4WXDA

Crystal structure of mycobacterium tuberculosis ogt-r37k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSKTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxdA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxdA01
3M7GA 3TOAA 4K2EA 1QNTA 3HTSB 3RKWA 4LLNA 4ZZDA 2RGVA 4GGGA 2HYFA 3KFWX 4BHBA 1K79A 2FBHA 1ZHFA 3EETA 4A5NA 2OQRA 4MHGA 2QQAA 4F7ZA 1ZYRF 1OR7A 4YIIA 5IT9K 4MEYF 2HZTA 2CWEA 2NNNA 3ECHA 2V79A 2E1NA 3NRVA 3PQJA 2L4MA 2Z3YA 1G6NA 3BZ6A 1FBSA 1BI1A 2HYGD 5HDNA 3EUHA 1R23A 4RB3C 3SHFA 4A6DA 2V1UA 5FD5A 2FBKA 2VC0A 2V9VA 4HF0A 3BPVA 1O3SA 1SFEA 1YW9A 3ML6A 1EH8A 5DEQA 2GA1A 2GZWA 1I1SA 2D45A 1MDMA 3RIRA 3WTZA 2RVCA 3FM5A 2PBIA 1YTYA 4WF2A 1R00A 4UHTA 4RAZA 5HLIA 4Z2YA 1R36A 1T98A 2RKHA 1HW2A 1W7PB 1W7PD 1D3YA 4EMSA 4A6EA 3C7JA 2XHKA 2D1VA 2UXXA 5CJ9A 2YPRA 1S8NA 5FLXZ 1QQIA 3FMSA 1P4WA 1BBYA 4UVAA 2F5FA 4I98B 4BAYA 4KNYA 1U2WA 2PI0A 3U1DA 3F8NA 4N9IA 5CYVA 3I0TA 2JTVA 2NS0A 3U9GA 2K86A 5DUIA 5DCMA 3VB2A 1FBQA 2GA2A 4WWCA 4HDUA 1TW3A 4KDPA 3O6BB 2W25A 3LQRA 1ON1A 2DFIA 1GXQA 2ZCWA 1JXSA 4O6JA 4OOIA 5HOOA 3WGIA 1SD6A 1XGMA 3ZN0A 4EM1A 2MBFA 4CDGA 2M5WA 5HVQC 3C3WA 1KQ8A 3LQQA 3F8MA 3QU3A 3V8KA 5D6FA 3V8LA 1ZREA 3FXUA 2O6GE 3MEXA 2V1DA 3E6BA 5ILSA 1YQAA 1B6AA 3K0LA 3BDDA 2HDCA 2OZUA 3ABTA 2XAHA 3LA7A 2Z5UA 5J8CA 1MDMB 4KA4A 2GIVA 4BYYA 3CLOA 4UNOA 3DV8A 2MLKA 2PQ8A 4HX4A 1R22A 2XGXA 2DK5A 2DK8A 2H6BA 2H09A 3JSPA 4R8HA 3KP2A 1SD4A 2BBYA 5HLHA 3EYIA 1B9NA 3VFZA 1YW8A 1SAXA 1I1GA 3QRFF 5LGTA 3HRMA 4HLXA 2EV5A 4Q48A 5A2QK 1U5TB 3IL2A 3DPLC 5L3CA 3GX4X 4G7ZF 1ZARA 4WXHA 3MZYA 3HOTA 4KIGA 3BP8A 3CTAA 3P9CA 2QLZA 2DPDA 4DNCA 4RGRA 4A0XA 3QOPA 3BY6A 4B8XA 4KMFA 5DDGA 3I5UA 2QZ8A 5K1YA 1R5HA 4CZZA 4Y13A 4OIQF 3J81Z 1EH7A 1BI3A 1RIOH 2HFHA 2O8XA 3FZVA 4P5OA 3SZPA 1B4AA 3HRTA 3GFIA 2BGCA 2IRFG 4EGZA 2HQNA 4KMUX 1WSUA 4FT8A 1HBXG 2ZNZA 2JPBA 1TQIA 2DTRA 2QWWA 5LLQA 3REOA 1J59A 2BEOA 5JR3A 4O5VA 4E70A 2J5OA 5F1RA 2YU3A 5LRSA 2VT3A 4NHJA 3GFLA 1IRGA 2QM3A 4KFCA 3KE2A 3F8FA 3TDZC 1LNWA 4I01A 1JHHA 4G7HF 2HTSA 2BE5F 5KK1A 3D0SA 2ESNA 2LF7A 2VN2A 4LK0F 3CO7C 2F5CA 1XGSA 5DUKA 1TNSA 2KKOA 1XCVA 2OZ6A 4GXOA 3KETA 2CSOA 1O7FA 2C6YA 3W6JB 1KU3A 3KCCA 4N9HA 4LD5A 2K02A 4EM2A 1K7AA 5AIQA 1HSJA 2FU4A 1HW5A 3BJAA 2A6EF 1ZG1A 3DPTA 4OIPF 5BOXA 3D5LA 3WTVC 3I4PA 3N4MA 2VODA 4B09A 4IJAA 4LB6B 4L5JA 2X4HA 1SMYF 2Z99A 4I02A 4LB5A 1X3UA 1O57A 4CO8A 1QZYA 3W6KB 1XSDA 2GAUA 3LAJA 1T6SA 3F6VA 3SZTA 3IC7A 2L02A 1S6LA 4D0PA 2QBYB 4HYEA 2PJPA 2A6HF 3HRSA 1ZRCA 2EA4A 3CUQA 1D8JA 5L3GA 2FA5A 4GCVA 4RB0A 4EJVA 4ENKA 2G7UA 2UZKA 3ULQB 1BOAA 1DDNA 1IXCA 3FF5A 1DPRA 1Z1DA 1ZGJA 3EQLF 3Q9VA 4ASNA 5D5XB 5LBQA 2ACJA 1R1UA 3WE3A 4I0AA 3GLXA 3DQVC 1D8KA 1RUOA 4RGSA 4Y17A 4AIKA 5LGUA 1FT9A 4O3MA 4WX9A 1FYKA 1O3RA 3U2RA 5DYMA 4ZYEA 4L18B 3ROUA 4FX4A 5FO5A 2FNAA 2PEXA 4HQEA 2ETHA 3ZN1A 5D5UB 1PP8F 1ZH5A 3GF2A 4ESBA 2FXAA 2QVOA 1YYVA 2O61A 3S2WA 2Y48A 2NRAC 3DKWA 2XAFA 3I53A 4BQAA 4EQQA 1ZGAA 1H9TA 2KJBA 5L3FA 1XN7A 1KA8A 4RGXA 1MGTA 2EA2A 2DLLA 3F3XA 3MWMA 2M8EA 2MH2A 4HDVA 3J81K 2NAZA 4KN7X 3GZ5A 5J8FA 1B59A 3HSEA 4EVIA 4EM0B 2P5KA 2DW4A 3F72A 2DT5A 1LDJA 4EJWA 5A2QZ 2PN6A 4R79A 4P9UA 2M45A 2EWNA 1S29A 1PP7U 1MKMA 5J6XA 1TNTA 1MD0A 3K1PA 3KLNA 1FY7A 1UFMA 3E6DA 2K7LA 3JW4A 3V4GA 3P7NA 1T2KA 2CQKA 3H3UA 2F2EA 4MGRA 3PQKA 2TDXA 3WGGA 2KIUA 4KYWA 1P4XA 3KEOA 2ZMEA 2CO5A 2HEOA 4HZFA 4M9ZA 1XDUA 2QYOA 1L0OC 5H6RA 2ESHA 1ODDA 4ESJA 5D4RA 3FX3A 4ZH4F 3HSFA 4U0YA 1YS7A 4RB1A 2QQBA 4ENJA 4I2OA 1IUYA 2JZYA 1KU9A 1SFXA 3FHZA 5ED4A 3ZPLA 3ZQ7A 5DV5A 3MAJA 4JBAA 1BI2A 3HHHA 4BXUA 2ELHA 3C1DA 2D2WA 2RV8A 1XB4A 2VE9A 3IKVA 4YIFA 3CJNA 1GHCA 3GO5A 1QBJA 1R7JA 5TJJA 2FE3A 1G3YA 1USSA 2P7VB 1K78A 5ICGA 3H3ZA 1LVAA 4LLLA 3KZYA 3HYIA 1W4MA 4PDKA 4HF2A 2FMYA 1RZ4A 3L2CA 3JTGA 2M87A 1WQ2A 4G94A 3I58A 1QZZA 3SQNA 5LHIA 4M73A 2FNPA 4NB5A 1OKRA 2DAOA 2F5DA 4KIFA 5CVUA 3T1BA 1U5TC 1JGSA 3RYRA 2L4AA 3HHGA 1IN6A 3RJPA 4S04A 1XGOA 1OYYA 4AIHA 2IA0A 2IT0A 2LKPA 2NNYA 1QO0D 3WTYC 2VC1A 5E1ZB 1MJAA 3ISPA 2J5PA 1F5TA 3GVAA 4U7DA 3E5UA 1IRFA 3QAHA 1O7LA 3KP3A 2BV6A 1IN7A 1O3QA 2P4WA 4IVNA 5IT3A 2R7FA 4Q47A 3T0YA 2IA2A 5HS7A 4MTDA 4ZYGA 2EJRA 3J80K 3V7SA 4YFNF 2EFQA 3WTUC 4XBFA 2LNBA 3WTSC 4HBLA 4HAMA 2COMA 3K1MA 1BN5A 4HV5A 3P9KA 4UUVA 3LA3A 3LFKA 4GYGA 2KJCA 3C18A 2MH9A 1FNNA 4LMYA 2XVCA 1DP7P 3WTWC 4RB2C 1KGSA 1V4RA 1ON2A 1HKSA 3ZMDA 2STWA 1RNLA 3DF8A 5FB2A 1KYZA 3DEUA 4MEXF 2PMHA 1R58A 1ONVA 2B0LA 4P96A 2IVMA 1ZLJA 5ILVA 3KP5A 5EEHA 3GFMA 3HUGA 1H0MA 1XMAA 2R3SA 3TKYA 3K2ZA 3JTHA 3GZ6A 2RC4A 1IXSB 4KT5C 1T38A 3R0JA 3LWFA 1XSVA 1MZBA 5F6FA 1S7OA 1IN5A 4LJZF 1CF7A 5DCMB 5K5RA 2PLYA 4EGYA 3FXQA 5K5OA 4GYIA 2IJLA 5D8KB 2HWVA 3LSTA 4MQVA 3NEUA 2DQLA 2P8TA 1IF1A 1BM9A 1H9GA 3M1EA 5FFZA 4R1HA 1IN4A 1D5VA 4G6DA 1ZG5A 5BMZA 2HR3A 3TO6A 4LGWA 1FX7A 3VEPA 4IHSA 4LLGF 3RKXA 5D5WB 3E97A 1TQPA 2A68F 3V7RA 3I59A 4LK1F 1YG2A 1Z05A 3DP7A 5HS8A 2P5VA 4U0WA 1IN8A 1J5YA 1RUNA 4LG0A 3QPHA 3KP6A 2OQGA 1J0RA 5LHGA 2WV0A 3K1NA 2P6TA 4UVBA 4ETSA 3RYPA 4U7BA 2P5LC 2E1CA 5E8GA 