2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tRNA hydrolase domain
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
2LUPB 2NUGA 2LUQA 1HNWE 5LMNE 4LFAE 4X66E 2LTRA 4DUZE 1N34E 2B3TB 3ADIA 4DKKA 4KHPE 2ZM6E 1J5EE 4GKJE 5LMUE 4AQYE 1UHZA 1WHQA 4DV1E 2VQFE 4DV0E 1YZ9A 2LJHA 1O0WA 1X49A 4LF9E 1I94E 3ADLA 1T4NA 3LLHA 2RTXA 2UUBE 1T4LB 2HHHE 1N33E 4M2ZA 4YY3E 1IBKE 4LF5E 4B3ME 3T1HE 4JI3E 4YHHE 2DIXA 2N3HA 3OTOE 2UXBE 1T4OA 4WFTA 1PKPA 2LRSA 2UU9E 2JVAA 2L33A 1J26A 2L2MA 1GQEA 2L3CA 4B3SE 4DR6E 4X65E 1QU6A 4DV6E 4B3RE 4M30A 4JI8E 4DR7E 2NUFA 2L2NA 1X48A 1N32E 2UXCE 4DV2E 3HTXA 4DV7E 2E5LE 1RQ0A 1XNRE 2RS7A 3C4BA 4DUYE 1XNQE 5CFFE 2KHXA 2RSMA 4X8WA 4DV3E 2UXDE 4OOGC 4NXNE 4JI4E 2MDRA 2NA2A 4JYAE 1XMOE 1EKZA 1IBME 4DR1E 3ADJA 2B7VA 1X47A 2B7TA 3ADGA 2YT4A 4LF8E 1YYOA 4WYQB 4JI6E 2DMYA 4DV4E 2NUEA 4DV5E 1RC7A 4DR5E 4DR3E 4DR4E 4GKKE 2L2KB 4JI0E 2LBSB 2F4VE 2N3GA 5BR8E 1ZBTA 2UUCE 1UILA 4B3TE 1XMQE 4LFCE 2UUAE 3VYYA 2EZ6A 3VYXA 4X62E 2IHR1 4DR2E 1HNXE 1DI2A 5IWAE 4NXME 3J7Yp 3T1YE 1HR0E 2CPNA 1N36E 4OX9E 3P1XA 4LF7E 1IBLE 2LTSA 1YYWA 4JI5E 1FKAE 2JY9A 2L3JA 4LF6E 1STUA 3C4TA 4X64E 2VQEE 4JI1E 1YYKA 4LFBE 2DB2A 1FJGE 2RS6A 1HNZE 4JI2E 4K0KE 4LF4E 4JI7E 1WHNA 4JV5E
chains in the Genus database with same CATH superfamily
2EWLA 2GLIA 2EL6A 4BC7A 2EPXA 2EMFA 4DUZE 2EMYA 2LO3A 3ADIA 2EOOA 2JOXA 4DKKA 4KHPE 2EMZA 4GKJE 2VQFE 2CT1A 5TSEA 4NHRA 3LMLA 2YSPA 3HPZA 3ADLA 1KYQA 2RTXA 1ZU1A 2BBGA 2EN4A 2HHHE 5A6JA 5KL6A 4IS1C 4B3ME 4JI3E 3F6HA 3K6QA 1PKPA 1TF3A 3IWBA 2GHFA 4LTYA 2EMLA 3EPJA 3EPLA 1A1KA 4KZSA 4BC9A 2FTXB 2WCC3 5A6BD 2EM7A 4M30A 1YUJA 3AUZA 4BCAA 3JAMC 3BGHA 1N32E 2YTIA 2M9AA 5IXMB 5AE1A 1EH8A 3VHTB 4M9VC 4J8ZA 1UN6B 5LL6R 3TQMA 2HGHA 1NEIA 2EMGA 4DV3E 4X9JA 1BBOA 4F9BB 2EOFA 4OOGC 4JI4E 2MDRA 2RPCA 2V86A 2YSOA 1IBME 5A6BA 4DR1E 1GTKA 2ADRA 2EMIA 2F8BA 3DJWA 2DMYA 4R2PA 4DR5E 1B69A 5A2QC 2EM4A 4NZVA 2R76A 5FLXC 2CTDA 4FK5C 1SR9A 5BR8E 1TN9A 2WBSA 2EJ4A 2JXPA 4B3TE 1PDAA 3EPKA 1X6HA 2YTQA 1YSAC 5F3WA 2IHR1 1HNXE 1DI2A 1N3GA 4NXME 2EM3A 2CPNA 4LF7E 1IBLE 2LTSA 1YYWA 2K7IA 5KL7A 