4WFTA

Crystal structure of trna-dihydrouridine(20) synthase dsrbd domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
SGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
publication title An extended dsRBD is required for post-transcriptional modification in human tRNAs.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 1.3.1.-:
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wftA00
2LUPB 2JVAA 4WFTA 2MDRA 1STUA 1YYOA 4JI4E 1X47A 1IBLE 4YY3E 1QU6A 1N34E 1XNQE 2F4VE 1WHQA 2N3GA 1UILA 4KHPE 1I94E 2KHXA 4JI1E 1YYKA 5LMUE 2LJHA 1RQ0A 4JI6E 2NUFA 2DB2A 3P1XA 2B3TB 4LFAE 1YZ9A 1J26A 4X66E 3C4BA 2B7TA 5LMNE 4AQYE 2EZ6A 1GQEA 4DR3E 4JYAE 4X64E 4YHHE 4X8WA 1WHNA 2UXDE 2YT4A 1RC7A 4DUYE 4DV4E 2RS6A 4JI3E 2LTSA 1O0WA 2DMYA 4LF8E 1XMQE 4GKKE 4JI5E 1N32E 2LRSA 3T1YE 2DIXA 1X48A 1PKPA 2NUEA 2IHR1 4B3ME 4DV2E 4DV1E 2UUAE 1N33E 4JI0E 4OOGC 3LLHA 4DV6E 3ADIA 4DV0E 5IWAE 3C4TA 2UXBE 1HNXE 4OX9E 1X49A 2LTRA 1T4OA 1HNWE 3ADGA 2UUBE 2NA2A 4JI2E 2CPNA 2UUCE 2NUGA 3ADJA 4DV3E 2UU9E 2VQEE 1J5EE 2UXCE 4NXNE 1IBKE 2ZM6E 4DV7E 1FKAE 2VQFE 4X65E 4B3RE 4LFBE 4JI8E 4DKKA 4B3SE 3VYXA 1T4NA 2L3CA 4X62E 4DV5E 2B7VA 1T4LB 4LF4E 3HTXA 3T1HE 4LF5E 4DR6E 2RSMA 5BR8E 4LF9E 5CFFE 4K0KE 2L3JA 4M30A 4JV5E 1DI2A 1FJGE 2L2NA 1XMOE 4GKJE 1XNRE 4WYQB 2L2KB 4LF6E 3VYYA 2LBSB 1YYWA 1HNZE 3J7Yp 4NXME 2LUQA 4JI7E 4DUZE 2L33A 4LF7E 4DR2E 4DR4E 2E5LE 4DR1E 2HHHE 1ZBTA 1EKZA 4B3TE 2RTXA 2JY9A 1N36E 4DR7E 2L2MA 1UHZA 1IBME 2RS7A 1HR0E 2N3HA 4M2ZA 4LFCE 3ADLA 3OTOE 4DR5E
chains in the Genus database with same CATH superfamily
5AE1A 2LUPB 1A1FA 2FGGA 2LE2A 1DGCA 1STUA 1NEIA 1X47A 3K6QA 4KHPE 2EM5A 2KHXA 4TUGA 4BC7A 1YYKA 2EMKA 5LMUE 1P47A 2LJHA 2EMXA 5KL3A 1WRJA 4NHRA 2DB2A 3P1XA 2NUFA 4LFAE 4X66E 2RPCA 2YTJA 1F2IG 5LMNE 2EPNA 2LJUA 4GZNC 4JYAE 5A6KA 2YT4A 2MDGA 1RC7A 4IS1C 2NABA 3J81C 1EH7A 2LTSA 2EP3A 4LF8E 3IWBA 1DQ3A 3T1YE 1X48A 2YTGA 3VK6A 1GZ6A 4RH8A 4B3ME 1N33E 4JI0E 4IJDA 2R1FA 4F9BB 2MC6A 1PJSA 2EOOA 3LMLA 3MSWA 1WJPA 3KZZA 5KL2A 5A69A 1UBDC 5KL7A 1AAYA 2ENAA 4TUIA 1HNXE 4KZSA 1BBOA 2EPXA 1PDAA 2LTRA 3H09A 2GPIA 2UUBE 3DJWA 1QNTA 2FTXB 1J5EE 