV0E 3H09A 4AD9A 5HDNA 2QENA 3VWBA 4I7HA 1ULYA 1X3ZB 4Q48A 4DV3E 1GUUA 3DU5A 5D6EA 5F1JA 3DPLC 5TSEA 4LIVA 5EEHA 2X0LA 3JAMC 3CESA 2HC5A 1N3GA 4BDYA 1A04A 1MZBA 3UR3C 3QAHA 5IV8B 2LO3A 3CCMI 2JWOA 1RNLA 2IA0A 5ICEA 4MTDA 1J9IA 4BBYA 3LNQA 4BJTA 5E3OA 3JRDA 3GTKJ 2BXYA 3SFIA 2E5NA 2LR8A 2RREA 4LB5A 4A12A 1ON1A 4R79A 3K0LA 2VQEE 1SVMA 2VODA 2L0KA 4IX7A 2DLLA 1WWXA 3O3KA 1V5FA 3WG9A 1W0UA 2XGEA 1Z6RA 5E18F 2GOXB 3GTOJ 4JYAE 3MQ0A 1WH5A 2DOEA 1PP8F 4WYQB 1IDZA 1A1FA 3WU0A 3D1NI 3GEZA 4DV6E 2OBPA 1LDDA 1XGOA 3OSFA 2EP3A 5AC4A 2VXDA 4UUSA 1S6LA 1R58A 3HHHA 2ENAA 3K69A 4GCVA 3F8NA 1E3OC 4HQMA 3AG2H 4UUTA 5DD4A 2JOXA 5AASA 3BPXA 4JK1X 5L3CA 1FJLA 4B3SE 4B44A 4D5FA 3L1PA 4ZYHA 4XRMA 2EMGA 2K9SA 2H8WA 2VXZA 2LRSA 1FP2A 1EH7A 1HNWE 1FWZA 2YTIA 1WXRA 4M74A 4LLLA 3JRBA 1WPKA 2EFPA 2EZ6A 2IA2A 4HF2A 4RB2C 2ELKA 3MWMA 2M4IA 1WJEA 4XM3A 1R22A 1R4NB 3BCAA 4E7KA 2P7VB 4RB0A 2HDDA 4DYQA 2ELHA 1T8IA 1RKWA 3BOQA 2BE5F 4IPAA 5D5VB 1ON2A 2HZTA 3RQIA 1JKRC 1WZ2A 2OU2A 2JVHA 5KNLA 4P78A 3DTIA 3J7AG 3P9CA 2VLAA 3F3XA 2CV1A 1X49A 1TW3A 3DFGA 1WH7A 4ZYEA 2IXSA 2LMZA 4WSPA 4P9FA 1ENHA 1U0JA 4NNJA 3HOTA 2EWLA 3LMMA 4RGSA 3BPVA 2X1EA 3CP8A 2N3GA 4GO1A 3J81C 1OMIA 2LY2A 4LG0A 5HODA 1T98A 2H27A 3DQVC 4JI7E 4MGRA 1RRJA 2VE8A 3HPHA 2R5ZA 3AL0B 3IWBA 3LMLA 5E1ZB 3T1HE 4M9XA 5HOOA 1APLC 3HEFA 4IVNA 2EQ1A 1XNQE 5DDGA 5A2QC 3CF5F 4NUBA 5AIPA 5J4YA 5B5EC 5GPCA 2MD5A 4U0WA 1L4SA 3Q9VA 4HDVA 5CQGA 4A0XA 3ULQB 2DSYA 3D5LA 1YITI 1T08B 3MHSC 4D7NA 4M3EA 3MKZA 2UV1A 4OINF 1JHFA 2UXNA 4J01A 2EMKA 2W24A 4LIUA 3ZP5A 2ECCA 3CCLI 5LFAA 4DKKA 4JYKA 4XONA 3W2VA 1BI0A 2L3JA 4BEHB 1K4SA 2EZHA 2IBDA 4LF8E 2EQRA 1MNMC 1SD4A 3Q5FA 4G6QA 3IRQA 2VJ5A 2XB5A 5FO5A 1X1DA 2EMXA 4IRIA 3BP8A 1UBDC 3V8JA 3IC7A 3WTTC 2ZXHA 3M8FA 1QBJA 4CICA 4ETSA 2B0LA 2EPZA 1XSVA 1H89C 2JTVA 3CUQC 2DI3A 5KL5A 4QTRA 3EUHA 3EUKL
