2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
molecule keywords Putative tRNA hydrolase domain
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
4JV5E 1O0WA 4LF6E 4YHHE 4WYQB 4M30A 4WFTA 4NXME 3LLHA 1RC7A 4GKJE 1RQ0A 4JI1E 4LFAE 1UHZA 4B3SE 1UILA 4AQYE 1FJGE 4DV2E 1IBLE 4X66E 4DR1E 4JI2E 4OX9E 4DV3E 2L2KB 2NUEA 2UXBE 4JI3E 2RS6A 2KHXA 1PKPA 3T1HE 3ADLA 1X48A 1X47A 4OOGC 3C4BA 2L33A 4DR4E 2DIXA 1YYWA 1XMOE 2JY9A 4K0KE 1T4LB 1N34E 4DV7E 2UUAE 4B3ME 2LJHA 4DR2E 2LUPB 1ZBTA 3C4TA 4LFBE 4NXNE 1GQEA 2LRSA 1WHQA 2RS7A 4JI8E 2DMYA 4JI4E 2DB2A 1HNZE 2E5LE 2RSMA 2LTSA 4DKKA 4KHPE 2HHHE 2RTXA 1XNQE 1WHNA 4DV0E 3ADJA 3P1XA 1N32E 4X64E 4LF7E 1FKAE 1N36E 4JI6E 2EZ6A 4LF4E 2UXCE 4JI7E 3T1YE 5IWAE 4DR6E 5BR8E 4DV6E 5LMNE 2LBSB 2B7TA 3VYXA 2L3JA 4DR3E 4LF5E 4DR7E 1QU6A 1DI2A 1XNRE 1YYOA 2L2NA 1YZ9A 1I94E 2VQFE 1XMQE 2LTRA 3J7Yp 2UU9E 4B3RE 2N3HA 4M2ZA 1EKZA 3ADGA 2JVAA 1HR0E 2F4VE 2NA2A 1X49A 1IBKE 4YY3E 4DV1E 2UUBE 2B7VA 3VYYA 2NUFA 5CFFE 4X65E 2NUGA 2N3GA 4B3TE 4LFCE 3OTOE 2LUQA 2L2MA 4JYAE 1HNWE 4DV4E 1IBME 2YT4A 3ADIA 2MDRA 4X62E 1STUA 4DUYE 2UUCE 1N33E 2VQEE 3HTXA 2L3CA 2CPNA 4DUZE 4GKKE 1YYKA 4LF9E 1T4NA 4JI0E 2UXDE 4JI5E 1J26A 4DV5E 1HNXE 1J5EE 5LMUE 1T4OA 2ZM6E 4X8WA 4LF8E 2IHR1 2B3TB 4DR5E
chains in the Genus database with same CATH superfamily
2HC5A 4JV5E 2EN8A 4LF6E 4GEQB 2YTEA 2EMCA 2EPNA 1EH8A 4NXME 4P78A 4GKJE 5AE3A 1RQ0A 3C6MA 2H36X 2EPKX 4R2PA 1AH5A 5LL6R 2LT7A 3JAMC 4AQYE 4JI2E 3QG5C 5A6AA 4BCAA 1UBDC 4F54A 4RHBB 3KWRA 2EOFA 4JI3E 2RS6A 2A25A 5KL7A 2EMXA 2WBSA 3FIGA 5IXMB 1RMDA 2JY9A 2M4IA 4K0KE 2DGCA 4B3ME 4O4KA 2EPAA 2LUPB 4BBYA 2MC5A 4I8OA 4LTYA 1TF3A 1A1FA 4JI4E 1WHQA 2DMYA 1HNZE 1X3CA 2E5LE 2VF1A 5FLXC 1TF6A 4DV0E 3ADJA 1IQOA 2VE7C 1NCSA 1FKAE 2DRPA 4BHBA 4LF4E 2UXCE 5IWAE 3THOB 2EMKA 2J7JA 4DV6E 3C6KA 4LF5E 4M9VC 2G7HA 3HPZA 3KZZA 1TN9A 1ZR9A 2LMZA 1YFHA 3JTZA 2EOEA 4IS1C 1XMQE 2EMHA 2UU9E 2N3HA 3BF2A 4ZYHA 2PRTA 2ELZA 3J81C 1X49A 1IBKE 3J80C 3HQ1A 3J7AG 4DV1E 2EQ0A 2GPIA 2B7VA 2YTNA 3VYYA 2EQ1A 4F2JC 1YSAC 5A6JA 2YTGA 4BHCA 2LUQA 1PJTA 2EN2A 5KL2A 4O43A 5AE2A 2UUCE 