2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
molecule keywords Putative tRNA hydrolase domain
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
4GKJE 1XNQE 2UUCE 2EZ6A 4X64E 1T4LB 2NUFA 1X48A 3C4TA 1HNZE 3J7Yp 1RQ0A 2CPNA 5IWAE 2LRSA 1HNWE 2LTSA 4DR2E 1T4OA 2LJHA 3ADJA 1XNRE 4B3RE 2RSMA 1FKAE 1UILA 4JV5E 4WFTA 4WYQB 2L3CA 4JI2E 3VYXA 4JYAE 2VQFE 4B3TE 4JI5E 2LTRA 4DV7E 2L2KB 4DUZE 1J26A 3LLHA 2ZM6E 4B3ME 2UUAE 4DV0E 4DR5E 4X8WA 1XMQE 2UXBE 2JY9A 4X65E 4DV4E 1XMOE 4DUYE 1YYWA 4X66E 4LFCE 1IBME 4OX9E 3ADIA 1N32E 1HR0E 4JI4E 2JVAA 1T4NA 2B7TA 1N36E 1X49A 1N33E 1YYKA 4LF7E 2NUEA 3P1XA 1FJGE 2LUPB 2L33A 1IBKE 4LF5E 4M30A 2RTXA 3C4BA 1EKZA 5LMNE 2NA2A 4DV3E 4DV2E 2UXDE 2IHR1 4DV6E 4JI7E 2LBSB 2UU9E 2LUQA 1O0WA 2B7VA 3T1HE 2HHHE 4NXNE 1N34E 4AQYE 2MDRA 4DV5E 4LF8E 4NXME 1WHNA 4JI0E 4LF4E 1STUA 1DI2A 2DB2A 1WHQA 1GQEA 4YHHE 2UXCE 1ZBTA 2UUBE 4X62E 1HNXE 3VYYA 2N3GA 4DR1E 1YZ9A 1QU6A 5LMUE 4JI3E 4DR6E 4YY3E 4DR3E 3T1YE 4DV1E 4LF6E 2E5LE 4DR4E 3ADGA 4B3SE 1RC7A 3HTXA 2RS7A 4LFBE 5BR8E 2VQEE 4DKKA 5CFFE 2L3JA 2L2NA 2RS6A 2NUGA 4K0KE 4OOGC 2N3HA 2F4VE 4JI6E 1X47A 1PKPA 4GKKE 2YT4A 2B3TB 4KHPE 2DIXA 3OTOE 4LFAE 1UHZA 4M2ZA 1I94E 4JI1E 2KHXA 4JI8E 4LF9E 4DR7E 2L2MA 2DMYA 1J5EE 1IBLE 3ADLA 1YYOA
chains in the Genus database with same CATH superfamily
1L4SA 1X6FA 4GKJE 4HTGA 4R2QA 2EPUA 4O4KA 2EL4A 3EPJA 2DRPA 2ENAA 4X64E 2NUFA 2EL5A 1X48A 3C4TA 2EOMA 2YTPA 1HNZE 2N8XA 2CPNA 2LRSA 2K7IA 2ELZA 4B3RE 2L92A 2JR1A 4JI2E 4B3TE 2FTXB 4JI5E 4M0VA 2LE2A 3DF6A 3J80C 2YU8A 3AUZA 2VF1A 4X8WA 1XMQE 3THNA 3BF2A 1YPNA 2LV2A 2EPAA 4X66E 2L6MA 2RQLA 5ADZA 4OX9E 3LMLA 2D9HA 2EOOA 2MKNA 2YTIA 4KWYA 2EOHA 2EPNA 3VK6A 4R2RA 1GZ6A 4ZYGA 2JVAA 1N36E 1N33E 2EPLX 3P1XA 1JK2A 1IBKE 1Z1BA 1EKZA 2RTXA 3C4BA 2EN2A 5A6BA 4O43A 4DV6E 2KONA 3KZYA 2B7VA 4P78A 2EM8A 2MDRA 1WHNA 2VE7C 4MLQA 2NABA 1STUA 2WZOA 2WBSA 1DI2A 3JU0A 1WHQA 3MSWA 2EN6A 2LT7A 1PJQA 2EN8A 2JYAA 2UXCE 1HNXE 2EMIA 5IT9C 3UK3C 1A1JA 1NEIA 4DR1E 3EPKA 3J81C 1IQSA 2EOJA 4YY3E 3MHHC 2EMXA 5A6JA 3HXLA 1PJSA 1RC7A 3HTXA 2RS7A 2YSPA 2VQEE 2G7HA 2V85A 3IWDA 