1A1GA 3FIGA 4I8OA 1STUA 4BMJA 2GPIA 4X64E 2VQEE 3H09A 2EPKX 4WX9A 5AE3A 5A69A 5A6AA 4WXDA 1A1JA 2EMBA 1BBGA 2LUQA 4LFAE 1IMUA 2LTRA 2ENAA 1N34E 2EM8A 4O24A 2YPNA 2MC5A 4WSGA 5LMUE 1PJTA 2LV2A 2EP3A 2EOJA 1AAYA 1UHZA 2ODRD 1JK1A 3EPHA 2WBUA 3ECRA 1YZ9A 2LJHA 1X49A 1I94E 1YPNA 2EL5A 1MEYC 4M2ZA 1IBKE 3T1HE 1QNTA 1X5WA 2DIXA 2YTNA 2EOZA 1Z1BA 5AASA 2G7HA 2I13A 2EL4A 2DMIA 2JVAA 2L33A 2EQ0A 5A6KA 4DR6E 4TUIA 4DV6E 4B3RE 4JI8E 2L2NA 3F6GA 4P7DA 2EOMA 3J7AG 3L00A 4L8NA 4O4KA 1X6EA 2E5LE 4KWYA 2DLKA 5KL3A 3QG5C 2EPAA 3HPSA 2CSHA 2YTJA 4Q28A 1P47A 4JYAE 2JOBA 2L6MA 3THNA 2B7TA 2YT4A 2M4IA 2A25A 2V83A 4DV5E 1RC7A 4LU9A 1YUIA 1T39A 1WXRA 2DLQA 4WPYA 3JU0A 5T6JA 3RMPA 2B9DA 2HC5A 2FV4B 2WBTA 2RQLA 2V88A 3HQ1A 3VYYA 2UUAE 1X3CA 2EPOA 3JTZA 2YTPA 3DF6A 4F9CB 5LLQA 4R2RA 3BIDA 2YU5A 2EMAA 2KOUA 2EOSA 2EPZA 4OX9E 2EM2A 3P1XA 4F6NA 1EH6A 4JI5E 2L3JA 4LF6E 2K4VA 4GZNC 4DMIA 4JI1E 1YYKA 2EOIA 1HNZE 5AC5A 2EPCA 2EMXA 1WHNA 4JV5E 4ZYHA 2EPRA 2LUPB 2NUGA 5LMNE 4R2EA 4X66E 3J81C 2JYAA 5ADZA 2EPPA 4IJDA 2I9IA 1IQSA 2VE7C 3IWDA 1G2FC 2VRDA 3KZYA 4O43A 4GEQB 1X6FA 3HXLA 4M0VA 2LE2A 2EN3A 3M99B 1O0WA 5KL2A 2EM6A 1EH7A 1T4NA 3LLHA 4RH8A 2EM5A 1T4LB 2UUBE 1N33E 2BB8A 2EPUA 2ODRC 4LF5E 2YWQA 2EQ3A 2N3HA 2UXBE 1T4OA 2EQ1A 3BF2A 3KWRA 2RSIA 1WRJA 5KL5A 3C6MA 2LRSA 4MLVA 2V89A 2UU9E 1J26A 2YRKA 2L2MA 1GQEA 2L3CA 4B3SE 2YTOA 2DGCA 3EQ1A 2EN2A 1G2DC 4X65E 1QU6A 2JP9A 4P78A 3IWCA 2EMWA 2NUFA 1BB8A 5KL4A 2DSYA 1A1LA 2UXCE 2EMHA 2ENCA 4DV2E 1RMDA 1F2IG 2YU8A 2E72A 4RHBB 2EMKA 2RS7A 3C4BA 4DUYE 2EPMX 1XNQE 1AH5A 5CFFE 2D9HA 3ZOQB 1PJSA 4R2CA 2KHXA 4X8WA 4Q35B 1ZR9A 4NXNE 2EM0A 4R03A 1XMOE 1EKZA 3VK6A 2MKNA 1NCSA 2LCEA 4DV4E 4BHBA 4DR3E 4DR4E 2H36X 4JI0E 2LBSB 2F4VE 2M7QA 2EOQA 1YFHA 1A1IA 4L5NC 2UUCE 4LFCE 4BBYA 3MSWA 5AC4A 3C6KA 1T38A 3MHSC 2EZ6A 3VYXA 4X62E 2MKDA 5IWAE 2YTFA 2V87A 2EN7A 2EOEA 3T1YE 2EOXA 2YRHA 4R2QA 1FKAE 3C4TA 4JI7E 4LFBE 1FJGE 4BS9A 4WSPA 2ELZA 4ZYGA 1HNWE 1DQ3A 2ENHA 1SFEA 2V85A 4R2DA 2B3TB 4O5GA 1MGTA 2N8XA 5AE2A 2R1FA 2V8QB 2ZM6E 1J5EE 4AQYE 3THOB 3BBGA 1WHQA 4F54A 4DV1E 1ZAAC 3UK3C 4DV0E 3OMLA 1IQOA 