chains in the Genus database with same CATH topology
4LLGF 4AVPA 2OD5A 2V1UA 5D6FA 3QP5A 4HDUA 5IT9K 4JQFA 5BOXA 1LEBA 3HTSB 1D8KA 1LJ9A 2EV5A 3Q9SA 1LDKB 5D5WB 1YS7A 5J6XA 4U0YA 2JPCA 2CSOA 3DKWA 4EJVA 3F21A 1BC8C 3RYRA 3WGHA 4ZZLA 3LAPA 2FA5A 4EJTA 2HFHA 3HRSA 1ZG1A 4IHSA 2HKXA 2KIFA 2J5OA 5FFZA 3ROUA 1UB9A 2RC4A 2EFNA 3H92A 1D3YA 2L02A 4UV9A 3JSOA 2UZKA 1WQ2A 2OAZA 5E8IA 1F5TA 1UFMA 2STWA 3DEUA 2H94A 2UXXA 1DP7P 1LEAA 2DW4A 4ESJA 1G6NA 4MEXF 4RGRA 4XSZF 2FQ3A 3FX3A 2XGXA 2HQNA 3LA3A 3ERED 3JW4A 2RGVA 2P4WA 3BWGA 3QRFF 3T1BA 5A2QZ 4WXDA 3KE2A 4AIKA 3MEXA 3KFWX 1IRFA 5HDKA 3E6CC 3SXYA 5DUIA 1XGNA 1YW7A 2AXLA 5ILUA 1OKRA 2IT0A 3QP6A 2LF8A 2RNJA 5TRDA 2C6YA 1IXCA 5CVIA 1RZ4A 2RVCA 5TJJA 5DV5A 2R3SA 2EFWA 4NHJA 4MNUA 3BROA 1F9NA 1BBYA 3GZ5A 3GW2A 3QU3A 4RGXA 5FLXK 4G7HF 4EQQA 4ESFA 1ZLKA 2BEOA 5CLSA 4QLCU 5HLIA 3DXJF 4BH9A 2A5YB 1BIBA 5DCMA 3ZN1A 1TBXA 1O3TA 4G7OF 2FOKA 1RUOA 3R4KA 2DTRA 3FMRA 1V4RA 2DT5A 2PEXA 1IXSB 1E17A 2XAJA 2XAFA 3I53A 5LHIA 2ESHA 4U0VA 4DQ2A 2MH9A 1XMAA 3ZMSA 1YG2A 5L3BA 2K86A 5AIQA 1WRJA 2QQAA 1YO5C 2O3FA 3ZMZA 4A0ZA 1KGSA 4M9ZA 4UVAA 3GWZA 1HW1A 4NB5A 4RAYA 3T5XA 1U5TC 2DAOA 3BY6A 4YFNF 1J5YA 1FNNA 3ZQ7A 2HR3A 2G7UA 2WV0A 2M8EA 3J7AO 5A2QK 3L9FA 4P5OA 4L5IA 1ZRFA 2LDUA 1PUEE 1KU2A 1KYWA 1RIOH 1MKMA 5FGMA 2QWWA 4HX7A 1QZYA 3I0TA 2ZMEB 3F6VA 3M8EA 1HSJA 1W7PB 2JSCA 1R23A 2H6CA 4Q47A 2HS5A 4N0BA 5LGNA 1IN4A 2MA3A 5HVQC 4HV5A 4HF1A 4DNCA 1IW7F 1BI3A 2DQLA 3LWFA 4TV7A 4H0EA 5E8GA 3GUDA 5ICFA 5CVRA 4KT5C 1OYIA 2H6BA 1NHAA 4M71A 1CF7B 1KU3A 3H3UA 5DYMA 4EVIA 2XASA 1ZLJA 2LF7A 3V7RA 2P8TA 4KNYA 2E7XA 3P9KA 