4WFTA

Crystal structure of trna-dihydrouridine(20) synthase dsrbd domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
SGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An extended dsRBD is required for post-transcriptional modification in human tRNAs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
total genus 26
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 1.3.1.-:
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wftA00
1T4OA 4JI4E 2LUQA 4GKJE 4M30A 2LBSB 4LFCE 1XMOE 2ZM6E 2UXBE 4LF9E 1N34E 1UILA 2L33A 4JI7E 2B7VA 4B3RE 1HNXE 4JI6E 1YYWA 2UUBE 4NXNE 2RS7A 5LMNE 2LRSA 2JY9A 3VYYA 1T4LB 2E5LE 3P1XA 4DV4E 4JYAE 5BR8E 4M2ZA 1I94E 2UUCE 1RQ0A 4YY3E 4DV3E 4DR3E 2DB2A 1N36E 4JI2E 1FKAE 1HNZE 2NUGA 2VQFE 4X65E 1RC7A 3J7Yp 4DV0E 2L3CA 2VQEE 2IHR1 1ZBTA 4DV6E 2CPNA 5CFFE 4OOGC 2N3GA 1XMQE 2L2MA 1J26A 4LF8E 4DV7E 4X8WA 4JI3E 2UU9E 2UUAE 5LMUE 1IBKE 4JV5E 4YHHE 2HHHE 4GKKE 4NXME 3T1HE 4X66E 1X47A 5IWAE 4DV1E 4LFBE 1X49A 1O0WA 4LF6E 2LTSA 4LF4E 4DR6E 1HNWE 2NUFA 3T1YE 4DR7E 3ADJA 4DUZE 4LFAE 1J5EE 4DR5E 1WHNA 2UXDE 2MDRA 1PKPA 1X48A 1YYKA 2LTRA 1QU6A 3C4TA 4X64E 1EKZA 3ADGA 2YT4A 2B3TB 1WHQA 4X62E 2RS6A 4DV2E 2F4VE 2NA2A 1XNQE 4OX9E 1GQEA 2L2KB 4K0KE 1STUA 3ADLA 1HR0E 1XNRE 2DIXA 1YZ9A 2KHXA 3HTXA 4AQYE 2UXCE 1N33E 3VYXA 4DKKA 2DMYA 4LF5E 2L3JA 4WYQB 4DR2E 3C4BA 4WFTA 1FJGE 1IBLE 4LF7E 4JI0E 4JI1E 2RSMA 4DR1E 2NUEA 3ADIA 2LJHA 2LUPB 1YYOA 4B3ME 1UHZA 2JVAA 4KHPE 3LLHA 4B3TE 3OTOE 4DR4E 4JI5E 4JI8E 4B3SE 4DV5E 2RTXA 4DUYE 1DI2A 1IBME 2EZ6A 1T4NA 1N32E 2N3HA 2L2NA 2B7TA
chains in the Genus database with same CATH superfamily
3VHTB 3JTZA 3OMLA 2ZM6E 2EN8A 5IT9C 2EM9A 1N34E 2L33A 2B7VA 4B3RE 4JI6E 1BBGA 2E72A 2K4VA 2RS7A 5LMNE 2LRSA 1T4LB 2A25A 3P1XA 1IMUA 2EQ0A 3J81C 5BR8E 2UUCE 1A1GA 2CT1A 3JU0A 2GPIA 4DV3E 1HNZE 3LMLA 1WRJA 2YTOA 4ZYHA 2R76A 4X65E 2EQ1A 2WCC3 4DV6E 5CFFE 2EQ3A 2UU9E 5ADZA 2EN1A 5LMUE 2HHHE 4R2CA 1PJTA 4NXME 4LU9A 2YTEA 1MEYC 2EMWA 5IWAE 2LV2A 4DV1E 2M4IA 4LTYA 4LF6E 2LTSA 1GZ6A 3T1YE 3EQ1A 4N4RB 4ZYDA 2HGHA 3ADJA 4DUZE 2L6MA 4LFAE 1J5EE 4BBYA 1X5WA 4DR5E 2MDRA 1PKPA 2YSOA 1YYKA 2JPAA 1X6FA 