4LF9E 2JPAA 2YZTA 4YY3E 1PJQA 5IV8B 2EPNA 2MDGA 2JR1A 4YHHE 2NABA 2ELYA 1A1HA 3OTOE 3MHHC 2EOHA 4WFTA 1UBDC 2LVHA 2YRMA 2YTDA 4MLQA 4DR7E 2LJUA 1X48A 4ZYDA 2Q8UA 5IT9C 1KJKA 2WZOA 3HTXA 4WXCA 4TUGA 2EMCA 1RQ0A 4DV7E 1XNRE 2EOYA 4HEIA 2VF1A 1ZBQA 1A1FA 1TF6A 2RSMA 2UXDE 2EN1A 2NA2A 2EM9A 2YTGA 2KONA 3ADJA 4F2JC 2B7VA 1X47A 3ADGA 4BHCA 2HJJA 2L92A 1YYOA 4WYQB 4JI6E 2LMZA 4LF8E 2NUEA 2MC6A 2EN6A 2E1MA 4GKKE 2L2KB 2N3GA 4ZYEA 2M1SA 1ZBTA 1UILA 4R8OA 1XMQE 2J7JA 2LT7A 1GZ6A 1L4SA 1WJPA 2PRTA 2EE8A 4DR2E 2EORA 4F9AB 2YTEA 3J80C 3J7Yp 4R2SA 2EPLX 1JK2A 1HR0E 2JWOA 5DNYA 1N36E 4R2AA 2DRPA 4HTGA 2L8TA 1LLMC 2JY9A 3AV0A 2FGGA 2DB2A 2RS6A 1DGCA 4JI2E 4K0KE 4LF4E 4F6MA 2EN8A 4N4RB 3KZZA
chains in the Genus database with same CATH topology
2EWLA 2LUPB 2NUGA 2LUQA 1DQ3A 1HNWE 5LMNE 4BC7A 4X66E 4LFAE 3J81C 2V85A 5ADZA 2LTRA 4DUZE 1N34E 2B3TB 3ADIA 5AE2A 4DKKA 2JOXA 4KHPE 2V8QB 2ZM6E 1J5EE 2MC5A 2VE7C 3IWDA 4GKJE 5LMUE 4AQYE 4GEQB 1UHZA 2ODRD 1WHQA 4F54A 4DV1E 3HXLA 2VQFE 4M0VA 2LE2A 4DV0E 3LMLA 2LJHA 3OMLA 1YZ9A 1O0WA 1X49A 4LF9E 3HPZA 1I94E 3ADLA 1T4NA 3LLHA 2RTXA 2UUBE 1T4LB 2HHHE 1N33E 2YZTA 4M2ZA 4YY3E 2ODRC 1IBKE 4B3ME 3T1HE 4JI3E 2JR1A 4YHHE 2DIXA 3F6HA 4LF5E 2N3HA 3OTOE 2UXBE 1T4OA 3K6QA 3KWRA 4WFTA 5AASA 2G7HA 1PKPA 2LRSA 3IWBA 2V89A 2UU9E 2JVAA 2L33A 4LTYA 1J26A 2L2MA 1GQEA 2L3CA 4B3SE 4KZSA 4BC9A 2FTXB 4DR6E 4TUIA 4X65E 1QU6A 4DV6E 4B3RE 4P78A 3IWCA 4M30A 4JI8E 4DR7E 2NUFA 3AUZA 2DSYA 2L2NA 3F6GA 1X48A 4BCAA 3JAMC 4LF8E 1N32E 2UXCE 4P7DA 5IT9C 3J7AG 4DV2E 5AE1A 4L8NA 2WZOA 3HTXA 4TUGA 4DV7E 1RQ0A 2E5LE 1XNRE 2RS7A 4J8ZA 3C4BA 4DUYE 1XNQE 5LL6R 3ZOQB 5CFFE 2VF1A 1ZBQA 3HPSA 2KHXA 4Q28A 2RSMA 4X8WA 4DV3E 4JI6E 2UXDE 4F9BB 4OOGC 4NXNE 4JI4E 2MDRA 2NA2A 4R03A 4JYAE 2JOBA 2L6MA 2V86A 1XMOE 1EKZA 1IBME 2KONA 3VK6A 4DR1E 3ADJA 2B7VA 1X47A 2B7TA 3ADGA 2F8BA 2M4IA 2L92A 2YT4A 3DJWA 4WYQB 2DMYA 2LMZA 2V83A 4DV4E 4DV5E 2MC6A 1YYOA 2NUEA 1RC7A 4DR5E 4LU9A 4DR3E 5A2QC 2H36X 4DR4E 2E1MA 4GKKE 2L2KB 4JI0E 1WXRA 2LBSB 2F4VE 2N3GA 2M7QA 4WPYA 5FLXC 2M1SA 1SR9A 5BR8E 3JU0A 5T6JA 3RMPA 1ZBTA 2B9DA 4L5NC 