2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tRNA hydrolase domain
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
1QU6A 2B7TA 4AQYE 4JI2E 2L3JA 3VYXA 4DR1E 4JV5E 1X47A 3LLHA 2B3TB 2YT4A 5LMUE 1O0WA 3C4BA 4JI6E 1FJGE 1YYWA 2JY9A 1HNWE 2L3CA 4DUZE 1YZ9A 4K0KE 1XMOE 2N3GA 5BR8E 1ZBTA 3OTOE 5IWAE 4GKKE 3HTXA 1X48A 4JI7E 3VYYA 2LUPB 4JI5E 2ZM6E 2DB2A 4DR7E 4DR6E 4DV6E 1XMQE 4X62E 4OOGC 2UUCE 4GKJE 1IBKE 2UUAE 1J5EE 4WFTA 2LJHA 3T1YE 2DMYA 2B7VA 1WHQA 4JI4E 4LF7E 4B3TE 1GQEA 4X64E 1WHNA 1YYKA 2UXDE 4DV7E 1XNRE 2NA2A 2LUQA 2CPNA 3P1XA 1FKAE 2UXCE 5LMNE 4DR3E 4LF5E 4DV4E 2NUGA 4M2ZA 2JVAA 4LFBE 4B3RE 4JI0E 2N3HA 4X66E 1HNZE 1RC7A 4DV2E 1STUA 2VQFE 3J7Yp 2NUEA 2IHR1 2F4VE 4LF4E 4M30A 1IBLE 2L33A 4DUYE 1J26A 1T4NA 2RS7A 4DV0E 4JYAE 1N32E 2LTSA 4NXME 2MDRA 4DR4E 2LBSB 4WYQB 4X8WA 4DV1E 4LFCE 1YYOA 4X65E 4LF9E 2NUFA 3ADGA 2EZ6A 3ADIA 2VQEE 1N33E 4YHHE 1UILA 1HR0E 3ADLA 2UUBE 3ADJA 4LF8E 1HNXE 2L2KB 4JI3E 1DI2A 1N34E 2UXBE 4JI1E 4DR5E 4B3ME 4NXNE 2L2NA 4DV3E 4DV5E 2RTXA 4OX9E 4DKKA 2UU9E 2HHHE 4DR2E 1UHZA 1I94E 1T4OA 1EKZA 4LFAE 2E5LE 1IBME 1RQ0A 1X49A 4YY3E 1XNQE 1T4LB 2L2MA 1PKPA 3T1HE 2LTRA 4KHPE 2KHXA 2LRSA 2RSMA 4JI8E 1N36E 2RS6A 4B3SE 4LF6E 2DIXA 3C4TA 5CFFE
chains in the Genus database with same CATH superfamily
1EH8A 3ECRA 2L3JA 4DR1E 2GPIA 1O0WA 3C4BA 2EOZA 2YRKA 4BC9A 4BBYA 2DSYA 3JAMC 3MHSC 2FGGA 1FJGE 2N8XA 1X3CA 1YZ9A 5IT9C 2EN6A 1A1FA 5BR8E 2V85A 2EPZA 2EQ1A 5AE2A 1JK1A 1X48A 4BC7A 4M0VA 2ZM6E 4NZVA 3BF2A 3TQMA 4DR7E 1YUJA 1XMQE 3JTZA 2WBSA 1EH6A 1IBKE 4L5NC 2UUAE 1A1IA 1DGCA 3T1YE 2EPKX 4LF7E 1WXRA 4B3TE 5KL2A 4WSPA 1XNRE 2LT7A 2YTEA 1UN6B 2LUQA 1WJPA 2YTPA 2E1MA 2KOUA 2YTQA 4KWYA 3ZOQB 5A6BD 2H36X 2EMHA 4M2ZA 2A25A 4B3RE 2RSIA 2K7IA 4R2DA 3RMPA 4DV2E 2VQFE 3KZYA 2EN1A 