2LJUA 2YPNA 5AE1A 1JK1A 1EKZA 2FGGA 2EORA 5F3WA 3J7AG 2YTQA 2RS6A 3BIDA 2EOSA 2NA2A 4OX9E 1STUA 2YRHA 3QG5C 2CSHA 2YZTA 2MC6A 4AQYE 2LO3A 2I13A 4DKKA 4LF5E 4WYQB 2LMZA 3C4BA 4WFTA 2WZOA 1AAYA 2YTDA 1FJGE 4JI0E 4JI1E 4F9BB 2NUEA 1NEIA 2LJHA 4B3ME 3C6KA 2EMHA 2JYAA 4KZSA 1WXRA 2MDGA 4P78A 2EJ4A 4KHPE 4WPYA 5AE2A 2YTIA 1KJKA 2Q8UA 5A6KA 2VRDA 4WXDA 3C6MA 4F2JC 2V89A 1F2IG 2DGCA 3THOB 2EZ6A 3KWRA 1T4NA 2VF1A 4KWYA 4TUIA 3EPJA 2EPPA 4IS1C 1YUJA 2EN4A 1IQOA 2JOBA 1T4OA 4R03A 1UN6B 4R2PA 2JXPA 4R8OA 4BC9A 2MKNA 4O24A 1HNXE 2V85A 2UUBE 1ZR9A 1YUIA 5A6AA 2JY9A 3VK6A 4M2ZA 3FIGA 2EMLA 1RQ0A 2BBGA 2ELYA 2EMBA 2MKDA 4YY3E 2HC5A 4F54A 1FKAE 4BCAA 4BHBA 2EOZA 1RC7A 2DLQA 2VQEE 1ZBTA 2CPNA 3L00A 2N3GA 1XMQE 3HQ1A 4LF8E 4DV7E 2EN6A 1IBKE 4GKKE 3HPZA 2J7JA 4BS9A 3T1HE 1YSAC 4X66E 2EMFA 5IXMB 2HJJA 3F6HA 1EH7A 5A6JA 1T39A 2EN7A 1HNWE 3DJWA 2YSPA 3BBGA 2EM3A 2EL5A 3RMPA 2EMXA 1TF6A 1QU6A 4X64E 2ODRC 4F6NA 2I9IA 2YT4A 4R2AA 2B3TB 1WHQA 4X62E 3IWCA 2V8QB 4DV2E 4R2SA 2V87A 4WSPA 2EL4A 1YZ9A 2KHXA 2H36X 2RQLA 2YTJA 2DMYA 4IJDA 2L3JA 4DR2E 2EL6A 1IBLE 4DR1E 2LUPB 1A1IA 2EMYA 1UHZA 4ZYGA 2JVAA 1PDAA 4B3TE 2KONA 4DR4E 1ZBQA 2L8TA 2EPCA 4BMJA 4JI5E 3MHSC 1DQ3A 2L2NA 2EPUA 2B7TA 2RSIA 4R2EA 4Q28A 2D9HA 4P7DA 4JI4E 4WXCA 2LUQA 4GKJE 4M30A 1SFEA 4LFCE 3EPKA 4JI7E 5AASA 2EMIA 1GTKA 2EPLX 1YYWA 4HEIA 3VYYA 4DV4E 3IWBA 2EM6A 1SR9A 2EPNA 2M9AA 5KL5A 1I94E 2EMAA 2GLIA 4DMIA 5FLXC 4HTGA 1QNTA 2DB2A 2V83A 4JI2E 2YTGA 2VQFE 2YRKA 2EPRA 3HXLA 5TSEA 2N8XA 2ENHA 1UBDC 2EE8A 4OOGC 2YTFA 2L2MA 3AV0A 4ZYEA 4X8WA 4JI3E 4Q35B 2UUAE 4F6MA 1ZAAC 5KL6A 3K6QA 1RMDA 5T6JA 2MC5A 4LFBE 2EOJA 1O0WA 4DR6E 2NUFA 4WSGA 3KZZA 2JR1A 4R2DA 1A1LA 2EOFA 2EPXA 1WHNA 2UXDE 1X48A 2PRTA 4WX9A 1X3CA 2LTRA 2ELZA 3IWDA 4GZNC 1YFHA 5A6BA 1DGCA 2EM7A 3UK3C 3ZOQB 2YRMA 2WBSA 2JWOA 4R2RA 3KZYA 3MSWA 1GQEA 2ODRD 2DMIA 4M0VA 4O43A 2EM8A 3TQMA 1X6HA 2EPAA 2VE7C 4M9VC 3AUZA 1A1KA 2GHFA 2JOXA 2EOMA 1PJSA 1KYQA 3J80C 2EOEA 2V86A 5A6BD 1AH5A 1L4SA 2RSMA 4L5NC 5KL2A 1MGTA 2V88A 4BHCA 2RPCA 2EPOA 2EOOA 4F9CB 1LLMC 1ZU1A 2YTNA 4JI8E 3EPHA 4DV5E 1JK2A 4DUYE 5IV8B 1DI2A 1IBME 2EP3A 4BC7A 2ENCA 2EOXA 5KL3A 