2FV4B 1UILA 2UUCE 4B3TE 4R8OA 1XMQE 4BBYA 3MSWA 2V88A 4LFCE 3HQ1A 3VYYA 2UUAE 1GZ6A 3JTZA 3DF6A 2EZ6A 3VYXA 4F9CB 4X62E 5F3WA 2IHR1 4DR2E 1HNXE 1DI2A 5IWAE 4F9AB 2V87A 4NXME 3J80C 3J7Yp 3T1YE 2KOUA 1HR0E 2JWOA 2CPNA 5DNYA 1N36E 4OX9E 3P1XA 4LF7E 1IBLE 2LTSA 1YYWA 2L8TA 3FIGA 4JI5E 1FKAE 2JY9A 4I8OA 2L3JA 2K4VA 1STUA 3C4TA 4BMJA 4WSPA 4DMIA 4X64E 4LF6E 3AV0A 2VQEE 4JI1E 2FGGA 1YYKA 3H09A 2DB2A 4LFBE 1FJGE 2RS6A 1HNZE 4JI2E 4K0KE 4LF4E 5AE3A 4BS9A 4JI7E 1WHNA 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUP B;  2NUG A;  2LUQ A;  1HNW E;  5LMN E;  4LFA E;  4X66 E;  2LTR A;  4DUZ E;  1N34 E;  2B3T B;  3ADI A;  4DKK A;  4KHP E;  2ZM6 E;  1J5E E;  4GKJ E;  5LMU E;  4AQY E;  1UHZ A;  1WHQ A;  4DV1 E;  2VQF E;  4DV0 E;  1YZ9 A;  2LJH A;  1O0W A;  1X49 A;  4LF9 E;  1I94 E;  3ADL A;  1T4N A;  3LLH A;  2RTX A;  2UUB E;  1T4L B;  2HHH E;  1N33 E;  4M2Z A;  4YY3 E;  1IBK E;  4LF5 E;  4B3M E;  3T1H E;  4JI3 E;  4YHH E;  2DIX A;  2N3H A;  3OTO E;  2UXB E;  1T4O A;  4WFT A;  1PKP A;  2LRS A;  2UU9 E;  2JVA A;  2L33 A;  1J26 A;  2L2M A;  1GQE A;  2L3C A;  4B3S E;  4DR6 E;  4X65 E;  1QU6 A;  4DV6 E;  4B3R E;  4M30 A;  4JI8 E;  4DR7 E;  2NUF A;  2L2N A;  1X48 A;  1N32 E;  2UXC E;  4DV2 E;  3HTX A;  4DV7 E;  2E5L E;  1RQ0 A;  1XNR E;  2RS7 A;  3C4B A;  4DUY E;  1XNQ E;  5CFF E;  2KHX A;  2RSM A;  4X8W A;  4DV3 E;  2UXD E;  4OOG C;  4NXN E;  4JI4 E;  2MDR A;  2NA2 A;  4JYA E;  1XMO E;  1EKZ A;  1IBM E;  4DR1 E;  3ADJ A;  2B7V A;  1X47 A;  2B7T A;  3ADG A;  2YT4 A;  4LF8 E;  1YYO A;  4WYQ B;  4JI6 E;  2DMY A;  4DV4 E;  2NUE A;  4DV5 E;  1RC7 A;  4DR5 E;  4DR3 E;  4DR4 E;  4GKK E;  2L2K B;  4JI0 E;  2LBS B;  2F4V E;  2N3G A;  5BR8 E;  1ZBT A;  2UUC E;  1UIL A;  4B3T E;  1XMQ E;  4LFC E;  2UUA E;  3VYY A;  2EZ6 A;  3VYX A;  4X62 E;  2IHR 1;  4DR2 E;  1HNX E;  1DI2 A;  5IWA E;  4NXM E;  3J7Y p;  3T1Y E;  1HR0 E;  2CPN A;  1N36 E;  4OX9 E;  3P1X A;  4LF7 E;  1IBL E;  2LTS A;  1YYW A;  4JI5 E;  1FKA E;  2JY9 A;  2L3J A;  4LF6 E;  1STU A;  3C4T A;  4X64 E;  2VQE E;  4JI1 E;  1YYK A;  4LFB E;  2DB2 A;  1FJG E;  2RS6 A;  1HNZ E;  4JI2 E;  4K0K E;  4LF4 E;  4JI7 E;  1WHN A;  4JV5 E; 