2YTOA 1J26A 1YYKA 1ZU1A 4JI0E 1PJSA 4JI5E 1HNXE 2EM9A 2LCEA 2EMWA 2YPNA 2ZM6E 1WJPA 1N33E 2LJUA 2M9AA 4F9CB 2JR1A 2L6MA 1O0WA 4F9AB 1X5WA 1A1JA 3EPKA 1P47A 3LLHA 4KZSA 4M0VA 3IWBA 2EL6A 2EM0A 3H09A 4N4RB 4LFAE 1KJKA 5LLQA 4B3SE 1UILA 2L8TA 1FJGE 3BBGA 1IBLE 4DR1E 2V83A 4BC7A 2JXPA 1X6EA 2YSPA 1EH6A 2EPRA 4L8NA 5AC5A 1G2DC 1PKPA 2EPUA 3JU0A 2EOOA 4DR4E 2DIXA 2CTDA 1XMOE 1PDAA 4F6MA 1T4LB 3MHSC 2LJHA 5KL4A 4BC9A 2N8XA 4L5NC 1WRJA 2DLQA 3C4TA 4O24A 3KZYA 2RS7A 1YPNA 4FK5C 4WSGA 2YWQA 2LTSA 2EOHA 2EOQA 4NZVA 2VRDA 2EJ4A 2YRMA 5TSEA 3P1XA 1N32E 4X64E 5KL3A 1N36E 4JI6E 2YRKA 2V89A 3T1YE 4KWYA 4R2RA 2LBSB 1T39A 2B7TA 3VYXA 1GTKA 4R8OA 4WXCA 2FGGA 4DR7E 1QU6A 2M1SA 4X9JA 1XNRE 1YYOA 2KOUA 2V86A 1I94E 2VQFE 2EM4A 1X6FA 2LE2A 4J8ZA 1WXRA 1EKZA 2V85A 3HPSA 1T38A 1HR0E 2F4VE 1IQSA 1A1LA 2EE8A 4YY3E 5ADZA 2EORA 2EMLA 4X65E 3M99B 4B3TE 4LFCE 2EN1A 1JK1A 5A6KA 1BBOA 2L2MA 2E1MA 3K6QA 4IJDA 1A1GA 1IBME 4F9BB 2EPCA 2WZOA 2UXDE 1A1IA 4LF9E 2I13A 3VK6A 1QNTA 2YRHA 4DV5E 1J5EE 1G2FC 4Q35B 2MKDA 5A6BD 3MSWA 2EM7A 3EPLA 4WYQB 3BIDA 2D9HA 2EMZA 4M30A 2E72A 3IWCA 1A1KA 4P7DA 2EMBA 4JI1E 4R03A 1UHZA 2MKNA 4LU9A 2EN4A 4DV2E 2CSHA 4X66E 2EN6A 4DV3E 2L2KB 2NUEA 2ENHA 5A69A 1X48A 4WSPA 3C4BA 2L33A 2DLKA 4ZYGA 5KL6A 1YYWA 2EOYA 3OMLA 4HEIA 2EM2A 3LMLA 1ZAAC 4NHRA 2EOIA 1BBGA 1ZBTA 5AE1A 2LO3A 2FV4B 2RQLA 4NXNE 1GQEA 2LRSA 4JI8E 4R2SA 2EPPA 1A1HA 2RSMA 1Z1BA 4KHPE 2LVHA 2RTXA 1N3GA 1WHNA 2EM5A 2JP9A 2R1FA 2M7QA 4LF7E 2RSIA 1SR9A 2BBGA 2ODRC 2EZ6A 1DGCA 3F6HA 4JI7E 2HJJA 5BR8E 2EMIA 4R2DA 4DR3E 4O5GA 2YU8A 2FTXB 2JYAA 1DI2A 1SFEA 2L2NA 1YZ9A 4HTGA 2YTFA 2JPAA 4RH8A 4B3RE 4M2ZA 1L4SA 4R2AA 2YTPA 3UK3C 4Q28A 2ELYA 4R2CA 1B69A 2EOJA 2YTQA 1ZBQA 2NUFA 5CFFE 2NUGA 2EL5A 2EMYA 4R2QA 2DMIA 2EMAA 1GZ6A 2K7IA 2CT1A 4JYAE 4GZNC 2YT4A 3ADIA 4TUGA 4X62E 2EOXA 2VQEE 3HTXA 2L3CA 4DUZE 4GKKE 2JOBA 2RPCA 5T6JA 5LMUE 2KONA 1T4OA 2I9IA 4X8WA 2YSOA 2YU5A 5AASA 2B3TB 3ZOQB 4LF8E 2EM3A 3ECRA 1MGTA 2Q8UA 2YTJA 4YHHE 2EPLX 5DNYA 3AUZA 4ZYDA 4WFTA 2V88A 2BB8A 1RC7A 1BB8A 2EN7A 3RMPA 2ADRA 3MHHC 1KYQA 1NEIA 2V8QB 4F6NA 5A6BA 2HGHA 4OX9E 2ENAA 