1A1JA 3DF6A 3M99B 3BF2A 2EPMX 2EMZA 2LBSB 1XMOE 4MLQA 2G7HA 2UXBE 4LF9E 3ECRA 1UILA 2DSYA 4TUGA 5AC4A 5KL4A 2JP9A 4O5GA 2M7QA 4NXNE 4RHBB 2E5LE 2EN3A 2EOQA 2DRPA 1B69A 1TF3A 4JYAE 2LCEA 2EM5A 2CTDA 1EH8A 2FTXB 5A2QC 4DR3E 1N36E 2NUGA 1BB8A 2EPKX 3J7Yp 4DV0E 2L3CA 2IHR1 2EPZA 1J26A 2BB8A 2YTPA 4JV5E 4YHHE 2F8BA 2KOUA 1N3GA 2K7IA 4FK5C 2WBUA 1A1FA 1X47A 1G2FC 2EMGA 1X49A 3EPLA 4NHRA 1TN9A 4LF4E 4X9JA 4R2QA 2LT7A 1IQSA 4DR7E 3JAMC 3F6GA 2B9DA 3HPSA 4NZVA 5KL7A 3BGHA 1BBOA 1EH6A 1A1HA 4RH8A 3C4TA 2ADRA 3ADGA 3H09A 1NCSA 2EM0A 2EWLA 2F4VE 1XNQE 2LVHA 2L92A 1YPNA 2L2KB 4K0KE 4J8ZA 2EM2A 3ADLA 1HR0E 1WJPA 1XNRE 2DIXA 4O4KA 2UXCE 1N33E 3VYXA 4I8OA 2YU8A 1P47A 4LF7E 5LL6R 2EOIA 4GEQB 3THNA 5A69A 3ADIA 2YU5A 3MHHC 2ENAA 5LLQA 1YYOA 2E1MA 4MLVA 2EOHA 2EMCA 1PJQA 3LLHA 1T38A 3OTOE 2EN2A 1Z1BA 2FV4B 5DNYA 1X6EA 2EMKA 5AC5A 4B3SE 2DLKA 2YWQA 2RTXA 2R1FA 2EM4A 2M1SA 2EOYA 2LE2A 2N3HA 4L8NA 1N32E 2NABA 4F9AB 5AE3A 3HTXA 2WBTA 1G2DC
chains in the Genus database with same CATH topology
1T4OA 3DF6A 4Q28A 4P7DA 4R03A 4JI4E 2LUQA 4GKJE 3JTZA 4M30A 2LBSB 4B3RE 3OMLA 4LFCE 1XMOE 2ZM6E 5IT9C 2G7HA 4R8OA 4LF9E 2UXBE 4BC9A 1N34E 1UILA 2DSYA 2L33A 2B7VA 4JI7E 5AASA 2V85A 4TUGA 1HNXE 4JI6E 2M7QA 1YYWA 2UUBE 4NXNE 2K4VA 2RS7A 5LMNE 2LRSA 2JY9A 3VYYA 1T4LB 2E5LE 3P1XA 3VK6A 4DV4E 3J81C 4JYAE 5BR8E 3IWBA 4M2ZA 1SR9A 1I94E 2UUCE 3FIGA 3JU0A 1RQ0A 2FTXB 4DMIA 4YY3E 5FLXC 5A2QC 2DB2A 2V83A 4DV3E 4F54A 4DR3E 1N36E 2VQFE 1FKAE 3LMLA 4BCAA 1HNZE 3HXLA 4X65E 1RC7A 3J7Yp 4DV0E 2L3CA 2VQEE 2IHR1 1ZBTA 4DV6E 2CPNA 5CFFE 4OOGC 2N3GA 1XMQE 2L2MA 3AV0A 3HQ1A 1J26A 4LF8E 4DV7E 4X8WA 4JI3E 2UU9E 2UUAE 5ADZA 5LMUE 1IBKE 4JV5E 4YHHE 2HHHE 2F8BA 2KOUA 4GKKE 3HPZA 4NXME 4BS9A 3K6QA 3T1HE 4X66E 4LU9A 5T6JA 1X47A 5IWAE 2MC5A 3F6HA 4DV1E 2M4IA 4LTYA 4LFBE 1X49A 1O0WA 4LF6E 2LTSA 4LF4E 1GZ6A 4DR6E 1HNWE 3DJWA 3T1YE 2NUFA 4DR7E 3JAMC 3F6GA 2B9DA 2JR1A 3HPSA 3ADJA 4DUZE 2L6MA 4LFAE 1J5EE 4BBYA 4DR5E 1WHNA 2NUGA 2UXDE 2MDRA 1PKPA 1X48A 3RMPA 1YYKA 5AE1A 2LTRA 1QU6A 2FGGA 3C4TA 3IWDA 2ODRC 4X64E 1EKZA 3ADGA 3ZOQB 2YT4A 3H09A 5F3WA 2B3TB 1WHQA 4X62E 2EWLA 2RS6A 2V8QB 3IWCA 4DV2E 3J7AG 