4WXDA

Crystal structure of mycobacterium tuberculosis ogt-r37k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
b'MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSKTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxdA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxdA01
2Q2EA 2HOEA 2ZMEB 3RPUA 4L9JA 2G9WA 3DPTA 5CVUA 3TKYA 1WSUA 1ZHFA 2HQRA 3F8CA 4NQWA 1QO0D 2NS0A 3LA2A 5ICFA 4Q48A 2XAJA 4HV6A 5LRSA 4MQ9F 5IT9Z 1I5ZA 1K78A 2FXAA 5CVRA 4L9NA 3N97A 4BYYA 5LLQA 2ESNA 1IRFA 1IN5A 1FZPB 1F5TA 4HAMA 1XB4A 2XAFA 3S2WA 2C6YA 3I0TA 2G7HA 2EFQA 2CSOA 4N9HA 5AONA 2E7XA 2HS5A 4UHTA 1WQ2A 1QQIA 1FP2A 2OU2A 5LEKA 3M8EA 4CGZA 3MFKA 3TO6A 2B0LA 4LLNA 4A0ZA 3IC7A 3HOSA 4I7HA 1FYMA 2FMLA 3E6CC 3LQRA 2R3SA 2W84A 1TLHB 1CF7A 3EQLF 3KLNA 5L3EA 3R6SA 2STWA 1J75A 1ZGAA 5JHUA 1SAXA 6PAXA 3Q9SA 1UFMA 2ESHA 2M1BA 1R1VA 5CLSA 3CO7C 4LJZF 3T8TA 1FSHA 4KMUX 4ESJA 2BGCA 3TDUC 3G3ZA 3HTSB 3T0YA 2JPBA 2JRTA 3W6JB 1O3RA 1IRGA 4DQ2A 2EV5A 1U8RA 3D0SA 2PEXA 3BJAA 5LBQA 4EGYA 5FB2A 4O3MA 5FLXK 4BHBA 1A04A 2EWNA 4A0XA 1RNLA 2DBBA 2L02A 4U0WA 3RYRA 3E5XA 4OIQF 5DD8A 3M8FA 1P92A 3R0AA 3I58A 2OD5A 2DAOA 3I5UA 4B09A 2UWMA 4CYDA 4G7ZF 2VONA 3P9KA 2V79A 1MGTA 1BIAA 3D5LA 1B59A 4UVAA 4BQAA 4P5OA 4FT8A 1RUOA 1MZBA 1XGOA 2HZTA 2RGVA 3IWFA 1SD7A 4KIGA 4CZZA 2P5KA 3ROUA 2MLGA 4WCGA 5D6EA 5DCMB 5BPDA 1ULYA 5F64A 4LK1F 5BS6A 4OOIA 4M71A 1YQAA 2Q8KA 3I54A 3CTAA 3KLOA 3K0LA 3RI4A 1BI2A 3KETA 3ECOA 4KDPA 4EGZA 1RIOH 5ERIA 1DUXC 3C18A 4EMSA 5E8IA 1KQ9A 2VBZA 2NNYA 1HKQA 1HXDA 2OZ6A 2PQ8A 2O6GE 2EK5A 2VBYA 2YX7A 4Q5SF 3BROA 3C7JA 5ILUA 3ZN1A 1ZLJA 2PI0A 1S6LA 4ZYHA 3IWZA 1HW5A 3QP6A 3L9FA 1MJ9A 3SZTA 1OR7A 1UCRA 1W5SA 4Y17A 1XDUA 2QQ9A 4FHTA 1OMIA 1XCBA 2EB7A 2ZNZA 4LLGF 3HUGA 5K5OA 5HS8A 2P5VA 1CGPA 1YYVA 4HDUA 5F1RA 4MEXF 1XGMA 3OV8A 2Y0MA 1LDJA 3GF2A 3O6BB 1O3TA 4CHUA 1HW2A 2LF8A 1ZRDA 3BPVA 5LGTA 3M7GA 2AXLA 2VC1A 3L00A 5HDGA 4PZJA 4RGRA 4S04A 2ADUA 1U78A 3FF5A 2YPRA 1T98A 3IRRA 4LG0A 1IW7F 2HR3A 1FPQA 2XROA 1SMYF 4GYGA 5FFZA 3FXRA 3WTUC 3WTYC 1FBUA 3DXJF 3R4KA 5A2QZ 3J81Z 1XSVA 3KP6A 4WF2A 3TO9A 2DU9A 5D8KB 1T39A 4KN7X 1GXPA 1P4AA 2G7UA 2H6CA 1DPRA 4U7BA 4HA8A 4IVNA 2FNAA 3LQQA 5ICCA 5D6FA 2CGPA 1LEAA 3MEXA 2EFNA 2FBKA 2RDPA 4O6JA 4EQQA 3ZMZA 2XGXA 3IL2A 3HYIA 2TDXA 5KVRA 1R22A 1IUYA 3G73A 2VOPA 1FNNA 1EH6A 1ZARA 2RN7A 4BXUA 4DNCA 3MQ0A 2VT3A 2KIMA 2HGCA 2A07F 1KYZA 1U5TC 5J8CA 2KRFA 2GXGA 4ASNA 3KZZA 1IZ1A 3GFLA 3LA3A 1KU7A 3RTRA 5E1ZB 1BM9A 2LNBA 1G3SA 4LGWA 4RB0A 3I4PA 2JSCA 2EFPA 3N4MA 3CUQA 1QNTA 5ICEA 4UV8A 3ZMTA 4Y13A 2ZKZA 4XSZF 3WGGA 3KP5A 2F5FA 4PCQA 1BN5A 2VT2A 2YU3A 5D5UB 1IN4A 3ECHA 1YO5C 1ZH5A 1I6XA 2DPDA 3T1BA 3BDDA 3E6MA 5DD4A 2CFXA 2YR2A 4A12A 1TQIA 2MD5A 5HS9A 3FMRA 2D45A 2VXZA 3L7WA 4S05A 2FBHA 1RUNA 3KEOA 3BP8A 2MLKA 1W7PD 3WTZA 3QPHA 4EM2A 2M45A 1MDMB 3EYIA 1XN7A 3FXQA 4I02A 4P55A 3V7CA 5FD5A 3F3XA 4YG2F 1TTYA 3T8RA 3WU1B 1TBXA 1KGSA 3ZN0A 2W24A 5DDGA 5JFRA 2XKPA 3F8BA 4U0YA 4M73A 5E8GA 4ZH4F 3V8LA 1O57A 3SQNA 1IN7A 5EEGA 2DT5A 4RB3C 3WTXC 3BOQA 2O03A 3P9IA 2QBYB 1R36A 4KICA 4LB5A 2CO5A 2HYGD 2HTJA 1U3EM 1FYKA 2KJCA 3R0JA 1S8NA 4Q4ZF 3KP2A 4MTDA 5FO5A 1S7AA 2EV0A 4GCVA 4LMYA 2GXBA 5H6QA 5LEJA 1U6GA 2ZMEA 2K4JA 1FC3A 5FLXZ 4AIJA 2DQLA 2L4AA 2GA2A 1G3YA 4IPAA 4L18B 1YG2A 5D8LB 3GVAA 3DFGA 3JAMK 4RGUA 5CVVA 3QU6A 4HF0A 2FE3A 1FLIA 5CVIA 3BWGA 5CVJA 1IN6A 2IA0A 5BQTA 2CWEA 1Z6RA 1FX7A 1KU9A 3P9CA 3CLOA 3QAHA 4HBLA 2O3FA 3NQOA 3FX3A 1GXQA 1YW8A 4N0BA 1BI3A 1KA8A 4G94A 3TQNA 3K1PA 3QRFF 2H6BA 2O61A 2P7VB 4Q47A 1W7PB 3F22A 1O3SA 3F23A 2CG4A 1PP8F 1O7LA 1OYIA 1USSA 2DK8A 1IN8A 3F6OA 2K7LA 4CDGA 1R1TA 3FXUA 3WTWC 2KKOA 4KA4A 1FSEA 3GXOA 2UXNA 1LNWA 4XLPF 4MTEA 1K6OA 1ODDA 2MBFA 4IRGA 2PLYA 4L0ZB 5LGNA 1R58A 3E97A 4PGHA 4BHPA 1USTA 4JQFA 3TO7A 4AWXB 3B02A 2FRHA 1PP7U 2M87A 2QYOA 4YIFA 5L3GA 4MHGA 2DK5A 1TNSA 4WXDA 1O3QA 5IT3A 2A6EF 2ZO4A 5H6RA 5CYVA 2HEOA 3LAJA 4IF4A 1D3YA 1ZREA 3RYPA 1XMKA 2DW4A 3K9TA 5K5RA 1G4DA 1YS7A 2COMA 5DEQA 1XMAA 1H9GA 4LB6B 2P7CB 3VB2A 3MZYA 2XASA 4M9ZA 2HKOA 3HIFA 4UUVA 4MQVA 5E20A 2EA4A 2UZKA 2A5YB 5HLHA 3SXYA 3WU0A 2ZCWA 2P5LC 2Z5UA 5D5XB 4UNOA 4I0AA 3E5QA 3Q5FA 2LKPA 2XAQA 1JGSA 1OPCA 1R00A 2QZ8A 3HRMA 4I01A 2Z33A 3E6DA 3NEUA 2KIFA 4HX8A 1HW1A 4XSXF 1WI9A 2ZBKA 2CW0F 3ZMSA 1H9TA 5DYMA 2RV8A 3E6BA 1ZG5A 4RAZA 3I59B 3SHFA 1V3FA 3ZMVA 1FOKA 1Z1DA 4I2OA 1P4WA 2VE9A 2MA3A 3E3VA 2QM3A 2W25A 2HDCA 4YFNF 2A68F 2FOKA 1Z91A 4AD9A 4NB5A 5HDKA 1ZN2A 3HTUA 3HHGA 3ABTA 4EJUA 4R79A 5FGMA 3WGHA 2X4HA 1H0MA 4L0YB 1ZG1A 4A6EA 1I1GA 1TQMA 1GVJA 5TRDA 2J5PA 4HX7A 2HQNA 2BEOA 4BHCA 2LDUA 2H09A 2R7DA 4TV7A 1SFUA 1O7FA 2F5CA 2E1NA 3DP7A 2FEZA 4KT5C 2VN2A 3LFKA 3K2ZA 2HWVA 3MZHA 1L0OC 2XRNA 3SZPA 2WWYA 3MCZA 4ENNA 4KNYA 2FBIA 4PGGA 2VOOA 2FNPA 4HV5A 4ESFA 4M6XA 3HHHA 1ZLKA 2UXXA 2JPCA 1TNTA 4GGGA 4LK0F 2VBWA 1JHFA 4AIKA 4I09A 3O2PE 3EDPA 4HX4A 3TGNA 1WRJA 5LRRA 4EJOA 2CYYA 1IXCA 5ILVA 1XDSA 1HSJA 2A6HF 4XBFA 4NHJA 3Q9VA 3FMQA 2ZFWA 1D5VA 1MJBA 2XV4S 3KP4A 3HSFA 1B9NA 3PQJA 2XIGA 4QLCU 3LA7A 1BIBA 3ERED 1E17A 