3E3VA 2EFWA 1ULYA 1KU7A 2A3SA 5D6EA 2DI3A 3PFIA 3GXOA 1IXRC 1T39A 3CO6C 5L3DA 2FSWA 3EYYA 3RPUA 3P9IA 3TO7A 5CLSA 5TRDA 1YO5C 3FMRA 3COAC 4G6QA 1UCRA 3MZHA 3FM3A 5ICFA 1LDKB 4OIRF 3T8RA 4IRGA 4PCQA 3KLOA 3QPTA 2P7CB 4FHTA 1IW7F 2WWYA 2HQRA 3CUOA 2IP2A 5JFRA 4CICA 2JPCA 1TW2A 5FD6A 3R61A 1BJAA 1FOKA 2W84A 4HQMA 1J2XA 1BI0A 3IRQA 1S3JA 4UVCA 1BC7C 3R6SA 5JVTA 3T5XA 2UWMA 3RTRA 1LB2A 1G3WA 4G9YA 2NYXA 4A12A 5CVRA 2EV0A 4PGGA 3GUDA 1FSEA 5HDGA 3J7AO 2DQRA 1LJ9A 2HKXA 3IHUA 4Y15A 2XIGA 1R1TA 3HOSA 1U6GA 3GYHX 4IPAA 2DPUA 5JHUA 2JRTA 3WTTC 2V6CA 1LDDA 3ABUA 5AONA 2KIFA 3JAMK 2XUBA 1K6OA 2L3DA 4LG0B 1YLFA 1R1VA 4U0VA 1G3SA 1T0FA 3GW2A 1P2FA 2A07F 3J80Z 2VOOA 1V3FA 2ZO4A 3QP6A 4G8XA 2H94A 2ZNYA 3BROA 1YIOA 2AS5F 2EFPA 1FBUA 2OAZA 4M71A 4OIOF 4TV7A 1REPC 3F21A 1Z9CA 1STZA 1PDNC 1GVJA 1MJBA 1P4AA 1Z7UA 4QLCU 3E6MA 1ZRFA 4N0BA 1USTA 2UXNA 4UV8A 3AAFA 4I09A 3EDPA 2M30A 1FP2A 5FFXA 1LEBA 3V7CA 3ECOA 1W7PA 4L9VA 3G3ZA 3BJ6A 4UXNA 4FX0A 3KP4A 4WK8F 5AIPA 3RDIA 1ZRDA 2F5EA 1R5GA 4L9NA 5D8LB 3H92A 3CUQB 3HSRA 1ZLKA 2FEZA 2D1HA 4DQ2A 2Z33A 3HRUA 1I27A 4AVPA 5H6QA 1ZN2A 1TLHB 4UV9A 2WTEA 2KRFA 5HS9A 1FLIA 2ZXJA 3E5XA 4M9XA 1ZAOA 2FMLA 3NQOA 1Z91A 3I54A 4JQFA 2H27A 1YS6A 2W57A 3F22A 2VBZA 5D4SA 5E17F 4JK1X 1A04A 1E2XA 2MA3A 5HLGA 2EB7A 4NQWA 4IXAA 3ZMTA 2GWRA 4M6XA 2EFOA 1XD7A 1UB9A 3WU0A 3WODF 2O3FA 4H0EA 1WKMA 4A5MA 4L9TA 4HF1A 2G7HA 1G4DA 2YX7A 4YFXF 2ISZA 3B02A 2E7XA 5HDKA 3ERED 4L0ZB 2W24A 2FF4A 1QPMA 4XLNF 1F4KA 3DFGA 4WCGA 4L9JA 1I6XA 3L7WA 2VT2A 4HA8A 2RDPA 2K27A 3WE2A 3R4KA 1LQ1A 3L09A 3QP5A 3RKYA 3SFZA 1MJ9A 1F1ZA 2XKPA 2VOPA 1U8RA 3F8BA 1U5TA 4XLPF 3KZZA 2XKOA 2P6SA 3ZMSA 1BIAA 2RNJA 4KICA 3HTUA 1W5SA 2YR2A 1UHWA 3WGHA 5JI6A 4OU0A 4CGZA 3E6CC 3WU1B 5LEKA 1DPUA 2EK5A 4YG2F 1FZPB 1EH6A 1QGPA 4BNCA 2PMUA 2ZMEB 2CGPA 5LHHA 3ZP5A 2DU9A 2VE8A 2LF8A 3OV8A 2MC3A 4ON0A 3IWFA 1HKQA 2L01A 1AOYA 2STTA 3TQNA 3F23A 3OOPA 1UHMA 4LFUA 1BC8C 5BPIA 5FGMA 3Q5FA 4XSZF 2O03A 2QQ9A 2YSRA 2QUFA 4Q4ZF 2JSCA 1FSHA 1PUEE 3V8JA 2AXLA 3TDUC 3JAMZ 3BJOA 2XV4S 5CVVA 5E20A 1IZ1A 3CDHA 5ICEA 4HW0A 1K78B 1U78A 3MCZA 3VOEA 3SXYA 3GWZA 1JHFA 5EEGA 3IWZA 3VODA 2QENA 3TGNA 2Z9OA 4P9FA 5CVJA 1B9MA 1P6RA 1FC3A 2XAGA 2OD5A 2ZJ2A 1SFUA 4OINF 2LDUA 2K4JA 2O0YA 4EV0A 1I5ZA 5L3EA 4ZYDA 5BQTA 4EJTA 4ESFA 1O3TA 2ADUA 4ENNA 4ZYHA 4IHTA 2VBXA 3FXRA 4U88A 5LRRA 4XSXF 3BOQA 3ELKA 1P92A 2PG4A 1RI7A 4KIBA 3TO9A 2HOEA 4AD9A 3IKTA 2FBIA 2HKOA 3R0AA 2ZBKA 4QWQA 4I7HA 2DO7A 1U3EM 4L0YB 2M1BA 5BS6A 2CW0F 2CFXA 2XAJA 2OU2A 5CVIA 3I71A 5LEJA 3LAPA 1XCBA 2GXBA 2V1XA 1HSTA 2Q2EA 3GEZA 2Y75A 3B73A 1XGNA 2QBYA 2VBWA 2ISYA 1OYIA 3M9AA 1TQMA 2OA4A 3Q9SA 5ERIA 3DXJF 5LGNA 5L3BA 2DBBA 3JSOA 2A61A 4PGHA 4MTEA 5DD4A 2XAQA 4I0BA 3N97A 2XRNA 2IW5A 1XSXA 5DD8A 1J7KA 2PFBA 5K5QA 2VONA 2ZKZA 5IT9Z 5DCFA 2RQPA 1FWZA 3R60A 3O2PE 4RS8A 3HIFA 1B1BA 1GXPA 3WG9A 4A0ZA 2LSOA 4L5IA 1IAWA 1HQCA 2A69F 5FLXK 2G9WA 1AWCA 2FOKA 1SMTA 1FYMA 2IPQX 3KEQA 1HXDA 2JT1A 1JE8A 1SD5A 2HS5A 2K4BA 4MQ9F 5E1XA 3FWEA 3E5QA 3K69A 3QU6A 4HX8A 4HLYA 2XASA 4YFKF 2X0LA 4ZZLA 1C0WA 3M8FA 1CF7B 2A5YB 1Y0UA 2VXZA 5BPDA 4Q5SF 2R7DA 4AWXB 1SD7A 3L00A 4A2UA 1EV7A 3LA2A 4EJUA 1E17A 4RGUA 1FYLA 4EJOA 2XROA 1BIBA 4BHCA 1J75A 1F9NA 4MNUA 1WI9A 5E8IA 1LEAA 4RAYA 4IRHA 4OMZA 3CUQC 3ZMVA 3ZMZA 4S05A 2L54A 1KYWA 2HTJA 4CYDA 2CG4A 4P55A 1OYWA 4CHUA 4OMYA 4WXCA 2MD5A 3TOBA 2IA1A 3MFKA 3I59B 5F64A 6PAXA 1L3LA 5H20A 5E18F 1HKTA 1FPQA 1FP1D 1KQ9A 4CXFA 4IF4A 2Q0OA 1G3TA 4IRIA 3IRRA 2Y0MA 4G7OF 1WRJA 5KVRA 5ICCA 3K9TA 2CYYA 2YX4A 2RN7A 1Z6TA 3ZMUA 4HOBA 3I64A 3T8TA 2MLGA 1Q1HA 4M72A 2Q8KA 1KQ0A 1HW1A 2W85A 1TBXA 1W5TA 1ZG3A 1YFHA 2OBPA 4ENMA 1WWXA 3BPXA 4M9SA 3KP7A 4AIJA 3MQ0A 2WC2A 3F6OA 1TTYA 2BYVE 4XRFA 1NHAA 4M74A 4A0YA 1YW7A 4PZJA 4HX7A 1J9IA 1OMIA 3L9FA 2GXGA 1OPCA 3F8CA 2VBYA 2HGCA 2E7WA 3GFJA 2FQ3A 4GO1A 3WTXC 2ZFWA 4WXDA 4BHPA 2EV6A 1DUXC 3BWGA 2EFNA 1XMKA 1KU2A 3RI4A 1XDSA 1CGPA 4KN4X 3FMQA 4M6YA 2FRHA 5E1WA 5D5VB 2H6CA 5ILUA 3O3KA 4KUMA 1VTNC 2KIMA 2GQQA 4BH9A 4HV6A 3RPQA 1S7AA 3M8EA 3G73A 1Z6RA
chains in the Genus database with same CATH superfamily
1YOVB 4R2AA 5BNGA 3LSKA 3M7GA 2WBMA 2QSGX 4WSPA 3TOAA 2VJJA 4IHVA 4K2EA 1QNTA 1A1GA 2LKXA 4NNJA 3HTSB 3RKWA 4DYCA 1FOXA 2D5VA 1WJCA 4ZZDA 2RGVA 2RREA 3IAM2 4GGGA 2HYFA 5GTHC 1VQOI 2QSFX 2UV1A 3BR6A 1VQNI 2MDGA 2RSMA 4I8OA 1ERDA 2BB8A 4PJNA 3KFWX 4BHBA 1K79A 2BY0A 2FBHA 1G2FC 1YX5A 1ZHFA 4MFEA 3EETA 4A5NA 1R71A 1BA5A 2OQRA 1YZ9A 4MHGA 2QQAA 4F7ZA 1ZYRF 2EPXA 1OR7A 2ZMEC 2E72A 2BXZA 4YIIA 5IT9K 4MEYF 2HZTA 3K70C 2CWEA 2NNNA 2XSJC 4NUBA 3ECHA 3Q0UA 4V19K 3C4BA 2V79A 2E1NA 2CQQA 3NRVA 3PQJA 3EUAA 2L4MA 3DKYA 2Z3YA 1G6NA 3BZ6A 1FBSA 1APLC 2V87A 2DGCA 1BI1A 4NZVA 3S16J 3HOWJ 2HYGD 3RZOJ 5GPAA 3IH4A 5HDNA 5EZHA 1I94E 4BKXA 3BIDA 4OOGC 5EGOA 3HOXJ 2DODA 4HTGA 1ORKA 3EUHA 1R23A 4RB3C 4RBOA 3SHFA 1EKEA 2Z2SB 4A6DA 2V1UA 2EPRA 5FD5A 2AO9A 2W4SA 2WA0A 4D5CA 2PRTA 2FBKA 3JRBA 2JQ7A 5JLXA 4XN3A 5K7FA 2KISA 2NUFA 1N78A 4UUTA 2VC0A 2YU8A 2V9VA 4DYRA 1GQEA 4HF0A 1QU6A 3H5AA 2JJ7A 