2JWOA 2F4VE 2NA2A 1XNQE 3MSWA 1GQEA 2L92A 2L2KB 4OX9E 1STUA 4J8ZA 4K0KE 3ADLA 1HR0E 2ODRD 2V87A 2YZTA 1XNRE 4M0VA 4WSPA 2MC6A 2DIXA 1YZ9A 2KHXA 3HTXA 4AQYE 2H36X 2VE7C 2UXCE 1N33E 3AUZA 4DKKA 3VYXA 2DMYA 4LF5E 2JOXA 2L3JA 4WYQB 3J80C 2LMZA 3C4BA 4I8OA 4DR2E 2V86A 4WFTA 2WZOA 1FJGE 1IBLE 4LF7E 5LL6R 4GEQB 4JI0E 4JI1E 2RSMA 4L5NC 4F9BB 4DR1E 2NUEA 3ADIA 2V88A 2LJHA 2LUPB 1YYOA 4B3ME 2E1MA 4JI2E 4KZSA 1UHZA 1WXRA 2JVAA 4P78A 4KHPE 3LLHA 4B3TE 4WPYA 2KONA 4F9CB 3OTOE 5AE2A 4DR4E 1ZBQA 2FV4B 2L8TA 5DNYA 4BMJA 4JI5E 4JI8E 4B3SE 4DV5E 2RTXA 4DUYE 2V89A 1DI2A 1IBME 2EZ6A 3KWRA 1T4NA 1DQ3A 2VF1A 2M1SA 2LE2A 4L8NA 2N3HA 2L2NA 4BC7A 4TUIA 1N32E 4F9AB 5AE3A 2B7TA 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4O A;  4JI4 E;  2LUQ A;  4GKJ E;  4M30 A;  2LBS B;  4LFC E;  1XMO E;  2ZM6 E;  2UXB E;  4LF9 E;  1N34 E;  1UIL A;  2L33 A;  4JI7 E;  2B7V A;  4B3R E;  1HNX E;  4JI6 E;  1YYW A;  2UUB E;  4NXN E;  2RS7 A;  5LMN E;  2LRS A;  2JY9 A;  3VYY A;  1T4L B;  2E5L E;  3P1X A;  4DV4 E;  4JYA E;  5BR8 E;  4M2Z A;  1I94 E;  2UUC E;  1RQ0 A;  4YY3 E;  4DV3 E;  4DR3 E;  2DB2 A;  1N36 E;  4JI2 E;  1FKA E;  1HNZ E;  2NUG A;  2VQF E;  4X65 E;  1RC7 A;  3J7Y p;  4DV0 E;  2L3C A;  2VQE E;  2IHR 1;  1ZBT A;  4DV6 E;  2CPN A;  5CFF E;  4OOG C;  2N3G A;  1XMQ E;  2L2M A;  1J26 A;  4LF8 E;  4DV7 E;  4X8W A;  4JI3 E;  2UU9 E;  2UUA E;  5LMU E;  1IBK E;  4JV5 E;  4YHH E;  2HHH E;  4GKK E;  4NXM E;  3T1H E;  4X66 E;  1X47 A;  5IWA E;  4DV1 E;  4LFB E;  1X49 A;  1O0W A;  4LF6 E;  2LTS A;  4LF4 E;  4DR6 E;  1HNW E;  2NUF A;  3T1Y E;  4DR7 E;  3ADJ A;  4DUZ E;  4LFA E;  1J5E E;  4DR5 E;  1WHN A;  2UXD E;  2MDR A;  1PKP A;  1X48 A;  1YYK A;  2LTR A;  1QU6 A;  3C4T A;  4X64 E;  1EKZ A;  3ADG A;  2YT4 A;  2B3T B;  1WHQ A;  4X62 E;  2RS6 A;  4DV2 E;  2F4V E;  2NA2 A;  1XNQ E;  4OX9 E;  1GQE A;  2L2K B;  4K0K E;  1STU A;  3ADL A;  1HR0 E;  1XNR E;  2DIX A;  1YZ9 A;  2KHX A;  3HTX A;  4AQY E;  2UXC E;  1N33 E;  3VYX A;  4DKK A;  2DMY A;  4LF5 E;  2L3J A;  4WYQ B;  4DR2 E;  3C4B A;  4WFT A;  1FJG E;  1IBL E;  4LF7 E;  4JI0 E;  4JI1 E;  2RSM A;  4DR1 E;  2NUE A;  3ADI A;  2LJH A;  2LUP B;  1YYO A;  4B3M E;  1UHZ A;  2JVA A;  4KHP E;  3LLH A;  4B3T E;  3OTO E;  4DR4 E;  4JI5 E;  4JI8 E;  4B3S E;  4DV5 E;  2RTX A;  4DUY E;  1DI2 A;  1IBM E;  2EZ6 A;  1T4N A;  1N32 E;  2N3H A;  2L2N A;  2B7T A; 