2V9VA 1YW7A 3RIRA 1FWZA 3QP5A 1BC8C 1XCVA 4M72A 1J2XA 3WGIA 4FX0A 2VBXA 1YLFA 2ACJA 2QUFA 2JTVA 3SFZA 2XVCA 2OQGA 1QBJA 5LGUA 2L54A 2BYVE 3FZVA 1LEBA 2W85A 4EVIA 3ZMDA 4A5NA 2JT1A 1QZZA 2Z3YA 1ZAOA 4IRHA 2FA5A 4PDKA 4RB1A 1AOYA 3W6KB 2O8XA 3FM3A 2EA2A 3BPXA 3ZPLA 4R1HA 1XD7A 4UV9A 3ULQB 2BBYA 2DFIA 4P9FA 2MH2A 4KN4X 3OOPA 1Q1HA 2OAZA 1VTNC 3GLXA 1JXSA 4H0EA 5TJJA 2QWWA 3C3WA 1ONVA 1SD5A 2K4BA 2GQQA 5L3CA 1KU2A 2NYXA 3QOPA 2IJLA 4WXCA 2PJPA 1F1ZA 1K7AA 2AS5F 1FYLA 1U5TA 4IRIA 4EJWA 4HF2A 2L01A 4L9TA 1V4RA 3WTTC 1J0RA 1XGSA 3U2RA 1F4KA 2KIUA 1YS6A 1PDNC 3JAMZ 3RPQA 3JSOA 2DO7A 2XAHA 4HW0A 3EUHA 3GZ6A 3M1EA 5D4RA 2PMHA 4KMFA 5JI6A 3KEQA 4KUMA 2HFHA 3J81K 3COAC 2H94A 1MD0A 2DTRA 1DDNA 1J9IA 4EJVA 1B6AA 1MDMA 1TQPA 5J6XA 1LVAA 5FFXA 2IA2A 1OKRA 2P8TA 1WKMA 3CO6C 2V6CA 3PQKA 3WODF 5F6FA 3FHZA 4D0PA 4KFCA 5BOXA 5HVQC 3GW2A 2PN6A 1P2FA 4MNUA 4FX4A 2L3DA 5D5VB 4M74A 1IAWA 1D8KA 5L3BA 1W5TA 2ISZA 4M9SA 2P6TA 3WE2A 3LWFA 2Y48A 3F8FA 4OIPF 1LDDA 3GEZA 1FBSA 3V8JA 2E1CA 4QWQA 3FWEA 3PFIA 5LHHA 2QBYA 1QPMA 3F8MA 1D8JA 5E17F 4ON0A 2XUBA 2M30A 1ZRCA 2VE8A 2ZXJA 3K1MA 1ZG3A 3BZ6A 4OMYA 2EV6A 3KP3A 4MGRA 4WX9A 4G6QA 3RKYA 1FBQA 3T5XA 2XKOA 1HSTA 1T2KA 1K78B 1HKTA 2MH9A 2PG4A 2QQAA 5ED4A 1XGNA 4K2EA 4IHSA 4HLXA 4Y15A 4ZZLA 1MKMA 1OYYA 1ON2A 5BPIA 2GAUA 4HDVA 4LFUA 2F2EA 4GXOA 5BMZA 1IXSB 4BNCA 1KYWA 1EV7A 2LF7A 3KP7A 3B73A 1R1UA 4IHTA 1Y0UA 5L3DA 1TW2A 5LHGA 4I0BA 1CF7B 3K69A 5HOOA 2XAGA 4A0YA 4G7HF 1G3TA 3REOA 2FMYA 1W7PA 3J80K 5K5QA 2BV6A 2DPUA 3U1DA 5E18F 1ZRFA 2RKHA 4YFKF 4YIIA 1LQ1A 3CDHA 1R5HA 3EYYA 1S29A 4RAYA 3C1DA 5HDNA 1XSDA 4R8HA 2EJRA 3ISPA 3HOTA 1YW9A 2RVCA 4LD5A 4ZYDA 5E1XA 1JHHA 4E70A 2WTEA 3JTGA 1HKSA 4M6YA 1YFHA 4Z2YA 2LSOA 1SFXA 3FMSA 4XLNF 2L4MA 4F7ZA 1X3UA 1L3LA 3DV8A 3L09A 5HS7A 4AIHA 2IA1A 3JSPA 4BH9A 1FT9A 4U88A 3QPTA 4CO8A 4YFXF 4OINF 1B1BA 2F5DA 4M9XA 1T0FA 2BE5F 2ELHA 2IT0A 2D1HA 5IT9K 5J8FA 2ZNYA 1FY7A 2ZJ2A 1E2XA 2GZWA 4IJAA 1EH8A 1PUEE 4ZYEA 2NAZA 4A6DA 3I64A 2IRFG 4ESBA 1IF1A 3GFIA 1K79A 4ZYGA 3ZMUA 3V7RA 2YSRA 3BY6A 4RGSA 2K86A 5D4SA 3F72A 2WC2A 1J59A 5DUIA 3CUOA 2DI3A 1WWXA 1Z05A 4CXFA 3HRUA 3HRSA 1REPC 1KQ8A 3H92A 1P4XA 2DLLA 5JVTA 4HYEA 1W4MA 5DCMA 4CICA 1STZA 1OYWA 1T6SA 3GZ5A 3KE2A 4OMZA 4U7DA 5FD6A 3RJPA 1S7OA 4HOBA 1EH7A 4KIFA 2RQPA 4IXAA 4GYIA 3K1NA 3VFZA 5HLIA 3DPLC 2M8EA 4O5VA 3F21A 2Z99A 4UVCA 3O3KA 4P9UA 4L9VA 2HTSA 3F8NA 3I59A 2Y75A 1RZ4A 1G3WA 2OQRA 3WTSC 3IHUA 4WXHA 2K02A 3L2CA 4RS8A 4G9YA 1BI1A 1ON1A 4EJTA 2KJBA 5K1YA 1BJAA 3DQVC 2OZUA 4N9IA 2EFWA 3F6VA 1BC7C 3WG9A 2R7FA 3RKXA 3GYHX 3LSTA 3LAPA 4HQEA 2HYFA 5EEHA 2IPQX 2A69F 4G7OF 1BBYA 3IKTA 1YIOA 3V7SA 4BAYA 4JBAA 1NHAA 3FM5A 4G8XA 5HLGA 3EETA 3R60A 1SD6A 1QGPA 1C0WA 1P6RA 2FF4A 2PFBA 5L3FA 4RGXA 3JW4A 2H27A 1S3JA 2A3SA 3TOBA 1Z6TA 1MJAA 1F9NA 2VC0A 3M9AA 4LG0B 2GWRA 3HSEA 2STTA 1R23A 1Z7UA 2MC3A 1JE8A 4WWCA 4I98B 2OBPA 1ZYRF 2D1VA 3QU3A 2FU4A 2FSWA 3WTVC 2QQBA 1LJ9A 4HF1A 4ETSA 3WE3A 2Q0OA 4P96A 1KQ0A 3E5UA 4L5IA 3VOEA 4OIOF 3KZYA 2K27A 4ENKA 2QLZA 2RC4A 4A2UA 4ZZDA 2NRAC 3RKWA 5DUKA 1U2WA 2QENA 4ENJA 1SFEA 1HBXG 1B4AA 3H3ZA 4RB2C 2PBIA 3JTHA 1Z9CA 3GFJA 1BOAA 2IW5A 2GIVA 4EM0B 3BJOA 4A5MA 1BI0A 2F5EA 2IVMA 3GX4X 3IKVA 2Z9OA 2A61A 4GO1A 3GO5A 3TOAA 3R61A 4G6DA 4UVBA 3CUQC 2PMUA 2RNJA 1B9MA 1R7JA 1YTYA 1LB2A 3HSRA 3V8KA 2NNNA 5CJ9A 2V1UA 3CUQB 2ISYA 2XHKA 3GFMA 3U9GA 5H20A 3J7AO 2W57A 1UB9A 4UXNA 5D5WB 3RDIA 4U0VA 1U5TB 1I1SA 3I53A 5LHIA 2V1DA 5DV5A 1DP7P 2GA1A 4OU0A 3VODA 3MWMA 2EFOA 1UHMA 4WK8F 3DKWA 1J5YA 4KIBA 5ILSA 3ZP5A 4XRFA 4AVPA 4B8XA 3NRVA 3CJNA 4KYWA 2DQRA 3IRQA 2HKXA 3ML6A 3BJ6A 3DEUA 5A2QK 1SMTA 2D2WA 1QZYA 1UHWA 3AAFA 3HRTA 4LLLA 1LDKB 3I71A 1DPUA 1I27A 5DCFA 1RI7A 2V1XA 5AIPA 1FP1D 1AWCA 4HQMA 1XSXA 1GHCA 2WV0A 3ZQ7A 3V4GA 1T38A 5AIQA 2CQKA 4EM1A 2VODA 3GUDA 3KCCA 3KFWX 3ABUA 3H3UA 1TW3A 3GWZA 1IXRC 1SD4A 3MAJA 4ENMA 3ELKA 1G6NA 5JR3A 1R5GA 2ETHA 2X0LA 2J5OA 1ZGJA 5ICGA 1KU3A 2IP2A 4JK1X 2O0YA 4HLYA 3TDZC 3J80Z 2P6SA 3VEPA 1J7KA 1HQCA 4L5JA 4OIRF 2QVOA 5KK1A 4MEYF 3P7NA 5E1WA 2OA4A 2FQ3A 4EV0A 3DF8A 2JZYA 2YX4A 2P4WA 4HZFA 2E7WA 2M5WA
chains in the Genus database with same CATH superfamily
2Q2EA 3LMLA 2HOEA 1OCTC 2ZMEB 3GLLA 3RPUA 4L9JA 2JPAA 2G9WA 3DPTA 2ICWG 3OYBA 4IHYA 2YS9A 5CVUA 3TKYA 3PUFA 2UUZA 2RNGA 2VJJA 1WSUA 1YITI 1ZHFA 2HQRA 3A02A 4Q28A 3F8CA 4DV3E 2E5LE 2WV1A 4NQWA 3ZRGA 2LKXA 3AUZA 2LT7A 3EUKL 2EBIA 4RAGA 5KHDA 1VQ6I 1QO0D 2NS0A 1MW7A 2JWTA 2VKEA 3LA2A 5ICFA 2NS7A 2JQ7A 2ODRC 4Q48A 3BG3A 2QQ8A 2QEXI 2V83A 3LOCA 2QSGX 2XAJA 2YRMA 4DV1E 4HV6A 5LRSA 3MSWA 1MIJA 4MQ9F 4RMNA 5IT9Z 4HSTA 3ERMA 5H2FC 5IY5H 1I5ZA 4X65E 1K78A 2EOXA 2FXAA 4DJAA 5CVRA 4L9NA 3OYAA 4BYYA 3N97A 5LLQA 2LFBA 2OJED 2ESNA 1IRFA 4KJZA 2UUAE 1GV2A 4E7ZA 3PL8A 1IN5A 1FZPB 3C2BA 4N4NB 1F5TA 3HOXJ 4HAMA 3JRHA 1XB4A 2XAFA 3S2WA 2EPPA 2LMZA 3LNQA 4C9YA 3SDGA 2C6YA 5IOZA 3J7ZI 3I0TA 2HU9A 1PJQA 2G7HA 2EFQA 1OCCH 2CSOA 1Z1BA 1XNQE 2AQFA 4N9HA 2E7XA 5AONA 1OFCX 3THOB 2HS5A 3HKZA 4UHTA 1WQ2A 1QQIA 2VE7C 1FP2A 2OU2A 2WBMA 2L3CA 3BZKA 3S32A 