3BPVA 1O3SA 1RMDA 1SANA 1SFEA 2VUMJ 1YW9A 2AHQA 3KYDB 3ML6A 1ETQA 1EH8A 1JTXA 2MKDA 3ESWB 4DGWB 5DEQA 1X5WA 4R2RA 2GA1A 4M9VC 1Z67A 2GZWA 1I1SA 2D45A 2R7OA 1MDMA 3RIRA 5K7ZA 3WTZA 3A03A 2VL8A 2CT1A 3IH2A 2NOJB 2RVCA 3FM5A 4ZDOA 2PBIA 4YIRX 1YTYA 4WF2A 4GEQB 4HRIA 3S2DJ 4D5FA 1R00A 4UHTA 2MG4A 4RAZA 5HLIA 1R36A 4Z2YA 2GXAA 2XGCA 1T98A 2RKHA 1HW2A 2V9PA 4IJDA 1BOBA 1W7PB 2I9IA 1W7PD 1D1BA 3OWTA 1D3YA 3SEQA 1PKPA 1PJRA 1VQMI 3S1NJ 4P7DA 1P7IA 4EMSA 2L8TA 2M0MA 2KQRA 2FUG2 3IWBA 4A6EA 1SFKA 1A1LA 3C7JA 2KDZA 1FOWA 2XHKA 1ZBTA 2EILH 1DQUA 1Y56A 2D1VA 2UXXA 3DBRB 1ETXA 2EMYA 5CJ9A 2YPRA 1S8NA 1A6QA 5FLXZ 3A2KA 1QQIA 3FMSA 1P4WA 2YSOA 3CC4I 1BBYA 3H0GJ 4JI1E 4UVAA 2HJJA 2EM5A 2F5FA 5J40A 3MKZA 1OCOH 4I98B 4BAYA 4KNYA 1U2WA 2PI0A 4Y4RA 4DUYE 3U1DA 1SVOA 3K4CA 4QPOA 1ZR9A 4HSRA 3F8NA 2IGOA 2ZM6E 3IUOA 4N9IA 1WI3A 3DWLE 5CYVA 4XLCA 2YTOA 2IS6A 3BQZA 4JP0A 5GTIC 3I0TA 1TZLA 4F92B 2JTVA 4XKCA 4A3EJ 1X49A 1HDPA 1MNDA 1JT6A 2NS0A 4HEA2 3U9GA 2K86A 3J80C 4UB8C 5DUIA 5DCMA 1FMVA 1QPIA 2CV1A 1MBEA 1TWFJ 2YTGA 1DGWY 2EINH 3K4JA 2LP0A 1JUPA 1Y1VJ 3VB2A 3PNVA 1FBQA 4R2PA 2VB6A 4XICA 3IWDA 2GA2A 2I10A 2CV2A 4XKWA 1H89C 1BW6A 2JA7J 3GTGJ 2FTXB 2WAFA 4WWCA 4HDUA 1TW3A 2E2IJ 4AM3A 3DBLB 4KDPA 4BQQA 2EQ0A 3O6BB 4BL0B 2W25A 2EPZA 2EOEA 3LQRA 4ZTFA 2WZOA 1ON1A 3HXLA 2DFIA 2QKLB 4CCOA 1GXQA 2ZCWA 2VJIA 1JXSA 2JY9A 4PFOA 4O6JA 4NQWB 3J7ZI 2O5RA 4OOIA 4RLFA 3FK6A 5HOOA 1FIAA 5J47A 1YRNB 1FTZA 1XNRE 4JX6A 2Y0SA 3WGIA 2FX0A 2RS6A 5TSEA 1SD6A 4DV4E 1XGMA 3ZN0A 4EM1A 4DV7E 2NUGA 1RETA 3CDIA 2MBFA 1TWCJ 3CP2A 2M5WA 4CDGA 5HVQC 3C3WA 2H1LA 3RCOA 1KQ8A 3EPZA 3SYTA 4P1WA 3LQQA 3HPZA 2VXDA 3F8MA 3QU3A 3V8KA 4DR7E 2CMPA 2CU7A 3LSMA 2E35A 5D6FA 3V8LA 2ELYA 4EEFG 3DU5A 1ZREA 3FXUA 2ZXIA 4FISA 2O6GE 2ODRD 3MEXA 2V1DA 4DMIA 3HOVJ 4XKBA 3QOEA 4MLVA 3E6BA 5F0CA 5ILSA 1YQAA 3GTPJ 4N4RB 5AC4A 3H0DA 1B6AA 3K0LA 3BDDA 2HDCA 2OZUA 3K4LA 2QA4I 3ABLH 1RR7A 3ABTA 4B47A 2HC5A 1G2HA 3SJMA 3MHSC 3AL0B 1IBME 3H5NA 4IHYA 1R4MB 2XAHA 3CF2A 3LA7A 2Z5UA 5J8CA 1MDMB 4KA4A 3CMYA 2GIVA 4UY8I 4B48A 4BYYA 3VHTB 3JR9A 1F43A 1UBDC 3CLOA 2ZSIB 4UNOA 3DV8A 2MLKA 2PQ8A 4X6AJ 2WCC3 5FKOA 4HX4A 5LL6R 4NXME 1R22A 1YYWA 2XGXA 2DK5A 2WB1N 2WBUA 2DK8A 2H6BA 2X85A 3EUKL 2H09A 4F55A 3JSPA 4R8HA 3KP2A 1SD4A 2BBYA 5HLHA 3FBNB 1V5EA 2E34A 2EQRA 1B9NA 3H9QA 3VFZA 5IYBJ 3F0CA 2M1SA 4P78A 1YW8A 2LTRA 3MZ8A 1SAXA 3MHHC 1FEXA 1N33E 1I1GA 5AASA 2F48A 3QRFF 2GHFA 4OX9E 5LGTA 3UNGC 3ZQQA 1ENHA 3HRMA 2DA4A 1T33A 4QPQA 2DA5A 1SAUA 4HLXA 1MH4A 4RH8A 2DXIA 2EV5A 4Q48A 2K4VA 5BR8E 5A2QK 1FMWA 2CRGA 4II2A 1U5TB 1IUFA 2JMWA 3HOUJ 5IY5H 2M4GA 3IL2A 4Q35B 3DPLC 5L3CA 2V83A 1UHSA 1TT5B 2Y9YA 3GX4X 1TWAJ 4G7ZF 1ZARA 4WXHA 4FK5C 2EMXA 1WFXA 4DV1E 3FXJA 3MZYA 3HOTA 4KIGA 3BP8A 1U9OA 2ZB9A 4DOZA 3CTAA 2DIXA 2CQXA 3P9CA 2QLZA 2DPDA 4DNCA 2X6YA 2V26A 3OYIA 4RGRA 4A0XA 2RNGA 3QOPA 3BY6A 2OCCH 4B8XA 4KMFA 1LPQA 1V5FA 5DDGA 3I5UA 2QZ8A 2IS2A 4F6NA 1A1HA 4LF4E 1A36A 5K1YA 4KZSA 4ZC3A 2OTLI 4A69C 3CMMA 1R5HA 4KT6A 2EMLA 2GOXB 4CZZA 4Y13A 1V5GA 4OIQF 4A3DJ 3J81Z 5A6BD 3SZGA 5A6JA 1EF4A 1MBGA 1EH7A 2X6XA 4B3SE 4CCJA 1ITYA 1BI3A 1RIOH 1EKZA 1X19A 3QPLA 2F4OB 4A3BJ 2VRDA 3VYXA 3AFHA 3OYCA 2HFHA 1AA7A 2O8XA 3FZVA 4P5OA 3SZPA 2XPVA 1B4AA 1TC3C 5EG0B 3HRTA 3GTQJ 2JYAA 3GFIA 5E3MA 3CC7I 2BGCA 2IRFG 5KL7A 2E19A 4EGZA 2NA2A 1MIJA 5DM6F 2HQNA 4KMUX 1WSUA 2LKSA 4FT8A 2XC7A 1HBXG 3F6HA 4GZNC 2ZNZA 3QYFA 1PDAA 2RTXA 4BXXJ 2NVYJ 3QG5C 2JPBA 4W1UA 4PJLA 2QWWA 1TQIA 2DTRA 4H4KC 5LLQA 2CUFA 3REOA 5EDNA 1J59A 2BEOA 5JR3A 1T4NA 2HXOA 1Z0XA 3KX2A 4O5VA 4E70A 2BW3A 1WHNA 1MSFC 2J5OA 2F4MB 2WV1A 5F1RA 2YU3A 1NK3P 5LRSA 2VT3A 4NHJA 3LMLA 3GFLA 3FXOA 3KYCB 2IAIA 1MBHA 1UG0A 3JRDA 2DMUA 4AIDA 1IRGA 2QM3A 4QSHA 2EMBA 3A01A 3K4MA 3UK3C 4KFCA 1N75A 2W1OA 3TP0A 3K4NA 3KE2A 1DI2A 4O4KA 2WB1A 3F8FA 3TDZC 1LNWA 2KHXA 4M6VA 4I01A 1M1EB 1JHHA 4G7HF 2HTSA 2K3FA 5E3OA 1BBOA 1YYKA 2BE5F 1YUJA 5KK1A 3JRHA 3D0SA 4IO9F 1X3CA 2ESNA 2LF7A 1IV6A 2VN2A 4CCMA 3ABKH 3BR1A 4LK0F 3CO7C 2EM3A 2VQEE 2F5CA 1PJTA 1XGSA 2K85A 5DUKA 1TNSA 3ECRA 3GTOJ 2KP6A 4J01A 2KKOA 1XCVA 2OZ6A 4CA0A 2LE2A 1T08B 4GXOA 3KETA 1HLVA 2HVRA 3OOUA 2CSOA 1E0EA 1O7FA 2C6YA 3W6JB 2EE8A 1KU3A 3KCCA 4N9HA 1J09A 4LD5A 4Y7NJ 2JSPA 4XIDA 4E7HA 2QQ8A 2TRTA 2LT7A 2K02A 4EM2A 2M4KA 2F4VE 2EOSA 1FJLA 4BJTA 4L5EA 3MKLA 1ETWA 1K7AA 3VSLA 2DLQA 3BGHA 3A1YA 2YU9J 5AIQA 2DA2A 2Y31A 1G59A 4K0KE 2EL5A 1HSJA 1DU0A 2FU4A 4XRMA 1X6HA 1HW5A 3S1MJ 3BJAA 2LOOA 2A6EF 3L2UA 3VYRB 1ZG1A 3DPTA 4OIPF 4XLHA 4JX4A 5BOXA 3D5LA 1XMXA 3WTVC 3AKZA 4DV0E 5M3MJ 3I4PA 5IPAA 3N4MA 3WHCA 2EIJH 2NXNB 1STUA 2L7FP 2VODA 2DMNA 1UHZA 1XTAA 5EJCA 4B09A 2R93J 4IJAA 3U21A 4LB6B 4A3JJ 4L5JA 1YIJI 5T6JA 2X4HA 4IQJA 4E7JA 1SMYF 1X3ZB 2Z99A 4I02A 2F4IA 4LB5A 2VKVA 3LSPA 3LLHA 1X3UA 1QA6A 4WYQB 1O57A 4CO8A 2XB5A 5KCMA 1QZYA 3W6KB 2YTPA 1XSDA 2DYSH 2EPAA 2GAUA 3LAJA 4BE1A 1T6SA 3N05A 2Q2EB 2V6EA 4LF9E 1LE8A 3F6VA 3SZTA 1X4PA 5LFAA 3IC7A 2L02A 3DCFA 1S6LA 4D0PA 2QBYB 3JAMC 4DR5E 4HYEA 2UUZA 4CH7A 2PJPA 2A6HF 3HRSA 2ENAA 1ZRCA 2CUZA 