4IS1C 2EMFA 2EMLA 5LL6R 2EM4A 2EMYA 2M1SA 4F54A 4JI6E 1NCSA 4GKKE 2YT4A 2B3TB 4KHPE 4LFAE 2YTNA 5FLXC 2GLIA 4M2ZA 1I94E 1ZAAC 2J7JA 1AH5A 2DMYA 1BBOA 2A25A 2EM2A 5A2QC 2YRHA 2EZ6A 1WRJA 4BHCA 4ZYEA 1X3CA 3M99B 2YU5A 5IWAE 3KWRA 3DJWA 4KZSA 1HNWE 5A69A 1DGCA 3C6MA 1G2DC 3JTZA 1UILA 4WFTA 2L3CA 2VQFE 5A6BD 5A6AA 2M7QA 4RHBB 4BS9A 1A1HA 1J26A 2EE8A 3LLHA 4DV0E 3JAMC 1AAYA 1WXRA 4J8ZA 2EPPA 4DV4E 1XMOE 4DUYE 1YYWA 2DLKA 1KJKA 1IBME 3ADIA 1PJTA 2V86A 4JI4E 2YRMA 1WJPA 2Q8UA 1A1FA 1F2IG 2YWQA 5AE1A 4LF7E 1FJGE 2EMAA 4WXCA 5AC4A 4O24A 2ODRC 4LF5E 2EORA 4R2PA 1IQOA 2UXDE 2IHR1 4JI7E 1X5WA 2HHHE 4LF8E 4DV5E 4F2JC 4NXME 3J7AG 4JI0E 2EPXA 4R2AA 5F3WA 4LTYA 1GQEA 1P47A 4F6NA 4R2DA 1UN6B 1T38A 5TSEA 2JOBA 2CT1A 2MDGA 4TUIA 4X62E 4MLVA 1X6HA 2N3GA 3VYYA 3QG5C 2YTQA 4WSGA 2EMWA 2MC5A 3AV0A 3HPZA 4RH8A 1YZ9A 5KL2A 5LMUE 1A1GA 2JP9A 4DR3E 2EP3A 2E5LE 3MHSC 4R2CA 4B3SE 4LFBE 2YTJA 2K4VA 3BBGA 2L3JA 2L2NA 3K6QA 3THOB 4LU9A 2NUGA 5DNYA 2MC6A 2N3HA 4HEIA 3FIGA 4DMIA 2V89A 2F4VE 5KL3A 3RMPA 2F8BA 4ZYHA 2H36X 3OTOE 1UHZA 2EPMX 2KHXA 1JK1A 5KL7A 1A1KA 4WSPA 1BB8A 3ADLA 4Q35B 4WXDA 5AC5A 2EN7A 2M9AA 5A6KA 3F6GA 2UUCE 1YUJA 2YPNA 1ZU1A 2YSOA 2LMZA 2EOIA 2L8TA 4DR2E 4F6MA 1XNRE 2CSHA 1FKAE 4JV5E 4WYQB 3HPSA 4JYAE 2LCEA 4BC9A 2EL6A 2LTRA 2I9IA 4DV7E 2L2KB 2EOQA 2JXPA 1A1LA 4DUZE 4B3ME 2EOFA 4WX9A 1GTKA 4DR5E 1BBGA 2M4IA 2I13A 2UXBE 4X65E 1QNTA 5T6JA 1SR9A 4F9CB 1YSAC 1LLMC 4LFCE 2EM5A 2R76A 4GZNC 1N32E 5AE3A 1HR0E 5AE2A 4BC7A 1T4NA 2B7TA 1X49A 1YYKA 3VHTB 2LUPB 4WPYA 4M30A 4N4RB 4BHBA 2EN1A 2NA2A 4L8NA 2DMIA 3IWCA 1ZR9A 2HJJA 2KOUA 2UU9E 4NXNE 4IJDA 1N34E 2V83A 4M9VC 2MKDA 4LF4E 5KL4A 1YUIA 4P7DA 2B9DA 2DB2A 4ZYDA 1A1IA 2DLQA 3H09A 4TUGA 1ZBTA 2UUBE 2EPCA 3F6HA 4R2EA 2EJ4A 5LLQA 2EMZA 1QU6A 2EOYA 3L00A 4NHRA 4JI3E 5AASA 4DR6E 1T39A 3BGHA 4LF6E 4DR4E 3ADGA 2LVHA 2EM3A 4GEQB 5BR8E 1B69A 2CTDA 4DKKA 1EH7A 5CFFE 2RS6A 2FV4B 1KYQA 2YTFA 2EQ0A 2EMGA 4OOGC 3C6KA 2DSYA 1X47A 2JOXA 2YTEA 2EPZA 3HQ1A 2DIXA 2EOEA 1EH8A 2ENHA 1IMUA 4JI1E 1RMDA 4JI8E 2EN4A 2EOSA 4LF9E 4DR7E 4FK5C 1IBLE 4BMJA 2E1MA 3EQ1A 1YYOA 1TF6A 1YFHA 1XNQE 