2EQ3A 2B9DA 3HPZA 2FTXB 1IBLE 2EPXA 2JWOA 4DUYE 1J26A 2RS7A 4R03A 2LV2A 2EPNA 3HQ1A 5KL3A 2CTDA 1ZBQA 2VF1A 3QG5C 4NXME 4O4KA 2R1FA 4X8WA 4IJDA 4X65E 2EOQA 4LF9E 2EZ6A 4F9BB 1YUIA 1HR0E 2GLIA 2EN7A 2V89A 5AC4A 2UXBE 2EPCA 2MC5A 4JI1E 2EPLX 5KL5A 3UK3C 1IQOA 4DV3E 1BBOA 1X6EA 2FV4B 3THOB 2HJJA 2EMXA 1T4OA 1IBME 2YWQA 2EM3A 2EM8A 2EPAA 1XNQE 5A6BA 3T1HE 2G7HA 1A1JA 4KHPE 1GZ6A 2WCC3 4P7DA 2VRDA 4AQYE 4JI2E 2B3TB 5LMUE 2MDGA 2EMWA 3J81C 1YYWA 1SR9A 1HNWE 4DUZE 2EMBA 3EPHA 4K0KE 2N3GA 1ZU1A 1PJTA 4O5GA 4BCAA 3HXLA 2M4IA 1IMUA 1YSAC 2LUPB 2EPOA 2ELYA 3BGHA 2EM9A 2DLQA 4DV6E 2UUCE 2DLKA 2R76A 5AC5A 1J5EE 2MKNA 5T6JA 4JI4E 2UXDE 4DV7E 2CT1A 3P1XA 2YU8A 4WPYA 2HC5A 3THNA 2EOFA 2JOXA 2YTJA 4KZSA 2JVAA 1WRJA 2ENHA 1X5WA 2N3HA 1RMDA 2F8BA 4R2RA 1RC7A 2EN4A 4O43A 1A1HA 4WXDA 1NEIA 5FLXC 1N3GA 1T4NA 1L4SA 4DV0E 2EM5A 2YU5A 4F2JC 2D9HA 3HPSA 2V88A 2EL6A 5AASA 2LTSA 2MDRA 4RHBB 4DR4E 4WYQB 1LLMC 4R8OA 4DV1E 3M99B 4LFCE 2EOOA 5A6JA 1YYOA 1TF6A 2NUFA 1UBDC 2EOMA 3L00A 4GZNC 3ADLA 2GHFA 2MKDA 4HEIA 1A1GA 3ADJA 4BHCA 4M9VC 5A69A 4DR5E 4TUGA 2YTIA 2EPMX 2EMKA 2YRHA 2UU9E 3LMLA 2HHHE 2RQLA 4F6NA 2YSPA 1UHZA 5LL6R 2JP9A 4L8NA 1EKZA 4LFAE 1AAYA 1X49A 2YTNA 2JR1A 2L2MA 1PKPA 2LTRA 2LRSA 2EL4A 3KWRA 2J7JA 2RS6A 1TN9A 5LLQA 4B3SE 4LF6E 2EM4A 5IV8B 1ZR9A 2B7TA 1TF3A 1QNTA 2YTGA 1T39A 4R2PA 1A1LA 3EPKA 1X6HA 2JY9A 2YRMA 1BBGA 3J80C 2EJ4A 2L92A 1XMOE 3OTOE 1KJKA 5KL7A 4LU9A 4BHBA 2YTDA 3HTXA 4GKKE 1P47A 3VYYA 4JI5E 4MLVA 2ELZA 2DB2A 1IQSA 4DR6E 4R2EA 1DQ3A 1X6FA 4GKJE 2EMAA 2ODRD 4WFTA 2EM6A 2DMYA 2B7VA 2E72A 2BB8A 2BBGA 4NHRA 1YYKA 2K4VA 3VHTB 2YTFA 2KONA 1PDAA 2NA2A 5A6KA 3IWBA 3F6GA 1YFHA 4DR3E 4LF5E 2Q8UA 3FIGA 4DV4E 1G2DC 2PRTA 4LFBE 2EOSA 2EM7A 4JI0E 2DGCA 3IWCA 2I13A 1HNZE 4WX9A 5A2QC 1STUA 2EMYA 4ZYHA 3BIDA 2NUEA 