#chains in the Genus database with same CATH topology
 3VHT B;  3JTZ A;  3OML A;  2ZM6 E;  2EN8 A;  5IT9 C;  2EM9 A;  1N34 E;  2L33 A;  2B7V A;  4B3R E;  4JI6 E;  1BBG A;  2E72 A;  2K4V A;  2RS7 A;  5LMN E;  2LRS A;  1T4L B;  2A25 A;  3P1X A;  1IMU A;  2EQ0 A;  3J81 C;  5BR8 E;  2UUC E;  1A1G A;  2CT1 A;  3JU0 A;  2GPI A;  4DV3 E;  1HNZ E;  3LML A;  1WRJ A;  2YTO A;  4ZYH A;  2R76 A;  4X65 E;  2EQ1 A;  2WCC 3;  4DV6 E;  5CFF E;  2EQ3 A;  2UU9 E;  5ADZ A;  2EN1 A;  5LMU E;  2HHH E;  4R2C A;  1PJT A;  4NXM E;  4LU9 A;  2YTE A;  1MEY C;  2EMW A;  5IWA E;  2LV2 A;  4DV1 E;  2M4I A;  4LTY A;  4LF6 E;  2LTS A;  1GZ6 A;  3T1Y E;  3EQ1 A;  4N4R B;  4ZYD A;  2HGH A;  3ADJ A;  4DUZ E;  2L6M A;  4LFA E;  1J5E E;  4BBY A;  1X5W A;  4DR5 E;  2MDR A;  1PKP A;  2YSO A;  1YYK A;  2JPA A;  1X6F A;  2LJU A;  2YPN A;  5AE1 A;  1JK1 A;  1EKZ A;  2FGG A;  2EOR A;  5F3W A;  3J7A G;  2YTQ A;  2RS6 A;  3BID A;  2EOS A;  2NA2 A;  4OX9 E;  1STU A;  2YRH A;  3QG5 C;  2CSH A;  2YZT A;  2MC6 A;  4AQY E;  2LO3 A;  2I13 A;  4DKK A;  4LF5 E;  4WYQ B;  2LMZ A;  3C4B A;  4WFT A;  2WZO A;  1AAY A;  2YTD A;  1FJG E;  4JI0 E;  4JI1 E;  4F9B B;  2NUE A;  1NEI A;  2LJH A;  4B3M E;  3C6K A;  2EMH A;  2JYA A;  4KZS A;  1WXR A;  2MDG A;  4P78 A;  2EJ4 A;  4KHP E;  4WPY A;  5AE2 A;  2YTI A;  1KJK A;  2Q8U A;  5A6K A;  2VRD A;  4WXD A;  3C6M A;  4F2J C;  2V89 A;  1F2I G;  2DGC A;  3THO B;  2EZ6 A;  3KWR A;  1T4N A;  2VF1 A;  4KWY A;  4TUI A;  3EPJ A;  2EPP A;  4IS1 C;  1YUJ A;  2EN4 A;  1IQO A;  2JOB A;  1T4O A;  4R03 A;  1UN6 B;  4R2P A;  2JXP A;  4R8O A;  4BC9 A;  2MKN A;  4O24 A;  1HNX E;  2V85 A;  2UUB E;  1ZR9 A;  1YUI A;  5A6A A;  2JY9 A;  3VK6 A;  4M2Z A;  3FIG A;  2EML A;  1RQ0 A;  2BBG A;  2ELY A;  2EMB A;  2MKD A;  4YY3 E;  2HC5 A;  4F54 A;  1FKA E;  4BCA A;  4BHB A;  2EOZ A;  1RC7 A;  2DLQ A;  2VQE E;  1ZBT A;  2CPN A;  