2E72A 2EQ1A 2GHFA 5IV8B 4R03A 1T4LB 2ADRA 2PRTA 4L5NC 2R1FA 1SFEA 3J7Yp 1RQ0A 2LTSA 2EMKA 2EM6A 1TN9A 1T4OA 2LJHA 4X9JA 3ADJA 2RSMA 3VYXA 1X6EA 2RSIA 3EPLA 2ZM6E 4I8OA 2UUAE 3KZZA 1EH6A 2JY9A 2EOXA 5KL5A 2ENCA 3TQMA 3OMLA 2DGCA 2HC5A 5IXMB 2LO3A 4F9BB 2NUEA 2L33A 2ODRD 2V87A 3BIDA 5LMNE 4DV3E 1UBDC 4DV2E 2VRDA 2LBSB 4BBYA 2LUQA 1O0WA 3T1HE 2BB8A 4AQYE 2V88A 2GPIA 2EMCA 2EQ3A 2BBGA 2YTOA 2EPRA 4YHHE 4R2SA 2WBUA 2EM0A 1DQ3A 2EM7A 2JWOA 2ELYA 2EMBA 1G2FC 4NZVA 2EPOA 4Q28A 4R8OA 2V8QB 3IWBA 2FGGA 3T1YE 2JPAA 4DV1E 2YZTA 2YTGA 1MEYC 2WCC3 1TF3A 1MGTA 3ZOQB 2EN3A 2YTDA 3EPHA 3ECRA 4K0KE 4BCAA 2EMHA 1PKPA 2YRKA 4O5GA 2LJUA 1N3GA 2EOZA 2HGHA 1ZBQA 1PDAA 2EM9A 5KL6A 2RPCA 2EPKX 2L2MA 4F9AB 1J5EE 2EWLA 2WBTA
chains in the Genus database with same CATH topology
4GKJE 1XNQE 5A2QC 2UUCE 3F6GA 2EZ6A 4R03A 4X64E 1T4LB 2NUFA 1X48A 4L5NC 3C4TA 1HNZE 3J7Yp 4JV5E 1RQ0A 2CPNA 5IWAE 2LMZA 2L8TA 3KWRA 3DJWA 2LRSA 4KZSA 1HNWE 2LTSA 4DR2E 1T4OA 2LJHA 3ADJA 1XNRE 4B3RE 2RSMA 3JTZA 2L92A 1UILA 1FKAE 2JR1A 4WFTA 4WYQB 3HPSA 2L3CA 4JI2E 3VYXA 2VQFE 4B3TE 4JYAE 2FTXB 4JI5E 4BC9A 4M0VA 2LTRA 4DV7E 2L2KB 2M7QA 4BS9A 2LE2A 3DF6A 3J80C 4DUZE 1J26A 3LLHA 4I8OA 2ZM6E 4B3ME 3AUZA 2UUAE 4DV0E 4NXNE 2VF1A 3JAMC 4X8WA 4DR5E 1XMQE 1WXRA 2M4IA 2UXBE 2JY9A 4J8ZA 4X65E 4DV4E 1XMOE 5T6JA 1SR9A 4F9CB 4X66E 4DUYE 1YYWA 2L6MA 4LFCE 1IBME 5ADZA 4OX9E 3ADIA 3LMLA 2V86A 1N32E 3OMLA 3VK6A 1GZ6A 5AE3A 1HR0E 5AE2A 4JI4E 2JVAA 4BC7A 1T4NA 2B7TA 1N36E 1X49A 1N33E 1YYKA 5AE1A 4F9BB 4LF7E 3P1XA 1FJGE 2NUEA 2LUPB 2L33A 2UU9E 1IBKE 2ODRD 2ODRC 4WPYA 4LF5E 2V87A 2RTXA 3C4BA 4M30A 1EKZA 5LMNE 2NA2A 4DV3E 4L8NA 3IWCA 4DV2E 2UXDE 2IHR1 4DV6E 4JI7E 2KOUA 2KONA 2LBSB 4BBYA 2LUQA 1O0WA 2B7VA 4P78A 3T1HE 2HHHE 1N34E 4AQYE 2V83A 2MDRA 4DV5E 2V88A 4LF8E 4NXME 1WHNA 3J7AG 2VE7C 4JI0E 4LF4E 1STUA 2WZOA 4P7DA 5F3WA 2B9DA 4LTYA 1DI2A 2DB2A 3JU0A 1WHQA 1GQEA 3H09A 3MSWA 4YHHE 4TUGA 2JOBA 2UXCE 1ZBTA 4TUIA 2UUBE 4X62E 1HNXE 1DQ3A 2JWOA 2N3GA 3VYYA 5IT9C 3F6HA 2MC5A 3AV0A 3HPZA 4DR1E 4Q28A 4R8OA 1YZ9A 1QU6A 2V8QB 3IWBA 3J81C 2FGGA 5LMUE 4JI3E 5AASA 4YY3E 4DR3E 3T1YE 