4LB6B 3U9GA 1OPCA 1TNTA 3IWZA 2ZNYA 3BJAA 1G3SA 2ISZA 4NQWA 2Q0OA 5DCFA 4UVCA 3MAJA 2F5DA 4CZZA 3F6OA 2K27A 3HOSA 5H6QA 3RDIA 5FFXA 2A3SA 2BV6A 2VE9A 4PZJA 2V79A 1T0FA 2STTA 2VBXA 2WC2A 3TO7A 3OV8A 3GLXA 5DCMB 5BMZA 2CWEA 2Z9OA 1JHHA 1MDMB 4EGYA 5HS8A 1FP1D 2Z33A 1TW2A 2JT1A 2DK8A 1SMYF 4WF2A 2WWYA 3EYYA 3LQRA 1G4DA 1W5SA 1KQ0A 4HOBA 5HLHA 3KP3A 3N97A 1IF1A 2JZYA 4CGZA 1WKMA 5D4RA 2EB7A 1LB2A 4L9JA 5LHHA 2ACJA 3JAMZ 2HTJA 3RKYA 4L0ZB 3WGGA 5LEJA 3FWEA 3C1DA 1HKTA 2VBYA 2F5EA 3VODA 1O3SA 4RB1A 3FXQA 4OIRF 5L3DA 3DV8A 1USSA 2A61A 5H20A 1MD0A 4ZYGA 1TNSA 2MBFA 2NAZA 2HGCA 4AIHA 3HSEA 4HV6A 3F72A 3ZMVA 2RDPA 2VC1A 2JRTA 3CO6C 5CVJA 1B9MA 4BAYA 4BXUA 1FBQA 2EWNA 1EH6A 1L3LA 4LK1F 2NRAC 1GXQA 4PDKA 2FSWA 1OYWA 4EJOA 1SD5A 3HSRA 2XVCA 1FLIA 2P5KA 4MHGA 1XDSA 1ONVA 2ZNZA 1FOKA 2L3DA 4XRFA 4O6JA 3M1EA 3I64A 4O3MA 4Z2YA 3ELKA 4ESBA 4JBAA 4PGGA 1IN5A 4YIIA 3GFIA 4KIGA 1XSDA 2V9VA 5AONA 1O7LA 2EK5A 2PLYA 4GYGA 3VEPA 2A69F 2Y75A 2W57A 1BM9A 4OMYA 4BQAA 4RGUA 3SZTA 4BHBA 3KP2A 2AS5F 2GAUA 1PP7U 3I59B 4WWCA 1ZGJA 3C18A 4P96A 5E1XA 3ZN0A 4LG0B 2M30A 4PGHA 3J80K 3KLOA 4IF4A 2QBYB 5LGUA 1UCRA 2D2WA 2FBHA 4M6XA 1K79A 3V7CA 2NNYA 3EYIA 4WXCA 3LQQA 3KEOA 2PQ8A 4KA4A 3JAMK 1FSEA 4OMZA 1HBXG 3G73A 3SFZA 1B4AA 1O57A 2HKOA 5FLXZ 4L9VA 4KMFA 1KQ8A 4I0AA 4OIPF 3GFMA 3TO9A 1FYMA 1P4WA 2M87A 3WTYC 3R0JA 3VB2A 1SFUA 3GX4X 1S3JA 4GGGA 4LMYA 3ECHA 2K4BA 4MTEA 3TDZC 4YG2F 1P6RA 2L4MA 4A6DA 4Q5SF 3BJOA 2O61A 1GXPA 1Y0UA 3K1PA 2XKPA 3RKXA 2ZFWA 3WE2A 1R1TA 1XSXA 1X3UA 3QU6A 3KETA 1SD6A 3SHFA 2FNAA 4IRGA 4KMUX 1YS6A 1B9NA 4CYDA 4A5MA 4I09A 2HYFA 2OA4A 3RJPA 3KZZA 4HW0A 3JTHA 2CFXA 2XROA 6PAXA 1IAWA 1W5TA 1MDMA 4A6EA 3KEQA 1ZAOA 3IL2A 1K78A 2MC3A 4M9SA 3J80Z 2R7FA 