3W2VA 2EA4A 3CUQA 1NG7A 1D8JA 2EOOA 3DTEA 2EMCA 1E3PA 4C9YA 2TCTA 2YS9A 2MW8A 5L3GA 1E3OC 2CTDA 1BL0A 2IBDA 2FA5A 2Y69H 4GCVA 5KL5A 3B6CA 4RB0A 3JU0A 4EJVA 2YTIA 1ETVA 2M9HA 4BDYA 4ENKA 2PX9A 2G7UA 1UZCA 2KRCA 2UZKA 3Q0WA 3ULQB 1BOAA 1DDNA 1IXCA 3FF5A 2JVGA 1Z3XA 1DPRA 4DW6A 2Y2ZA 5DNYA 1Z1DA 2W00A 1ZGJA 3OSFA 3EQLF 3Q9VA 1SC7A 2MC6A 4ASNA 2E71A 5D5XB 4LIVA 5LBQA 2ACJA 2LCEA 1R1UA 3WE3A 1U0JA 4I0AA 4F93B 1MMNA 3GLXA 3GTKJ 5AE1A 3OYBA 3DQVC 1D8KA 1RUOA 3HQ1A 2B9DA 1T4OA 3ZQIA 4RGSA 1T0FC 4Y17A 3U1KA 3OYLA 1FOYA 4AIKA 5LGUA 4I6ZA 2L2KB 1FT9A 2HNHA 4O3MA 2VPRA 3BTCA 3FKIJ 4LITA 4WX9A 5HODA 3JRGA 1FYKA 1O3RA 4F9CB 1RC7A 1WJPA 2K7IA 2AQFA 3U2RA 5DYMA 2VLAA 4ZYEA 1TF6A 5EF6A 4JI0E 4L18B 3LOCA 3SEZA 3ROUA 4FX4A 4IHWA 1X6EA 5FO5A 4UUSB 1MNEA 2FNAA 2PEXA 3M1CA 4HQEA 2ETHA 3ZN1A 5KAFC 5D5UB 1PP8F 1UMQA 1ZH5A 3GF2A 1BJZA 1S7EA 1X1DA 2L6MA 4CYCB 3C2BA 2W48A 2EIKH 4ESBA 2GPIA 2FXAA 1H8AC 2EZHA 2ZXHA 2QVOA 2CJJA 3FXLA 1YYVA 4XM3A 2O61A 3S2WA 4U87A 1VFCA 2Y48A 3CDLA 3JCUC 4XKVA 1JTYA 2EOYA 1YJ9I 2NRAC 3DKWA 5B1BH 2QGUA 2XAFA 3I53A 1XC5A 3HGGA 3OIPA 5AC5A 4BQAA 2LRSA 2B9SA 2R1FA 3AG3H 4EQQA 1ZGAA 1H9TA 2EPUA 5E3LA 3CP8A 2EOIA 1GDTA 2KJBA 2DCEA 4A3IJ 2KDOA 2HQAA 2R5ZA 5L3FA 1XN7A 1KA8A 2K9LA 4JI6E 4RGXA 1S5LC 1MGTA 2EA2A 2DLLA 4BDZA 3F3XA 3K7AJ 3MWMA 3E0JB 2M8EA 4B1RA 2MH2A 4HDVA 3J81K 2NAZA 4KN7X 1X1CA 4XOTA 3GZ5A 3BZKA 4DR4E 4MFDA 5J8FA 4O24A 1B59A 1HR0E 3HSEA 1YX3A 4EVIA 4EM0B 2OUMA 2IEKA 3MKWB 2P5KA 5GAGJ 2DW4A 3F72A 2DT5A 1LDJA 3ZRGA 1YI2I 2KIQA 4EJWA 1D0ZA 3NWTA 5A2QZ 2MDRA 2PN6A 1K4SA 2E60A 4R79A 4P9UA 2M45A 1IDYA 1S29A 2EWNA 2LY9A 1PP7U 1MKMA 1W0UA 3PJRA 5J6XA 1A1FA 1TNTA 4EATA 1MD0A 2R7RA 1J5EE 3K1PA 3KLNA 2EL6A 1QVUA 2QKMB 1FIPA 1FY7A 1UFMA 3MMYB 3SDBA 3E6DA 2LK2A 1O0WA 3KEYA 4B43A 1N25A 2K7LA 3JW4A 3V4GA 2YPNA 3P7NA 5IOYA 1HF0A 1E3HA 1T2KA 2CQKA 3H3UA 1IG7A 1HOMA 2F2EA 4MGRA 3PQKA 2TDXA 2DA1A 3S8PA 3WGGA 2YTQA 2KIUA 3EPHA 2JK3A 2L3CA 2HOTA 1TF3A 1JK2A 1OQYA 2VQLA 1JJ6C 2LO3A 1VF9A 4KYWA 3C6KA 1ETYA 1P4XA 2LRDA 2M8GX 2NS8A 3KEOA 2EQ1A 1Y8QB 4CSWA 2ZMEA 2CO5A 2HEOA 3P5JA 4HZFA 2N8XA 4M9ZA 1R9TJ 1XDUA 2QYOA 1L0OC 5H6RA 2ESHA 1ODDA 2R4GA 4ESJA 2ZXWH 1D0YA 1Z1BA 2ID3A 4FETA 5D4RA 1AAYA 2P0WA 4DBQA 3FX3A 4ZH4F 4PJJA 4E7IA 5E79C 4XONA 5EZGA 3HSFA 3W3CA 3OY9A 1QU3A 4U0YA 1YS7A 4TUGA 5JLWA 4RB1A 3HTXA 2QQBA 4ENJA 1JKQC 1AKHA 4II3A 2WY7Q 4ZDPA 4L8NA 2ZJPF 3EPLA 3CCMI 4I2OA 2ZSHB 2Y0SN 3WG7H 2HI3A 4XNFA 2LVSA 5F0FA 1IUYA 2WAQA 2JZYA 1P9QC 2LBSB 1KU9A 1SFXA 3FHZA 4X9JA 2E2JJ 5ED4A 1VNDA 3ZPLA 2JOXA 3ZQ7A 4F52A 2ZJQF 4B3RE 5DV5A 4BEHA 3CF5F 3MAJA 1NCSA 3BG6A 2XGDA 4ABZA 4JBAA 2EN4A 2ODRC 2VE7C 4M3GA 2LTPA 1JJ8C 1BI2A 4F9AB 4JYAE 3HHHA 5A6AA 4XR6A 4BXUA 2ELHA 2X48A 4FTHA 5FKKA 3C1DA 2QSHX 2D2WA 2RV8A 4M3FA 3OYMA 2RSIA 1XB4A 2YSPA 2VE9A 2E1MB 3IKVA 4YIFA 3CJNA 3AL0C 2EP3A 4I99C 1GHCA 3GO5A 1QBJA 1R7JA 5TJJA 2YRMA 3ADGA 5B66C 2PJRA 5IWAE 2FE3A 1G3YA 1R49A 1USSA 2P7VB 1K78A 3H09A 2OC6A 5ICGA 5CPRB 3H3ZA 4E4HA 5E3NA 2HOAA 1JKRC 1A1IA 1LVAA 5TISC 4LLLA 3KZYA 2CUEA 2YZTA 2FJ1A 3HYIA 1W4MA 3AG4H 4PDKA 4HF2A 3TP3A 2EOQA 4XK4A 2R5YA 2IGNA 2FMYA 1RZ4A 2KT0A 1OFCX 3L2CA 3JTGA 2M87A 4OWRB 1WQ2A 4G94A 1YJNI 3I58A 4BE0A 2DA7A 1QZZA 3D5SC 3K2AA 2DFHA 3SQNA 4BBRJ 2GOMA 5LHIA 2JPAA 3HL2A 3S1RJ 2W82A 3S17J 2GLIA 4M73A 4R2EA 5GAHJ 2FNPA 2VQHA 4NB5A 4M2ZA 2L33A 1OKRA 2DAOA 1V55H 2F5DA 5LMUE 3JTZA 4KIFA 1QZEA 5CVUA 3T1BA 1U5TC 1VQ9I 1JGSA 3RYRA 4X62E 2L4AA 2V9KA 3BG9A 1FTTA 3HHGA 3ABMH 3BG3A 4RDUA 1RRJA 2EPLX 1IN6A 3G4SI 3H3VK 3OR1C 3RJPA 4S04A 5KL2A 1G8XA 1XGOA 3OMLA 2X1EA 3L2VA 3CQZJ 2LTSA 1OYYA 4R03A 4NC7A 2BY2A 4AIHA 2R7VA 4IS1C 2IA0A 3IH3A 2IT0A 1WVRA 2LKPA 2NNYA 1QO0D 1B69A 2YUSA 1WH7A 3WTYC 2VC1A 1VQKI 5E1ZB 3A0HC 1MJAA 2B7EA 2ELKA 1K6YA 3ISPA 2J5PA 3NWSA 1F5TA 1X3WB 3GVAA 4E6KG 4L5NC 4U7DA 3L1PA 2L9VA 3BLYA 3RQIA 3E5UA 5F08A 1IRFA 1Y39A 2O8KA 3VYUB 2F8BA 1ZR2A 1O7LA 3QAHA 2DYRH 1SEUA 2M9AA 3KP3A 2V85A 2BV6A 2XPUA 2EPMX 3KWRA 2DB2A 1EJ9A 1IN7A 1O3QA 2P4WA 1N34E 2V7FA 2E36A 2EM2A 4DV2E 2MGQA 1QVTA 2IS1A 5IYDJ 2V89A 2I5UA 1P47A 2LC2A 3AV0A 3MKYB 3M3YJ 3GZNB 4IVNA 5F3WA 3OS2A 3HJEA 3QYBA 1WGXA 1VQ4I 2OF7A 2XPWA 4XMYA 2EM4A 3EPJA 1JUMA 1IJWC 5IT3A 2CW7A 2R7FA 4Q47A 2IA2A 3T0YA 5HS7A 4XL9A 2XF5A 5EGOB 3CCYA 4PFPA 4MTDA 4ZYGA 1GV5A 2EJRA 3J80K 3V7SA 4YFNF 2EFQA 3DEWA 2YWQA 1NG6A 3BR5A 3WTUC 4XBFA 4JI4E 1WPKA 2LNBA 2NVXJ 1FKAE 4LFAE 3WTSC 1UN6B 4HBLA 4HAMA 2CFOA 2COMA 3CC2I 1TN9A 2DSYA 3K1MA 1CQTA 1KZHA 3I55I 3M99B 1BN5A 4HV5A 4PUSA 3HEFA 2MSYA 1WXRA 3P9KA 1L4SA 1DU6A 4UUVA 1KONA 3LA3A 3LFKA 4GYGA 3VYSB 2KJCA 5JVGF 2XB0X 3TMOA 3BCAA 3C18A 2P81A 3L2RA 2MH9A 3OYHA 1D0XA 3WU2C 1FNNA 2L9NA 1MMSA 4S0HB 4J19A 2M0CA 1BBGA 2JP9A 4LMYA 4DZPA 2XVCA 2DLKA 1X2NA 1P7JA 1DP7P 1OISA 3WTWC 4B4CA 2YT4A 2BHYA 2EMWA 4RB2C 1B72A 3ASOH 1KGSA 1V4RA 1ON2A 2YTFA 2CUJA 1HKSA 4ZJZA 3ZMDA 2ME0A 2STWA 1RNLA 3DF8A 5FB2A 4AU7A 1KYZA 4BE2A 2BY3A 3DEUA 5HNHA 1HNWE 3HM5A 4OAYA 5HNFA 4XQFA 3CMAI 4MEXF 2LUPB 2PMHA 1R58A 1B8IA 1ONVA 1I50J 1LFPA 2B0LA 2BHZA 1F2IG 3JREA 