4TUIA 2EQ3A 2R76A 3F6GA 2UXBE 2KHXA 3T1HE 3ADLA 3AV0A 1X47A 4OOGC 3VHTB 2EMGA 2EPXA 2LV2A 1MEYC 4WPYA 1LLMC 1N34E 2WBTA 5AC4A 4DV7E 2UUAE 2EPMX 4DR2E 3TQMA 2K4VA 2V87A 3IWDA 2EOSA 2GHFA 4LFBE 2B9DA 2DB2A 2WBUA 1JK2A 4DKKA 2GLIA 1PJQA 3EPHA 2HHHE 4BMJA 1XNQE 1IMUA 2EM8A 2EL4A 2JWOA 2MDGA 1F2IG 2EMFA 2EN3A 4DR6E 1YUIA 2MC6A 4DMIA 3THNA 5LMNE 3DJWA 5KL5A 3EQ1A 2L3JA 5IT9C 2EPZA 4WX9A 2JOXA 3HXLA 2WCC3 2YZTA 2LTRA 3J7Yp 2ENCA 2EWLA 3ADGA 2JVAA 1UN6B 2F8BA 3BGHA 2NA2A 4MLVA 2EOZA 2EPOA 2UUBE 4ZYEA 2YTIA 3L00A 2L92A 5F3WA 2N3GA 2EOMA 2YTDA 1DQ3A 5IV8B 5A2QC 1X6HA 3OTOE 4MLQA 2ODRD 1HNWE 2EP3A 4DV4E 2NABA 2EM6A 2MDRA 4WXDA 1STUA 4DUYE 2DSYA 4R2EA 1YUJA 1AAYA 1EH7A 2CPNA 1T4NA 3EPJA 3DF6A 4BS9A 2IHR1 4DR5E
chains in the Genus database with same CATH topology
4F9CB 2JR1A 2L6MA 4JV5E 1O0WA 4LF6E 4GEQB 4F9AB 5DNYA 4WYQB 3AUZA 4YHHE 4M30A 4WFTA 4NXME 3LLHA 4P78A 2V88A 1RC7A 4KZSA 3IWCA 4M0VA 4GKJE 5AE3A 3IWBA 1RQ0A 3H09A 4P7DA 2H36X 4JI1E 3RMPA 4R03A 4LFAE 1UHZA 5LL6R 4B3SE 4LU9A 3JAMC 1UILA 2L8TA 4AQYE 1FJGE 2V8QB 4DV2E 5AASA 1IBLE 4X66E 4DR1E 4JI2E 2V83A 4BC7A 4DV3E 4OX9E 2L2KB 4TUIA 4BCAA 4F54A 2NUEA 3F6GA 4L8NA 3KWRA 3ADIA 2UXBE 4JI3E 2RS6A 2KHXA 1PKPA 3T1HE 3ADLA 1X48A 1X47A 3AV0A 3JU0A 4OOGC 4WSPA 3C4BA 2L33A 4DR4E 2DIXA 3FIGA 4WPYA 1YYWA 1XMOE 2JY9A 3OMLA 2M4IA 4K0KE 3LMLA 1T4LB 1N34E 4DV7E 2UUAE 4B3ME 2LJHA 4DR2E 2LUPB 4BC9A 2K4VA 4BBYA 4L5NC 2V87A 2MC5A 1ZBTA 3C4TA 3IWDA 4I8OA 5AE1A 4LTYA 2FV4B 4LFBE 4NXNE 2B9DA 1GQEA 2LRSA 1WHQA 2RS7A 4JI8E 2DMYA 4JI4E 2DB2A 1HNZE 2E5LE 2RSMA 2LTSA 4DKKA 2VF1A 4KHPE 2HHHE 4BMJA 5FLXC 2RTXA 1XNQE 1WHNA 4DV0E 3ADJA 2M7QA 3P1XA 2JWOA 2VE7C 1N32E 4X64E 4LF7E 1SR9A 1FKAE 1N36E 2ODRC 4JI6E 2EZ6A 2V89A 4LF4E 3F6HA 2UXCE 4JI7E 3T1YE 5IWAE 4B3RE 4DR6E 1J26A 2MC6A 5BR8E 4DMIA 4DV6E 5LMNE 2LBSB 3DJWA 2B7TA 3VYXA 4R8OA 2L3JA 4DR3E 5IT9C 4LF5E 2G7HA 2JOXA 3HXLA 2FGGA 3HPZA 1QU6A 2M1SA 2FTXB 4DR7E 1DI2A 1XNRE 2LMZA 1YYOA 2L2NA 2KOUA 2V86A 3JTZA 1YZ9A 1I94E 2VQFE 1XMQE 2YZTA 2LTRA 3J7Yp 2LE2A 2EWLA 4J8ZA 1WXRA 2N3HA 2UU9E 1EKZA 4M2ZA 2V85A 3ADGA 2JVAA 3HPSA 3J81C 2F8BA 1HR0E 