3L00 A;  2N3G A;  1XMQ E;  3HQ1 A;  4LF8 E;  4DV7 E;  2EN6 A;  1IBK E;  4GKK E;  3HPZ A;  2J7J A;  4BS9 A;  3T1H E;  1YSA C;  4X66 E;  2EMF A;  5IXM B;  2HJJ A;  3F6H A;  1EH7 A;  5A6J A;  1T39 A;  2EN7 A;  1HNW E;  3DJW A;  2YSP A;  3BBG A;  2EM3 A;  2EL5 A;  3RMP A;  2EMX A;  1TF6 A;  1QU6 A;  4X64 E;  2ODR C;  4F6N A;  2I9I A;  2YT4 A;  4R2A A;  2B3T B;  1WHQ A;  4X62 E;  3IWC A;  2V8Q B;  4DV2 E;  4R2S A;  2V87 A;  4WSP A;  2EL4 A;  1YZ9 A;  2KHX A;  2H36 X;  2RQL A;  2YTJ A;  2DMY A;  4IJD A;  2L3J A;  4DR2 E;  2EL6 A;  1IBL E;  4DR1 E;  2LUP B;  1A1I A;  2EMY A;  1UHZ A;  4ZYG A;  2JVA A;  1PDA A;  4B3T E;  2KON A;  4DR4 E;  1ZBQ A;  2L8T A;  2EPC A;  4BMJ A;  4JI5 E;  3MHS C;  1DQ3 A;  2L2N A;  2EPU A;  2B7T A;  2RSI A;  4R2E A;  4Q28 A;  2D9H A;  4P7D A;  4JI4 E;  4WXC A;  2LUQ A;  4GKJ E;  4M30 A;  1SFE A;  4LFC E;  3EPK A;  4JI7 E;  5AAS A;  2EMI A;  1GTK A;  2EPL X;  1YYW A;  4HEI A;  3VYY A;  4DV4 E;  3IWB A;  2EM6 A;  1SR9 A;  2EPN A;  2M9A A;  5KL5 A;  1I94 E;  2EMA A;  2GLI A;  4DMI A;  5FLX C;  4HTG A;  1QNT A;  2DB2 A;  2V83 A;  4JI2 E;  2YTG A;  2VQF E;  2YRK A;  2EPR A;  3HXL A;  5TSE A;  2N8X A;  2ENH A;  1UBD C;  2EE8 A;  4OOG C;  2YTF A;  2L2M A;  3AV0 A;  4ZYE A;  4X8W A;  4JI3 E;  4Q35 B;  2UUA E;  4F6M A;  1ZAA C;  5KL6 A;  3K6Q A;  1RMD A;  5T6J A;  2MC5 A;  4LFB E;  2EOJ A;  1O0W A;  4DR6 E;  2NUF A;  4WSG A;  3KZZ A;  2JR1 A;  4R2D A;  1A1L A;  2EOF A;  2EPX A;  1WHN A;  2UXD E;  1X48 A;  2PRT A;  4WX9 A;  1X3C A;  2LTR A;  2ELZ A;  3IWD A;  4GZN C;  1YFH A;  5A6B A;  1DGC A;  2EM7 A;  3UK3 C;  3ZOQ B;  2YRM A;  2WBS A;  2JWO A;  4R2R A;  3KZY A;  3MSW A;  1GQE A;  2ODR D;  2DMI A;  4M0V A;  4O43 A;  2EM8 A;  3TQM A;  1X6H A;  2EPA A;  2VE7 C;  4M9V C;  3AUZ A;  1A1K A;  2GHF A;  2JOX A;  2EOM A;  1PJS A;  1KYQ A;  3J80 C;  2EOE A;  2V86 A;  5A6B D;  1AH5 A;  1L4S A;  2RSM A;  4L5N C;  5KL2 A;  1MGT A;  2V88 A;  4BHC A;  2RPC A;  2EPO A;  2EOO A;  4F9C B;  1LLM C;  1ZU1 A;  2YTN A;  4JI8 E;  3EPH A;  4DV5 E;  1JK2 A;  4DUY E;  5IV8 B;  1DI2 A;  1IBM E;  2EP3 A;  4BC7 A;  2ENC A;  2EOX A;  5KL3 