2R5YB 2MABA 2DMPA 4P96A 2IVMA 2EBIA 1W0TA 2WY8Q 4C2UA 1ZLJA 3VWBA 4HNUA 5ILVA 3M4OJ 3KP5A 1AU7A 4JX5A 1HC8A 5EEHA 3GFMA 3HUGA 1H0MA 1XMAA 3HOZJ 2R3SA 5LD2C 3A0BC 2HZDA 1WCMJ 3TKYA 4DR6E 1IC8A 3K2ZA 2KL4A 1OCCH 3JTHA 5F27A 3CCSI 3MSWA 3GZ6A 3G71I 2EQ3A 5FKMA 3VPRA 1Q1VA 2RC4A 1IXSB 5FRNA 2EMIA 2DA3A 4KT5C 3I9V2 1T38A 3R0JA 3LWFA 1ZBQA 2VKDA 5AE2A 1XSVA 2BVLA 2BXYA 1MZBA 5F6FA 1S7OA 3GMEA 1IN5A 2EM6A 4LJZF 4KISA 3LSRA 1CF7A 5M5WJ 5DCMB 1UAAA 4LF7E 5K5RA 4IL6C 2MFZA 2PLYA 3S2HJ 2YTJA 4EGYA 1YYOA 3FXQA 5K5OA 2L2NA 3ADJA 4GYIA 3HG9A 3OL3A 2LVHA 2IJLA 5D8KB 2HWVA 4FCYA 3LSTA 4MQVA 2DQLA 3NEUA 4BJ6C 2D9HA 4BU2A 2OCEA 4MIMA 1KYQA 2P8TA 1IF1A 5J1YA 1BM9A 1H9GA 2RQQA 3M1EA 5FFZA 4R1HA 1IN4A 5EEAA 1D5VA 4G6DA 4A93J 2OJED 1ZG5A 2LMZA 2IGKA 1O4XA 4FE4A 2FD5A 4BC9A 4DR3E 5BMZA 2ECBA 2HR3A 4UB6C 3TO6A 4LGWA 1FX7A 3OMYA 4V2GA 1BB8A 4DUZE 1IQOA 4Q28A 4R2SA 3VEPA 2COBA 2I8DA 3EQ1A 2ME6A 1LLMC 1IBKE 4IHSA 1AH5A 1X47A 4LLGF 1RQ0A 3RKXA 2KMUA 2A25A 3T1YE 5D5WB 3K10A 1VQ8I 5KL3A 3E97A 3BTJA 5FKLA 2R7SA 1TQPA 2A68F 3V7RA 3I59A 4LK1F 1YG2A 2Y30A 1Z05A 3DP7A 4A3MJ 1K4TA 1GT0C 3AG1H 5HS8A 5FLXC 2P5VA 1W36D 1TT0A 2G0EA 1TL8A 1PJQA 1F36A 4U0WA 1TWHJ 2LY2A 2EOXA 2YTEA 2X9DA 1IN8A 3FBIB 1J5YA 4BXFA 2LBFA 3O8HA 3G6EI 1RUNA 4NC8A 4RM2A 4JYKA 3QPHA 3KP6A 4LG0A 3S1QJ 2KHMA 2EN3A 2OQGA 1J0RA 5IP9J 3ONQA 5LHGA 4JI8E 3CCUI 2KRHA 4CCLA 3MD2A 2LFBA 2QEXI 1VZ0A 2WV0A 3K1NA 2JWTA 5F04A 1HCRA 2ZJRF 2EN2A 3CCQI 2P6TA 1V54H 2K40A 2KZGA 4UVBA 4ETSA 2EPOA 3J7AY 3RYPA 4U7BA 2P5LC 4LTYA 2E1CA 4YRVA 5E8GA 3E3VA 4WPYA 2DDBA 5CQGA 2EFWA 2EMFA 1ULYA 1UILA 1Y8RB 2IXSA 1Y1WJ 2A3SA 2L7MP 2DI3A 5D6EA 1KU7A 4YY3E 3PFIA 1B8IB 3GXOA 1MEYC 1IXRC 3FHNA 4Y3OA 2XSDC 1IRZA 1T39A 3CO6C 1I6HJ 5L3DA 4KJZA 2FSWA 2EOFA 3EYYA 5B3SH 3RPUA 3P9IA 3CCEI 3TO7A 1ETOA 3G2BA 1IBLE 3QQAA 5CLSA 1OCRH 5TRDA 1YO5C 2L7ZA 3FMRA 3HUGB 3COAC 3HPHA 3S15J 2VPLA 4G6QA 2DFEA 2EM8A 1JKOC 1UCRA 3MZHA 5F0HA 3ZQHA 2XF6A 3FM3A 5ICFA 5KL6A 1LDKB 2EPFA 4M3DA 4OIRF 3T8RA 4IRGA 4KITB 4PCQA 3DEEA 3G1OA 3KLOA 3OL4A 3QPTA 2ENHA 2VKHA 2B7VA 5IYCJ 3PIPF 2X51A 2P7CB 4R2DA 4FHTA 1IW7F 4GRIA 1A1JA 3LFUA 4XLEA 2WWYA 2HQRA 1U9NA 2KOUA 3Q0VA 1ZAAC 1N77A 1VQ6I 3CUOA 4CCNA 2IP2A 5JFRA 1YHQI 4CICA 2JPCA 1TW2A 9ANTA 4LF6E 2KONA 5FD6A 1Z77A 4B3AA 2VI6A 3R61A 1BJAA 1FOKA 2W84A 4HQMA 1PVEA 1I39A 3HBLA 1J2XA 1BI0A 3IRQA 1S3JA 5J3LA 3FISA 4NDLA 4UVCA 1X4OA 1BC7C 3DLLF 3R6SA 1RPWA 2BZTA 2IS4A 5JVTA 1T56A 3T5XA 1SFOJ 1ZQ3P 3RTRA 2UWMA 1LB2A 1G3WA 4G9YA 2NYXA 4LLNA 5J4YA 2WBTA 1XS9A 3PUFA 2WADA 4A12A 3QPSA 2EV0A 5CVRA 2MYSA 4PGGA 2EWLA 4AUXA 4BJ5C 3CCLI 3GUDA 1FSEA 5HDGA 4N4NB 4B3ME 2EOMA 1WJEA 3J7AO 2DQRA 4QTRA 1LJ9A 4BQNA 2HKXA 3IHUA 4Y15A 2XIGA 1R1TA 1D5YA 5CFFE 3RMPA 4IHXA 3EPKA 1D1AA 4C3JJ 1YSAC 3HOSA 3A4CA 2BW3B 1U6GA 2H1KA 3GYHX 3OYAA 4IPAA 4B3XA 2YTDA 2DPUA 5JHUA 2LR8A 2JRTA 2X6WA 2UU9E 1X2MA 2FV4B 3WTTC 4BUPA 2V6CA 5J1UA 2Q1ZB 1LDDA 3PO3J 2JWOA 4LOCA 1VQPI 3ABUA 2DT7B 1LKXA 5AONA 2KIFA 3JAMK 2FGGA 3A01B 4CCKA 2XUBA 4RHBB 2QCOA 1K6OA 2L3DA 4XOPA 1DQ3A 2EZIA 2EZKA 2GM4A 4LG0B 1YLFA 1R1VA 4DV6E 4U0VA 1G3SA 4BY1J 4R2QA 1T0FA 3TL4X 1ZELA 4F54A 3GW2A 3PNYA 4D1QA 1P2FA 2A07F 4F91B 4NHRA 2XDVA 2YU5A 3J80Z 1EA3A 3AG2H 4HPQA 1ACIA 2VOOA 1V3FA 2A05A 2HYJA 2ZO4A 3QP6A 4G8XA 5KHDA 2LH9A 2LMDA 2M34A 3FIGA 2H94A 2ECCA 2ZNYA 1GTKA 1YPNA 2HPMA 3BROA 1SR9A 1YIOA 3QODA 2AS5F 2EFPA 1FBUA 4IQ4A 5CQEA 2OAZA 2WAQN 1DP3A 3DJWA 4M71A 4OIOF 5FKNA 4X8WA 3ZOQB 4TV7A 1REPC 1A35A 1JGGA 3F21A 1Z9CA 4RAFA 3OYJA 1STZA 2JRMA 4PJMA 1PDNC 1GVJA 1MJBA 3KIOA 3ZR8X 2NVTJ 2EN1A 3VYYA 2LYCA 1P4AA 2ELJA 5M5YJ 2YTNA 1GZ6A 2HHHE 1Z7UA 1BR4A 4MLOA 3J81C 3VSKA 3V42A 4JI3E 4BQOA 1NK2P 4QLCU 3E6MA 1ZRFA 4N0BA 2E1MC 1USTA 3C6MA 2UXNA 2DN0A 4UV8A 2FOWA 3HKZA 3AAFA 4I09A 4X0GA 2R7XA 5GADJ 3P1XA 3EDPA 2M30A 4DBRA 1FP2A 5FFXA 1LEBA 3V7CA 3G1MA 3ECOA 4Z6YA 3E7LA 3OR2C 1OJLA 1OCZH 1W7PA 4L9VA 4LF5E 3G3ZA 5IV8B 2GIZA 3BJ6A 4UXNA 4FX0A 3H5RA 4BC7A 3OYFA 3VK6A 3CZ6A 3OS0A 3CD6I 3KP4A 4WK8F 4PSXA 2CSHA 3BC8A 5AIPA 3RDIA 4LG3A 3GBGA 1A1KA 1LE8B 1ZRDA 3CJQB 2A6TA 5IT9C 2UUCE 4YHHE 2F5EA 3D1NI 1R5GA 4C2TA 4L9NA 3BT9A 4BY7J 5D8LB 4IX7A 4CUGA 3H92A 3PIOF 4W97A 3CUQB 4D7NA 3HSRA 4A3FJ 3IWCA 3TBIA 4BGDA 1ZLKA 2EMGA 3OYEA 2FEZA 2D1HA 1WJFA 3K4KA 5M3FJ 1VQ5I 2L3JA 4DQ2A 2Z33A 4WSGA 3HRUA 5IOZA 2VQCA 1RESA 3J7AG 1I27A 5FRMA 2O9LA 2ENCA 5IP7J 4KHPE 2E2HJ 4AVPA 3ASNH 1ZN2A 1TLHB 1MBJA 1GUUA 2DMTA 4UV9A 2WTEA 3OIQA 5H6QA 2KRFA 5HS9A 2CV0A 1FLIA 3CJRB 3Q3SA 1SVMA 2ZXJA 3E5XA 2CQ7A 4M9XA 1IDZA 2JUGA 4ANJA 2ICWG 1OR7C 1JKPC 1ZAOA 1OCTC 2FMLA 3NQOA 1Z91A 1IRXA 2M2EA 2ZC2A 3I54A 4JQFA 2EPKX 2MKNA 2H27A 4R2CA 2NOGA 2XAUA 3CMEI 1YS6A 3BQYA 2W57A 3F22A 2VBZA 3S3MA 2UUBE 5D4SA 5E17F 4J8ZA 4JI2E 2F5VA 4JK1X 2N3GA 1J26A 5KAIC 1A04A 1E2XA 2MA3A 3NAUA 3ZOBA 4QIWN 5HLGA 2H8RA 4IZZA 2EB7A 4NQWA 4E7KA 5C4XJ 4IXAA 2R0QC 3ZMTA 2GWRA 4M6XA 4ZYAA 2EFOA 4CZCA 3EUHC 1YRNA 1XD7A 3QWLA 1UB9A 4G6TB 3WU0A 4E7LA 2V8QB 4RM3A 3WODF 2O3FA 4XRSG 2R76A 4H0EA 3FIWA 3S14J 1WKMA 3BR2A 3C2HA 4A5MA 2JVAA 