1J2XA 1ZN2A 4LK0F 3U1DA 2QM3A 3C3WA 4YIFA 1F4KA 2F2EA 2BBYA 3NEUA 4IXAA 4LFUA 2GWRA 1EV7A 3SQNA 3L7WA 2W84A 2CQKA 1O3RA 2KKOA 4S05A 2Q2EA 5JR3A 1LVAA 3BJ6A 5CYVA 5ILVA 3GFJA 5F64A 5HS9A 1H9GA 5J8CA 4UV8A 3KLNA 2VT3A 2TDXA 2XRNA 2XHKA 1IZ1A 2VOOA 1P4AA 4YFXF 2FEZA 3LSTA 1FSHA 4M73A 2W85A 5LLQA 3PQJA 1D5VA 2DK5A 3TKYA 2RQPA 1SD7A 4Y15A 5BQTA 3NRVA 1ZG3A 1QO0D 3E5XA 3I4PA 3T8TA 2XAGA 3BZ6A 4FT8A 1KYZA 5ILSA 4B09A 1J75A 4UVBA 3G3ZA 2P7CB 1LDJA 1SFXA 1W7PA 2ZJ2A 3WODF 2DPUA 1TQPA 5CVUA 1DUXC 3R6SA 5EEGA 3GYHX 1R5GA 2Z99A 1WI9A 3C7JA 4HZFA 1DDNA 3FF5A 2NYXA 2A6HF 2PFBA 4KYWA 2MLKA 5JI6A 3TO6A 1RI7A 2EV6A 2EFQA 3CUQB 4HAMA 3V7SA 2VBZA 3ABTA 4P9UA 2F5CA 3TDUC 4HYEA 2EJRA 4KFCA 1QQIA 1QNTA 3RYPA 1QZZA 4HX8A 3F8FA 2QLZA 2P6SA 2O6GE 5D8KB 5CVVA 4GXOA 1BI2A 3F8BA 1H9TA 3S2WA 4EJWA 3FMQA 4HBLA 5E20A 1IN8A 4WCGA 1Z91A 2OZUA 1HKQA 3RTRA 3E5QA 3IWFA 2KRFA 1K6OA 2E1CA 3RPUA 4HX4A 4ENNA 3J81Z 3KZYA 1J7KA 4M6YA 4RS8A 2QQBA 5LBQA 4ZZDA 1YYVA 1CF7A 2KJBA 5LHGA 2LNBA 5D8LB 1U8RA 4AIJA 2MLGA 5ED4A 4U7DA 3GVAA 2HTSA 1YQAA 1U5TA 1EH8A 3F23A 3T0YA 2KJCA 2IP2A 2ZO4A 2Z3YA 2KIUA 1FYLA 4KDPA 2FE3A 4HLXA 2ZMEA 2O0YA 5DUKA 3I71A 3MCZA 2PBIA 2EA4A 1ZRDA 5JHUA 3WTWC 4R8HA 4OIOF 1V3FA 3TQNA 3W6KB 1IRGA 1Z6TA 2RV8A 1XCBA 3I54A 2OQGA 2YPRA 2Q8KA 2D1VA 3V8KA 2O03A 1YW8A 2LKPA 2QUFA 1B59A 2YX7A 2HEOA 3L2CA 3RIRA 2YU3A 3DP7A 4M72A 3L09A 2M5WA 3HSFA 4RAZA 3CO7C 3LA2A 4UHTA 1I5ZA 1TQMA 1ODDA 2GQQA 3WTUC 5BS6A 1MJ9A 1Z05A 2XV4S 4L5JA 3B73A 1XMKA 4ZH4F 2LSOA 2CW0F 2CYYA 2VT2A 2K7LA 3F22A 2IPQX 2IJLA 2F5FA 2VC0A 1SAXA 2HQRA 3WGIA 1I27A 3ISPA 5K5RA 1BOAA 4IHTA 2UWMA 5K5QA 3COAC 5LRSA 3MZYA 5JFRA 1XN7A 1KU7A 1BI1A 1MGTA 1D8JA 1FC3A 1BN5A 3GF2A 1FYKA 3U2RA 4KUMA 3KP4A 1K78B 1KA8A 