2DRPA 3ECRA 3EQ1A 2J7JA 1LLMC 2K7IA 5IXMB 1RMDA 4I8OA 4B3RE 1X6EA 4DKKA 4B3SE 2EE8A 1A1IA 5TSEA 3HTXA 2EQ0A 4LF9E 4R2PA 1DI2A 2YTQA 2JP9A 2K4VA 4WYQB 2V87A 2EM2A 1ZR9A 4ZYDA 3MHHC 1EH8A 3THOB 2E72A 1YYWA 2ELYA 5LLQA 2EN7A 1ZAAC 2E5LE 3DF6A 5DNYA 1N36E 2VRDA 3RMPA 1MGTA 2ENCA 2EPLX 2RS7A 2N3HA 4LFCE 4R2QA 3OTOE 4DR5E 5KL5A 4FK5C 2M9AA 1YUJA 1T38A 2VE7C 3AV0A 4JI4E 1XNQE 1IBLE 4YY3E 2F8BA 1JK2A 1WHQA 2JOBA 2N3GA 5IT9C 2EM4A 4O24A 4JI1E 2EMLA 4RHBB 2WBUA 2ODRC 2EQ1A 5T6JA 2JPAA 2B7TA 4HEIA 1YSAC 1GQEA 1X3CA 4BS9A 4DR3E 1WHNA 2UXDE 5AC4A 4DUYE 2RS6A 2EPUA 1GTKA 4JI3E 3AUZA 2L92A 5IV8B 2EPPA 2YRMA 4GKKE 1ZU1A 1N32E 2DLQA 2EM9A 1G2DC 4P7DA 3L00A 3BGHA 4DV2E 2Q8UA 2EN4A 2UUAE 4Q28A 3LLHA 2YU8A 2L8TA 5IWAE 2CSHA 4LU9A 2LV2A 3FIGA 2ELZA 2EMBA 2NA2A 2BB8A 2NUGA 3EPLA 3ADJA 2H36X 2VQEE 2MKDA 1IBKE 3F6HA 2YRKA 2YTFA 3HPZA 2ZM6E 3ZOQB 5ADZA 4X65E 2A25A 3VYXA 1TN9A 1T4NA 4DV5E 3JTZA 2B7VA 1T4LB 4LF4E 2CTDA 2ODRD 2YTPA 3IWCA 4LF5E 2D9HA 2HC5A 5BR8E 2EPCA 3KZYA 2JXPA 4BHCA 2YPNA 4JV5E 4BC9A 2EPRA 2WBTA 1IMUA 1A1HA 4LF6E 2EOFA 4BCAA 2LBSB 3J7Yp 3QG5C 4O5GA 2LUQA 4LF7E 1EKZA 2YSOA 2EQ3A 2N8XA 2G7HA 2YZTA 4DR7E 1IQOA 2EN8A 2ADRA 3ADLA 1X6FA 1MEYC 1WXRA 4O43A 5F3WA 4R2EA 4R2SA 2JWOA 4F54A 4ZYGA 2V86A 2F4VE 2JOXA 4O4KA 3HXLA 2EOXA 2DSYA 3JAMC 4F6NA 2MKNA 1RQ0A 2YTDA 4JI6E 2JYAA 3OMLA 2RQLA 1KYQA 3C4BA 4R2AA 2JR1A 4R8OA 1B69A 1PJTA 2EOJA 4DMIA 2DGCA 4X64E 4YHHE 4X8WA 2PRTA 3EPHA 2EWLA 2ENHA 2V85A 4R2DA 4WSGA 1XMQE 2DLKA 2RSIA 2GLIA 2MC5A 4JI5E 5AE2A 2EN3A 2M1SA 1PKPA 4WX9A 4F9AB 4GEQB 2EM3A 2I13A 4X9JA 2EN6A 3KWRA 3ADIA 2EOEA 3C4TA 2UXBE 2KOUA 2YTIA 2EPZA 3EPJA 4F9CB 3ADGA 4JI2E 2CPNA 2FV4B 3JU0A 2EMGA 2UUCE 2EOQA 4BBYA 4DV3E 2UU9E 2HJJA 4NXNE 2EOHA 1PJQA 1JK1A 2EL6A 2VQFE 1TF3A 3C6MA 4LFBE 4NZVA 4N4RB 2L3CA 2EM8A 2I9IA 4J8ZA 2EOZA 4WXDA 2EOSA 2EOIA 2V83A 1IQSA 5CFFE 3BBGA 2E1MA 2L3JA 3BIDA 3HQ1A 2L2NA 3M99B 1A1LA 4GKJE 2EMZA 1X5WA 2L2KB 2YTEA 3VYYA 3VHTB 3J80C 4JI7E 4DUZE 2EOYA 2L33A 1Z1BA 4DR4E 4L5NC 4DR1E 1ZBTA 4B3TE 2V8QB 4LTYA 2EM7A 4R2RA 5A6BA 1A1GA 1UHZA 3F6GA 2EL5A 4R2CA 1AH5A 2JVAA 4WFTA 4ZYEA 2GHFA 2MDRA 1YYOA 3THNA 1N34E 1QU6A 