4L9TA 4IOAF 2CH0A 1Y0NA 4ZTJA 1X1AA 4HF1A 2R7TA 3THNA 1MBFA 2G7HA 1LUJB 2WBSA 4NXNE 3MN2A 3UR3C 1NH3A 2CPNA 1G4DA 2YX7A 2MD0A 5J4VA 2KFDA 3OYNA 4YFXF 2ISZA 1Z21A 3B02A 2E7XA 4MO7A 5HDKA 3ADLA 5GPCA 1MSEC 1A31A 2R7ZJ 5EYRA 3DTIA 3LNQA 3ERED 4L0ZB 1IO2A 2EJ4A 3PM1A 2W24A 2V4JC 2FF4A 4FE7A 3ADIA 1XNQE 1QPMA 4A3LJ 3BTIA 4XLNF 3GCMA 2LY1A 2EMAA 1ZU1A 1F4KA 2R5ZB 3DFGA 3HGYA 4L9JA 4WCGA 1I6XA 1WJBA 3L7WA 3CCRI 2VT2A 3CJTB 2J7JA 2IHR1 2VJ4A 4HA8A 2L9RA 1RC9A 2RDPA 4ITVA 5K7HA 4NBQA 4AYBN 2K27A 3WE2A 3R4KA 1LQ1A 1MMGA 1W5CC 4M3BA 3I4MJ 4M3EA 3DKXA 2L2OA 3L09A 1X1PA 1G2DC 1FJGE 3QP5A 2M4IA 3J7Yp 3RKYA 3SFZA 1MJ9A 1F1ZA 2EMHA 2XKPA 2VOPA 3SDGA 3IP4B 2DFFA 1U8RA 3F8BA 2WAEA 4O43A 3CCJI 4F3QA 2BBGA 3FXKA 2DOFA 1U5TA 5DTDA 1VQ7I 4XLPF 3KZZA 4J00A 5DM7F 4LIUA 3C4TA 2XKOA 1WHUA 1YUIA 3TW6A 2P6SA 3ZMSA 5KNLA 3W2WA 1BIAA 2RNJA 3L2WA 1OCPA 2NS7A 3O8GA 5KL4A 4KICA 2HU9A 4KWYA 3BG7A 3HTUA 4LFBE 1GV2A 1W5SA 2YR2A 1UHWA 3E1SA 3WGHA 5JI6A 2L9SA 4DIQA 2N8GA 4OU0A 5GAEJ 5HLTA 1QHGA 2JN6A 3E6CC 3S3NA 4CGZA 3AUZA 3BG5A 3WU1B 4LFCE 2LV2A 5DS9A 5LEKA 1DPUA 4MLQA 3HDDA 2EK5A 2LLKA 1HNZE 4YG2F 4RAGA 2DMQA 1FZPB 1EH6A 1JI8A 1QGPA 4BNCA 2PMUA 2ZMEB 2EORA 2H36X 2CS3A 3HPGA 2EPCA 2E1OA 3K70D 1WHQA 2EL4A 4X64E 2CGPA 3GLLA 3DTKA 5A6BA 5LHHA 2DMYA 3L2QA 3ZP5A 2DU9A 1X48A 2VE8A 4O5GA 2LF8A 3OV8A 2DMIA 3H1CA 5LMNE 2MC3A 4ON0A 3IV5A 3IWFA 1LFUP 2EN6A 3LSHA 1HKQA 2L01A 4PK4A 4YELA 2FQ4A 1AKHB 5EG0A 2X1DA 1AOYA 2STTA 3TQNA 3F23A 5FROA 3PL8A 1MMDA 1JUSA 3OOPA 4C30A 2EN7A 1UHMA 3SFIA 2B63J 1U8BA 2LG4A 2RQLA 4LFUA 1BC8C 2K9QA 5BPIA 1BR2A 5FGMA 3Q5FA 4XSZF 2O03A 2QQ9A 2NVQJ 3ZCOA 5FLMJ 4BEHB 2YSRA 4RLQA 1N32E 2QUFA 1OLTA 4Q4ZF 2OV7A 3K6QA 4RMNA 1W36C 3W2AA 2JSCA 3NARA 1FSHA 1PUEE 4GDFA 3V8JA 5TGTA 1HDDC 2AXLA 3PNTA 3GTMJ 3S93A 4F9BB 3ZQCA 3THOB 4F6MA 1T4LB 1UELB 3TDUC 3ZGKA 3OYDA 1ZTRA 3JAMZ 3D5RC 4M0VA 2JA8J 3BJOA 2XV4S 3W6VA 5B1AH 3X2QH 1ZGWA 5A2QC 2LUQA 3HOYJ 3F6GA 5CVVA 5E20A 3OIOA 1IZ1A 3CDHA 3KZIC 2HXIA 2PJRB 5ICEA 4HW0A 1K78B 1WJDA 5FLVA 1U78A 4LF8E 4PSWA 3MCZA 2A5WA 3VOEA 3SXYA 4AYBA 3GWZA 4DV3E 2DRPA 3J7YJ 1JHFA 5EEGA 3IWZA 3VODA 2DT6A 2K5CA 2X1CA 2QENA 3TGNA 2Z9OA 4P9FA 2EM9A 5CVJA 3S3OA 1B9MA 3ZQGA 1P6RA 1FC3A 3DF6A 2ADRA 1R4NB 5M5XJ 4RA2A 4IEJA 5C3EJ 1K61A 3A02A 2XAGA 4DJAA 2OD5A 3EYIA 1VI0A 2ZJ2A 1TP4A 1SFUA 4OINF 2LDUA 4HNVA 2K4JA 1YJWI 4GKJE 2O0YA 2O7OA 4EV0A 1I5ZA 5L3EA 4A3CJ 4ZYDA 2BOLA 4G12A 4DZJA 4DV5E 1MBKA 5BQTA 4EJTA 2VQFE 2V1NA 4ESFA 1A6IA 1XPXA 1T8IA 1O3TA 2ADUA 1QRYA 4ENNA 4ZYHA 4IHTA 4M30A 2VBXA 3BTLA 4AQYE 2XGEA 3WHBA 2OPTA 3FXRA 1XG1A 2HGHA 4U88A 5LRRA 2DDAA 3B6AA 5AE3A 4XSXF 3BOQA 3ELKA 1P92A 3PO2J 2PG4A 1RI7A 4KIBA 3TO9A 2HOEA 4AD9A 3IKTA 1X58A 2FBIA 2HKOA 3R0AA 5C44J 3I3LA 2ZBKA 2L7KA 4QWQA 4I7HA 2DO7A 4B44A 1U3EM 5ADZA 4L0YB 3H35A 2X6OA 5JHFA 5GP9A 1GVDA 4A3KJ 2K9MA 3PFYA 2M1BA 1WZ2A 5BS6A 1YITI 1X1BA 2M7AA 3HPSA 3CLQA 2CW0F 2CFXA 2JVHA 4FQGA 2XAJA 2OU2A 2GBYA 5CVIA 1ZR4A 1DGCA 2LREA 3I71A 5LEJA 3LAPA 3LSJA 1XCBA 3BR0A 2VJ5A 2GXBA 2V1XA 1IMUA 1HSTA 2ELZA 2Q2EA 3GEZA 2Y75A 3B73A 1XGNA 4BBSJ 2F6CA 2QBYA 4D7MA 3ZQFA 1XMQE 2LJUA 4LU9A 3QYEA 2E5LE 2VBWA 4C2MJ 3LMMA 2DOEA 1IQSA 4HSTA 2ISYA 2JA5J 3TEDA 1OYIA 2EOHA 3M9AA 1TQMA 2OA4A 3Q9SA 4DKKA 3PSIA 2AXTC 5ERIA 3DXJF 1WJ5A 1PJSA 5H2FC 5LGNA 5L3BA 1I3QJ 2E5NA 2DBBA 2CW8A 2HVQA 3JSOA 2K9NA 3LSIA 2A61A 4PGHA 4MTEA 2XRLA 2MC4A 5DD4A 1WH5A 2XAQA 4I0BA 1ZK8A 3N97A 1GLNA 2HVSA 2XRNA 2IW5A 2K9SA 4FASD 1XSXA 5DD8A 3PUBA 4JOMA 2V86A 1J7KA 3OYKA 3OSGA 2PFBA 5K5QA 3RZDJ 2VONA 3T1HE 2ZKZA 5IT9Z 5A6KA 5DCFA 1MNMC 2XF7A 3LL7A 1B72B 1DGRM 2RQPA 1JT0A 1BR1A 2VASA 1FWZA 3R60A 2Q8UA 2JXPA 3O2PE 4RS8A 3HIFA 1B1BA 3JRIA 2L92A 3BF2A 1QHHD 1LVKA 1PUFA 1YE9A 1N3GA 1GXPA 2YRKA 3WG9A 4A0ZA 2LSOA 3TQMA 3FK7A 4L5IA 4UUSA 1IAWA 1UJ8A 4BS9A 1HQCA 3JRCA 2A69F 4BMJA 3FDYA 5FLXK 2GLOA 2I13A 1T95A 2VQGA 2G9WA 4Y33A 4CYCA 4C3IJ 2FOKA 1SMTA 1AWCA 1FYMA 4X65E 1ZKGA 2IPQX 2HQ5A 3KEQA 4I76A 4JI5E 3UKGA 1HXDA 3HZJA 5IP6A 2JT1A 1JE8A 4B3TE 1ETKA 1SD5A 2HS5A 2K4BA 4MQ9F 5E1XA 2OTJI 3FWEA 2BY1A 3ZQLA 1VQLI 2EM7A 3E5QA 4NC6A 3K69A 1WJAA 3QU6A 3VDXA 3S32A 2UXBE 4DYQA 2DA6A 4HX8A 4HLYA 1Z7LA 1XMOE 3OS1A 2IGMA 2XASA 2KZVA 2R7WA 2M3AA 3DPUA 4YFKF 4GFBA 2X0LA 3BCBA 3HKZN 3RQ4A 1RKTA 4ZZLA 1C0WA 3M8FA 4BCAA 2R7QA 3K4BA 3I4NJ 1CF7B 2A5YB 1Y0UA 2VXZA 5BPDA 4Q5SF 2R7DA 3OTOE 4V2FA 4AWXB 1SD7A 2VIXA 2JA2A 5IXMB 2EPNA 4DR2E 3L00A 5C4JJ 4IOCF 4F2JC 4A2UA 1EV7A 2DJIA 3LA2A 5J1RA 4EJUA 2CQNA 2NABA 1E17A 4XRSA 4R8OA 4RGUA 5CKTA 2EZLA 1FYLA 4YEJA 1SVLA 4EJOA 3CCVI 1S72I 2XROA 3RSNA 2ZFUA 1BIBA 4BHCA 1J75A 1F9NA 4OAZA 2VKEA 3DBHB 1WI9A 4MNUA 3VYTB 5E8IA 1LEAA 4RAYA 2EZ6A 1HNXE 4IRHA 4OMZA 3RKQA 4BBYA 3FXMA 2R92J 3CUQC 3ZMVA 3ZMZA 1LFBA 3KPHA 4S05A 2L54A 2HTJA 1KYWA 2B7TA 4CYDA 1D1CA 2CG4A 2PMZN 1OYWA 4P55A 4XLAA 4CHUA 2L2MA 4D9JA 4BACA 2EPPA 2H8WA 4XORA 1W1WE 4OMYA 2EMZA 2L5QA 4WXCA 3GTLJ 2MD5A 3TOBA 2IA1A 3GTJJ 3MFKA 3BZCA 3I59B 2EN8A 3I56I 4A3GJ 5F64A 1R5ID 6PAXA 3PSFA 1L3LA 3FKJA 3F9KA 2M7BA 5H20A 3K6GA 4PJ0C 5E18F 2EMKA 