5LEKA 3M8EA 5B3SH 2WBUA 1IBLE 1N33E 4K0KE 3GTLJ 4CGZA 1J09A 3MFKA 2W48A 3TO6A 4XM3A 4XLEA 2B0LA 4LG3A 5IYDJ 1HDDC 2OC6A 2K85A 2P81A 3D5SC 4A3IJ 4LLNA 1CQTA 3DCFA 2IEKA 1K83J 1A31A 4A0ZA 2LE2A 3IC7A 2LMDA 2K9SA 3K70D 2H36X 3BCAA 5E3LA 2RS6A 3QPSA 3HOSA 1ZQ3P 3ADJA 2WAQA 5EJCA 1X3WB 4I7HA 3G4SI 1FYMA 1X47A 1Y8RB 1HDPA 2EM4A 1RR7A 2FMLA 3E6CC 1JKRC 3LQRA 1F2IG 2R3SA 2W84A 2K3PA 4II2A 1TLHB 1CF7A 4DUZE 1GUUA 2HDDA 2ELKA 2IS1A 3EQLF 1T33A 3KLNA 5L3EA 2EOHA 3R6SA 1LFUP 2STWA 2OTLI 4AU7A 3VSLA 2DYRH 1J75A 1ZGAA 2JOBA 2R5ZA 3ZQLA 2FD5A 2M3AA 4IQJA 5JHUA 1ZR4A 4PJ0C 1SAXA 6PAXA 3S1QJ 3Q9SA 2DXIA 3FXOA 3HZJA 3OMLA 3NARA 1UFMA 1G2HA 2ESHA 2EOOA 2M1BA 4F9CB 1JTXA 4BBSJ 3AG1H 1R1VA 5CLSA 3CO7C 2LJUA 2V26A 4LJZF 3T8TA 3HPGA 1FSHA 2IAIA 2XGEA 4KMUX 4ESJA 1U8BA 2BGCA 2CMPA 3TDUC 1B72B 2V6EA 2M7BA 1MBFA 3G3ZA 3HTSB 3A03A 4R2CA 4XORA 1Z3XA 3GBGA 2JPBA 2JRTA 2I5UA 3T0YA 1PKPA 2M1SA 3BR2A 3W6JB 2JK3A 3H9QA 1O3RA 1OISA 2GIZA 4IOCF 2NABA 2IS2A 4DQ2A 1IRGA 3BQZA 2FOWA 1ZK8A 2EV5A 1U8RA 3TMOA 4CSWA 3D0SA 3OYIA 1MMNA 2HHHE 2KDOA 1RQ0A 2OPTA 2PEXA 3BJAA 5LBQA 4EGYA 1Z77A 5FB2A 2E2JJ 4O3MA 2HJJA 5EDNA 2CUFA 4XLHA 4HTGA 5FLXK 3BIDA 4BHBA 1A04A 2EWNA 4A0XA 1RNLA 1NK3P 2DBBA 2L02A 4U0WA 3RYRA 3OL4A 4A3KJ 3CCUI 3E5XA 3JRCA 4OIQF 5DD8A 3M8FA 2X6OA 1P92A 3R0AA 3H0DA 3ABMH 2YT4A 3HJEA 5GAHJ 4RHBB 3OTOE 3I58A 2OD5A 4DV2E 4BC7A 1XG1A 4Y4RA 2EQ1A 2N3HA 2WBSA 2DAOA 3I5UA 4B09A 1I94E 5DNYA 2VF1A 3TEDA 2UWMA 4CYDA 5A6KA 3Q0VA 3GZNB 3S17J 3DF6A 2I13A 4G7ZF 2LTSA 3F9KA 2VONA 3P9KA 4E6KG 2V79A 1QPIA 4YEJA 1MGTA 1BIAA 3D5LA 2W1OA 4FTHA 3IWBA 4LF9E 3UK3C 2B7TA 3QWLA 1B59A 3OYEA 1N77A 1MMDA 5A2QC 2K9NA 3J81C 4RM2A 4UVAA 4Z6YA 5CFFE 4BQAA 2TCTA 3M1CA 4FT8A 4P5OA 2L9NA 2JUCA 1RUOA 1AH5A 1MH3A 3BG7A 2YU5A 1MZBA 1UHSA 1XGOA 2HZTA 2RGVA 3IWFA 4JP0A 4AC0A 2EP3A 2FQ4A 1BR2A 1SD7A 4KIGA 5CQEA 5EF6A 4CZZA 1I3QJ 2P5KA 3BT9A 1TWHJ 3ROUA 2MLGA 3W2VA 4WCGA 2EMLA 2LRSA 3D1NI 5D6EA 5DCMB 5BPDA 1ULYA 5F64A 2K4VA 4LK1F 3SJMA 5BS6A 2R76A 4OOIA 4M71A 4M3DA 4OX9E 1YQAA 4DW6A 2Q8KA 1POGA 3I54A 3CTAA 3KLOA 3BLYA 3AFHA 2ME6A 3K0LA 2LBFB 2XSDC 2JA5J 1SAUA 3RI4A 1A5JA 3CC4I 1BI2A 3LSIA 4B48A 4LU9A 4DR7E 3KETA 3ECOA 4KDPA 1FTZA 1JKPC 2DMUA 4EGZA 1RIOH 3FBNB 5ERIA 4MFDA 3C18A 4XK4A 2XF7A 4EMSA 1DUXC 5E8IA 2LY9A 1WHUA 5K7HA 1KQ9A 2VBZA 1A1HA 2P0WA 2NNYA 4XN0A 5LFAA 2YTEA 1HKQA 5A69A 3K70C 1HXDA 4XR6A 2E60A 3MHSC 2OZ6A 2YSOA 2PQ8A 3G6EI 4AIDA 3OYGA 1O0WA 1X4PA 1FOXA 1BBOA 2O6GE 4N4OB 2EK5A 2VBYA 2YX7A 4IEJA 1QU3A 1TP4A 2I10A 4Q5SF 4FETA 3BZCA 3BROA 1PJRA 3C7JA 5ILUA 4XL9A 3ZN1A 4ANJA 3L1PA 3DLAA 2EPAA 3OYCA 3PO3J 3QG5C 5AC5A 1IMUA 1ZLJA 3C6MA 2PI0A 1X5WA 1Y56A 1S6LA 3LSGA 4ZYHA 1YRNA 3IWZA 2DOEA 1P47A 3GMEA 1HW5A 3VYRB 4LF6E 3QP6A 1QVTA 3L9FA 1R49A 2DDBA 3WHBA 1MJ9A 4DIQA 2JOXA 1Z7LA 2ZB9A 3SZTA 1ITYA 3H9GA 1S5LC 4KWYA 1XX5A 1OR7A 2M7AA 3KYCB 1UCRA 1W5SA 3W6VA 4Y17A 4F9BB 1XDUA 4BE1A 1PJSA 3BCBA 1D0ZA 1WHNA 2QQ9A 2MDGA 4FHTA 5J1YA 1N25A 1OMIA 1XCBA 3B6AA 2EB7A 2ZNZA 2F8BA 1HNZE 1EKEA 3OS1A 4LLGF 3T1YE 3HUGA 5K5OA 5HS8A 2P5VA 1CGPA 4LF7E 3ADGA 4CCNA 1YYVA 4HDUA 5F1RA 3MKWB 3IP4B 4MEXF 2YRKA 5FKNA 1XGMA 3HBLA 2EM7A 3OV8A 5JHFA 1FMVA 3NWTA 4XKBA 1B8IB 2DGCA 3ADIA 2VQCA 2Y0MA 4Q35B 2YZTA 2HOAA 1LDJA 4LF5E 2WB1N 3SYTA 3PNTA 2R92J 2RQLA 1GV5A 3S16J 4GKKE 2BB8A 3GF2A 3O6BB 3I4MJ 1XMOE 4W1UA 1O3TA 2HI3A 1N3GA 1WI3A 4DYRA 2DJNA 4CHUA 1HW2A 1YSAC 3ZXSA 3PO2J 3NAUA 2LF8A 4ABZA 3BPVA 4I99C 1ZRDA 5LGTA 3M7GA 2DYSH 2AXLA 2VC1A 3L00A 4M6VA 5HDGA 2EMWA 2CJJA 4PZJA 5KAIC 1A1IA 4RGRA 4S04A 1RR8C 2Y9ZA 2VIXA 1T95A 2ADUA 1U78A 2DSYA 1U9OA 3DU6A 5FKMA 3MD2A 3G2BA 2K9QA 1XC5A 3FF5A 3RCOA 2YPRA 1K4TA 2UXDE 1T98A 1TF6A 2K7IA 2R7ZJ 3IRRA 2QSHX 4LG0A 1IW7F 2O8KA 4P1WA 2HR3A 2R4GA 2Y30A 4EATA 4O4KA 1FPQA 2XROA 1SMYF 2NXNB 3SDBA 4RH8A 1RC7A 4GYGA 3IAM2 3PM1A 5EZHA 5M5WJ 5FFZA 4C2UA 3FXRA 3WTUC 2DJIA 3H5NA 4M30A 3WTYC 1FBUA 1X1CA 1R71A 3VWBA 3ECRA 4B3ME 2GM4A 3DXJF 3R4KA 4ZJZA 2DCEA 1XMQE 3HXLA 5A2QZ 3J81Z 4D5FA 3E1SA 1XSVA 3QOEA 1EA3A 3KP6A 3J7YJ 2V7FA 5HODA 3ESWB 4WF2A 3TO9A 2DU9A 5D8KB 3VK6A 1T39A 4KN7X 1GXPA 1P4AA 2MC4A 4XIDA 1WJBA 3SEQA 1J5EE 1WJPA 3LSHA 2G7UA 1X1PA 3DTIA 2H6CA 3LFUA 1DPRA 4U7BA 4HA8A 2VLAA 4DMIA 2E2HJ 4IVNA 4U87A 2QA4I 2FNAA 3LQQA 3L2WA 2EPNA 2X6WA 1BL0A 4F91B 5ICCA 3O8GA 2DMYA 3CCMI 2LLKA 5D6FA 5EGOA 2CGPA 2JA7J 1LEAA 1Y1WJ 3MEXA 2EFNA 2FBKA 2RDPA 1X49A 2CT1A 4DR2E 2D9HA 4O6JA 4EQQA 3ZMZA 1ETQA 2NUFA 1LVKA 2XGXA 3IL2A 2VPRA 3HYIA 2TDXA 5F08A 5KVRA 1R22A 1WJDA 1IUYA 3G73A 2VOPA 1FNNA 1EH6A 2L33A 1ZARA 4IZZA 1ETVA 2RN7A 4F54A 2EZKA 4BXUA 4DNCA 3MQ0A 3OS0A 1Y6IA 2VT3A 2KIMA 4A93J 5FLXC 2EOQA 3HGGA 2HGCA 3J7AG 2A07F 2V85A 3DJWA 2BXYA 3HEFA 2EOZA 5EG0A 1KYZA 1U5TC 4DR6E 5J8CA 2KRFA 3CCQI 3HOYJ 4JI4E 2K9MA 3HPZA 5E3NA 2GXGA 4O24A 2WY8Q 4J19A 4ASNA 2UU9E 1MSFC 1EF4A 4JI2E 3KZZA 1IZ1A 1IRZA 3GFLA 3LA3A 4QTRA 3ZCOA 2UV1A 4IKFA 2L0KA 5KL5A 1KU7A 1AAYA 1ZGWA 4JX6A 3RTRA 5E1ZB 1BM9A 4BUPA 1R5ID 2LNBA 1G3SA 3CCVI 4LGWA 1VQPI 4RB0A 1NEIA 2DLKA 3FDYA 2E1MA 1ZAAC 1X58A 1RMDA 1X1DA 3I4PA 2JSCA 