2LMZA 3MHSC 1UILA 1I94E 1KJKA 3EPKA 3C6KA 2LT7A 3HPSA 2EMWA 2B3TB 2EPOA 4P78A 1YZ9A 1J26A 2EJ4A 5KL6A 5AE3A 4AQYE 2EZ6A 4BMJA 2WCC3 3BF2A 4WXCA 2YTOA 4DV4E 5AASA 2WZOA 2EMIA 1T39A 2EPAA 1YUIA 1O0WA 2DMYA 2EL4A 5KL4A 2DMIA 2LRSA 2DIXA 2EM6A 2NUEA 2YWQA 2IHR1 4HTGA 4MLVA 4DV1E 1SR9A 2YRHA 5A6BD 1A1KA 4OOGC 4WPYA 4DV6E 4DV0E 4M0VA 2YU5A 2LCEA 4Q35B 4OX9E 1X49A 2EN2A 1TF6A 3J7AG 1T4OA 4R03A 2R76A 1HNWE 1UN6B 2EMHA 2EOMA 1N3GA 2EPKX 1A1JA 2EMCA 2V89A 3UK3C 2UXCE 2B9DA 2V88A 2BBGA 2VF1A 2LO3A 2YSPA 4DV7E 1FKAE 4KWYA 4JI8E 1X6HA 2EMFA 2WBSA 4X62E 5A6AA 3T1HE 4BHBA 4DR6E 2RSMA 2LVHA 1G2FC 5LL6R 2KONA 5AC5A 4WSPA 4K0KE 2EPMX 4M30A 1YFHA 1FJGE 1YPNA 1SFEA 2M4IA 4MLQA 1XMOE 1XNRE 1ZBQA 5A6JA 2EM0A 4ZYHA 4F6MA 2CT1A 5A2QC 3TQMA 1HNZE 4NXME 1NCSA 2YTNA 4F2JC 2EN1A 4M9VC 2EMYA 4DR2E 2L6MA 5FLXC 2EMAA 2HHHE 2RTXA 2JY9A 2EORA 2L2MA 1IBME 2HGHA 1BB8A 1BBGA 3IWDA 4M2ZA 1HR0E 1EH6A 2M7QA 1L4SA 4L8NA
chains in the Genus database with same CATH topology
5AE1A 2LUPB 2JVAA 2FGGA 2LE2A 4WFTA 1WXRA 5F3WA 2JWOA 2MDRA 1STUA 4F54A 2VE7C 3AV0A 1YYOA 4JI4E 1X47A 2V86A 4YY3E 1QU6A 2LMZA 2F8BA 3K6QA 1N34E 1WHQA 2JOBA 2N3GA 2F4VE 1UILA 5IT9C 4KHPE 1I94E 2JOXA 2KHXA 3HXLA 4TUGA 2DSYA 3JAMC 4JI1E 4BC7A 1YYKA 5LMUE 2LJHA 1RQ0A 4JI6E 2ODRC 2NUFA 2DB2A 3HPSA 2B3TB 3OMLA 3P1XA 4P78A 5T6JA 4X66E 4LFAE 1YZ9A 3C4BA 2B7TA 2JR1A 4R8OA 5AE3A 5LMNE 4AQYE 2EZ6A 1GQEA 4DMIA 4BS9A 4DR3E 4BMJA 4JYAE 4X64E 4YHHE 4X8WA 1WHNA 2UXDE 2YT4A 1RC7A 2EWLA 4DUYE 4DV4E 5AASA 3J81C 2RS6A 2V85A 2WZOA 4JI3E 3AUZA 2LTSA 1O0WA 2DMYA 2L92A 3IWBA 1DQ3A 4LF8E 1XMQE 4GKKE 2MC5A 4JI5E 1N32E 2LRSA 5AE2A 2DIXA 3T1YE 1X48A 2M1SA 3VK6A 1PKPA 2NUEA 2IHR1 4P7DA 1GZ6A 4B3ME 4DV2E 4F9AB 1SR9A 4DV1E 2UUAE 4GEQB 1N33E 4JI0E 4Q28A 4OOGC 1J26A 4WPYA 3LLHA 2MC6A 4F9BB 3LMLA 3MSWA 3KWRA 4DV6E 3ADIA 4DV0E 1XNQE 2L8TA 5IWAE 3C4TA 4LU9A 4M0VA 2UXBE 4TUIA 1HNXE 4KZSA 2KOUA 4OX9E 1X49A 2LTRA 3J7AG 3H09A 1T4OA 4R03A 3FIGA 4F9CB 3ADGA 2UUBE 1HNWE 2NA2A 4JI2E 2CPNA 2FV4B 3DJWA 3JU0A 2UUCE 2NUGA 3ADJA 2FTXB 4BBYA 2V89A 4DV3E 2H36X 2UU9E 2VQEE 1J5EE 2UXCE 4NXNE 2B9DA 2V88A 2VF1A 1IBKE 3F6HA 4I8OA 2ZM6E 3HPZA 