1HKTA 2EOZA 3H9GA 1FPQA 3LSGA 1FP1D 1KQ9A 2LBFB 2QF7A 4JV5E 4CXFA 1MW7A 1RR8C 1TWGJ 2Q0OA 4IF4A 1G3TA 4X66E 4IRIA 4AC0A 2KLOA 3IRRA 1NEIA 3G1LA 2LD5A 2DJNA 3MVPA 2Y0MA 2EM0A 3JRFA 2BVMA 3H9JA 4G7OF 4E7SA 5A69A 1IV8A 1WRJA 5KVRA 5ICCA 3K9TA 5FJ8J 2R7UA 2CYYA 2YX4A 2RN7A 4E7ZA 1Z6TA 3ZMUA 1BW5A 2KPMA 1R6RA 4HOBA 3I64A 4TUIA 2HPIA 1H88C 3ZXSA 2YRHA 1POGA 3T8TA 4DR1E 2RS7A 2DOAA 2MLGA 1Q1HA 5F1JA 1N36E 3H36A 4C3HJ 2L0KA 4M72A 4HG2A 1UG2A 2V88A 2Q8KA 2E5ZA 1KQ0A 1MMAA 1RKWA 1HW1A 4XN0A 2W85A 2N3HA 2EH3A 1TBXA 1W5TA 1ZG3A 1PUFB 3BR3A 2HDDA 1YFHA 2OBPA 4ENMA 2JA6J 1NTCA 2UXDE 1WWXA 4Y52J 2ID6A 2Z16A 3HB9A 2JR1A 3BPXA 3RPUD 1IGNA 1KJKA 4M9SA 2B3TB 3KP7A 3IAS2 4AIJA 3M07A 3M8JA 3MQ0A 2WC2A 3F6OA 1TTYA 2AQEA 1HA8A 2DTZA 2BYVE 5B5EC 2UUAE 4XRFA 4GKKE 3DU6A 1NHAA 4M74A 4HEIA 2HDWA 1YW7A 3TW7A 4PZJA 4HX7A 4A0YA 2M7QA 2NUEA 4IKFA 1J9IA 2JOBA 2E1MA 1OMIA 3L9FA 1X6FA 2GXGA 1OPCA 3F8CA 2VBYA 2Y9ZA 1A5JA 2JUCA 2VF1A 2HGCA 2E7WA 3HC7A 3GFJA 2W7NA 4WFTA 1S9HA 2FQ3A 4GO1A 3OYGA 3BBGA 3WTXC 2UXCE 4HNTA 1K83J 2ZFWA 4WXDA 4XLFA 4BHPA 2EV6A 2K3PA 2RAEA 3BWGA 4ZDLA 2EFNA 1DUXC 1XMKA 1AHDP 1KU2A 3JRAA 3RI4A 2MC5A 3DLAA 1XDSA 2LJHA 1I3AA 1CGPA 4KN4X 4JI7E 3FMQA 4M6YA 1XX5A 1MH3A 2FRHA 3ERMA 2EOJA 5E1WA 2Z1DA 5D5VB 1Y6IA 2H6CA 4N4OB 5ILUA 3O3KA 4X1EA 4KUMA 2EIMH 3C2GA 1VTNC 1JK1A 2PMZA 2NVUB 2KIMA 2GQQA 2RPCA 4BH9A 3KYLA 1Z3YA 3CESA 4HV6A 3RPQA 2HOSA 1PYVA 1S7AA 3M8EA 3G73A 4AVZA 1Z6RA
chains in the Genus database with same CATH topology
3M7GA 3TOAA 4K2EA 1QNTA 3HTSB 3RKWA 4LLNA 4ZZDA 2RGVA 4GGGA 2HYFA 3KFWX 4BHBA 1K79A 2FBHA 1ZHFA 3EETA 4A5NA 2OQRA 4MHGA 2QQAA 4F7ZA 1ZYRF 1OR7A 4YIIA 5IT9K 4MEYF 2HZTA 2CWEA 2NNNA 3ECHA 2V79A 2E1NA 3NRVA 3PQJA 2L4MA 2Z3YA 1G6NA 3BZ6A 1FBSA 1BI1A 2HYGD 5HDNA 3EUHA 1R23A 4RB3C 3SHFA 4A6DA 2V1UA 5FD5A 2FBKA 2VC0A 2V9VA 4HF0A 3BPVA 1O3SA 1SFEA 1YW9A 3ML6A 1EH8A 5DEQA 2GA1A 2GZWA 1I1SA 2D45A 1MDMA 3RIRA 3WTZA 2RVCA 3FM5A 2PBIA 1YTYA 4WF2A 1R00A 4UHTA 4RAZA 5HLIA 4Z2YA 1R36A 1T98A 2RKHA 1HW2A 1W7PB 1W7PD 1D3YA 4EMSA 4A6EA 3C7JA 2XHKA 2D1VA 2UXXA 5CJ9A 2YPRA 1S8NA 5FLXZ 1QQIA 3FMSA 1P4WA 1BBYA 4UVAA 2F5FA 4I98B 4BAYA 4KNYA 1U2WA 2PI0A 3U1DA 3F8NA 4N9IA 5CYVA 3I0TA 2JTVA 2NS0A 3U9GA 2K86A 5DUIA 5DCMA 3VB2A 1FBQA 2GA2A 4WWCA 4HDUA 1TW3A 4KDPA 3O6BB 2W25A 3LQRA 1ON1A 2DFIA 1GXQA 2ZCWA 1JXSA 4O6JA 4OOIA 5HOOA 3WGIA 1SD6A 1XGMA 3ZN0A 4EM1A 2MBFA 4CDGA 2M5WA 5HVQC 3C3WA 1KQ8A 3LQQA 3F8MA 3QU3A 3V8KA 5D6FA 3V8LA 1ZREA 3FXUA 2O6GE 3MEXA 2V1DA 3E6BA 5ILSA 1YQAA 1B6AA 3K0LA 3BDDA 2HDCA 2OZUA 3ABTA 2XAHA 3LA7A 2Z5UA 5J8CA 1MDMB 4KA4A 2GIVA 4BYYA 3CLOA 4UNOA 3DV8A 2MLKA 2PQ8A 4HX4A 1R22A 2XGXA 2DK5A 2DK8A 2H6BA 2H09A 3JSPA 4R8HA 3KP2A 1SD4A 2BBYA 5HLHA 3EYIA 1B9NA 3VFZA 1YW8A 1SAXA 1I1GA 3QRFF 5LGTA 3HRMA 4HLXA 2EV5A 4Q48A 5A2QK 1U5TB 3IL2A 3DPLC 5L3CA 3GX4X 4G7ZF 1ZARA 4WXHA 3MZYA 3HOTA 4KIGA 3BP8A 3CTAA 3P9CA 2QLZA 2DPDA 4DNCA 4RGRA 4A0XA 3QOPA 3BY6A 4B8XA 4KMFA 5DDGA 3I5UA 2QZ8A 5K1YA 1R5HA 4CZZA 4Y13A 4OIQF 3J81Z 1EH7A 1BI3A 1RIOH 2HFHA 2O8XA 3FZVA 4P5OA 3SZPA 1B4AA 3HRTA 3GFIA 2BGCA 2IRFG 4EGZA 2HQNA 4KMUX 1WSUA 4FT8A 1HBXG 2ZNZA 2JPBA 1TQIA 2DTRA 2QWWA 5LLQA 3REOA 1J59A 2BEOA 5JR3A 4O5VA 4E70A 2J5OA 5F1RA 2YU3A 5LRSA 2VT3A 4NHJA 3GFLA 1IRGA 2QM3A 4KFCA 3KE2A 3F8FA 3TDZC 1LNWA 4I01A 1JHHA 4G7HF 2HTSA 2BE5F 5KK1A 3D0SA 2ESNA 2LF7A 2VN2A 4LK0F 3CO7C 2F5CA 1XGSA 5DUKA 1TNSA 2KKOA 1XCVA 2OZ6A 4GXOA 3KETA 2CSOA 1O7FA 2C6YA 3W6JB 1KU3A 3KCCA 4N9HA 4LD5A 2K02A 4EM2A 1K7AA 5AIQA 1HSJA 2FU4A 1HW5A 3BJAA 2A6EF 1ZG1A 3DPTA 4OIPF 5BOXA 3D5LA 3WTVC 3I4PA 3N4MA 2VODA 4B09A 4IJAA 4LB6B 4L5JA 2X4HA 1SMYF 2Z99A 4I02A 4LB5A 1X3UA 1O57A 4CO8A 1QZYA 3W6KB 1XSDA 2GAUA 3LAJA 1T6SA 3F6VA 3SZTA 3IC7A 2L02A 1S6LA 4D0PA 2QBYB 4HYEA 2PJPA 2A6HF 3HRSA 1ZRCA 2EA4A 3CUQA 1D8JA 5L3GA 2FA5A 4GCVA 4RB0A 4EJVA 4ENKA 2G7UA 2UZKA 3ULQB 1BOAA 1DDNA 1IXCA 3FF5A 1DPRA 1Z1DA 1ZGJA 3EQLF 3Q9VA 4ASNA 5D5XB 5LBQA 2ACJA 1R1UA 3WE3A 4I0AA 3GLXA 3DQVC 1D8KA 1RUOA 4RGSA 4Y17A 4AIKA 5LGUA 1FT9A 4O3MA 4WX9A 1FYKA 1O3RA 3U2RA 5DYMA 4ZYEA 4L18B 3ROUA 4FX4A 5FO5A 2FNAA 2PEXA 4HQEA 2ETHA 3ZN1A 5D5UB 1PP8F 1ZH5A 3GF2A 4ESBA 2FXAA 2QVOA 1YYVA 2O61A 3S2WA 2Y48A 2NRAC 3DKWA 2XAFA 3I53A 4BQAA 4EQQA 1ZGAA 1H9TA 2KJBA 5L3FA 1XN7A 1KA8A 4RGXA 1MGTA 2EA2A 2DLLA 3F3XA 3MWMA 2M8EA 2MH2A 4HDVA 3J81K 2NAZA 4KN7X 3GZ5A 5J8FA 1B59A 3HSEA 4EVIA 4EM0B 2P5KA 2DW4A 3F72A 2DT5A 1LDJA 4EJWA 5A2QZ 2PN6A 4R79A 4P9UA 2M45A 2EWNA 1S29A 1PP7U 1MKMA 5J6XA 1TNTA 1MD0A 3K1PA 3KLNA 1FY7A 1UFMA 3E6DA 2K7LA 3JW4A 3V4GA 3P7NA 1T2KA 2CQKA 3H3UA 2F2EA 4MGRA 3PQKA 2TDXA 3WGGA 2KIUA 4KYWA 1P4XA 3KEOA 2ZMEA 2CO5A 2HEOA 4HZFA 4M9ZA 1XDUA 2QYOA 1L0OC 5H6RA 2ESHA 1ODDA 4ESJA 5D4RA 3FX3A 4ZH4F 3HSFA 4U0YA 1YS7A 4RB1A 2QQBA 4ENJA 4I2OA 1IUYA 2JZYA 1KU9A 1SFXA 3FHZA 5ED4A 3ZPLA 3ZQ7A 5DV5A 3MAJA 4JBAA 1BI2A 3HHHA 4BXUA 2ELHA 3C1DA 2D2WA 2RV8A 1XB4A 2VE9A 3IKVA 4YIFA 3CJNA 1GHCA 3GO5A 1QBJA 1R7JA 5TJJA 2FE3A 1G3YA 1USSA 2P7VB 1K78A 5ICGA 3H3ZA 1LVAA 4LLLA 3KZYA 3HYIA 1W4MA 4PDKA 4HF2A 2FMYA 1RZ4A 