2EFPA 3N4MA 3CUQA 1QNTA 4NNJA 5ICEA 5FJ8J 2EMFA 3JR9A 2R7UA 2L2NA 2CV2A 4UV8A 2LH9A 3ZMTA 4Y13A 1FMWA 3EUHC 2ZKZA 4XSZF 2FX0A 3WGGA 3KP5A 1AA7A 2JUGA 2HPIA 3H5AA 2F5FA 4PCQA 1KONA 3LLHA 1BN5A 2VT2A 2YU3A 5D5UB 3RZDJ 1YHQI 3K6GA 3F6HA 5KL6A 1PVEA 1IN4A 3BG6A 3ECHA 2HZDA 5J3LA 1YO5C 1A36A 1ZH5A 2RSIA 3HTXA 3FISA 1I6XA 2DPDA 1WJAA 4KZSA 4DR1E 2ME0A 2BBGA 4BMJA 4M2ZA 3K4JA 1YYKA 1FIPA 3G1MA 1WVRA 2O9LA 4Y3OA 3T1BA 3GTMJ 3BDDA 2MABA 2M8GX 3E6MA 5DD4A 2CFXA 1X3ZB 1N36E 2YR2A 4A3DJ 4A12A 1TQIA 2MD5A 5HS9A 3FMRA 2LYCA 3CMYA 2D45A 3VYSB 2VXZA 1NK2P 2JR1A 3L7WA 2IGOA 4S05A 3QODA 3VSKA 1RC9A 2M0CA 4BXXJ 2EILH 2MC5A 3ZQGA 2DMIA 1T4LB 2FBHA 1RUNA 3OOUA 3KEOA 3BP8A 2EM2A 2MLKA 2WBTA 1W7PD 3FKIJ 3WTZA 3QPHA 4EM2A 2M45A 1MDMB 3EYIA 3ASNH 1XN7A 3RSNA 2GOXB 3HOUJ 3FXQA 2GOMA 4I02A 1VQ4I 4X9JA 2R7XA 4P55A 3MVPA 3V7CA 3OYJA 1A35A 5FD5A 3F3XA 3QYBA 4UUTA 5JLWA 2WAQN 4YG2F 2XGDA 2R7VA 2BW3B 1SC7A 1TTYA 2GLOA 3T8RA 3WU1B 2KISA 2VQGA 1TBXA 3S3MA 1KGSA 3ZN0A 3RZOJ 2W24A 5DDGA 2YTDA 2JVAA 5JFRA 3JREA 2DMQA 2XKPA 3F8BA 1DI2A 2KIQA 3U1KA 4U0YA 2XPUA 4M73A 5E8GA 1V55H 4ZH4F 3V8LA 2OF7A 1O57A 1SVOA 2FV4B 1IJWC 3SQNA 1IN7A 1A6QA 1IRXA 5EEGA 4C2MJ 4BGDA 4WSGA 2ZXWH 1YJWI 4RAFA 2M2EA 2EMHA 2DT5A 4DR3E 4RB3C 3WTXC 2K5CA 3BOQA 2O03A 4XKCA 2A25A 1JI8A 2K9LA 1WCMJ 1X6HA 3P9IA 5C4JJ 4MIMA 2QBYB 4CYCA 1R36A 2EZLA 4KICA 4FQGA 4LB5A 2CO5A 2HYGD 2VB6A 2LV2A 2HTJA 1T8IA 1U3EM 3JRIA 1FYKA 4XNFA 2KJCA 4XKWA 2L7ZA 3R0JA 1YYOA 1UZCA 2KT0A 1YOVB 1S8NA 3ABLH 3PNVA 4Q4ZF 4BDZA 3EPJA 3WHCA 3KP2A 1DQ3A 3TQMA 2Y2ZA 1UHZA 4MTDA 4NQWB 3W2AA 5FO5A 1S7AA 2EZHA 2DIXA 5LMUE 3MN2A 2EV0A 3AKZA 1PUFB 1H89C 4GCVA 4LMYA 2ENCA 1ACIA 1IUFA 1V5FA 2O7OA 3IH2A 2GXBA 1JT0A 4MO7A 5H6QA 5LEJA 1U6GA 4EEFG 2ZMEA 3ZQIA 2K4JA 1FC3A 3K4BA 4UB8C 4C3JJ 5FLXZ 2DQLA 2L4AA 4AIJA 2GA2A 5IP9J 1G3YA 4DZJA 4JI6E 3GTOJ 4IPAA 4L18B 1YG2A 3BTLA 2X51A 5D8LB 4OWRB 3JRGA 3GVAA 3DFGA 1VQLI 3JAMK 2ENAA 4YELA 2L6MA 2DMPA 4MLOA 1YJ9I 4RGUA 5CVVA 3J7Yp 3QU6A 3S2DJ 4HF0A 5BNGA 4ZTFA 2FE3A 2EN3A 4A3BJ 4HG2A 1FLIA 5CVIA 2WAEA 3BWGA 1F36A 2LKSA 5CVJA 4ZDPA 2X6YA 2GLIA 1IN6A 2IA0A 2VL8A 5BQTA 3VHTB 2PX9A 2EN8A 2CWEA 4A3GJ 4LF4E 2MW8A 1Z6RA 1FX7A 2CQNA 3T1HE 2JJ7A 2ENHA 2YUSA 3A1YA 1KU9A 3P9CA 1YIJI 4BL0B 2A5WA 3CLOA 3QAHA 4JOMA 4HBLA 2Y31A 1MNDA 2O3FA 3U21A 3NQOA 2EQRA 3FX3A 1LFPA 4KT6A 3EUAA 1GXQA 2XRLA 2NVTJ 2JY9A 1YW8A 4N0BA 1G8XA 4OAYA 1TWCJ 2AQEA 1BI3A 3TP0A 1KA8A 5HNFA 1AHDP 4GEQB 2DOFA 1BW6A 1YUJA 1MBHA 2A05A 3FK6A 4G94A 3TQNA 1VQ7I 3K1PA 3QRFF 2H6BA 2O61A 4CCLA 2IGMA 1Q1VA 2P7VB 5C44J 4LIVA 2XB5A 4Q47A 4B3AA 4E7IA 1W7PB 5IWAE 4II3A 3LSRA 3F22A 3H35A 1O3SA 3H1CA 3LL7A 4ZYAA 2JSPA 3F23A 2YRHA 3S3OA 2CG4A 1PP8F 1O7LA 1OYIA 2W7NA 2HDWA 3LMMA 5HLTA 4F9AB 1USSA 2DK8A 1MEYC 4BY7J 1IN8A 3F6OA 4MLQA 2K7LA 4CDGA 1R1TA 3FXUA 3WTWC 2WZOA 2LP0A 2KKOA 1JKQC 1NTCA 2LJHA 4KA4A 1XTAA 3S15J 1FSEA 2EMGA 4JI0E 4B47A 3GXOA 2UXNA 3H5RA 1LNWA 4XLPF 4MTEA 4AVZA 4B3SE 2E35A 1K6OA 1ODDA 3C4TA 2VI6A 2YTGA 2MBFA 4IRGA 4HPQA 2BZTA 2Y0SA 2PLYA 3B6CA 4L0ZB 5LGNA 1R58A 3E97A 5DTDA 2XC7A 4PGHA 1IV6A 2ADRA 1VQ8I 3IWCA 4A3CJ 3VYTB 4BHPA 1N78A 2EN7A 1USTA 1EKZA 5KCMA 4L5NC 1T0FC 4JX5A 4NXNE 4JQFA 1MBJA 3TO7A 4AWXB 5GAEJ 3B02A 2CQ7A 5A6BD 3HPHA 2JMWA 5FKLA 2EMYA 1Y0NA 1FKAE 2FRHA 1PP7U 5CQGA 2M87A 3LSMA 5F27A 3S1RJ 2CV1A 2QYOA 1JTYA 2ZJQF 2F5VA 4YIFA 4GDFA 2EIMH 5L3GA 4GFBA 3CCEI 1BW5A 4LFBE 1B72A 4X6AJ 1D1BA 2M4KA 1ETWA 3RQIA 4G12A 4MHGA 2M4GA 4IO9F 2DK5A 1TNSA 3FBIB 4WXDA 1O3QA 5IT3A 4X66E 2A6EF 2ZO4A 5H6RA 5CYVA 5KL7A 2HEOA 2OTJI 3LAJA 1IQSA 4BJTA 4E7JA 2XPVA 4A69C 4IF4A 4V19K 1JT6A 1D3YA 4ZDOA 5AE2A 1ZREA 5FRMA 2CW7A 3RYPA 1XMKA 2DW4A 3K9TA 4RLFA 5K5RA 3OL3A 4UUSB 1G4DA 4E4HA 1YS7A 3L2VA 2COMA 2L5QA 5DEQA 1XMAA 1BB8A 1H9GA 4LB6B 2P7CB 3EPKA 1VI0A 3BC8A 2ID6A 4R2RA 2VRDA 3VB2A 3MZYA 3SZGA 1MMSA 2XASA 4M9ZA 4R2QA 1S72I 2HKOA 3HIFA 2BHYA 2DT6A 1RRJA 4JX4A 4MQVA 4UUVA 4R2EA 5E20A 5F04A 2EA4A 4TUGA 2EOEA 2AHQA 2UZKA 4PFOA 2N3GA 2A5YB 5HLHA 3SXYA 3WU0A 1SFOJ 2HVQA 4DYQA 2ZCWA 3CMEI 2P5LC 4GRIA 3TL4X 3JRBA 2Z5UA 5D5XB 1EJ9A 2F4OB 1GLNA 4UNOA 4I0AA 2IHR1 2CUZA 5E3OA 3E5QA 1N32E 5FKKA 3Q5FA 4BE2A 2DMNA 3BF2A 2BY0A 2LKPA 2XAQA 2BY1A 3DKXA 3FHNA 1JGSA 1OPCA 1R00A 2BXZA 2QSFX 2QZ8A 3HRMA 2EMKA 4I01A 2Z33A 2EMCA 4NDLA 3E6DA 2W00A 3NEUA 3TBIA 2KIFA 4HX8A 1HW1A 2R7OA 4XSXF 2QF7A 4B44A 3H09A 1WI9A 1PJTA 1AKHB 2ZBKA 3PSFA 2EPZA 2CW0F 3ZMSA 2R7WA 4IHVA 2XF6A 1YUIA 4Y52J 1FOYA 3A01B 1H9TA 1HCRA 4XOPA 3C2HA 2BOLA 5DYMA 2RV8A 4ZTJA 2LBSB 2V87A 2ELJA 3OYMA 3PSIA 3E6BA 2H1LA 4HSRA 3AL0C 1WJFA 1ZG5A 4RAZA 4XOTA 3I59B 3CF5F 2LUQA 3SHFA 2EOIA 1V3FA 3GTKJ 3EQ1A 2PJRB 3HOVJ 2V89A 4IQ4A 3ZMVA 5F0CA 1FOKA 2EL4A 1XNRE 2RREA 1Z1DA 5J1RA 4I2OA 1P4WA 1K6YA 2VE9A 3BR3A 1NCSA 2HQ5A 2LBFA 2MA3A 2ZC2A 3E3VA 2R0QC 1Y39A 1MSEC 1UAAA 1NG7A 2QM3A 4NBQA 3AL0B 2W25A 5E3MA 2X6XA 2HDCA 4UY8I 4YFNF 2A68F 2WADA 5DM6F 5KL2A 2FOKA 1Z91A 1G59A 4AD9A 4E7LA 5FLVA 2X1CA 2MDRA 4NB5A 5HDKA 3DBHB 2UUBE 4FCYA 4JI3E 1ZN2A 5AE3A 2LY1A 3HTUA 3HHGA 3ABTA 3A0HC 4EJUA 1P9QC 4R79A 3OR1C 