4DV7E 2VQFE 1FKAE 3ZOQB 5ADZA 4X65E 4B3RE 4LFBE 4JI8E 4DKKA 4B3SE 3VYXA 1T4NA 2L3CA 4X62E 3JTZA 2B7VA 4DV5E 1T4LB 4LF4E 3HTXA 2ODRD 3T1HE 4J8ZA 3IWCA 4LF5E 4DR6E 2RSMA 5BR8E 5LL6R 2KONA 4LF9E 2V83A 4WSPA 5CFFE 4K0KE 2E1MA 2L3JA 4M30A 4JV5E 1DI2A 1FJGE 3HQ1A 4BC9A 2K4VA 2L2NA 2M4IA 1XMOE 4GKJE 1XNRE 4WYQB 1ZBQA 2V87A 2L2KB 3VYYA 4LF6E 1IBLE 4BCAA 5A2QC 2LBSB 1YYWA 1HNZE 3J7Yp 3J80C 4NXME 2LUQA 4JI7E 4DUZE 2L33A 4LF7E 4DR2E 4DR4E 2L6MA 2E5LE 3DF6A 4L5NC 5FLXC 4DR1E 2HHHE 5DNYA 1ZBTA 1EKZA 4B3TE 2V8QB 2RTXA 4LTYA 2JY9A 1N36E 2G7HA 3RMPA 2YZTA 4DR7E 2L2MA 1UHZA 1IBME 3F6GA 3IWDA 2RS7A 1HR0E 2N3HA 4M2ZA 4LFCE 3ADLA 2M7QA 3OTOE 4L8NA 4DR5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUP B;  2JVA A;  4WFT A;  2MDR A;  1STU A;  1YYO A;  4JI4 E;  1X47 A;  1IBL E;  4YY3 E;  1QU6 A;  1N34 E;  1XNQ E;  2F4V E;  1WHQ A;  2N3G A;  1UIL A;  4KHP E;  1I94 E;  2KHX A;  4JI1 E;  1YYK A;  5LMU E;  2LJH A;  1RQ0 A;  4JI6 E;  2NUF A;  2DB2 A;  3P1X A;  2B3T B;  4LFA E;  1YZ9 A;  1J26 A;  4X66 E;  3C4B A;  2B7T A;  5LMN E;  4AQY E;  2EZ6 A;  1GQE A;  4DR3 E;  4JYA E;  4X64 E;  4YHH E;  4X8W A;  1WHN A;  2UXD E;  2YT4 A;  1RC7 A;  4DUY E;  4DV4 E;  2RS6 A;  4JI3 E;  2LTS A;  1O0W A;  2DMY A;  4LF8 E;  1XMQ E;  4GKK E;  4JI5 E;  1N32 E;  2LRS A;  3T1Y E;  2DIX A;  1X48 A;  1PKP A;  2NUE A;  2IHR 1;  4B3M E;  4DV2 E;  4DV1 E;  2UUA E;  1N33 E;  4JI0 E;  4OOG C;  3LLH A;  4DV6 E;  3ADI A;  4DV0 E;  5IWA E;  3C4T A;  2UXB E;  1HNX E;  4OX9 E;  1X49 A;  2LTR A;  1T4O A;  1HNW E;  3ADG A;  2UUB E;  2NA2 A;  4JI2 E;  2CPN A;  2UUC E;  2NUG A;  3ADJ A;  4DV3 E;  2UU9 E;  2VQE E;  1J5E E;  2UXC E;  4NXN E;  1IBK E;  2ZM6 E;  4DV7 E;  1FKA E;  2VQF E;  4X65 E;  4B3R E;  4LFB E;  4JI8 E;  4DKK A;  4B3S E;  3VYX A;  1T4N A;  2L3C A;  4X62 E;  4DV5 E;  2B7V A;  1T4L B;  4LF4 E;  3HTX A;  3T1H E;  4LF5 E;  4DR6 E;  2RSM A;  5BR8 E;  4LF9 E;  5CFF E;  4K0K E;  2L3J A;  4M30 A;  4JV5 E;  1DI2 A;  1FJG E;  2L2N A;  1XMO E;  4GKJ E;  1XNR E;  4WYQ B;  2L2K B;  4LF6 E;  3VYY A;  2LBS B;  1YYW A;  1HNZ E;  3J7Y p;  4NXM E;  2LUQ A;  4JI7 E;  4DUZ E;  2L33 A;  4LF7 E;  4DR2 E;  4DR4 E;  2E5L E;  4DR1 E;  2HHH E;  1ZBT A;  1EKZ A;  4B3T E;  2RTX A;  2JY9 A;  1N36 E;  4DR7 E;  2L2M A;  1UHZ A;  1IBM E;  2RS7 A;  1HR0 E;  2N3H A;  4M2Z A;  4LFC E;  3ADL A;  3OTO E;  4DR5 E; 