4DR6E 4DV1E 2YZTA 4LF6E 2E5LE 4DR4E 3ADGA 3HXLA 4B3SE 1RC7A 3HTXA 2RS7A 3ZOQB 4GEQB 2K4VA 5BR8E 4LFBE 2VQEE 4DKKA 2G7HA 5CFFE 2V85A 2L3JA 2L2NA 3IWDA 3K6QA 2RS6A 2FV4B 5LL6R 4LU9A 2NUGA 4BCAA 5DNYA 2MC6A 4OOGC 4K0KE 2N3HA 2M1SA 3FIGA 2V89A 4DMIA 4F54A 2DSYA 4JI6E 2F4VE 1X47A 3RMPA 1PKPA 2F8BA 4GKKE 2JOXA 2YT4A 2B3TB 2H36X 3HQ1A 2DIXA 3OTOE 1ZBQA 1UHZA 4LFAE 4KHPE 5FLXC 4M2ZA 1I94E 4JI1E 2KHXA 4JI8E 4LF9E 4WSPA 4DR7E 2L2MA 2DMYA 4BMJA 2E1MA 4F9AB 1J5EE 2EWLA 1IBLE 1YYOA 3ADLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ E;  1XNQ E;  2UUC E;  2EZ6 A;  4X64 E;  1T4L B;  2NUF A;  1X48 A;  3C4T A;  1HNZ E;  3J7Y p;  1RQ0 A;  2CPN A;  5IWA E;  2LRS A;  1HNW E;  2LTS A;  4DR2 E;  1T4O A;  2LJH A;  3ADJ A;  1XNR E;  4B3R E;  2RSM A;  1FKA E;  1UIL A;  4JV5 E;  4WFT A;  4WYQ B;  2L3C A;  4JI2 E;  3VYX A;  4JYA E;  2VQF E;  4B3T E;  4JI5 E;  2LTR A;  4DV7 E;  2L2K B;  4DUZ E;  1J26 A;  3LLH A;  2ZM6 E;  4B3M E;  2UUA E;  4DV0 E;  4DR5 E;  4X8W A;  1XMQ E;  2UXB E;  2JY9 A;  4X65 E;  4DV4 E;  1XMO E;  4DUY E;  1YYW A;  4X66 E;  4LFC E;  1IBM E;  4OX9 E;  3ADI A;  1N32 E;  1HR0 E;  4JI4 E;  2JVA A;  1T4N A;  2B7T A;  1N36 E;  1X49 A;  1N33 E;  1YYK A;  4LF7 E;  2NUE A;  3P1X A;  1FJG E;  2LUP B;  2L33 A;  1IBK E;  4LF5 E;  4M30 A;  2RTX A;  3C4B A;  1EKZ A;  5LMN E;  2NA2 A;  4DV3 E;  4DV2 E;  2UXD E;  2IHR 1;  4DV6 E;  4JI7 E;  2LBS B;  2UU9 E;  2LUQ A;  1O0W A;  2B7V A;  3T1H E;  2HHH E;  4NXN E;  1N34 E;  4AQY E;  2MDR A;  4DV5 E;  4LF8 E;  4NXM E;  1WHN A;  4JI0 E;  4LF4 E;  1STU A;  1DI2 A;  2DB2 A;  1WHQ A;  1GQE A;  4YHH E;  2UXC E;  1ZBT A;  2UUB E;  4X62 E;  1HNX E;  3VYY A;  2N3G A;  4DR1 E;  1YZ9 A;  1QU6 A;  5LMU E;  4JI3 E;  4DR6 E;  4YY3 E;  4DR3 E;  3T1Y E;  4DV1 E;  4LF6 E;  2E5L E;  4DR4 E;  3ADG A;  4B3S E;  1RC7 A;  3HTX A;  2RS7 A;  4LFB E;  5BR8 E;  2VQE E;  4DKK A;  5CFF E;  2L3J A;  2L2N A;  2RS6 A;  2NUG A;  4K0K E;  4OOG C;  2N3H A;  2F4V E;  4JI6 E;  1X47 A;  1PKP A;  4GKK E;  2YT4 A;  2B3T B;  4KHP E;  2DIX A;  3OTO E;  4LFA E;  1UHZ A;  4M2Z A;  1I94 E;  4JI1 E;  2KHX A;  4JI8 E;  4LF9 E;  4DR7 E;  2L2M A;  2DMY A;  1J5E E;  1IBL E;  3ADL A;  1YYO A; 