5FGMA 1OR7C 4DZPA 2KDZA 3WGHA 4P7DA 2X4HA 1H0MA 4L0YB 3HB9A 3A2KA 1ZG1A 4A6EA 1I1GA 2M9AA 3F6GA 1TQMA 2VKVA 4Y7NJ 2HXIA 1GVJA 2J5PA 5TRDA 4HNTA 2HYJA 2EJ4A 4HX7A 2BY2A 3CJTB 3HGYA 1FOWA 2EH3A 2HQNA 2BEOA 4BHCA 2LDUA 2H09A 3S1MJ 2R7DA 4TV7A 3L2QA 3S14J 2LTPA 1SFUA 1O7FA 2EIKH 2F5CA 1G2FC 2CQXA 2E1NA 3DP7A 3OWTA 3OYLA 4GZNC 4WPYA 2FEZA 1OCOH 2LOOA 4KT5C 4OOGC 5A6AA 3CCJI 2VN2A 3LFKA 4S0HB 3K2ZA 2HWVA 2ZSIB 2DLQA 2M34A 3MZHA 2LG4A 1TWGJ 1L0OC 3OYNA 2XRNA 2KHXA 1R4NB 2DFFA 4IHWA 3Q0WA 2J7JA 4TUIA 2BY3A 3SZPA 1Z3YA 1R6RA 3MCZA 4BQOA 2WWYA 4D5CA 4ENNA 3JAMC 4KNYA 1S9HA 2IGNA 3S2HJ 2FBIA 4PGGA 2VOOA 2FNPA 4HV5A 3HDDA 2RPCA 4ESFA 2CW8A 4M6XA 5B66C 2QCOA 3HHHA 1ZLKA 2UXXA 2EOYA 5A6JA 2JPCA 1TNTA 2JRMA 2JYAA 2CU7A 1B8IA 4GGGA 2CSHA 2EQ0A 4LK0F 1VZ0A 2LRDA 2FTXB 1XMXA 3KZIC 1VQNI 2NS8A 2VBWA 1JHFA 4AIKA 4I09A 3O2PE 1I39A 2KL4A 3EDPA 3FKJA 1TZLA 4HX4A 1TF3A 3TGNA 4QIWN 1WRJA 5LRRA 3CCLI 1GDTA 4EJOA 2CYYA 1IXCA 1YE9A 5ILVA 3MKZA 1XDSA 1A1LA 5GPCA 2DODA 4X0GA 1HSJA 2A6HF 4R8OA 4WFTA 4PK4A 3C2GA 4XBFA 2EPRA 4NHJA 2X85A 2ZFUA 3Q9VA 3FMQA 4AQYE 2ZFWA 1D5VA 4KHPE 4BEHB 1MJBA 2XAUA 2GPIA 5T6JA 2XV4S 2F6CA 3M4OJ 1QU6A 3K4KA 3M8JA 2LCEA 2LTRA 3KP4A 2R5YB 2AO9A 2L9SA 3HSFA 1B9NA 4M0VA 3PQJA 2XIGA 3PUBA 4I76A 4QLCU 5GTIC 1ETOA 2L2OA 5B5EC 4IHXA 2E72A 3LA7A 1BIBA 3BG9A 3ERED 4A3FJ 2WY7Q 1YYWA 2EM9A 1E17A 1HOMA 2V9VA 1YW7A 3OYFA 4JI1E 4XLCA 1HF0A 3RIRA 1HNXE 1B69A 1MNMC 1H8AC 2EPKX 1FWZA 2JXPA 3CZ6A 3QP5A 1BC8C 1XCVA 4M72A 1LPQA 4XRMA 1J2XA 3WGIA 4FX0A 2VBXA 3VYYA 1YLFA 1ZELA 1UG2A 5C3EJ 2ACJA 2QUFA 1FTTA 2JTVA 2D5VA 3SFZA 2XVCA 2MD0A 2OQGA 4BS9A 4ZC3A 5LGUA 2L54A 3DKYA 2BYVE 3FZVA 1QBJA 1LEBA 5EGOB 2YTQA 5TSEA 1ZU1A 1A1JA 1SVMA 2W85A 4EVIA 1L4SA 3OMYA 2EORA 2N8XA 3FXMA 3QQAA 4CUGA 3ZMDA 4FE4A 2DN0A 1QRYA 5EZGA 4A5NA 2JT1A 4B3XA 3TW6A 1QZZA 2Z3YA 1YX3A 1ZAOA 2F48A 4IRHA 1ZBQA 5BR8E 3DWLE 4X1EA 4BXFA 2FA5A 4KITB 4PDKA 2K40A 4RB1A 3RPUD 1AOYA 1GT0C 3W6KB 2O8XA 3MHHC 3FM3A 2DDAA 2EA2A 3PIOF 1X3CA 3BPXA 4NUBA 3ZPLA 4R1HA 3K6QA 4CCMA 1XD7A 4UV9A 3DLLF 3ULQB 5EG0B 1NG6A 3A4CA 1T08B 2BBYA 2CV0A 2DFIA 1HA8A 4P9FA 2MH2A 2KZVA 4V2GA 3AG3H 4J01A 4KN4X 3OOPA 1OQYA 1QHHD 1Q1HA 2OAZA 4M9VC 1VTNC 2JP9A 2OV7A 4E7SA 3GLXA 1JXSA 4O5GA 2IS6A 5ADZA 1FEXA 1TWAJ 5CKTA 4H0EA 2PMZA 1LE8B 4A3MJ 3IAS2 4R03A 4M3FA 1IDYA 5TJJA 2QWWA 3C3WA 1ONVA 1SD5A 2K4BA 2GQQA 5FKOA 1KU2A 5L3CA 5KNLA 2CH0A 5JVGF 5IXMB 1KJKA 2NYXA 4FK5C 3QOPA 4W97A 2IJLA 3CF2A 4O43A 4WXCA 4B4CA 2PJPA 1F1ZA 1K7AA 3C6KA 5IV8B 9ANTA 2AS5F 2EMZA 3C4BA 1FYLA 4YRVA 4C3HJ 1U5TA 4RLQA 3JRAA 2R7RA 2KOUA 1MBEA 4RM3A 3RQ4A 4IRIA 3OSFA 2NVUB 4EJWA 5C4XJ 2EQ3A 3OR2C 4HF2A 2L01A 2OCEA 4L9TA 1V4RA 3WTTC 1IO2A 1J0RA 1XGSA 4ITVA 3U2RA 1F4KA 2KIUA 1LLMC 3VPRA 1X4OA 1YS6A 1J26A 2KZGA 1PDNC 4IX7A 3AV0A 3HKZN 4F3QA 3JAMZ 1DGCA 1RKTA 1W0UA 1ZKGA 3RPQA 3CD6I 3AG4H 2E5ZA 3JSOA 2DO7A 3HPSA 2XAHA 4HW0A 1A6IA 4YIRX 3EUHA 3GZ6A 3E0JB 1KZHA 2NVYJ 4JV5E 3M1EA 5D4RA 4LFCE 1ZR2A 2PMHA 4KMFA 1WH7A 3KEQA 4KUMA 5JI6A 5GP9A 1TT0A 1DU6A 3OS2A 2EZ6A 1WH5A 2MFZA 2EPUA 5E79C 2M4IA 1JUMA 2HFHA 4XONA 1UELB 3CP2A 3J81K 1JKOC 3COAC 4D1QA 4RBOA 2H94A 5F3WA 1MD0A 2DTRA 3IWDA 4BJ6C 1HLVA 2CUJA 1DDNA 2EN4A 1W0TA 2NOGA 3M07A 2ECCA 5HNHA 1J9IA 1STUA 4H4KC 5FROA 4EJVA 1WFXA 2ECBA 1B6AA 3KX2A 1MDMA 1OLTA 1TQPA 5IOYA 5J6XA 1LVAA 4LITA 2DA2A 2N8GA 3SFIA 2ELYA 5FFXA 5AC4A 2IA2A 1V5GA 1A1FA 1OKRA 2P8TA 1WKMA 3CO6C 1QA6A 2MG4A 4RA2A 1WZ2A 3I56I 5EEAA 2V6CA 4DV6E 2HGHA 3PQKA 3WODF 5J47A 3PIPF 3BR5A 5F6FA 2BW3A 3FHZA 4D0PA 4KFCA 5BOXA 1I6HJ 3OYHA 5HVQC 3GW2A 5TGTA 3FIGA 2PN6A 3IH4A 1P2FA 3I9V2 2JA2A 3IV5A 4MNUA 1QZEA 4FX4A 1XPXA 3ABKH 2Y0SN 4KISA 2L3DA 1QVUA 1Z21A 5D5VB 2LUPB 4M3EA 2IBDA 1AU7A 2E36A 4M74A 2V1NA 2W4SA 1D8KA 5L3BA 1IAWA 4CA0A 2EOMA 4NZVA 4D7MA 3LSPA 2ELZA 2HC5A 4PFPA 1PDAA 4R2PA 1BR1A 3BR0A 1W5TA 2ISZA 3ZR8X 4YY3E 4M9SA 3OIPA 2P6TA 3WE2A 4BU2A 2Q2EB 2EPXA 3LWFA 2PRTA 2Y48A 3F8FA 1ENHA 4B1RA 4OIPF 3GTPJ 1LDDA 1FBSA 3GEZA 2X48A 4DYCA 3V8JA 4LTYA 2E1CA 1X2NA 3RKQA 4QWQA 3FWEA 2MKDA 2YTFA 1T4NA 2VQFE 1JJ8C 3PFIA 5LHHA 2QBYA 4JI8E 2QKLB 4JYAE 3FIWA 4NC7A 1QPMA 2DA7A 3F8MA 3S8PA 2LY2A 1D8JA 3M99B 4YHHE 2VPLA 5E17F 4BACA 4ON0A 2XUBA 2M30A 5GTHC 1ZRCA 2VE8A 2ZXJA 3DTEA 3K1MA 1ZG3A 3BZ6A 3IUOA 4OMYA 2EV6A 3KP3A 1RKWA 4MGRA 2EE8A 4WX9A 4XLAA 1WGXA 1FIAA 2HVSA 4G6QA 1LFBA 3RKYA 1FBQA 2O5RA 3T5XA 1BOBA 1NH3A 1QHGA 4XQFA 2XKOA 2ZSHB 1HSTA 1T2KA 1OJLA 4WSPA 3Q0UA 1VQ5I 1K78B 2L3JA 1PUFA 4QSHA 2NOJB 5CPRB 1DGWY 1HKTA 4BKXA 1R9TJ 3H3VK 2WCC3 2MH9A 2PG4A 3EPLA 2LR8A 2QQAA 2V9PA 1XGNA 4K2EA 5ED4A 2DRPA 4IHSA 2RQQA 3CC2I 1G2DC 3O8HA 1P7JA 2EN1A 2RTXA 4QPQA 3J7AY 4HLXA 4Y15A 4IJDA 4ZZLA 1MKMA 1OYYA 4DBRA 3KYDB 1ON2A 1M1EB 1ETYA 3CJQB 4ZDLA 1E3HA 4FISA 1HC8A 2M0MA 5BPIA 1H88C 4DOZA 1UILA 3G1OA 2RS7A 2V86A 2GAUA 4F52A 4RDUA 4HDVA 4LFUA 2F2EA 4JI5E 2EIJH 2R7TA 2G0EA 2DFEA 2HNHA 1IGNA 3G71I 4GXOA 4HEA2 5BMZA 1WJEA 1ZR9A 2EMIA 1IXSB 4AYBA 2FUG2 4BNCA 4BJ5C 1KYWA 1MMAA 1VQ9I 1EV7A 3E7LA 3M3YJ 2LF7A 2F4MB 3KP7A 3VDXA 1TC3C 2M7QA 3B73A 1R1UA 2NA2A 3CLQA 