1S29A 2DU9A 4WXHA 2GIVA 2FNPA 4HA8A 3RPQA 3LAJA 2H09A 2IVMA 1BIAA 4I2OA 3HRTA 4B8XA 3JSPA 1L0OC 2P5VA 3HYIA 4FX0A 2Y48A 1GVJA 1HW2A 1GHCA 4HLYA 3O6BB 1XDUA 3ZPLA 4EGZA 1JGSA 1PDNC 3RKWA 4CO8A 3V8LA 3EDPA 4BYYA 1XCVA 1FX7A 1P4XA 4I02A 3TGNA 4OIQF 2YX4A 2L01A 4I01A 2DBBA 3R61A 3R0AA 3B02A 1E2XA 2PG4A 1HSTA 1HXDA 3IKVA 1ZG5A 4R1HA 3EQLF 5HLGA 4G6DA 3ECOA 5CJ9A 3MZHA 3WTVC 2RN7A 3EETA 1U3EM 4KN7X 3KP5A 4BHPA 1P92A 4F7ZA 3T8RA 4N9HA 1B6AA 3J81K 2A07F 1CGPA 4RB3C 3GO5A 1S7OA 4Y17A 3CTAA 1XB4A 3D0SA 1KU9A 1ZRCA 2OZ6A 3PFIA 2BGCA 2GA1A 1UHWA 1AWCA 1T39A 3MFKA 5D5UB 1FY7A 4L9NA 3V4GA 3WTSC 1ZARA 4ON0A 3PQKA 3QOPA 1TLHB 2E7WA 1T6SA 5KVRA 3LFKA 5IT9Z 5K5OA 5ICGA 3E6MA 4I98B 4LJZF 4GYIA 3P7NA 4U7BA 1YLFA 4IRHA 3REOA 2CG4A 2XAHA 5E1WA 4L0YB 3LA7A 2D45A 3VOEA 4EM0B 1U6GA 3HTUA 1HKSA 2L4AA 2NS0A 1USTA 1REPC 1T38A 2M45A 3CLOA 2JPBA 3M9AA 1H0MA 1IN7A 3I59A 3WTZA 4CDGA 4FHTA 1U78A 5DD8A 1IUYA 5L3FA 2OQRA 4LLNA 5LGTA 2A6EF 3K1NA 1FPQA 5L3EA 3ZMDA 2FRHA 2PN6A 2G9WA 3W6JB 3N4MA 1O3QA 1Q1HA 2YR2A 4XBFA 2Y0MA 5K1YA 1B1BA 1T2KA 5D4SA 2O8XA 3FHZA 4A0YA 3FM3A 4N9IA 3L00A 1BJAA 4MQ9F 1U5TB 5F6FA 4HF0A 4EJUA 1S8NA 2ETHA 2KIMA 3RI4A 4KN4X 2PJPA 2NNNA 3FXUA 3KP7A 1W4MA 4UUVA 1ZH5A 3FZVA 4KIBA 1K7AA 4G94A 2V1DA 1G3YA 3F8MA 3WU1B 4KIFA 3JTGA 2GXBA 2EFOA 3H3ZA 3AAFA 3FXRA 4Q4ZF 3VFZA 5LEKA 3ZMUA 1IXRC 1VTNC 1LQ1A 4G8XA 4D0PA 2QZ8A 4XLPF 3IRRA 1I1SA 4ENMA 3HIFA 4XSXF 1HQCA 3K9TA 1DPUA 4P55A 2P6TA 3HHGA 1DPRA 3DPTA 2Z5UA 1FBUA 1U2WA 3R60A 2CO5A 4K2EA 2V6CA 2DFIA 2XUBA 1OYYA 1HW5A 1MJBA 1J0RA 5FB2A 3E3VA 2FXAA 1YIOA 4CXFA 2V1XA 2GZWA 2YSRA 5IT3A 2WTEA 4MQVA 4XLNF 1XGSA 3CUOA 2IA1A 4ZYDA 1Z7UA 4BNCA 4EM1A 2M1BA 4BHCA 2XAQA 3DF8A 3GZ6A 2FMLA 1JE8A 1FZPB 2FBKA 2A68F 