#chains in the Genus database with same CATH topology
 1L4S A;  1X6F A;  4GKJ E;  4HTG A;  4R2Q A;  2EPU A;  4O4K A;  2EL4 A;  3EPJ A;  2DRP A;  2ENA A;  4X64 E;  2NUF A;  2EL5 A;  1X48 A;  3C4T A;  2EOM A;  2YTP A;  1HNZ E;  2N8X A;  2CPN A;  2LRS A;  2K7I A;  2ELZ A;  4B3R E;  2L92 A;  2JR1 A;  4JI2 E;  4B3T E;  2FTX B;  4JI5 E;  4M0V A;  2LE2 A;  3DF6 A;  3J80 C;  2YU8 A;  3AUZ A;  2VF1 A;  4X8W A;  1XMQ E;  3THN A;  3BF2 A;  1YPN A;  2LV2 A;  2EPA A;  4X66 E;  2L6M A;  2RQL A;  5ADZ A;  4OX9 E;  3LML A;  2D9H A;  2EOO A;  2MKN A;  2YTI A;  4KWY A;  2EOH A;  2EPN A;  3VK6 A;  4R2R A;  1GZ6 A;  4ZYG A;  2JVA A;  1N36 E;  1N33 E;  2EPL X;  3P1X A;  1JK2 A;  1IBK E;  1Z1B A;  1EKZ A;  2RTX A;  3C4B A;  2EN2 A;  5A6B A;  4O43 A;  4DV6 E;  2KON A;  3KZY A;  2B7V A;  4P78 A;  2EM8 A;  2MDR A;  1WHN A;  2VE7 C;  4MLQ A;  2NAB A;  1STU A;  2WZO A;  2WBS A;  1DI2 A;  3JU0 A;  1WHQ A;  3MSW A;  2EN6 A;  2LT7 A;  1PJQ A;  2EN8 A;  2JYA A;  2UXC E;  1HNX E;  2EMI A;  5IT9 C;  3UK3 C;  1A1J A;  1NEI A;  4DR1 E;  3EPK A;  3J81 C;  1IQS A;  2EOJ A;  4YY3 E;  3MHH C;  2EMX A;  5A6J A;  3HXL A;  1PJS A;  1RC7 A;  3HTX A;  2RS7 A;  2YSP A;  2VQE E;  2G7H A;  2V85 A;  3IWD A;  4IS1 C;  2EMF A;  2EML A;  5LL6 R;  2EM4 A;  2EMY A;  2M1S A;  4F54 A;  4JI6 E;  1NCS A;  4GKK E;  2YT4 A;  2B3T B;  4KHP E;  4LFA E;  2YTN A;  5FLX C;  2GLI A;  4M2Z A;  1I94 E;  1ZAA C;  2J7J A;  1AH5 A;  2DMY A;  1BBO A;  2A25 A;  2EM2 A;  5A2Q C;  2YRH A;  2EZ6 A;  1WRJ A;  4BHC A;  4ZYE A;  1X3C A;  3M99 B;  2YU5 A;  5IWA E;  3KWR A;  3DJW A;  4KZS A;  1HNW E;  5A69 A;  1DGC A;  3C6M A;  1G2D C;  3JTZ A;  1UIL A;  4WFT A;  2L3C A;  2VQF E;  5A6B D;  5A6A A;  2M7Q A;  4RHB B;  4BS9 A;  1A1H A;  1J26 A;  2EE8 A;  3LLH A;  4DV0 E;  3JAM C;  1AAY A;  1WXR A;  4J8Z A;  2EPP A;  4DV4 E;  1XMO E;  4DUY E;  1YYW A;  2DLK A;  1KJK A;  1IBM E;  3ADI A;  1PJT A;  2V86 A;  4JI4 E;  2YRM A;  1WJP A;  2Q8U A;  1A1F A;  1F2I G;  2YWQ A;  5AE1 A;  4LF7 