3TP3A 1YPNA 2KFDA 4IHTA 2LVHA 1ETXA 1Y1VJ 3ONQA 1IBME 3DU5A 3FXLA 3ZQFA 3JU0A 3K4LA 1P7IA 1Y0UA 1FJLA 2YTNA 1YI2I 5L3DA 1TW2A 2XPWA 5LHGA 2KONA 3MZ8A 4I0BA 1CF7B 3K69A 2XGCA 5HOOA 4F92B 2XAGA 3D5RC 4A0YA 4G7HF 5AE1A 4MFEA 1G3TA 2EOFA 3REOA 2R5ZB 2FMYA 1W7PA 3DEEA 4JI7E 3PJRA 3J80K 5K5QA 2BV6A 4PSWA 1S7EA 3U1DA 5E18F 1ZRFA 2RKHA 2DPUA 2EMBA 1UMQA 4YFKF 4HRIA 4LFAE 3WU2C 5J1UA 2NUGA 3FXKA 4G6TB 4YIIA 4A3LJ 3V42A 1LQ1A 3CDHA 1D0YA 5IP6A 3JRFA 3UNGC 1R5HA 3DBLB 3EYYA 1S29A 2OUMA 4RAYA 3C1DA 2OCCH 2LC2A 5HDNA 1XSDA 2COBA 4R8HA 2EJRA 2L9RA 3ISPA 4PJMA 2RVCA 1YW9A 4LD5A 3HC7A 3CJRB 3HOTA 4ZYDA 5E1XA 1JHHA 2MYSA 3EPZA 1Z67A 4E70A 2YTIA 2Z16A 2WTEA 1GVDA 3JTGA 1HKSA 4M6YA 1YFHA 4Z2YA 3CCSI 2LSOA 1SFXA 2RAEA 3FMSA 3FXJA 3TW7A 4BBRJ 4XLFA 4XLNF 1X1AA 2HQAA 5J4YA 2KRCA 4D7NA 4DV7E 2L4MA 1FJGE 4F7ZA 1X3UA 3MKYB 1VQKI 1L3LA 5DS9A 3DV8A 1X6EA 3L09A 5HS7A 3KYLA 1DU0A 1YX5A 3NWSA 4AIHA 3DBRB 2IA1A 1DQUA 1VF9A 2Q1ZB 3CCYA 4BH9A 3JSPA 1XS9A 1FT9A 4U88A 1JK2A 1SVLA 3OSGA 3QPTA 4CO8A 4QPOA 4YFXF 4OINF 2DFHA 2R1FA 5KL4A 1B1BA 2F5DA 3F0CA 4M9XA 4BCAA 2UUCE 1T0FA 1JUSA 2KRHA 4JYKA 2BE5F 2ELHA 2KPMA 2D1HA 2IT0A 5IT9K 5J8FA 2ZNYA 1FY7A 2ZJ2A 3PNYA 2EM5A 3CQZJ 1E2XA 2GZWA 4IJAA 5GADJ 2VXDA 3JRDA 1EH8A 1PUEE 2LK2A 3QPLA 1DGRM 4CH7A 4C3IJ 4ZYEA 2YTJA 1IDZA 2NAZA 4A6DA 5FLMJ 3I64A 2IRFG 2EN2A 4ESBA 5IP7J 4UUSA 1IF1A 3GFIA 1K79A 4ZYGA 3ZMUA 3V7RA 4DV4E 2YTPA 3A0BC 4DV0E 1TWFJ 2YSRA 3BY6A 5F0FA 1MH4A 2CTDA 4RGSA 2EPOA 2K86A 2IS4A 2Z2SB 3F72A 5D4SA 1VFCA 1UN6B 2WC2A 1J59A 3VYUB 5DUIA 3CUOA 2DI3A 1WWXA 1Z05A 1X48A 4CXFA 2E5NA 3HRUA 3HRSA 2HPMA 4R2DA 3KPHA 1REPC 2KLOA 2VQEE 1KQ8A 3H92A 1P4XA 3BGHA 4WYQB 3HOWJ 2FGGA 2B9DA 2DLLA 5JVTA 4HYEA 1W4MA 2IXSA 5DCMA 4CICA 1STZA 1OYWA 2W82A 1T6SA 1VQMI 3L2UA 1YJNI 3GZ5A 3QYEA 1Z0XA 2EMAA 3KE2A 2X1DA 4OMZA 4U7DA 5FD6A 3RJPA 1S7OA 1ZTRA 2E1OA 4HOBA 4CCKA 1RETA 1EH7A 3K4MA 1AKHA 2M9HA 4A3JJ 1K4SA 1MNEA 4KIFA 2RQPA 4IXAA 3A01A 4GYIA 2L2KB 4GKJE 3KEYA 5TISC 3K1NA 3VFZA 2YWQA 1W1WE 5HLIA 3DPLC 2M8EA 4O5VA 2JA6J 3F21A 2Z99A 4C30A 4UVCA 3O3KA 5GPAA 4P9UA 1K61A 4L9VA 2F4VE 2ZXIA 2HTSA 3F8NA 3I59A 2NVQJ 5B1BH 2Y75A 4M3BA 1RZ4A 1G3WA 2OQRA 3BTJA 4L5EA 5K7ZA 3Q3SA 2H8RA 2PJRA 4B3TE 3WTSC 2ZXHA 4HNVA 1E3OC 2LVSA 3IHUA 1YRNB 2ZJPF 4OAZA 4LOCA 3K4NA 4WXHA 2K02A 1SEUA 3L2CA 4RS8A 3W3CA 4BDYA 2DT7B 4G9YA 4FE7A 1IV8A 1BI1A 1ON1A 4EJTA 4UB6C 2AXTC 4P78A 3CP8A 2KJBA 5K1YA 1BJAA 2WAFA 2XF5A 2R7SA 3DQVC 4IOAF 2OZUA 2DA3A 4N9IA 2EFWA 3ZOQB 4BQQA 4IS1C 3CMMA 5F1JA 1V54H 3F6VA 4NC6A 2YSPA 3KWRA 1BC7C 3HUGB 3WG9A 3S1NJ 2PMZN 3OYDA 2R7FA 2VKHA 3RKXA 2EM0A 2DA1A 5IPAA 2B9SA 4E7KA 3GYHX 3LSTA 4IL6C 2LREA 3LAPA 1E0EA 1YZ9A 5KL3A 5K7FA 4X62E 4HQEA 2LD5A 4LF8E 2CUEA 2QKMB 2VASA 2HYFA 5EEHA 2IPQX 3SEZA 2A69F 2L7KA 2GBYA 4G7OF 4HNUA 1BBYA 3HM5A 2EM8A 4DKKA 1GZ6A 4N4RB 3K2AA 2HOTA 4BQNA 3IKTA 1YIOA 4XRSA 2CRGA 2L7MP 3V7SA 2MC6A 4BAYA 4JBAA 5J40A 1NHAA 3FM5A 4CZCA 4PUSA 5J4VA 2UXCE 4G8XA 2EPLX 5HLGA 2XDVA 2YPNA 3EETA 3R60A 2R93J 3ADLA 5M3MJ 1SD6A 1X2MA 3CMAI 5A6BA 4NHRA 3EPHA 1QGPA 1C0WA 2XB0X 2VQLA 1E3PA 2K3FA 2H8WA 1P6RA 1Y8QB 2FF4A 2PFBA 3CDLA 2BVLA 5L3FA 4RGXA 3JW4A 2H27A 1S3JA 1UG0A 2A3SA 1IQOA 3TOBA 2DMTA 3G1LA 3GTGJ 1Z6TA 1HNWE 1SFKA 1MJAA 3JCUC 1F9NA 2VC0A 3VYXA 3AG2H 4X8WA 3ZQHA 4F6MA 3M9AA 4LG0B 1ORKA 2GWRA 2DOAA 3HSEA 3DTKA 3ASOH 1D0XA 2STTA 1W5CC 3L2RA 5IYCJ 3S93A 2DB2A 2E19A 1R23A 1Z7UA 3ZGKA 2MC3A 1X19A 3ZOBA 1JE8A 4WWCA 2JA8J 1TT5B 1WPKA 4I98B 2EL5A 5LMNE 3CC7I 2UXBE 2OBPA 1ZYRF 2VJIA 5LD2C 2CFOA 2D1VA 3QYFA 2ZM6E 3I3LA 5F0HA 3DEWA 2KP6A 1KYQA 3QU3A 2FU4A 2EL6A 2V4JC 3FK7A 3N05A 3OIOA 2V8QB 2FSWA 3WTVC 2TRTA 1BA5A 2QQBA 2VUMJ 4DR5E 1LJ9A 4DBQA 3THNA 4HF1A 3HG9A 4BEHA 4HEIA 4ETSA 2EOSA 3WE3A 2Q0OA 1OCZH 4P96A 3RMPA 3S3NA 1A1GA 3J80C 2R5YA 3JTZA 2VKDA 2EWLA 2H1KA 1KQ0A 2EPCA 3E5UA 5B1AH 2RSMA 4L5IA 4PJLA 2NUEA 5M3FJ 4A3EJ 3VOEA 4OIOF 3KZYA 2K27A 4Y33A 4X64E 4ENKA 2YU9J 2EMXA 2QLZA 2JN6A 2Y69H 3DPUA 1PYVA 2RC4A 2HVRA 2JVHA 2I9IA 1WJCA 4A2UA 1F43A 4ZZDA 2NRAC 3RKWA 5DUKA 1U2WA 3GCMA 2L2MA 2QENA 2Y9YA 3CDIA 4ENJA 2MSYA 2EOJA 1BR4A 1SFEA 1JK1A 1HBXG 2B7EA 2EM3A 4F55A 4R2SA 3LSJA 2CS3A 1W36D 1I3AA 1B4AA 4R2AA 2GHFA 3H3ZA 4BY1J 1V5EA 4RB2C 2PBIA 1X6FA 4F6NA 3JTHA 1Z9CA 3GFJA 3IH3A 1BOAA 2IW5A 1I50J 2WA0A 3K10A 4I6ZA 3H36A 2EN6A 2GIVA 2F4IA 3OIQA 3BJOA 4EM0B 1RPWA 4A5MA 2CQQA 1BI0A 3BG5A 2F5EA 2IVMA 3GX4X 4DGWB 4J8ZA 1LUJB 1ZBTA 3IKVA 2Z9OA 2A61A 4I8OA 1BJZA 1VNDA 2V9KA 4GO1A 1RESA 1OCRH 3GO5A 4F93B 4J00A 4BBYA 5DM7F 1R4MB 1LKXA 3TOAA 3R61A 4DV5E 2E1MC 3K7AJ 4G6DA 2L8TA 4UVBA 2DA4A 3CUQC 2PMUA 3BTCA 2RNJA 1B9MA 1R7JA 4LIUA 2Z1DA 1ETKA 1YTYA 1N75A 2B7VA 2HXOA 2ID3A 2EM6A 2KQRA 2EPMX 4PSXA 1LB2A 3HSRA 3H0GJ 5M5YJ 2I8DA 4PJJA 4CCOA 4XN3A 5IT9C 4NXME 3V8KA 2E1MB 3HOZJ 1TN9A 1JJ6C 3UR3C 3KIOA 1OCPA 2NNNA 5CJ9A 3BBGA 2V1UA 3CUQB 4DUYE 2ISYA 4B43A 5FRNA 1JUPA 2EZIA 5LL6R 2XHKA 3GFMA 3U9GA 5H20A 3J7AO 2W57A 2KMUA 4AM3A 1SANA 1UB9A 4UXNA 5D5WB 1T56A 1A1KA 3RDIA 3BTIA 1LE8A 4DR4E 4U0VA 2VJ5A 1HR0E 1U5TB 1I1SA 3PFYA 3I53A 2X1EA 5KAFC 