4EV0A 2PI0A 2DPDA 4ASNA 3O2PE 3ZMTA 2D1HA 5JVTA 1RUNA 3HRUA 4LD5A 1Z1DA 4WX9A 2X4HA 1FBSA 1R7JA 4ENJA 1LNWA 2VONA 1YFHA 1I1GA 4MEYF 1UHMA 3FM5A 2L54A 3CDHA 3GFLA 5HS7A 1ZGAA 3K1MA 1R5HA 4O5VA 3I58A 4ENKA 2J5PA 2IRFG 2R7DA 2FMYA 4G7ZF 1XD7A 1FT9A 3NQOA 1ZHFA 1XGMA 3IKTA 5LRRA 4YFKF 5ERIA 2P5LC 2QYOA 2XIGA 4A2UA 3FMSA 2HOEA 2HWVA 1TTYA 3E97A 4L9TA 1JXSA 5FD5A 2QBYA 5H6RA 3CJNA 3HUGA 5HDGA 1ZREA 4Y13A 1QGPA 3ML6A 3F8CA 2ZKZA 3CUQA 5F1RA 2G7HA 3GXOA 5L3GA 3BDDA 2ADUA 4OU0A 2FBIA 3TOAA 2EA2A 2ISYA 3TOBA 4U88A 1S7AA 2IW5A 5D5XB 3KCCA 3IHUA 2HDCA 4IJAA 4QWQA 1WSUA 2VOPA 1ZYRF 2ZBKA 4LGWA 1G3TA 1P2FA 4OOIA 3QPTA 3E5UA 5ICCA 3P9IA 5DEQA 4G9YA 2DO7A 2GXGA 3K2ZA 4I0BA 2FF4A 5BPIA 3ABUA 3QPHA 4S04A 5J8FA 3HRMA 1AOYA 1KQ9A 2ZXJA 1YTYA 1SFEA 2E1NA 1O7FA 2PMUA 2MH2A 1J59A 1YW9A 1SMTA 3SZPA 3E6BA 1STZA 3I5UA 1I6XA 5BPDA 4UXNA 1R00A 3M7GA 4FX4A 1OR7A 1F1ZA 2COMA 2RKHA 4UNOA 2HYGD 3OOPA 1IN6A 2W25A 4AWXB 3WE3A 1R1UA 2VN2A 1TQIA 2DQRA 1R36A 2ZCWA 2QVOA 2PMHA 4EMSA 2BYVE 2VBWA 4A5NA 2K02A 4KICA 2K4JA 4PCQA 5KK1A 4WK8F 1C0WA 2ESNA 2QQ9A 1MJAA 3KP6A 2EV0A 1W7PD 2CGPA 1QPMA 2FU4A 2GA2A 3E6DA 1Z9CA 4E70A 3WTXC 1BC7C 5FD6A 1R1VA 4HQEA 5E17F 4EM2A 1G3WA 4CHUA 4L18B 2XKOA 4AD9A 5HDNA 2QENA 4I7HA 1ULYA 4Q48A 5D6EA 3DPLC 5EEHA 2X0LA 1A04A 1MZBA 3QAHA 1RNLA 2IA0A 5ICEA 4MTDA 1J9IA 4LB5A 4A12A 1ON1A 4R79A 3K0LA 2VODA 2DLLA 1WWXA 3O3KA 3WG9A 1Z6RA 5E18F 3MQ0A 1PP8F 3WU0A 3GEZA 2OBPA 1LDDA 1XGOA 1S6LA 1R58A 3HHHA 3K69A 4GCVA 3F8NA 4HQMA 5DD4A 3BPXA 4JK1X 5L3CA 4ZYHA 2VXZA 1FP2A 1EH7A 1FWZA 4M74A 4LLLA 2EFPA 2IA2A 4HF2A 4RB2C 3MWMA 1R22A 2P7VB 4RB0A 2ELHA 5D5VB 3BOQA 2BE5F 4IPAA 1ON2A 2HZTA 2OU2A 3P9CA 3F3XA 1TW3A 3DFGA 4ZYEA 4P9FA 3HOTA 4RGSA 3BPVA 4GO1A 1OMIA 4LG0A