E;  1FJG E;  2EMA A;  4WXC A;  5AC4 A;  4O24 A;  2ODR C;  4LF5 E;  2EOR A;  4R2P A;  1IQO A;  2UXD E;  2IHR 1;  4JI7 E;  1X5W A;  2HHH E;  4LF8 E;  4DV5 E;  4F2J C;  4NXM E;  3J7A G;  4JI0 E;  2EPX A;  4R2A A;  5F3W A;  4LTY A;  1GQE A;  1P47 A;  4F6N A;  4R2D A;  1UN6 B;  1T38 A;  5TSE A;  2JOB A;  2CT1 A;  2MDG A;  4TUI A;  4X62 E;  4MLV A;  1X6H A;  2N3G A;  3VYY A;  3QG5 C;  2YTQ A;  4WSG A;  2EMW A;  2MC5 A;  3AV0 A;  3HPZ A;  4RH8 A;  1YZ9 A;  5KL2 A;  5LMU E;  1A1G A;  2JP9 A;  4DR3 E;  2EP3 A;  2E5L E;  3MHS C;  4R2C A;  4B3S E;  4LFB E;  2YTJ A;  2K4V A;  3BBG A;  2L3J A;  2L2N A;  3K6Q A;  3THO B;  4LU9 A;  2NUG A;  5DNY A;  2MC6 A;  2N3H A;  4HEI A;  3FIG A;  4DMI A;  2V89 A;  2F4V E;  5KL3 A;  3RMP A;  2F8B A;  4ZYH A;  2H36 X;  3OTO E;  1UHZ A;  2EPM X;  2KHX A;  1JK1 A;  5KL7 A;  1A1K A;  4WSP A;  1BB8 A;  3ADL A;  4Q35 B;  4WXD A;  5AC5 A;  2EN7 A;  2M9A A;  5A6K A;  3F6G A;  2UUC E;  1YUJ A;  2YPN A;  1ZU1 A;  2YSO A;  2LMZ A;  2EOI A;  2L8T A;  4DR2 E;  4F6M A;  1XNR E;  2CSH A;  1FKA E;  4JV5 E;  4WYQ B;  3HPS A;  4JYA E;  2LCE A;  4BC9 A;  2EL6 A;  2LTR A;  2I9I A;  4DV7 E;  2L2K B;  2EOQ A;  2JXP A;  1A1L A;  4DUZ E;  4B3M E;  2EOF A;  4WX9 A;  1GTK A;  4DR5 E;  1BBG A;  2M4I A;  2I13 A;  2UXB E;  4X65 E;  1QNT A;  5T6J A;  1SR9 A;  4F9C B;  1YSA C;  1LLM C;  4LFC E;  2EM5 A;  2R76 A;  4GZN C;  1N32 E;  5AE3 A;  1HR0 E;  5AE2 A;  4BC7 A;  1T4N A;  2B7T A;  1X49 A;  1YYK A;  3VHT B;  2LUP B;  4WPY A;  4M30 A;  4N4R B;  4BHB A;  2EN1 A;  2NA2 A;  4L8N A;  2DMI A;  3IWC A;  1ZR9 A;  2HJJ A;  2KOU A;  2UU9 E;  4NXN E;  4IJD A;  1N34 E;  2V83 A;  4M9V C;  2MKD A;  4LF4 E;  5KL4 A;  1YUI A;  4P7D A;  2B9D A;  2DB2 A;  4ZYD A;  1A1I A;  2DLQ A;  3H09 A;  4TUG A;  1ZBT A;  2UUB E;  2EPC A;  3F6H A;  4R2E A;  2EJ4 A;  5LLQ A;  2EMZ A;  1QU6 A;  2EOY A;  3L00 A;  4NHR A;  4JI3 E;  5AAS A;  4DR6 E;  1T39 A;  3BGH A;  4LF6 E;  4DR4 E;  3ADG A;  2LVH A;  2EM3 A;  4GEQ B;  5BR8 E;  1B69 A;  2CTD A;  4DKK A;  1EH7 A;  5CFF E;  2RS6 A;  2FV4 B;  1KYQ A;  2YTF A;  2EQ0 A;  2EMG A;  4OOG