5LHIA 2V1DA 1WXRA 4M3GA 5DV5A 2ODRD 3K4CA 1DP7P 2GA1A 1SR9A 4OU0A 2QGUA 3VODA 3X2QH 2WB1A 3CESA 4AUXA 3MWMA 2YU8A 2ZJRF 2EFOA 3BR1A 1GTKA 2FJ1A 4D9JA 2LO3A 4XICA 1UHMA 4WK8F 5GAGJ 1O4XA 4XKVA 3DKWA 3W2WA 3P1XA 1J5YA 4KIBA 5ILSA 2L92A 2HOSA 3ZP5A 1X1BA 4XRFA 4AVPA 4B8XA 3I4NJ 4AYBN 3NRVA 3CJNA 4KYWA 2DQRA 3BR6A 3MMYB 1T4OA 4C2TA 1TL8A 5IYBJ 2HKXA 4CCJA 3ML6A 3IRQA 2CPNA 1U0JA 3BJ6A 3DEUA 4FASD 5A2QK 1IG7A 3OYKA 1U9NA 1SMTA 1MBGA 2XSJC 2D2WA 1QZYA 1UHWA 3AAFA 3HRTA 4LLLA 1LDKB 2DTZA 2L9VA 3I71A 4F2JC 1DPUA 3GTQJ 1D1CA 1I27A 5DCFA 1RI7A 2V1XA 5AIPA 3UKGA 1FP1D 1DP3A 1AWCA 3BQYA 1UJ8A 4HQMA 3HQ1A 4L8NA 1XSXA 2KHMA 1GHCA 2WV0A 3H9JA 3ZQ7A 3V4GA 4E7HA 1T38A 1WJ5A 2B3TB 2E2IJ 4V2FA 2VQHA 5AIQA 2CQKA 2MKNA 2A6TA 2L7FP 4EM1A 2VODA 2BVMA 3GUDA 3I55I 2JWOA 3KCCA 4XRSG 3KFWX 1BBGA 5M5XJ 2V88A 3ABUA 2Q8UA 3H3UA 1APLC 1TW3A 3GWZA 1IXRC 1D5YA 3P5JA 4B3RE 1SD4A 3MAJA 4ENMA 1GQEA 4MLVA 3ELKA 1G6NA 5JR3A 1UBDC 1IC8A 4PJNA 2YTOA 1R5GA 2ETHA 2VJ4A 2X0LA 1WHQA 2J5OA 1ZGJA 1N34E 3GTJJ 5ICGA 1W36C 1KU3A 2IP2A 4JK1X 5EYRA 2NVXJ 5JLXA 4BC9A 4XMYA 2O0YA 1MBKA 4CYCB 4HLYA 3TDZC 3J80Z 1MMGA 2P6SA 2GXAA 1ERDA 3ZQQA 1JGGA 2R7QA 3VEPA 2E71A 1J7KA 1HQCA 2B63J 4L5JA 2JVGA 2X9DA 4OIRF 2QVOA 1D1AA 2DA6A 5KK1A 2IGKA 4NC8A 1VQOI 4MEYF 3P7NA 5E1WA 2ZMEC 2BHZA 3HL2A 2OA4A 3CCRI 4BE0A 2FQ3A 3WG7H 4EV0A 3DF8A 3ZQCA 2JZYA 2DA5A 2YX4A 2P4WA 4HZFA 2MGQA 1IBKE 2E7WA 2E34A 5AASA 2EINH 3OY9A 3MKLA 2EPFA 3LSKA 2M5WA
chains in the Genus database with same CATH topology
2Q2EA 2HOEA 2ZMEB 3RPUA 4L9JA 2G9WA 3DPTA 5CVUA 3TKYA 1WSUA 1ZHFA 2HQRA 3F8CA 4NQWA 1QO0D 2NS0A 3LA2A 5ICFA 4Q48A 2XAJA 4HV6A 5LRSA 4MQ9F 5IT9Z 1I5ZA 1K78A 2FXAA 5CVRA 4L9NA 3N97A 4BYYA 5LLQA 2ESNA 1IRFA 1IN5A 1FZPB 1F5TA 4HAMA 1XB4A 2XAFA 3S2WA 2C6YA 3I0TA 2G7HA 2EFQA 2CSOA 4N9HA 5AONA 2E7XA 2HS5A 4UHTA 1WQ2A 1QQIA 1FP2A 2OU2A 5LEKA 3M8EA 4CGZA 3MFKA 3TO6A 2B0LA 4LLNA 4A0ZA 3IC7A 3HOSA 4I7HA 1FYMA 2FMLA 3E6CC 3LQRA 2R3SA 2W84A 1TLHB 1CF7A 3EQLF 3KLNA 5L3EA 3R6SA 2STWA 1J75A 1ZGAA 5JHUA 1SAXA 6PAXA 3Q9SA 1UFMA 2ESHA 2M1BA 1R1VA 5CLSA 3CO7C 4LJZF 3T8TA 1FSHA 4KMUX 4ESJA 2BGCA 3TDUC 3G3ZA 3HTSB 3T0YA 2JPBA 2JRTA 3W6JB 1O3RA 1IRGA 4DQ2A 2EV5A 1U8RA 3D0SA 2PEXA 3BJAA 5LBQA 4EGYA 5FB2A 4O3MA 5FLXK 4BHBA 1A04A 2EWNA 4A0XA 1RNLA 2DBBA 2L02A 4U0WA 3RYRA 3E5XA 4OIQF 5DD8A 3M8FA 1P92A 3R0AA 3I58A 2OD5A 2DAOA 3I5UA 4B09A 2UWMA 4CYDA 4G7ZF 2VONA 3P9KA 2V79A 1MGTA 1BIAA 3D5LA 1B59A 4UVAA 4BQAA 4P5OA 4FT8A 1RUOA 1MZBA 1XGOA 2HZTA 2RGVA 3IWFA 1SD7A 4KIGA 4CZZA 2P5KA 3ROUA 2MLGA 4WCGA 5D6EA 5DCMB 5BPDA 1ULYA 5F64A 4LK1F 5BS6A 4OOIA 4M71A 1YQAA 2Q8KA 3I54A 3CTAA 3KLOA 3K0LA 3RI4A 1BI2A 3KETA 3ECOA 4KDPA 4EGZA 1RIOH 5ERIA 1DUXC 3C18A 4EMSA 5E8IA 1KQ9A 2VBZA 2NNYA 1HKQA 1HXDA 2OZ6A 2PQ8A 2O6GE 2EK5A 2VBYA 2YX7A 4Q5SF 3BROA 3C7JA 5ILUA 3ZN1A 1ZLJA 2PI0A 1S6LA 4ZYHA 3IWZA 1HW5A 3QP6A 3L9FA 1MJ9A 3SZTA 1OR7A 1UCRA 1W5SA 4Y17A 1XDUA 2QQ9A 4FHTA 1OMIA 1XCBA 2EB7A 2ZNZA 4LLGF 3HUGA 5K5OA 5HS8A 2P5VA 1CGPA 1YYVA 4HDUA 5F1RA 4MEXF 1XGMA 3OV8A 2Y0MA 1LDJA 3GF2A 3O6BB 1O3TA 4CHUA 1HW2A 2LF8A 1ZRDA 3BPVA 5LGTA 3M7GA 2AXLA 2VC1A 3L00A 5HDGA 4PZJA 4RGRA 4S04A 2ADUA 1U78A 3FF5A 2YPRA 1T98A 3IRRA 4LG0A 1IW7F 2HR3A 1FPQA 2XROA 1SMYF 4GYGA 5FFZA 3FXRA 3WTUC 3WTYC 1FBUA 3DXJF 3R4KA 5A2QZ 3J81Z 1XSVA 3KP6A 4WF2A 3TO9A 2DU9A 5D8KB 1T39A 4KN7X 1GXPA 1P4AA 2G7UA 2H6CA 1DPRA 4U7BA 4HA8A 4IVNA 2FNAA 3LQQA 5ICCA 5D6FA 2CGPA 1LEAA 3MEXA 2EFNA 2FBKA 2RDPA 4O6JA 4EQQA 3ZMZA 2XGXA 3IL2A 3HYIA 2TDXA 5KVRA 1R22A 1IUYA 3G73A 2VOPA 1FNNA 1EH6A 1ZARA 2RN7A 4BXUA 4DNCA 3MQ0A 2VT3A 2KIMA 2HGCA 2A07F 1KYZA 1U5TC 5J8CA 2KRFA 2GXGA 4ASNA 3KZZA 1IZ1A 3GFLA 3LA3A 1KU7A 3RTRA 5E1ZB 1BM9A 2LNBA 1G3SA 4LGWA 4RB0A 3I4PA 2JSCA 2EFPA 3N4MA 3CUQA 1QNTA 5ICEA 4UV8A 3ZMTA 4Y13A 2ZKZA 4XSZF 3WGGA 3KP5A 2F5FA 4PCQA 1BN5A 2VT2A 2YU3A 5D5UB 1IN4A 3ECHA 1YO5C 1ZH5A 1I6XA 2DPDA 3T1BA 3BDDA 3E6MA 5DD4A 2CFXA 2YR2A 4A12A 1TQIA 2MD5A 5HS9A 3FMRA 2D45A 2VXZA 3L7WA 4S05A 2FBHA 1RUNA 3KEOA 3BP8A 2MLKA 1W7PD 3WTZA 3QPHA 4EM2A 2M45A 1MDMB 3EYIA 1XN7A 3FXQA 4I02A 4P55A 3V7CA 5FD5A 3F3XA 4YG2F 1TTYA 3T8RA 3WU1B 1TBXA 1KGSA 3ZN0A 2W24A 5DDGA 5JFRA 2XKPA 3F8BA 4U0YA 4M73A 5E8GA 4ZH4F 3V8LA 1O57A 3SQNA 1IN7A 5EEGA 2DT5A 4RB3C 3WTXC 3BOQA 2O03A 3P9IA 2QBYB 1R36A 4KICA 4LB5A 2CO5A 2HYGD 2HTJA 1U3EM 1FYKA 2KJCA 3R0JA 1S8NA 4Q4ZF 3KP2A 4MTDA 5FO5A 1S7AA 2EV0A 4GCVA 4LMYA 2GXBA 5H6QA 5LEJA 1U6GA 2ZMEA 2K4JA 1FC3A 5FLXZ 4AIJA 2DQLA 2L4AA 2GA2A 1G3YA 4IPAA 4L18B 1YG2A 5D8LB 3GVAA 3DFGA 3JAMK 4RGUA 5CVVA 3QU6A 4HF0A 2FE3A 1FLIA 5CVIA 3BWGA 5CVJA 1IN6A 2IA0A 5BQTA 2CWEA 1Z6RA 1FX7A 1KU9A 3P9CA 3CLOA 3QAHA 4HBLA 2O3FA 3NQOA 3FX3A 1GXQA 1YW8A 4N0BA 1BI3A 1KA8A 4G94A 3TQNA 3K1PA 3QRFF 2H6BA 2O61A 2P7VB 4Q47A 1W7PB 3F22A 1O3SA 3F23A 2CG4A 1PP8F 1O7LA 1OYIA 1USSA 2DK8A 1IN8A 3F6OA 2K7LA 4CDGA 1R1TA 3FXUA 3WTWC 2KKOA 4KA4A 1FSEA 3GXOA 2UXNA 1LNWA 4XLPF 4MTEA 1K6OA 1ODDA 2MBFA 4IRGA 2PLYA 4L0ZB 5LGNA 1R58A 3E97A 4PGHA 4BHPA 1USTA 4JQFA 3TO7A 4AWXB 3B02A 2FRHA 1PP7U 2M87A 2QYOA 4YIFA 