#chains in the Genus database with same CATH topology
 2EWL A;  2GLI A;  2EL6 A;  4BC7 A;  2EPX A;  2EMF A;  4DUZ E;  2EMY A;  2LO3 A;  3ADI A;  2EOO A;  2JOX A;  4DKK A;  4KHP E;  2EMZ A;  4GKJ E;  2VQF E;  2CT1 A;  5TSE A;  4NHR A;  3LML A;  2YSP A;  3HPZ A;  3ADL A;  1KYQ A;  2RTX A;  1ZU1 A;  2BBG A;  2EN4 A;  2HHH E;  5A6J A;  5KL6 A;  4IS1 C;  4B3M E;  4JI3 E;  3F6H A;  3K6Q A;  1PKP A;  1TF3 A;  3IWB A;  2GHF A;  4LTY A;  2EML A;  3EPJ A;  3EPL A;  1A1K A;  4KZS A;  4BC9 A;  2FTX B;  2WCC 3;  5A6B D;  2EM7 A;  4M30 A;  1YUJ A;  3AUZ A;  4BCA A;  3JAM C;  3BGH A;  1N32 E;  2YTI A;  2M9A A;  5IXM B;  5AE1 A;  1EH8 A;  3VHT B;  4M9V C;  4J8Z A;  1UN6 B;  5LL6 R;  3TQM A;  2HGH A;  1NEI A;  2EMG A;  4DV3 E;  4X9J A;  1BBO A;  4F9B B;  2EOF A;  4OOG C;  4JI4 E;  2MDR A;  2RPC A;  2V86 A;  2YSO A;  1IBM E;  5A6B A;  4DR1 E;  1GTK A;  2ADR A;  2EMI A;  2F8B A;  3DJW A;  2DMY A;  4R2P A;  4DR5 E;  1B69 A;  5A2Q C;  2EM4 A;  4NZV A;  2R76 A;  5FLX C;  2CTD A;  4FK5 C;  1SR9 A;  5BR8 E;  1TN9 A;  2WBS A;  2EJ4 A;  2JXP A;  4B3T E;  1PDA A;  3EPK A;  1X6H A;  2YTQ A;  1YSA C;  5F3W A;  2IHR 1;  1HNX E;  1DI2 A;  1N3G A;  4NXM E;  2EM3 A;  2CPN A;  4LF7 E;  1IBL E;  2LTS A;  1YYW A;  2K7I A;  5KL7 A;  1A1G A;  3FIG A;  4I8O A;  1STU A;  4BMJ A;  2GPI A;  4X64 E;  2VQE E;  3H09 A;  2EPK X;  4WX9 A;  5AE3 A;  5A69 A;  5A6A A;  4WXD A;  1A1J A;  2EMB A;  1BBG A;  2LUQ A;  4LFA E;  1IMU A;  2LTR A;  2ENA A;  1N34 E;  2EM8 A;  4O24 A;  2YPN A;  2MC5 A;  4WSG A;  5LMU E;  1PJT A;  2LV2 A;  2EP3 A;  2EOJ A;  1AAY A;  1UHZ A;  2ODR D;  1JK1 A;  3EPH A;  2WBU A;  3ECR A;  1YZ9 A;  2LJH A;  1X49 A;  1I94 E;  1YPN A;  2EL5 A;  1MEY C;  4M2Z A;  1IBK E;  3T1H E;  1QNT A;  1X5W A;  2DIX A;  2YTN A;  2EOZ A;  1Z1B A;  5AAS A;  2G7H A;  2I13 A;  2EL4 A;  2DMI A;  2JVA A;  2L33 A;  2EQ0 A;  5A6K A;  4DR6 E;  4TUI A;  4DV6 E;  4B3R E;  4JI8 E;  2L2N A;  3F6G A;  4P7D A;  2EOM A;  3J7A G;  3L00 A;  4L8N A;  4O4K A;  1X6E A;  2E5L