A;  1A1J A;  3DF6 A;  3M99 B;  3BF2 A;  2EPM X;  2EMZ A;  2LBS B;  1XMO E;  4MLQ A;  2G7H A;  2UXB E;  4LF9 E;  3ECR A;  1UIL A;  2DSY A;  4TUG A;  5AC4 A;  5KL4 A;  2JP9 A;  4O5G A;  2M7Q A;  4NXN E;  4RHB B;  2E5L E;  2EN3 A;  2EOQ A;  2DRP A;  1B69 A;  1TF3 A;  4JYA E;  2LCE A;  2EM5 A;  2CTD A;  1EH8 A;  2FTX B;  5A2Q C;  4DR3 E;  1N36 E;  2NUG A;  1BB8 A;  2EPK X;  3J7Y p;  4DV0 E;  2L3C A;  2IHR 1;  2EPZ A;  1J26 A;  2BB8 A;  2YTP A;  4JV5 E;  4YHH E;  2F8B A;  2KOU A;  1N3G A;  2K7I A;  4FK5 C;  2WBU A;  1A1F A;  1X47 A;  1G2F C;  2EMG A;  1X49 A;  3EPL A;  4NHR A;  1TN9 A;  4LF4 E;  4X9J A;  4R2Q A;  2LT7 A;  1IQS A;  4DR7 E;  3JAM C;  3F6G A;  2B9D A;  3HPS A;  4NZV A;  5KL7 A;  3BGH A;  1BBO A;  1EH6 A;  1A1H A;  4RH8 A;  3C4T A;  2ADR A;  3ADG A;  3H09 A;  1NCS A;  2EM0 A;  2EWL A;  2F4V E;  1XNQ E;  2LVH A;  2L92 A;  1YPN A;  2L2K B;  4K0K E;  4J8Z A;  2EM2 A;  3ADL A;  1HR0 E;  1WJP A;  1XNR E;  2DIX A;  4O4K A;  2UXC E;  1N33 E;  3VYX A;  4I8O A;  2YU8 A;  1P47 A;  4LF7 E;  5LL6 R;  2EOI A;  4GEQ B;  3THN A;  5A69 A;  3ADI A;  2YU5 A;  3MHH C;  2ENA A;  5LLQ A;  1YYO A;  2E1M A;  4MLV A;  2EOH A;  2EMC A;  1PJQ A;  3LLH A;  1T38 A;  3OTO E;  2EN2 A;  1Z1B A;  2FV4 B;  5DNY A;  1X6E A;  2EMK A;  5AC5 A;  4B3S E;  2DLK A;  2YWQ A;  2RTX A;  2R1F A;  2EM4 A;  2M1S A;  2EOY A;  2LE2 A;  2N3H A;  4L8N A;  1N32 E;  2NAB A;  4F9A B;  5AE3 A;  3HTX A;  2WBT A;  1G2D C; 
#chains in the Genus database with same CATH homology
 1T4O A;  3DF6 A;  4Q28 A;  4P7D A;  4R03 A;  4JI4 E;  2LUQ A;  4GKJ E;  3JTZ A;  4M30 A;  2LBS B;  4B3R E;  3OML A;  4LFC E;  1XMO E;  2ZM6 E;  5IT9 C;  2G7H A;  4R8O A;  4LF9 E;  2UXB E;  4BC9 A;  1N34 E;  1UIL A;  2DSY A;  2L33 A;  2B7V A;  4JI7 E;  5AAS A;  2V85 A;  4TUG A;  1HNX E;  4JI6 E;  2M7Q A;  1YYW A;  2UUB E;  4NXN E;  2K4V A;  2RS7 A;  5LMN E;  2LRS A;  2JY9 A;  3VYY A;  1T4L B;  2E5L E;  3P1X A;  3VK6 A;  4DV4 E;  3J81 C;  4JYA E;  5BR8 E;  3IWB A;  4M2Z A;  1SR9 A;  1I94 E;  2UUC E;  3FIG A;  3JU0 A;  1RQ0 A;  2FTX B;  4DMI A;  4YY3 E;  5FLX C;  5A2Q C;  2DB2 A;  2V83 A;  4DV3 E;  4F54 