2F4VE 2NA2A 4Q28A 1X49A 1IBKE 4YY3E 5ADZA 3J80C 3HQ1A 3J7AG 4DV1E 1ZBQA 2UUBE 2B7VA 3VYYA 2NUFA 2L92A 5CFFE 4X65E 5F3WA 2NUGA 2N3GA 4B3TE 4LFCE 1DQ3A 5A2QC 1GZ6A 3OTOE 2LUQA 2L2MA 2E1MA 2ODRD 3K6QA 4JYAE 1HNWE 4DV4E 1IBME 2YT4A 4F9BB 5AE2A 2MDRA 4X62E 1STUA 4TUGA 4DUYE 2UUCE 2DSYA 1N33E 2WZOA 2VQEE 3HTXA 2L3CA 2CPNA 4DUZE 4GKKE 1YYKA 4LF9E 1T4NA 4JI0E 2UXDE 4JI5E 2JOBA 3VK6A 4DV5E 1HNXE 5T6JA 1J5EE 3DF6A 5LMUE 4BS9A 2KONA 1T4OA 2ZM6E 4X8WA 4LF8E 2IHR1 3MSWA 2B3TB 3ZOQB 4DR5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  1O0W A;  4LF6 E;  4YHH E;  4WYQ B;  4M30 A;  4WFT A;  4NXM E;  3LLH A;  1RC7 A;  4GKJ E;  1RQ0 A;  4JI1 E;  4LFA E;  1UHZ A;  4B3S E;  1UIL A;  4AQY E;  1FJG E;  4DV2 E;  1IBL E;  4X66 E;  4DR1 E;  4JI2 E;  4OX9 E;  4DV3 E;  2L2K B;  2NUE A;  2UXB E;  4JI3 E;  2RS6 A;  2KHX A;  1PKP A;  3T1H E;  3ADL A;  1X48 A;  1X47 A;  4OOG C;  3C4B A;  2L33 A;  4DR4 E;  2DIX A;  1YYW A;  1XMO E;  2JY9 A;  4K0K E;  1T4L B;  1N34 E;  4DV7 E;  2UUA E;  4B3M E;  2LJH A;  4DR2 E;  2LUP B;  1ZBT A;  3C4T A;  4LFB E;  4NXN E;  1GQE A;  2LRS A;  1WHQ A;  2RS7 A;  4JI8 E;  2DMY A;  4JI4 E;  2DB2 A;  1HNZ E;  2E5L E;  2RSM A;  2LTS A;  4DKK A;  4KHP E;  2HHH E;  2RTX A;  1XNQ E;  1WHN A;  4DV0 E;  3ADJ A;  3P1X A;  1N32 E;  4X64 E;  4LF7 E;  1FKA E;  1N36 E;  4JI6 E;  2EZ6 A;  4LF4 E;  2UXC E;  4JI7 E;  3T1Y E;  5IWA E;  4DR6 E;  5BR8 E;  4DV6 E;  5LMN E;  2LBS B;  2B7T A;  3VYX A;  2L3J A;  4DR3 E;  4LF5 E;  4DR7 E;  1QU6 A;  1DI2 A;  1XNR E;  1YYO A;  2L2N A;  1YZ9 A;  1I94 E;  2VQF E;  1XMQ E;  2LTR A;  3J7Y p;  2UU9 E;  4B3R E;  2N3H A;  4M2Z A;  1EKZ A;  3ADG A;  2JVA A;  1HR0 E;  2F4V E;  2NA2 A;  1X49 A;  1IBK E;  4YY3 E;  4DV1 E;  2UUB E;  2B7V A;  3VYY A;  2NUF A;  5CFF E;  4X65 E;  2NUG A;  2N3G A;  4B3T E;  4LFC E;  3OTO E;  2LUQ A;  2L2M A;  4JYA E;  1HNW E;  4DV4 E;  1IBM E;  2YT4 A;  3ADI A;  2MDR A;  4X62 E;  1STU A;  4DUY E;  2UUC E;  1N33 E;  2VQE E;  3HTX A;  2L3C A;  2CPN A;  4DUZ E;  4GKK E;  1YYK A;  4LF9 E;  1T4N A;  4JI0 E;  2UXD E;  4JI5 E;  1J26 A;  4DV5 E;  1HNX E;  1J5E E;  5LMU E;  1T4O A;  2ZM6 E;  4X8W A;  4LF8 E;  2IHR 1;  2B3T B;  4DR5 E; 