#chains in the Genus database with same CATH topology
 5AE1 A;  2LUP B;  1A1F A;  2FGG A;  2LE2 A;  1DGC A;  1STU A;  1NEI A;  1X47 A;  3K6Q A;  4KHP E;  2EM5 A;  2KHX A;  4TUG A;  4BC7 A;  1YYK A;  2EMK A;  5LMU E;  1P47 A;  2LJH A;  2EMX A;  5KL3 A;  1WRJ A;  4NHR A;  2DB2 A;  3P1X A;  2NUF A;  4LFA E;  4X66 E;  2RPC A;  2YTJ A;  1F2I G;  5LMN E;  2EPN A;  2LJU A;  4GZN C;  4JYA E;  5A6K A;  2YT4 A;  2MDG A;  1RC7 A;  4IS1 C;  2NAB A;  3J81 C;  1EH7 A;  2LTS A;  2EP3 A;  4LF8 E;  3IWB A;  1DQ3 A;  3T1Y E;  1X48 A;  2YTG A;  3VK6 A;  1GZ6 A;  4RH8 A;  4B3M E;  1N33 E;  4JI0 E;  4IJD A;  2R1F A;  4F9B B;  2MC6 A;  1PJS A;  2EOO A;  3LML A;  3MSW A;  1WJP A;  3KZZ A;  5KL2 A;  5A69 A;  1UBD C;  5KL7 A;  1AAY A;  2ENA A;  4TUI A;  1HNX E;  4KZS A;  1BBO A;  2EPX A;  1PDA A;  2LTR A;  3H09 A;  2GPI A;  2UUB E;  3DJW A;  1QNT A;  2FTX B;  1J5E E;  2DRP A;  3ECR A;  3EQ1 A;  2J7J A;  1LLM C;  2K7I A;  5IXM B;  1RMD A;  4I8O A;  4B3R E;  1X6E A;  4DKK A;  4B3S E;  2EE8 A;  1A1I A;  5TSE A;  3HTX A;  2EQ0 A;  4LF9 E;  4R2P A;  1DI2 A;  2YTQ A;  2JP9 A;  2K4V A;  4WYQ B;  2V87 A;  2EM2 A;  1ZR9 A;  4ZYD A;  3MHH C;  1EH8 A;  3THO B;  2E72 A;  1YYW A;  2ELY A;  5LLQ A;  2EN7 A;  1ZAA C;  2E5L E;  3DF6 A;  5DNY A;  1N36 E;  2VRD A;  3RMP A;  1MGT A;  2ENC A;  2EPL X;  2RS7 A;  2N3H A;  4LFC E;  4R2Q A;  3OTO E;  4DR5 E;  5KL5 A;  4FK5 C;  2M9A A;  1YUJ A;  1T38 A;  2VE7 C;  3AV0 A;  4JI4 E;  1XNQ E;  1IBL E;  4YY3 E;  2F8B A;  1JK2 A;  1WHQ A;  2JOB A;  2N3G A;  5IT9 C;  2EM4 A;  4O24 A;  4JI1 E;  2EML A;  4RHB B;  2WBU A;  2ODR C;  2EQ1 A;  5T6J A;  2JPA A;  2B7T A;  4HEI A;  1YSA C;  1GQE A;  1X3C A;  4BS9 A;  4DR3 E;  1WHN A;  2UXD E;  5AC4 A;  4DUY E;  2RS6 A;  2EPU A;  1GTK A;  4JI3 E;  3AUZ A;  2L92 A;  5IV8 B;  2EPP A;  2YRM A;  4GKK E;  1ZU1 A;  1N32 E;  2DLQ A;  2EM9 A;  1G2D C;  4P7D A;  3L00 A;  3BGH