E;  4KWY A;  2DLK A;  5KL3 A;  3QG5 C;  2EPA A;  3HPS A;  2CSH A;  2YTJ A;  4Q28 A;  1P47 A;  4JYA E;  2JOB A;  2L6M A;  3THN A;  2B7T A;  2YT4 A;  2M4I A;  2A25 A;  2V83 A;  4DV5 E;  1RC7 A;  4LU9 A;  1YUI A;  1T39 A;  1WXR A;  2DLQ A;  4WPY A;  3JU0 A;  5T6J A;  3RMP A;  2B9D A;  2HC5 A;  2FV4 B;  2WBT A;  2RQL A;  2V88 A;  3HQ1 A;  3VYY A;  2UUA E;  1X3C A;  2EPO A;  3JTZ A;  2YTP A;  3DF6 A;  4F9C B;  5LLQ A;  4R2R A;  3BID A;  2YU5 A;  2EMA A;  2KOU A;  2EOS A;  2EPZ A;  4OX9 E;  2EM2 A;  3P1X A;  4F6N A;  1EH6 A;  4JI5 E;  2L3J A;  4LF6 E;  2K4V A;  4GZN C;  4DMI A;  4JI1 E;  1YYK A;  2EOI A;  1HNZ E;  5AC5 A;  2EPC A;  2EMX A;  1WHN A;  4JV5 E;  4ZYH A;  2EPR A;  2LUP B;  2NUG A;  5LMN E;  4R2E A;  4X66 E;  3J81 C;  2JYA A;  5ADZ A;  2EPP A;  4IJD A;  2I9I A;  1IQS A;  2VE7 C;  3IWD A;  1G2F C;  2VRD A;  3KZY A;  4O43 A;  4GEQ B;  1X6F A;  3HXL A;  4M0V A;  2LE2 A;  2EN3 A;  3M99 B;  1O0W A;  5KL2 A;  2EM6 A;  1EH7 A;  1T4N A;  3LLH A;  4RH8 A;  2EM5 A;  1T4L B;  2UUB E;  1N33 E;  2BB8 A;  2EPU A;  2ODR C;  4LF5 E;  2YWQ A;  2EQ3 A;  2N3H A;  2UXB E;  1T4O A;  2EQ1 A;  3BF2 A;  3KWR A;  2RSI A;  1WRJ A;  5KL5 A;  3C6M A;  2LRS A;  4MLV A;  2V89 A;  2UU9 E;  1J26 A;  2YRK A;  2L2M A;  1GQE A;  2L3C A;  4B3S E;  2YTO A;  2DGC A;  3EQ1 A;  2EN2 A;  1G2D C;  4X65 E;  1QU6 A;  2JP9 A;  4P78 A;  3IWC A;  2EMW A;  2NUF A;  1BB8 A;  5KL4 A;  2DSY A;  1A1L A;  2UXC E;  2EMH A;  2ENC A;  4DV2 E;  1RMD A;  1F2I G;  2YU8 A;  2E72 A;  4RHB B;  2EMK A;  2RS7 A;  3C4B A;  4DUY E;  2EPM X;  1XNQ E;  1AH5 A;  5CFF E;  2D9H A;  3ZOQ B;  1PJS A;  4R2C A;  2KHX A;  4X8W A;  4Q35 B;  1ZR9 A;  4NXN E;  2EM0 A;  4R03 A;  1XMO E;  1EKZ A;  3VK6 A;  2MKN A;  1NCS A;  2LCE A;  4DV4 E;  4BHB A;  4DR3 E;  4DR4 E;  2H36 X;  4JI0 E;  2LBS B;  2F4V E;  2M7Q A;  2EOQ A;  1YFH A;  1A1I A;  4L5N C;  2UUC E;  4LFC E;  4BBY A;  3MSW A;  5AC4 A;  3C6K A;  1T38 A;  3MHS C;  2EZ6 A;  3VYX A;  4X62 E;  2MKD A;  5IWA E;  2YTF A;  2V87 A;  2EN7 A;  2EOE A;  3T1Y E;  2EOX A;  2YRH A;  4R2Q A;  1FKA E;  3C4T A;  4JI7 E;  4LFB E;  1FJG E;  4BS9 A;  4WSP A;  2ELZ A;  4ZYG A;  1HNW E;  1DQ3 A;  2ENH A;  1SFE A;  2V85 A;  4R2D A;  2B3T B;  4O5G A;  1MGT A;  2N8X A;  5AE2 A;  2R1F A;  2V8Q B;  2ZM6 E;  1J5E E;  4AQY E;  3THO B;  3BBG A;  1WHQ A;  4F54 A;  4DV1 E;  1ZAA C;  3UK3 C;  4DV0 E;  3OML A;  1IQO A;  4LF9 E;  2JPA A;  2YZT A;  4YY3 E;  1PJQ A;  5IV8 B;  2EPN A;  2MDG A;  2JR1 A;  4YHH E;  2NAB A;  2ELY A;  1A1H A;  3OTO E;  3MHH C;  2EOH A;  4WFT A;  1UBD C;  2LVH A;  2YRM A;  2YTD A;  4MLQ A;  4DR7 E;  2LJU A;  1X48 A;  4ZYD A;  2Q8U A;  5IT9 C;  1KJK A;  2WZO A;  3HTX A;  4WXC A;  4TUG A;  2EMC A;  1RQ0 A;  4DV7 E;  1XNR E;  2EOY A;  4HEI A;  2VF1 A;  1ZBQ A;  1A1F A;  1TF6 A;  2RSM A;  2UXD E;  2EN1 A;  2NA2 A;  2EM9 A;  2YTG A;  2KON A;  3ADJ A;  4F2J C;  2B7V A;  1X47 A;  3ADG A;  4BHC A;  2HJJ A;  2L92 A;  1YYO A;  4WYQ B;  4JI6 E;  2LMZ A;  4LF8 E;  2NUE A;  2MC6 A;  2EN6 A;  2E1M A;  4GKK E;  2L2K B;  2N3G A;  4ZYE A;  2M1S A;  1ZBT A;  1UIL A;  4R8O A;  1XMQ E;  2J7J A;  2LT7 A;  1GZ6 A;  1L4S A;  1WJP A;  2PRT A;  2EE8 A;  4DR2 E;  2EOR A;  4F9A B;  2YTE A;  3J80 C;  3J7Y p;  4R2S A;  2EPL X;  1JK2 A;  1HR0 E;  2JWO A;  5DNY A;  1N36 E;  4R2A A;  2DRP A;  4HTG A;  2L8T A;  1LLM C;  2JY9 A;  3AV0 A;  2FGG A;  2DB2 A;  2RS6 A;  1DGC A;  4JI2 E;  4K0K E;  4LF4 E;  4F6M A;  2EN8 A;  4N4R B;  3KZZ A; 
#chains in the Genus database with same CATH homology
 2EWL A;  2LUP B;  2NUG A;  2LUQ A;  1DQ3 A;  1HNW E;  5LMN E;  4BC7 A;  4X66 E;  4LFA E;  3J81 C;  2V85 A;  5ADZ A;  2LTR A;  4DUZ E;  1N34 E;  2B3T B;  3ADI A;  5AE2 A;  4DKK A;  2JOX A;  4KHP E;  2V8Q B;  2ZM6 E;  1J5E E;  2MC5 A;  2VE7 C;  3IWD A;  4GKJ E;  5LMU E;  4AQY E;  4GEQ B;  1UHZ A;  2ODR D;  1WHQ A;  4F54 A;  4DV1 E;  3HXL A;  2VQF E;  4M0V A;  2LE2 A;  4DV0 E;  3LML A;  2LJH A;  3OML A;  1YZ9 A;  1O0W A;  1X49 A;  4LF9 E;  3HPZ A;  1I94 E;  3ADL A;  1T4N A;  3LLH A;  2RTX A;  2UUB E;  1T4L B;  2HHH E;  1N33 E;  2YZT A;  4M2Z A;  4YY3 E;  2ODR C;  1IBK E;  4B3M E;  3T1H E;  4JI3 E;  2JR1 A;  4YHH E;  2DIX A;  3F6H A;  4LF5 