A;  4DR3 E;  1N36 E;  2VQF E;  1FKA E;  3LML A;  4BCA A;  1HNZ E;  3HXL A;  4X65 E;  1RC7 A;  3J7Y p;  4DV0 E;  2L3C A;  2VQE E;  2IHR 1;  1ZBT A;  4DV6 E;  2CPN A;  5CFF E;  4OOG C;  2N3G A;  1XMQ E;  2L2M A;  3AV0 A;  3HQ1 A;  1J26 A;  4LF8 E;  4DV7 E;  4X8W A;  4JI3 E;  2UU9 E;  2UUA E;  5ADZ A;  5LMU E;  1IBK E;  4JV5 E;  4YHH E;  2HHH E;  2F8B A;  2KOU A;  4GKK E;  3HPZ A;  4NXM E;  4BS9 A;  3K6Q A;  3T1H E;  4X66 E;  4LU9 A;  5T6J A;  1X47 A;  5IWA E;  2MC5 A;  3F6H A;  4DV1 E;  2M4I A;  4LTY A;  4LFB E;  1X49 A;  1O0W A;  4LF6 E;  2LTS A;  4LF4 E;  1GZ6 A;  4DR6 E;  1HNW E;  3DJW A;  3T1Y E;  2NUF A;  4DR7 E;  3JAM C;  3F6G A;  2B9D A;  2JR1 A;  3HPS A;  3ADJ A;  4DUZ E;  2L6M A;  4LFA E;  1J5E E;  4BBY A;  4DR5 E;  1WHN A;  2NUG A;  2UXD E;  2MDR A;  1PKP A;  1X48 A;  3RMP A;  1YYK A;  5AE1 A;  2LTR A;  1QU6 A;  2FGG A;  3C4T A;  3IWD A;  2ODR C;  4X64 E;  1EKZ A;  3ADG A;  3ZOQ B;  2YT4 A;  3H09 A;  5F3W A;  2B3T B;  1WHQ A;  4X62 E;  2EWL A;  2RS6 A;  2V8Q B;  3IWC A;  4DV2 E;  3J7A G;  2JWO A;  2F4V E;  2NA2 A;  1XNQ E;  3MSW A;  1GQE A;  2L92 A;  2L2K B;  4OX9 E;  1STU A;  4J8Z A;  4K0K E;  3ADL A;  1HR0 E;  2ODR D;  2V87 A;  2YZT A;  1XNR E;  4M0V A;  4WSP A;  2MC6 A;  2DIX A;  1YZ9 A;  2KHX A;  3HTX A;  4AQY E;  2H36 X;  2VE7 C;  2UXC E;  1N33 E;  3AUZ A;  4DKK A;  3VYX A;  2DMY A;  4LF5 E;  2JOX A;  2L3J A;  4WYQ B;  3J80 C;  2LMZ A;  3C4B A;  4I8O A;  4DR2 E;  2V86 A;  4WFT A;  2WZO A;  1FJG E;  1IBL E;  4LF7 E;  5LL6 R;  4GEQ B;  4JI0 E;  4JI1 E;  2RSM A;  4L5N C;  4F9B B;  4DR1 E;  2NUE A;  3ADI A;  2V88 A;  2LJH A;  2LUP B;  1YYO A;  4B3M E;  2E1M A;  4JI2 E;  4KZS A;  1UHZ A;  1WXR A;  2JVA A;  4P78 A;  4KHP E;  3LLH A;  4B3T E;  4WPY A;  2KON A;  4F9C B;  3OTO E;  5AE2 A;  4DR4 E;  1ZBQ A;  2FV4 B;  2L8T A;  5DNY A;  4BMJ A;  4JI5 E;  4JI8 E;  4B3S E;  4DV5 E;  2RTX A;  4DUY E;  2V89 A;  1DI2 A;  1IBM E;  2EZ6 A;  3KWR A;  1T4N A;  1DQ3 A;  2VF1 A;  2M1S A;  2LE2 A;  4L8N A;  2N3H A;  2L2N A;  4BC7 A;  4TUI A;  1N32 E;  4F9A B;  5AE3 A;  2B7T A;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...