C;  3C6K A;  2DSY A;  1X47 A;  2JOX A;  2YTE A;  2EPZ A;  3HQ1 A;  2DIX A;  2EOE A;  1EH8 A;  2ENH A;  1IMU A;  4JI1 E;  1RMD A;  4JI8 E;  2EN4 A;  2EOS A;  4LF9 E;  4DR7 E;  4FK5 C;  1IBL E;  4BMJ A;  2E1M A;  3EQ1 A;  1YYO A;  1TF6 A;  1YFH A;  1XNQ E;  2E72 A;  2EQ1 A;  2GHF A;  5IV8 B;  4R03 A;  1T4L B;  2ADR A;  2PRT A;  4L5N C;  2R1F A;  1SFE A;  3J7Y p;  1RQ0 A;  2LTS A;  2EMK A;  2EM6 A;  1TN9 A;  1T4O A;  2LJH A;  4X9J A;  3ADJ A;  2RSM A;  3VYX A;  1X6E A;  2RSI A;  3EPL A;  2ZM6 E;  4I8O A;  2UUA E;  3KZZ A;  1EH6 A;  2JY9 A;  2EOX A;  5KL5 A;  2ENC A;  3TQM A;  3OML A;  2DGC A;  2HC5 A;  5IXM B;  2LO3 A;  4F9B B;  2NUE A;  2L33 A;  2ODR D;  2V87 A;  3BID A;  5LMN E;  4DV3 E;  1UBD C;  4DV2 E;  2VRD A;  2LBS B;  4BBY A;  2LUQ A;  1O0W A;  3T1H E;  2BB8 A;  4AQY E;  2V88 A;  2GPI A;  2EMC A;  2EQ3 A;  2BBG A;  2YTO A;  2EPR A;  4YHH E;  4R2S A;  2WBU A;  2EM0 A;  1DQ3 A;  2EM7 A;  2JWO A;  2ELY A;  2EMB A;  1G2F C;  4NZV A;  2EPO A;  4Q28 A;  4R8O A;  2V8Q B;  3IWB A;  2FGG A;  3T1Y E;  2JPA A;  4DV1 E;  2YZT A;  2YTG A;  1MEY C;  2WCC 3;  1TF3 A;  1MGT A;  3ZOQ B;  2EN3 A;  2YTD A;  3EPH A;  3ECR A;  4K0K E;  4BCA A;  2EMH A;  1PKP A;  2YRK A;  4O5G A;  2LJU A;  1N3G A;  2EOZ A;  2HGH A;  1ZBQ A;  1PDA A;  2EM9 A;  5KL6 A;  2RPC A;  2EPK X;  2L2M A;  4F9A B;  1J5E E;  2EWL A;  2WBT A; 
#chains in the Genus database with same CATH homology
 4GKJ E;  1XNQ E;  5A2Q C;  2UUC E;  3F6G A;  2EZ6 A;  4R03 A;  4X64 E;  1T4L B;  2NUF A;  1X48 A;  4L5N C;  3C4T A;  1HNZ E;  3J7Y p;  4JV5 E;  1RQ0 A;  2CPN A;  5IWA E;  2LMZ A;  2L8T A;  3KWR A;  3DJW A;  2LRS A;  4KZS A;  1HNW E;  2LTS A;  4DR2 E;  1T4O A;  2LJH A;  3ADJ A;  1XNR E;  4B3R E;  2RSM A;  3JTZ A;  2L92 A;  1UIL A;  1FKA E;  2JR1 A;  4WFT A;  4WYQ B;  3HPS A;  2L3C A;  4JI2 E;  3VYX A;  2VQF E;  4B3T E;  4JYA E;  2FTX B;  4JI5 E;  4BC9 A;  4M0V A;  2LTR A;  4DV7 E;  2L2K B;  2M7Q A;  4BS9 A;  2LE2 A;  3DF6 A;  3J80 C;  4DUZ E;  1J26 A;  3LLH A;  4I8O A;  2ZM6 E;  4B3M E;  3AUZ A;  2UUA E;  4DV0 E;  4NXN E;  2VF1 A;  3JAM C;  