#chains in the Genus database with same CATH topology
 2HC5 A;  4JV5 E;  2EN8 A;  4LF6 E;  4GEQ B;  2YTE A;  2EMC A;  2EPN A;  1EH8 A;  4NXM E;  4P78 A;  4GKJ E;  5AE3 A;  1RQ0 A;  3C6M A;  2H36 X;  2EPK X;  4R2P A;  1AH5 A;  5LL6 R;  2LT7 A;  3JAM C;  4AQY E;  4JI2 E;  3QG5 C;  5A6A A;  4BCA A;  1UBD C;  4F54 A;  4RHB B;  3KWR A;  2EOF A;  4JI3 E;  2RS6 A;  2A25 A;  5KL7 A;  2EMX A;  2WBS A;  3FIG A;  5IXM B;  1RMD A;  2JY9 A;  2M4I A;  4K0K E;  2DGC A;  4B3M E;  4O4K A;  2EPA A;  2LUP B;  4BBY A;  2MC5 A;  4I8O A;  4LTY A;  1TF3 A;  1A1F A;  4JI4 E;  1WHQ A;  2DMY A;  1HNZ E;  1X3C A;  2E5L E;  2VF1 A;  5FLX C;  1TF6 A;  4DV0 E;  3ADJ A;  1IQO A;  2VE7 C;  1NCS A;  1FKA E;  2DRP A;  4BHB A;  4LF4 E;  2UXC E;  5IWA E;  3THO B;  2EMK A;  2J7J A;  4DV6 E;  3C6K A;  4LF5 E;  4M9V C;  2G7H A;  3HPZ A;  3KZZ A;  1TN9 A;  1ZR9 A;  2LMZ A;  1YFH A;  3JTZ A;  2EOE A;  4IS1 C;  1XMQ E;  2EMH A;  2UU9 E;  2N3H A;  3BF2 A;  4ZYH A;  2PRT A;  2ELZ A;  3J81 C;  1X49 A;  1IBK E;  3J80 C;  3HQ1 A;  3J7A G;  4DV1 E;  2EQ0 A;  2GPI A;  2B7V A;  2YTN A;  3VYY A;  2EQ1 A;  4F2J C;  1YSA C;  5A6J A;  2YTG A;  4BHC A;  2LUQ A;  1PJT A;  2EN2 A;  5KL2 A;  4O43 A;  5AE2 A;  2UUC E;  2YTO A;  1J26 A;  1YYK A;  1ZU1 A;  4JI0 E;  1PJS A;  4JI5 E;  1HNX E;  2EM9 A;  2LCE A;  2EMW A;  2YPN A;  2ZM6 E;  1WJP A;  1N33 E;  2LJU A;  2M9A A;  4F9C B;  2JR1 A;  2L6M A;  1O0W A;  4F9A B;  1X5W A;  1A1J A;  3EPK A;  1P47 A;  3LLH A;  4KZS A;  4M0V A;  3IWB A;  2EL6 A;  2EM0 A;  3H09 A;  4N4R B;  4LFA E;  1KJK A;  5LLQ A;  4B3S E;  1UIL A;  2L8T A;  1FJG E;  3BBG A;  1IBL E;  4DR1 E;  2V83 A;  4BC7 A;  2JXP A;  1X6E A;  2YSP A;  1EH6 A;  2EPR A;  4L8N A;  5AC5 A;  1G2D C;  1PKP A;  2EPU A;  3JU0 A;  2EOO A;  4DR4 E;  2DIX A;  2CTD A;  1XMO E;  1PDA A;  4F6M A;  1T4L B;  3MHS C;  2LJH A;  5KL4 A;  4BC9 A;  2N8X A;  4L5N C;  1WRJ A;  2DLQ A;  3C4T A;  4O24 A;  3KZY A;  2RS7 A;  1YPN A;  4FK5 C;  4WSG A;  2YWQ A;  2LTS A;  2EOH A;  2EOQ A;  4NZV A;  2VRD A;  2EJ4 A;  2YRM A;  5TSE A;  3P1X A;  1N32 E;  4X64 E;  5KL3 A;  1N36 E;  4JI6 E;  2YRK A;  2V89 A;  3T1Y E;  4KWY A;  4R2R A;  2LBS B;  1T39 A;  2B7T A;  3VYX A;  1GTK A;  4R8O A;  4WXC A;  2FGG A;  4DR7 E;  1QU6 A;  2M1S A;  4X9J A;  1XNR E;  1YYO A;  2KOU A;  2V86 A;  1I94 E;  2VQF E;  2EM4 A;  1X6F A;  2LE2 A;  4J8Z A;  1WXR A;  1EKZ A;  2V85 A;  3HPS A;  1T38 A;  1HR0 E;  2F4V E;  1IQS A;  1A1L A;  2EE8 A;  4YY3 E;  5ADZ A;  2EOR A;  2EML A;  4X65 E;  3M99 B;  4B3T E;  4LFC E;  2EN1 A;  1JK1 A;  5A6K A;  1BBO A;  2L2M A;  2E1M A;  3K6Q A;  4IJD A;  1A1G A;  1IBM E;  4F9B B;  2EPC A;  2WZO A;  2UXD E;  1A1I A;  4LF9 E;  2I13 A;  3VK6 A;  1QNT A;  2YRH A;  4DV5 E;  1J5E E;  1G2F C;  4Q35 B;  2MKD A;  5A6B D;  3MSW A;  2EM7 A;  3EPL A;  4WYQ B;  3BID A;  2D9H A;  2EMZ A;  4M30 A;  2E72 A;  3IWC A;  1A1K A;  4P7D A;  2EMB A;  4JI1 E;  4R03 A;  1UHZ A;  2MKN A;  4LU9 A;  2EN4 A;  4DV2 E;  2CSH A;  4X66 E;  2EN6 A;  4DV3 E;  2L2K B;  2NUE A;  2ENH A;  5A69 A;  1X48 A;  4WSP A;  3C4B A;  2L33 A;  2DLK A;  4ZYG A;  5KL6 A;  1YYW A;  2EOY A;  3OML A;  4HEI A;  2EM2 A;  3LML A;  1ZAA C;  4NHR A;  2EOI A;  1BBG A;  1ZBT A;  5AE1 A;  2LO3 A;  2FV4 B;  2RQL A;  4NXN E;  1GQE A;  2LRS A;  4JI8 E;  4R2S A;  2EPP A;  1A1H A;  2RSM A;  1Z1B A;  4KHP E;  2LVH A;  2RTX A;  1N3G A;  1WHN A;  2EM5 A;  2JP9 A;  2R1F A;  2M7Q A;  4LF7 E;  2RSI A;  1SR9 A;  2BBG A;  2ODR C;  2EZ6 A;  1DGC A;  3F6H A;  4JI7 E;  2HJJ A;  5BR8 E;  2EMI A;  4R2D A;  4DR3 E;  4O5G A;  2YU8 A;  2FTX B;  2JYA A;  1DI2 A;  1SFE A;  2L2N A;  1YZ9 A;  4HTG A;  2YTF A;  2JPA A;  4RH8 A;  4B3R E;  4M2Z A;  1L4S A;  4R2A A;  2YTP A;  3UK3 C;  4Q28 A;  2ELY A;  4R2C A;  1B69 A;  2EOJ A;  2YTQ A;  1ZBQ A;  2NUF A;  5CFF E;  2NUG A;  2EL5 A;  2EMY A;  4R2Q A;  2DMI A;  2EMA A;  1GZ6 A;  2K7I A;  2CT1 A;  4JYA E;  4GZN C;  2YT4 A;  3ADI A;  4TUG A;  4X62 E;  2EOX A;  2VQE E;  3HTX A;  2L3C A;  4DUZ E;  4GKK E;  2JOB A;  2RPC A;  5T6J A;  5LMU E;  2KON A;  1T4O A;  2I9I A;  4X8W A;  2YSO A;  2YU5 A;  5AAS A;  2B3T B;  3ZOQ B;  4LF8 E;  2EM3 A;  3ECR A;  1MGT A;  2Q8U A;  2YTJ A;  4YHH E;  2EPL X;  5DNY A;  3AUZ A;  4ZYD A;  4WFT A;  2V88 A;  2BB8 A;  1RC7 A;  1BB8 A;  2EN7 A;  3RMP A;  2ADR A;  3MHH C;  1KYQ A;  1NEI A;  2V8Q B;  4F6N A;  5A6B A;  2HGH A;  4OX9 E;  2ENA A;  4TUI A;  2EQ3 A;  2R76 A;  3F6G A;  2UXB E;  2KHX A;  3T1H E;  3ADL A;  3AV0 A;  1X47 A;  4OOG C;  3VHT B;  2EMG A;  2EPX A;  2LV2 A;  1MEY C;  4WPY A;  1LLM C;  1N34 E;  2WBT A;  5AC4 A;  4DV7 E;  2UUA E;  2EPM X;  4DR2 E;  3TQM A;  2K4V A;  2V87 A;  3IWD A;  2EOS A;  2GHF A;  4LFB E;  2B9D A;  2DB2 A;  2WBU A;  1JK2 A;  4DKK A;  2GLI A;  1PJQ A;  3EPH A;  2HHH E;  4BMJ A;  1XNQ E;  1IMU A;  2EM8 A;  2EL4 A;  2JWO A;  2MDG A;  1F2I G;  2EMF A;  2EN3 A;  4DR6 E;  1YUI A;  2MC6 A;  4DMI A;  3THN A;  5LMN E;  3DJW A;  5KL5 A;  3EQ1 A;  2L3J A;  5IT9 C;  2EPZ A;  4WX9 A;  2JOX A;  3HXL A;  2WCC 3;  2YZT A;  2LTR A;  3J7Y p;  2ENC A;  2EWL A;  3ADG A;  2JVA A;  1UN6 B;  2F8B A;  3BGH A;  2NA2 A;  4MLV A;  2EOZ A;  2EPO A;  2UUB E;  4ZYE A;  2YTI A;  3L00 A;  2L92 A;  5F3W A;  2N3G A;  2EOM A;  2YTD A;  1DQ3 A;  5IV8 B;  5A2Q C;  1X6H A;  3OTO E;  4MLQ A;  2ODR D;  1HNW E;  2EP3 A;  4DV4 E;  2NAB A;  2EM6 A;  2MDR A;  4WXD A;  1STU A;  4DUY E;  2DSY A;  4R2E A;  1YUJ A;  1AAY A;  1EH7 A;  2CPN A;  1T4N A;  3EPJ A;  3DF6 A;  4BS9 A;  2IHR 1;  4DR5 E; 
#chains in the Genus database with same CATH homology
 4F9C B;  2JR1 A;  2L6M A;  4JV5 E;  1O0W A;  4LF6 E;  4GEQ B;  4F9A B;  5DNY A;  4WYQ B;  3AUZ A;  4YHH E;  4M30 A;  4WFT A;  4NXM E;  3LLH A;  4P78 A;  2V88 A;  1RC7 A;  4KZS A;  3IWC A;  4M0V A;  4GKJ E;  5AE3 A;  3IWB A;  1RQ0 A;  3H09 A;  4P7D A;  2H36 X;  4JI1 E;  3RMP A;  4R03 A;  4LFA E;  1UHZ A;  5LL6 R;  4B3S E;  4LU9 A;  3JAM C;  1UIL A;  2L8T A;  4AQY E;  1FJG E;  2V8Q B;  4DV2 E;  5AAS A;  1IBL E;  4X66 E;  4DR1 E;  4JI2 E;  2V83 A;  4BC7 A;  4DV3 E;  4OX9 E;  2L2K B;  4TUI A;  4BCA A;  4F54 A;  2NUE A;  3F6G A;  4L8N A;  3KWR A;  3ADI A;  2UXB E;  4JI3 E;  2RS6 A;  2KHX A;  1PKP A;  3T1H E;  3ADL A;  1X48 A;  1X47 A;  3AV0 A;  