3L2CA 3JTGA 2M87A 1WQ2A 4G94A 3I58A 1QZZA 3SQNA 5LHIA 4M73A 2FNPA 4NB5A 1OKRA 2DAOA 2F5DA 4KIFA 5CVUA 3T1BA 1U5TC 1JGSA 3RYRA 2L4AA 3HHGA 1IN6A 3RJPA 4S04A 1XGOA 1OYYA 4AIHA 2IA0A 2IT0A 2LKPA 2NNYA 1QO0D 3WTYC 2VC1A 5E1ZB 1MJAA 3ISPA 2J5PA 1F5TA 3GVAA 4U7DA 3E5UA 1IRFA 3QAHA 1O7LA 3KP3A 2BV6A 1IN7A 1O3QA 2P4WA 4IVNA 5IT3A 2R7FA 4Q47A 3T0YA 2IA2A 5HS7A 4MTDA 4ZYGA 2EJRA 3J80K 3V7SA 4YFNF 2EFQA 3WTUC 4XBFA 2LNBA 3WTSC 4HBLA 4HAMA 2COMA 3K1MA 1BN5A 4HV5A 3P9KA 4UUVA 3LA3A 3LFKA 4GYGA 2KJCA 3C18A 2MH9A 1FNNA 4LMYA 2XVCA 1DP7P 3WTWC 4RB2C 1KGSA 1V4RA 1ON2A 1HKSA 3ZMDA 2STWA 1RNLA 3DF8A 5FB2A 1KYZA 3DEUA 4MEXF 2PMHA 1R58A 1ONVA 2B0LA 4P96A 2IVMA 1ZLJA 5ILVA 3KP5A 5EEHA 3GFMA 3HUGA 1H0MA 1XMAA 2R3SA 3TKYA 3K2ZA 3JTHA 3GZ6A 2RC4A 1IXSB 4KT5C 1T38A 3R0JA 3LWFA 1XSVA 1MZBA 5F6FA 1S7OA 1IN5A 4LJZF 1CF7A 5DCMB 5K5RA 2PLYA 4EGYA 3FXQA 5K5OA 4GYIA 2IJLA 5D8KB 2HWVA 3LSTA 4MQVA 3NEUA 2DQLA 2P8TA 1IF1A 1BM9A 1H9GA 3M1EA 5FFZA 4R1HA 1IN4A 1D5VA 4G6DA 1ZG5A 5BMZA 2HR3A 3TO6A 4LGWA 1FX7A 3VEPA 4IHSA 4LLGF 3RKXA 5D5WB 3E97A 1TQPA 2A68F 3V7RA 3I59A 4LK1F 1YG2A 1Z05A 3DP7A 5HS8A 2P5VA 4U0WA 1IN8A 1J5YA 1RUNA 4LG0A 3QPHA 3KP6A 2OQGA 1J0RA 5LHGA 2WV0A 3K1NA 2P6TA 4UVBA 4ETSA 3RYPA 4U7BA 2P5LC 2E1CA 5E8GA 3E3VA 2EFWA 1ULYA 1KU7A 2A3SA 5D6EA 2DI3A 3PFIA 3GXOA 1IXRC 1T39A 3CO6C 5L3DA 2FSWA 3EYYA 3RPUA 3P9IA 3TO7A 5CLSA 5TRDA 1YO5C 3FMRA 3COAC 4G6QA 1UCRA 3MZHA 3FM3A 5ICFA 1LDKB 4OIRF 3T8RA 4IRGA 4PCQA 3KLOA 3QPTA 2P7CB 4FHTA 1IW7F 2WWYA 2HQRA 3CUOA 2IP2A 5JFRA 4CICA 2JPCA 1TW2A 5FD6A 3R61A 1BJAA 1FOKA 2W84A 4HQMA 1J2XA 1BI0A 3IRQA 1S3JA 4UVCA 1BC7C 3R6SA 5JVTA 3T5XA 2UWMA 3RTRA 1LB2A 1G3WA 4G9YA 2NYXA 4A12A 5CVRA 2EV0A 4PGGA 3GUDA 1FSEA 5HDGA 3J7AO 2DQRA 1LJ9A 2HKXA 3IHUA 4Y15A 2XIGA 1R1TA 3HOSA 1U6GA 3GYHX 4IPAA 2DPUA 5JHUA 2JRTA 3WTTC 2V6CA 1LDDA 3ABUA 5AONA 2KIFA 3JAMK 2XUBA 1K6OA 2L3DA 4LG0B 1YLFA 1R1VA 4U0VA 1G3SA 1T0FA 3GW2A 1P2FA 2A07F 3J80Z 2VOOA 1V3FA 2ZO4A 3QP6A 4G8XA 2H94A 2ZNYA 3BROA 1YIOA 2AS5F 2EFPA 1FBUA 2OAZA 4M71A 4OIOF 4TV7A 1REPC 3F21A 1Z9CA 1STZA 1PDNC 1GVJA 1MJBA 1P4AA 1Z7UA 4QLCU 3E6MA 1ZRFA 4N0BA 1USTA 2UXNA 4UV8A 3AAFA 4I09A 3EDPA 2M30A 1FP2A 5FFXA 1LEBA 3V7CA 3ECOA 1W7PA 4L9VA 3G3ZA 3BJ6A 4UXNA 4FX0A 3KP4A 4WK8F 5AIPA 3RDIA 1ZRDA 2F5EA 1R5GA 4L9NA 5D8LB 3H92A 3CUQB 3HSRA 1ZLKA 2FEZA 2D1HA 4DQ2A 2Z33A 3HRUA 1I27A 4AVPA 5H6QA 1ZN2A 1TLHB 4UV9A 2WTEA 2KRFA 5HS9A 1FLIA 2ZXJA 3E5XA 4M9XA 1ZAOA 2FMLA 3NQOA 1Z91A 3I54A 4JQFA 2H27A 1YS6A 2W57A 3F22A 2VBZA 5D4SA 5E17F 4JK1X 1A04A 1E2XA 2MA3A 5HLGA 2EB7A 4NQWA 4IXAA 3ZMTA 2GWRA 4M6XA 2EFOA 1XD7A 1UB9A 3WU0A 3WODF 2O3FA 4H0EA 1WKMA 4A5MA 4L9TA 4HF1A 2G7HA 1G4DA 2YX7A 4YFXF 2ISZA 3B02A 2E7XA 5HDKA 3ERED 4L0ZB 2W24A 2FF4A 1QPMA 4XLNF 1F4KA 3DFGA 4WCGA 4L9JA 1I6XA 3L7WA 2VT2A 4HA8A 2RDPA 2K27A 3WE2A 3R4KA 1LQ1A 3L09A 3QP5A 3RKYA 3SFZA 1MJ9A 1F1ZA 2XKPA 2VOPA 1U8RA 3F8BA 1U5TA 4XLPF 3KZZA 2XKOA 2P6SA 3ZMSA 1BIAA 2RNJA 4KICA 3HTUA 1W5SA 2YR2A 1UHWA 3WGHA 5JI6A 4OU0A 4CGZA 3E6CC 3WU1B 5LEKA 1DPUA 2EK5A 4YG2F 1FZPB 1EH6A 1QGPA 4BNCA 2PMUA 2ZMEB 2CGPA 5LHHA 3ZP5A 2DU9A 2VE8A 2LF8A 3OV8A 2MC3A 4ON0A 3IWFA 1HKQA 2L01A 1AOYA 2STTA 3TQNA 3F23A 3OOPA 1UHMA 4LFUA 1BC8C 5BPIA 5FGMA 3Q5FA 4XSZF 2O03A 2QQ9A 2YSRA 2QUFA 4Q4ZF 2JSCA 1FSHA 1PUEE 3V8JA 2AXLA 3TDUC 3JAMZ 3BJOA 2XV4S 5CVVA 5E20A 1IZ1A 3CDHA 5ICEA 4HW0A 1K78B 1U78A 3MCZA 3VOEA 3SXYA 3GWZA 1JHFA 5EEGA 3IWZA 3VODA 2QENA 3TGNA 2Z9OA 4P9FA 5CVJA 1B9MA 1P6RA 1FC3A 2XAGA 2OD5A 2ZJ2A 1SFUA 4OINF 2LDUA 2K4JA 2O0YA 4EV0A 1I5ZA 5L3EA 4ZYDA 5BQTA 4EJTA 4ESFA 1O3TA 2ADUA 4ENNA 4ZYHA 4IHTA 2VBXA 3FXRA 4U88A 5LRRA 4XSXF 3BOQA 3ELKA 1P92A 2PG4A 1RI7A 4KIBA 3TO9A 2HOEA 4AD9A 3IKTA 2FBIA 2HKOA 3R0AA 2ZBKA 4QWQA 4I7HA 2DO7A 1U3EM 4L0YB 2M1BA 5BS6A 2CW0F 2CFXA 2XAJA 2OU2A 5CVIA 3I71A 5LEJA 3LAPA 1XCBA 2GXBA 2V1XA 1HSTA 2Q2EA 3GEZA 2Y75A 3B73A 1XGNA 2QBYA 2VBWA 2ISYA 1OYIA 3M9AA 1TQMA 2OA4A 3Q9SA 5ERIA 3DXJF 5LGNA 5L3BA 2DBBA 3JSOA 2A61A 4PGHA 4MTEA 5DD4A 2XAQA 4I0BA 3N97A 2XRNA 2IW5A 1XSXA 5DD8A 1J7KA 2PFBA 5K5QA 2VONA 2ZKZA 5IT9Z 5DCFA 2RQPA 1FWZA 3R60A 3O2PE 4RS8A 3HIFA 1B1BA 1GXPA 3WG9A 4A0ZA 2LSOA 4L5IA 1IAWA 1HQCA 2A69F 5FLXK 2G9WA 1AWCA 2FOKA 1SMTA 1FYMA 2IPQX 3KEQA 1HXDA 2JT1A 1JE8A 1SD5A 2HS5A 2K4BA 4MQ9F 5E1XA 3FWEA 3E5QA 3K69A 3QU6A 4HX8A 4HLYA 2XASA 4YFKF 2X0LA 4ZZLA 1C0WA 3M8FA 1CF7B 2A5YB 1Y0UA 2VXZA 5BPDA 4Q5SF 2R7DA 4AWXB 1SD7A 3L00A 4A2UA 1EV7A 3LA2A 4EJUA 1E17A 4RGUA 1FYLA 4EJOA 2XROA 1BIBA 4BHCA 1J75A 1F9NA 4MNUA 1WI9A 5E8IA 1LEAA 4RAYA 4IRHA 4OMZA 3CUQC 3ZMVA 3ZMZA 4S05A 2L54A 1KYWA 2HTJA 4CYDA 2CG4A 4P55A 1OYWA 4CHUA 4OMYA 4WXCA 2MD5A 3TOBA 2IA1A 3MFKA 3I59B 5F64A 6PAXA 1L3LA 5H20A 5E18F 1HKTA 1FPQA 1FP1D 1KQ9A 4CXFA 4IF4A 2Q0OA 1G3TA 4IRIA 3IRRA 2Y0MA 4G7OF 1WRJA 5KVRA 5ICCA 3K9TA 2CYYA 2YX4A 2RN7A 1Z6TA 3ZMUA 4HOBA 3I64A 3T8TA 2MLGA 1Q1HA 4M72A 2Q8KA 1KQ0A 1HW1A 2W85A 1TBXA 1W5TA 1ZG3A 1YFHA 2OBPA 4ENMA 1WWXA 3BPXA 4M9SA 3KP7A 4AIJA 3MQ0A 2WC2A 3F6OA 1TTYA 2BYVE 4XRFA 1NHAA 4M74A 4A0YA 1YW7A 4PZJA 4HX7A 1J9IA