4X8W A;  4DR5 E;  1XMQ E;  1WXR A;  2M4I A;  2UXB E;  2JY9 A;  4J8Z A;  4X65 E;  4DV4 E;  1XMO E;  5T6J A;  1SR9 A;  4F9C B;  4X66 E;  4DUY E;  1YYW A;  2L6M A;  4LFC E;  1IBM E;  5ADZ A;  4OX9 E;  3ADI A;  3LML A;  2V86 A;  1N32 E;  3OML A;  3VK6 A;  1GZ6 A;  5AE3 A;  1HR0 E;  5AE2 A;  4JI4 E;  2JVA A;  4BC7 A;  1T4N A;  2B7T A;  1N36 E;  1X49 A;  1N33 E;  1YYK A;  5AE1 A;  4F9B B;  4LF7 E;  3P1X A;  1FJG E;  2NUE A;  2LUP B;  2L33 A;  2UU9 E;  1IBK E;  2ODR D;  2ODR C;  4WPY A;  4LF5 E;  2V87 A;  2RTX A;  3C4B A;  4M30 A;  1EKZ A;  5LMN E;  2NA2 A;  4DV3 E;  4L8N A;  3IWC A;  4DV2 E;  2UXD E;  2IHR 1;  4DV6 E;  4JI7 E;  2KOU A;  2KON A;  2LBS B;  4BBY A;  2LUQ A;  1O0W A;  2B7V A;  4P78 A;  3T1H E;  2HHH E;  1N34 E;  4AQY E;  2V83 A;  2MDR A;  4DV5 E;  2V88 A;  4LF8 E;  4NXM E;  1WHN A;  3J7A G;  2VE7 C;  4JI0 E;  4LF4 E;  1STU A;  2WZO A;  4P7D A;  5F3W A;  2B9D A;  4LTY A;  1DI2 A;  2DB2 A;  3JU0 A;  1WHQ A;  1GQE A;  3H09 A;  3MSW A;  4YHH E;  4TUG A;  2JOB A;  2UXC E;  1ZBT A;  4TUI A;  2UUB E;  4X62 E;  1HNX E;  1DQ3 A;  2JWO A;  2N3G A;  3VYY A;  5IT9 C;  3F6H A;  2MC5 A;  3AV0 A;  3HPZ A;  4DR1 E;  4Q28 A;  4R8O A;  1YZ9 A;  1QU6 A;  2V8Q B;  3IWB A;  3J81 C;  2FGG A;  5LMU E;  4JI3 E;  5AAS A;  4YY3 E;  4DR3 E;  3T1Y E;  4DR6 E;  4DV1 E;  2YZT A;  4LF6 E;  2E5L E;  4DR4 E;  3ADG A;  3HXL A;  4B3S E;  1RC7 A;  3HTX A;  2RS7 A;  3ZOQ B;  4GEQ B;  2K4V A;  5BR8 E;  4LFB E;  2VQE E;  4DKK A;  2G7H A;  5CFF E;  2V85 A;  2L3J A;  2L2N A;  3IWD A;  3K6Q A;  2RS6 A;  2FV4 B;  5LL6 R;  4LU9 A;  2NUG A;  4BCA A;  5DNY A;  2MC6 A;  4OOG C;  4K0K E;  2N3H A;  2M1S A;  3FIG A;  2V89 A;  4DMI A;  4F54 A;  2DSY A;  4JI6 E;  2F4V E;  1X47 A;  3RMP A;  1PKP A;  2F8B A;  4GKK E;  2JOX A;  2YT4 A;  2B3T B;  2H36 X;  3HQ1 A;  2DIX A;  3OTO E;  1ZBQ A;  1UHZ A;  4LFA E;  4KHP E;  5FLX C;  4M2Z A;  1I94 E;  4JI1 E;  2KHX A;  4JI8 E;  4LF9 E;  4WSP A;  4DR7 E;  2L2M A;  2DMY A;  4BMJ A;  2E1M A;  4F9A B;  1J5E E;  2EWL A;  1IBL E;  1YYO A;  3ADL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...