5L3GA 4MHGA 2DK5A 1TNSA 4WXDA 1O3QA 5IT3A 2A6EF 2ZO4A 5H6RA 5CYVA 2HEOA 3LAJA 4IF4A 1D3YA 1ZREA 3RYPA 1XMKA 2DW4A 3K9TA 5K5RA 1G4DA 1YS7A 2COMA 5DEQA 1XMAA 1H9GA 4LB6B 2P7CB 3VB2A 3MZYA 2XASA 4M9ZA 2HKOA 3HIFA 4UUVA 4MQVA 5E20A 2EA4A 2UZKA 2A5YB 5HLHA 3SXYA 3WU0A 2ZCWA 2P5LC 2Z5UA 5D5XB 4UNOA 4I0AA 3E5QA 3Q5FA 2LKPA 2XAQA 1JGSA 1OPCA 1R00A 2QZ8A 3HRMA 4I01A 2Z33A 3E6DA 3NEUA 2KIFA 4HX8A 1HW1A 4XSXF 1WI9A 2ZBKA 2CW0F 3ZMSA 1H9TA 5DYMA 2RV8A 3E6BA 1ZG5A 4RAZA 3I59B 3SHFA 1V3FA 3ZMVA 1FOKA 1Z1DA 4I2OA 1P4WA 2VE9A 2MA3A 3E3VA 2QM3A 2W25A 2HDCA 4YFNF 2A68F 2FOKA 1Z91A 4AD9A 4NB5A 5HDKA 1ZN2A 3HTUA 3HHGA 3ABTA 4EJUA 4R79A 5FGMA 3WGHA 2X4HA 1H0MA 4L0YB 1ZG1A 4A6EA 1I1GA 1TQMA 1GVJA 5TRDA 2J5PA 4HX7A 2HQNA 2BEOA 4BHCA 2LDUA 2H09A 2R7DA 4TV7A 1SFUA 1O7FA 2F5CA 2E1NA 3DP7A 2FEZA 4KT5C 2VN2A 3LFKA 3K2ZA 2HWVA 3MZHA 1L0OC 2XRNA 3SZPA 2WWYA 3MCZA 4ENNA 4KNYA 2FBIA 4PGGA 2VOOA 2FNPA 4HV5A 4ESFA 4M6XA 3HHHA 1ZLKA 2UXXA 2JPCA 1TNTA 4GGGA 4LK0F 2VBWA 1JHFA 4AIKA 4I09A 3O2PE 3EDPA 4HX4A 3TGNA 1WRJA 5LRRA 4EJOA 2CYYA 1IXCA 5ILVA 1XDSA 1HSJA 2A6HF 4XBFA 4NHJA 3Q9VA 3FMQA 2ZFWA 1D5VA 1MJBA 2XV4S 3KP4A 3HSFA 1B9NA 3PQJA 2XIGA 4QLCU 3LA7A 1BIBA 3ERED 1E17A 2V9VA 1YW7A 3RIRA 1FWZA 3QP5A 1BC8C 1XCVA 4M72A 1J2XA 3WGIA 4FX0A 2VBXA 1YLFA 2ACJA 2QUFA 2JTVA 3SFZA 2XVCA 2OQGA 1QBJA 5LGUA 2L54A 2BYVE 3FZVA 1LEBA 2W85A 4EVIA 3ZMDA 4A5NA 2JT1A 1QZZA 2Z3YA 1ZAOA 4IRHA 2FA5A 4PDKA 4RB1A 1AOYA 3W6KB 2O8XA 3FM3A 2EA2A 3BPXA 3ZPLA 4R1HA 1XD7A 4UV9A 3ULQB 2BBYA 2DFIA 4P9FA 2MH2A 4KN4X 3OOPA 1Q1HA 2OAZA 1VTNC 3GLXA 1JXSA 4H0EA 5TJJA 2QWWA 3C3WA 1ONVA 1SD5A 2K4BA 2GQQA 5L3CA 1KU2A 2NYXA 3QOPA 2IJLA 4WXCA 2PJPA 1F1ZA 1K7AA 2AS5F 1FYLA 1U5TA 4IRIA 4EJWA 4HF2A 2L01A 4L9TA 1V4RA 3WTTC 1J0RA 1XGSA 3U2RA 1F4KA 2KIUA 1YS6A 1PDNC 3JAMZ 3RPQA 3JSOA 2DO7A 2XAHA 4HW0A 3EUHA 3GZ6A 3M1EA 5D4RA 2PMHA 4KMFA 5JI6A 3KEQA 4KUMA 2HFHA 3J81K 3COAC 2H94A 1MD0A 2DTRA 1DDNA 1J9IA 4EJVA 1B6AA 1MDMA 1TQPA 5J6XA 1LVAA 5FFXA 2IA2A 1OKRA 2P8TA 1WKMA 3CO6C 2V6CA 3PQKA 3WODF 5F6FA 3FHZA 4D0PA 4KFCA 5BOXA 5HVQC 3GW2A 2PN6A 1P2FA 4MNUA 4FX4A 2L3DA 5D5VB 4M74A 1IAWA 1D8KA 5L3BA 1W5TA 2ISZA 4M9SA 2P6TA 3WE2A 3LWFA 2Y48A 3F8FA 4OIPF 1LDDA 3GEZA 1FBSA 3V8JA 2E1CA 4QWQA 3FWEA 3PFIA 5LHHA 2QBYA 1QPMA 3F8MA 1D8JA 5E17F 4ON0A 2XUBA 2M30A 1ZRCA 2VE8A 2ZXJA 3K1MA 1ZG3A 3BZ6A 4OMYA 2EV6A 3KP3A 4MGRA 4WX9A 4G6QA 3RKYA 1FBQA 3T5XA 2XKOA 1HSTA 1T2KA 1K78B 1HKTA 2MH9A 2PG4A 2QQAA 5ED4A 1XGNA 4K2EA 4IHSA 4HLXA 4Y15A 4ZZLA 1MKMA 1OYYA 1ON2A 5BPIA 2GAUA 4HDVA 4LFUA 2F2EA 4GXOA 5BMZA 1IXSB 4BNCA 1KYWA 1EV7A 2LF7A 3KP7A 3B73A 1R1UA 4IHTA 1Y0UA 5L3DA 1TW2A 5LHGA 4I0BA 1CF7B 3K69A 5HOOA 2XAGA 4A0YA 4G7HF 1G3TA 3REOA 2FMYA 1W7PA 3J80K 5K5QA 2BV6A 2DPUA 3U1DA 5E18F 1ZRFA 2RKHA 4YFKF 4YIIA 1LQ1A 3CDHA 1R5HA 3EYYA 1S29A 4RAYA 3C1DA 5HDNA 1XSDA 4R8HA 2EJRA 3ISPA 3HOTA 1YW9A 2RVCA 4LD5A 4ZYDA 5E1XA 1JHHA 4E70A 2WTEA 3JTGA 1HKSA 4M6YA 1YFHA 4Z2YA 2LSOA 1SFXA 3FMSA 4XLNF 2L4MA 4F7ZA 1X3UA 1L3LA 3DV8A 3L09A 5HS7A 4AIHA 2IA1A 3JSPA 4BH9A 1FT9A 4U88A 3QPTA 4CO8A 4YFXF 4OINF 1B1BA 2F5DA 4M9XA 1T0FA 2BE5F 2ELHA 2IT0A 2D1HA 5IT9K 5J8FA 2ZNYA 1FY7A 2ZJ2A 1E2XA 2GZWA 4IJAA 1EH8A 1PUEE 4ZYEA 2NAZA 4A6DA 3I64A 2IRFG 4ESBA 1IF1A 3GFIA 1K79A 4ZYGA 3ZMUA 3V7RA 2YSRA 3BY6A 4RGSA 2K86A 5D4SA 3F72A 2WC2A 1J59A 5DUIA 3CUOA 2DI3A 1WWXA 1Z05A 4CXFA 3HRUA 3HRSA 1REPC 1KQ8A 3H92A 1P4XA 2DLLA 5JVTA 4HYEA 1W4MA 5DCMA 4CICA 1STZA 1OYWA 1T6SA 3GZ5A 3KE2A 4OMZA 4U7DA 5FD6A 3RJPA 1S7OA 4HOBA 1EH7A 4KIFA 2RQPA 4IXAA 4GYIA 3K1NA 3VFZA 5HLIA 3DPLC 2M8EA 4O5VA 3F21A 2Z99A 4UVCA 3O3KA 4P9UA 4L9VA 2HTSA 3F8NA 3I59A 2Y75A 1RZ4A 1G3WA 2OQRA 3WTSC 3IHUA 4WXHA 2K02A 3L2CA 4RS8A 4G9YA 1BI1A 1ON1A 4EJTA 2KJBA 5K1YA 1BJAA 3DQVC 2OZUA 4N9IA 2EFWA 3F6VA 1BC7C 3WG9A 2R7FA 3RKXA 3GYHX 3LSTA 3LAPA 4HQEA 2HYFA 5EEHA 2IPQX 2A69F 4G7OF 1BBYA 3IKTA 1YIOA 3V7SA 4BAYA 4JBAA 1NHAA 3FM5A 4G8XA 5HLGA 3EETA 3R60A 1SD6A 1QGPA 1C0WA 1P6RA 2FF4A 2PFBA 5L3FA 4RGXA 3JW4A 2H27A 1S3JA 2A3SA 3TOBA 1Z6TA 1MJAA 1F9NA 2VC0A 3M9AA 4LG0B 2GWRA 3HSEA 2STTA 1R23A 1Z7UA 2MC3A 1JE8A 4WWCA 4I98B 2OBPA 1ZYRF 2D1VA 3QU3A 2FU4A 2FSWA 3WTVC 2QQBA 1LJ9A 4HF1A 4ETSA 3WE3A 2Q0OA 4P96A 1KQ0A 3E5UA 4L5IA 3VOEA 4OIOF 3KZYA 2K27A 4ENKA 2QLZA 2RC4A 4A2UA 4ZZDA 2NRAC 3RKWA 5DUKA 1U2WA 2QENA 4ENJA 1SFEA 1HBXG 1B4AA 3H3ZA 4RB2C 2PBIA 3JTHA 1Z9CA 3GFJA 1BOAA 2IW5A 2GIVA 4EM0B 3BJOA 4A5MA 1BI0A 2F5EA 2IVMA 3GX4X 3IKVA 2Z9OA 2A61A 4GO1A 3GO5A 3TOAA 3R61A 4G6DA 4UVBA 3CUQC 2PMUA 2RNJA 1B9MA 1R7JA 1YTYA 1LB2A 3HSRA 3V8KA 2NNNA 5CJ9A 2V1UA 3CUQB 2ISYA 2XHKA 3GFMA 3U9GA 5H20A 3J7AO 2W57A 1UB9A 4UXNA 5D5WB 3RDIA 4U0VA 1U5TB 1I1SA 3I53A 5LHIA 2V1DA 5DV5A 1DP7P 2GA1A 4OU0A 3VODA 3MWMA 2EFOA 1UHMA 4WK8F 3DKWA 1J5YA 4KIBA 5ILSA 3ZP5A 4XRFA 4AVPA 4B8XA 3NRVA 3CJNA 4KYWA 2DQRA 3IRQA 2HKXA 3ML6A 3BJ6A 3DEUA 5A2QK 1SMTA 2D2WA 1QZYA 1UHWA 3AAFA 3HRTA 4LLLA 1LDKB 3I71A 1DPUA 1I27A 5DCFA 1RI7A 2V1XA 5AIPA 1FP1D 1AWCA 4HQMA 1XSXA 1GHCA 2WV0A 3ZQ7A 3V4GA 1T38A 5AIQA 2CQKA 4EM1A 2VODA 3GUDA 3KCCA 3KFWX 3ABUA