A;  4DV2 E;  2Q8U A;  2EN4 A;  2UUA E;  4Q28 A;  3LLH A;  2YU8 A;  2L8T A;  5IWA E;  2CSH A;  4LU9 A;  2LV2 A;  3FIG A;  2ELZ A;  2EMB A;  2NA2 A;  2BB8 A;  2NUG A;  3EPL A;  3ADJ A;  2H36 X;  2VQE E;  2MKD A;  1IBK E;  3F6H A;  2YRK A;  2YTF A;  3HPZ A;  2ZM6 E;  3ZOQ B;  5ADZ A;  4X65 E;  2A25 A;  3VYX A;  1TN9 A;  1T4N A;  4DV5 E;  3JTZ A;  2B7V A;  1T4L B;  4LF4 E;  2CTD A;  2ODR D;  2YTP A;  3IWC A;  4LF5 E;  2D9H A;  2HC5 A;  5BR8 E;  2EPC A;  3KZY A;  2JXP A;  4BHC A;  2YPN A;  4JV5 E;  4BC9 A;  2EPR A;  2WBT A;  1IMU A;  1A1H A;  4LF6 E;  2EOF A;  4BCA A;  2LBS B;  3J7Y p;  3QG5 C;  4O5G A;  2LUQ A;  4LF7 E;  1EKZ A;  2YSO A;  2EQ3 A;  2N8X A;  2G7H A;  2YZT A;  4DR7 E;  1IQO A;  2EN8 A;  2ADR A;  3ADL A;  1X6F A;  1MEY C;  1WXR A;  4O43 A;  5F3W A;  4R2E A;  4R2S A;  2JWO A;  4F54 A;  4ZYG A;  2V86 A;  2F4V E;  2JOX A;  4O4K A;  3HXL A;  2EOX A;  2DSY A;  3JAM C;  4F6N A;  2MKN A;  1RQ0 A;  2YTD A;  4JI6 E;  2JYA A;  3OML A;  2RQL A;  1KYQ A;  3C4B A;  4R2A A;  2JR1 A;  4R8O A;  1B69 A;  1PJT A;  2EOJ A;  4DMI A;  2DGC A;  4X64 E;  4YHH E;  4X8W A;  2PRT A;  3EPH A;  2EWL A;  2ENH A;  2V85 A;  4R2D A;  4WSG A;  1XMQ E;  2DLK A;  2RSI A;  2GLI A;  2MC5 A;  4JI5 E;  5AE2 A;  2EN3 A;  2M1S A;  1PKP A;  4WX9 A;  4F9A B;  4GEQ B;  2EM3 A;  2I13 A;  4X9J A;  2EN6 A;  3KWR A;  3ADI A;  2EOE A;  3C4T A;  2UXB E;  2KOU A;  2YTI A;  2EPZ A;  3EPJ A;  4F9C B;  3ADG A;  4JI2 E;  2CPN A;  2FV4 B;  3JU0 A;  2EMG A;  2UUC E;  2EOQ A;  4BBY A;  4DV3 E;  2UU9 E;  2HJJ A;  4NXN E;  2EOH A;  1PJQ A;  1JK1 A;  2EL6 A;  2VQF E;  1TF3 A;  3C6M A;  4LFB E;  4NZV A;  4N4R B;  2L3C A;  2EM8 A;  2I9I A;  4J8Z A;  2EOZ A;  4WXD A;  2EOS A;  2EOI A;  2V83 A;  1IQS A;  5CFF E;  3BBG A;  2E1M A;  2L3J A;  3BID A;  3HQ1 A;  2L2N A;  3M99 B;  1A1L A;  4GKJ E;  2EMZ A;  1X5W A;  2L2K B;  2YTE A;  3VYY A;  3VHT B;  3J80 C;  4JI7 E;  4DUZ E;  2EOY A;  2L33 A;  1Z1B A;  4DR4 E;  4L5N C;  4DR1 E;  1ZBT A;  4B3T E;  2V8Q B;  4LTY A;  2EM7 A;  4R2R A;  5A6B A;  1A1G A;  1UHZ A;  3F6G A;  2EL5 A;  4R2C A;  1AH5 A;  2JVA A;  4WFT A;  4ZYE A;  2GHF