3JU0 A;  4OOG C;  4WSP A;  3C4B A;  2L33 A;  4DR4 E;  2DIX A;  3FIG A;  4WPY A;  1YYW A;  1XMO E;  2JY9 A;  3OML A;  2M4I A;  4K0K E;  3LML A;  1T4L B;  1N34 E;  4DV7 E;  2UUA E;  4B3M E;  2LJH A;  4DR2 E;  2LUP B;  4BC9 A;  2K4V A;  4BBY A;  4L5N C;  2V87 A;  2MC5 A;  1ZBT A;  3C4T A;  3IWD A;  4I8O A;  5AE1 A;  4LTY A;  2FV4 B;  4LFB E;  4NXN E;  2B9D A;  1GQE A;  2LRS A;  1WHQ A;  2RS7 A;  4JI8 E;  2DMY A;  4JI4 E;  2DB2 A;  1HNZ E;  2E5L E;  2RSM A;  2LTS A;  4DKK A;  2VF1 A;  4KHP E;  2HHH E;  4BMJ A;  5FLX C;  2RTX A;  1XNQ E;  1WHN A;  4DV0 E;  3ADJ A;  2M7Q A;  3P1X A;  2JWO A;  2VE7 C;  1N32 E;  4X64 E;  4LF7 E;  1SR9 A;  1FKA E;  1N36 E;  2ODR C;  4JI6 E;  2EZ6 A;  2V89 A;  4LF4 E;  3F6H A;  2UXC E;  4JI7 E;  3T1Y E;  5IWA E;  4B3R E;  4DR6 E;  1J26 A;  2MC6 A;  5BR8 E;  4DMI A;  4DV6 E;  5LMN E;  2LBS B;  3DJW A;  2B7T A;  3VYX A;  4R8O A;  2L3J A;  4DR3 E;  5IT9 C;  4LF5 E;  2G7H A;  2JOX A;  3HXL A;  2FGG A;  3HPZ A;  1QU6 A;  2M1S A;  2FTX B;  4DR7 E;  1DI2 A;  1XNR E;  2LMZ A;  1YYO A;  2L2N A;  2KOU A;  2V86 A;  3JTZ A;  1YZ9 A;  1I94 E;  2VQF E;  1XMQ E;  2YZT A;  2LTR A;  3J7Y p;  2LE2 A;  2EWL A;  4J8Z A;  1WXR A;  2N3H A;  2UU9 E;  1EKZ A;  4M2Z A;  2V85 A;  3ADG A;  2JVA A;  3HPS A;  3J81 C;  2F8B A;  1HR0 E;  2F4V E;  2NA2 A;  4Q28 A;  1X49 A;  1IBK E;  4YY3 E;  5ADZ A;  3J80 C;  3HQ1 A;  3J7A G;  4DV1 E;  1ZBQ A;  2UUB E;  2B7V A;  3VYY A;  2NUF A;  2L92 A;  5CFF E;  4X65 E;  5F3W A;  2NUG A;  2N3G A;  4B3T E;  4LFC E;  1DQ3 A;  5A2Q C;  1GZ6 A;  3OTO E;  2LUQ A;  2L2M A;  2E1M A;  2ODR D;  3K6Q A;  4JYA E;  1HNW E;  4DV4 E;  1IBM E;  2YT4 A;  4F9B B;  5AE2 A;  2MDR A;  4X62 E;  1STU A;  4TUG A;  4DUY E;  2UUC E;  2DSY A;  1N33 E;  2WZO A;  2VQE E;  3HTX A;  2L3C A;  2CPN A;  4DUZ E;  4GKK E;  1YYK A;  4LF9 E;  1T4N A;  4JI0 E;  2UXD E;  4JI5 E;  2JOB A;  3VK6 A;  4DV5 E;  1HNX E;  5T6J A;  1J5E E;  3DF6 A;  5LMU E;  4BS9 A;  2KON A;  1T4O A;  2ZM6 E;  4X8W A;  4LF8 E;  2IHR 1;  3MSW A;  2B3T B;  3ZOQ B;  4DR5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...