E;  2N3H A;  3OTO E;  2UXB E;  1T4O A;  3K6Q A;  3KWR A;  4WFT A;  5AAS A;  2G7H A;  1PKP A;  2LRS A;  3IWB A;  2V89 A;  2UU9 E;  2JVA A;  2L33 A;  4LTY A;  1J26 A;  2L2M A;  1GQE A;  2L3C A;  4B3S E;  4KZS A;  4BC9 A;  2FTX B;  4DR6 E;  4TUI A;  4X65 E;  1QU6 A;  4DV6 E;  4B3R E;  4P78 A;  3IWC A;  4M30 A;  4JI8 E;  4DR7 E;  2NUF A;  3AUZ A;  2DSY A;  2L2N A;  3F6G A;  1X48 A;  4BCA A;  3JAM C;  4LF8 E;  1N32 E;  2UXC E;  4P7D A;  5IT9 C;  3J7A G;  4DV2 E;  5AE1 A;  4L8N A;  2WZO A;  3HTX A;  4TUG A;  4DV7 E;  1RQ0 A;  2E5L E;  1XNR E;  2RS7 A;  4J8Z A;  3C4B A;  4DUY E;  1XNQ E;  5LL6 R;  3ZOQ B;  5CFF E;  2VF1 A;  1ZBQ A;  3HPS A;  2KHX A;  4Q28 A;  2RSM A;  4X8W A;  4DV3 E;  4JI6 E;  2UXD E;  4F9B B;  4OOG C;  4NXN E;  4JI4 E;  2MDR A;  2NA2 A;  4R03 A;  4JYA E;  2JOB A;  2L6M A;  2V86 A;  1XMO E;  1EKZ A;  1IBM E;  2KON A;  3VK6 A;  4DR1 E;  3ADJ A;  2B7V A;  1X47 A;  2B7T A;  3ADG A;  2F8B A;  2M4I A;  2L92 A;  2YT4 A;  3DJW A;  4WYQ B;  2DMY A;  2LMZ A;  2V83 A;  4DV4 E;  4DV5 E;  2MC6 A;  1YYO A;  2NUE A;  1RC7 A;  4DR5 E;  4LU9 A;  4DR3 E;  5A2Q C;  2H36 X;  4DR4 E;  2E1M A;  4GKK E;  2L2K B;  4JI0 E;  1WXR A;  2LBS B;  2F4V E;  2N3G A;  2M7Q A;  4WPY A;  5FLX C;  2M1S A;  1SR9 A;  5BR8 E;  3JU0 A;  5T6J A;  3RMP A;  1ZBT A;  2B9D A;  4L5N C;  2FV4 B;  1UIL A;  2UUC E;  4B3T E;  4R8O A;  1XMQ E;  4BBY A;  3MSW A;  2V88 A;  4LFC E;  3HQ1 A;  3VYY A;  2UUA E;  1GZ6 A;  3JTZ A;  3DF6 A;  2EZ6 A;  3VYX A;  4F9C B;  4X62 E;  5F3W A;  2IHR 1;  4DR2 E;  1HNX E;  1DI2 A;  5IWA E;  4F9A B;  2V87 A;  4NXM E;  3J80 C;  3J7Y p;  3T1Y E;  2KOU A;  1HR0 E;  2JWO A;  2CPN A;  5DNY A;  1N36 E;  4OX9 E;  3P1X A;  4LF7 E;  1IBL E;  2LTS A;  1YYW A;  2L8T A;  3FIG A;  4JI5 E;  1FKA E;  2JY9 A;  4I8O A;  2L3J A;  2K4V A;  1STU A;  3C4T A;  4BMJ A;  4WSP A;  4DMI A;  4X64 E;  4LF6 E;  3AV0 A;  2VQE E;  4JI1 E;  2FGG A;  1YYK A;  3H09 A;  2DB2 A;  4LFB E;  1FJG E;  2RS6 A;  1HNZ E;  4JI2 E;  4K0K E;  4LF4 E;  5AE3 A;  4BS9 A;  4JI7 E;  1WHN A;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...