A;  2MDR A;  1YYO A;  3THN A;  1N34 E;  1QU6 A;  2LMZ A;  3MHS C;  1UIL A;  1I94 E;  1KJK A;  3EPK A;  3C6K A;  2LT7 A;  3HPS A;  2EMW A;  2B3T B;  2EPO A;  4P78 A;  1YZ9 A;  1J26 A;  2EJ4 A;  5KL6 A;  5AE3 A;  4AQY E;  2EZ6 A;  4BMJ A;  2WCC 3;  3BF2 A;  4WXC A;  2YTO A;  4DV4 E;  5AAS A;  2WZO A;  2EMI A;  1T39 A;  2EPA A;  1YUI A;  1O0W A;  2DMY A;  2EL4 A;  5KL4 A;  2DMI A;  2LRS A;  2DIX A;  2EM6 A;  2NUE A;  2YWQ A;  2IHR 1;  4HTG A;  4MLV A;  4DV1 E;  1SR9 A;  2YRH A;  5A6B D;  1A1K A;  4OOG C;  4WPY A;  4DV6 E;  4DV0 E;  4M0V A;  2YU5 A;  2LCE A;  4Q35 B;  4OX9 E;  1X49 A;  2EN2 A;  1TF6 A;  3J7A G;  1T4O A;  4R03 A;  2R76 A;  1HNW E;  1UN6 B;  2EMH A;  2EOM A;  1N3G A;  2EPK X;  1A1J A;  2EMC A;  2V89 A;  3UK3 C;  2UXC E;  2B9D A;  2V88 A;  2BBG A;  2VF1 A;  2LO3 A;  2YSP A;  4DV7 E;  1FKA E;  4KWY A;  4JI8 E;  1X6H A;  2EMF A;  2WBS A;  4X62 E;  5A6A A;  3T1H E;  4BHB A;  4DR6 E;  2RSM A;  2LVH A;  1G2F C;  5LL6 R;  2KON A;  5AC5 A;  4WSP A;  4K0K E;  2EPM X;  4M30 A;  1YFH A;  1FJG E;  1YPN A;  1SFE A;  2M4I A;  4MLQ A;  1XMO E;  1XNR E;  1ZBQ A;  5A6J A;  2EM0 A;  4ZYH A;  4F6M A;  2CT1 A;  5A2Q C;  3TQM A;  1HNZ E;  4NXM E;  1NCS A;  2YTN A;  4F2J C;  2EN1 A;  4M9V C;  2EMY A;  4DR2 E;  2L6M A;  5FLX C;  2EMA A;  2HHH E;  2RTX A;  2JY9 A;  2EOR A;  2L2M A;  1IBM E;  2HGH A;  1BB8 A;  1BBG A;  3IWD A;  4M2Z A;  1HR0 E;  1EH6 A;  2M7Q A;  1L4S A;  4L8N A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  2LUP B;  2JVA A;  2FGG A;  2LE2 A;  4WFT A;  1WXR A;  5F3W A;  2JWO A;  2MDR A;  1STU A;  4F54 A;  2VE7 C;  3AV0 A;  1YYO A;  4JI4 E;  1X47 A;  2V86 A;  4YY3 E;  1QU6 A;  2LMZ A;  2F8B A;  3K6Q A;  1N34 E;  1WHQ A;  2JOB A;  2N3G A;  2F4V E;  1UIL A;  5IT9 C;  4KHP E;  1I94 E;  2JOX A;  2KHX A;  3HXL A;  4TUG A;  2DSY A;  3JAM C;  4JI1 E;  4BC7 A;  1YYK A;  5LMU E;  2LJH A;  1RQ0 A;  4JI6 E;  2ODR C;  2NUF A;  2DB2 A;  3HPS A;  2B3T B;  3OML A;  3P1X A;  4P78 A;  5T6J A;  4X66 E;  4LFA E;  1YZ9 A;  3C4B A;  2B7T A;  2JR1 A;  4R8O A;  5AE3 A;  5LMN E;  4AQY E;  2EZ6 A;  1GQE A;  4DMI A;  4BS9 A;  4DR3 E;  4BMJ A;  4JYA E;  4X64 E;  4YHH E;  4X8W A;  1WHN A;  2UXD E;  2YT4 A;  1RC7 A;  2EWL A;  4DUY E;  4DV4 E;  5AAS A;  3J81 C;  2RS6 A;  2V85 A;  2WZO A;  4JI3 E;  3AUZ A;  2LTS A;  1O0W A;  2DMY A;  2L92 A;  3IWB A;  1DQ3 A;  4LF8 E;  1XMQ E;  4GKK E;  2MC5 A;  4JI5 E;  1N32 E;  2LRS A;  5AE2 A;  2DIX A;  3T1Y E;  1X48 A;  2M1S A;  3VK6 A;  1PKP A;  2NUE A;  2IHR 1;  4P7D A;  1GZ6 A;  4B3M E;  4DV2 E;  4F9A B;  1SR9 A;  4DV1 E;  2UUA E;  4GEQ B;  1N33 E;  4JI0 E;  4Q28 A;  4OOG C;  1J26 A;  4WPY A;  3LLH A;  2MC6 A;  4F9B B;  3LML A;  3MSW A;  3KWR A;  4DV6 E;  3ADI A;  4DV0 E;  1XNQ E;  2L8T A;  5IWA E;  3C4T A;  4LU9 A;  4M0V A;  2UXB E;  4TUI A;  1HNX E;  4KZS A;  2KOU A;  4OX9 E;  1X49 A;  2LTR A;  3J7A G;  3H09 A;  1T4O A;  4R03 A;  3FIG A;  4F9C B;  3ADG A;  2UUB E;  1HNW E;  2NA2 A;  4JI2 E;  2CPN A;  2FV4 B;  3DJW A;  3JU0 A;  2UUC E;  2NUG A;  3ADJ A;  2FTX B;  4BBY A;  2V89 A;  4DV3 E;  2H36 X;  2UU9 E;  2VQE E;  1J5E E;  2UXC E;  4NXN E;  2B9D A;  2V88 A;  2VF1 A;  1IBK E;  3F6H A;  4I8O A;  2ZM6 E;  3HPZ A;  4DV7 E;  2VQF E;  1FKA E;  3ZOQ B;  5ADZ A;  4X65 E;  4B3R E;  4LFB E;  4JI8 E;  4DKK A;  4B3S E;  3VYX A;  1T4N A;  2L3C A;  4X62 E;  3JTZ A;  2B7V A;  4DV5 E;  1T4L B;  4LF4 E;  3HTX A;  2ODR D;  3T1H E;  4J8Z A;  3IWC A;  4LF5 E;  4DR6 E;  2RSM A;  5BR8 E;  5LL6 R;  2KON A;  4LF9 E;  2V83 A;  4WSP A;  5CFF E;  4K0K E;  2E1M A;  2L3J A;  4M30 A;  4JV5 E;  1DI2 A;  1FJG E;  3HQ1 A;  4BC9 A;  2K4V A;  2L2N A;  2M4I A;  1XMO E;  4GKJ E;  1XNR E;  4WYQ B;  1ZBQ A;  2V87 A;  2L2K B;  3VYY A;  4LF6 E;  1IBL E;  4BCA A;  5A2Q C;  2LBS B;  1YYW A;  1HNZ E;  3J7Y p;  3J80 C;  4NXM E;  2LUQ A;  4JI7 E;  4DUZ E;  2L33 A;  4LF7 E;  4DR2 E;  4DR4 E;  2L6M A;  2E5L E;  3DF6 A;  4L5N C;  5FLX C;  4DR1 E;  2HHH E;  5DNY A;  1ZBT A;  1EKZ A;  4B3T E;  2V8Q B;  2RTX A;  4LTY A;  2JY9 A;  1N36 E;  2G7H A;  3RMP A;  2YZT A;  4DR7 E;  2L2M A;  1UHZ A;  1IBM E;  3F6G A;  3IWD A;  2RS7 A;  1HR0 E;  2N3H A;  4M2Z A;  4LFC E;  3ADL A;  2M7Q A;  3OTO E;  4L8N A;  4DR5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...