2EMIA 2F4VE 2EM2A 4M30A 3IWDA 1MEYC 3KZZA 2EE8A 4JYAE 2WZOA 2LBSB 2LMZA 2EMZA 4BS9A 2EMFA 4WSGA 2EPUA 3ADGA 4HTGA 4IS1C 1PJQA 2V86A 2VQEE 2EN2A 2WBTA 1UILA 1SFEA 1JK2A 3BBGA 2EWLA 2UUBE 2ENCA 4MLQA 5DNYA 4LF8E 1HNXE 2JOBA 1F2IG 4P78A 4JI3E 3AV0A 4B3ME 4WXCA 2EMCA 1MGTA 2L2NA 2RTXA 1NCSA 4F9AB 1I94E 2MC6A 2JYAA 4F9CB 1RQ0A 2EPRA 4YY3E 1T4LB 2EOIA 1YPNA 2EN3A 2VE7C 2KHXA 2RSMA 2YPNA 2RPCA 4JI8E 1N36E 2M9AA 3C6MA 3C4TA 3DJWA 2EPPA 2V8QB 2LO3A 5CFFE 1QU6A 2L8TA 2LJUA 3VYXA 4JV5E 2HGHA 1X47A 3LLHA 4Q28A 2YT4A 2YSOA 5KL6A 4JI6E 3JU0A 4ZYGA 2DMIA 2L3CA 4I8OA 3K6QA 1ZBTA 2YTOA 4FK5C 5IWAE 4LTYA 2LVHA 3F6HA 4JI7E 1A1KA 4Q35B 5KL4A 3MSWA 4O24A 2EOHA 2ENAA 3J7AG 4X62E 4OOGC 3EPLA 2EMLA 2LJHA 1WHQA 1GQEA 4X64E 1WHNA 4DMIA 2CPNA 1FKAE 2UXCE 4F6MA 2I9IA 4RH8A 2EN8A 2EOJA 5LMNE 4ZYEA 1ZAAC 2NUGA 2M7QA 2V87A 3C6KA 4J8ZA 4X66E 5F3WA 3MHHC 1KYQA 4N4RB 5TSEA 3J7Yp 2NABA 2IHR1 4F54A 5AE3A 2EORA 4TUIA 2EQ0A 4R2CA 2EM0A 2L33A 4LF4E 1B69A 3AUZA 1BB8A 1N32E 2EP3A 1G2FC 2JPAA 2YZTA 2M1SA 2EL5A 3H09A 2L6MA 1EH7A 3DF6A 4GEQB 2ODRC 5IXMB 3ADIA 3EPJA 1N33E 4YHHE 2DRPA 1T38A 1GTKA 1Z1BA 2ADRA 2EMGA 2EOEA 1PJSA 4ZYDA 2L2KB 1N34E 1DI2A 3VK6A 2EOXA 4NXNE 4DV5E 4OX9E 4DKKA 3EQ1A 4DR2E 2WBUA 5AE1A 2LCEA 2E5LE 4BMJA 2CSHA 2LE2A 4R2AA 1AH5A 2V83A 2EOYA 4X9JA 3OMLA 5ADZA 5A6AA 4R2QA 2DIXA 4R2SA 2JXPA
chains in the Genus database with same CATH topology
4P7DA 1QU6A 2L8TA 2B7TA 4AQYE 4JI2E 2L3JA 3VYXA 4DR1E 4JV5E 1X47A 3LLHA 4Q28A 2B3TB 2YT4A 5LMUE 1O0WA 3C4BA 3JAMC 4BC9A 4BBYA 4JI6E 2DSYA 3J81C 2FGGA 1FJGE 3JU0A 2JY9A 1SR9A 1YYWA 1HNWE 2L3CA 4DUZE 3J80C 5IT9C 1YZ9A 4I8OA 2L92A 4K0KE 1XMOE 2N3GA 3K6QA 1ZBTA 5BR8E 2V85A 2M4IA 3HXLA 4BCAA 3OTOE 5IWAE 5AE2A 4LTYA 4LU9A 4GKKE 3HTXA 3F6HA 1X48A 4JI7E 4BC7A 3VYYA 2LUPB 4JI5E 4M0VA 2ZM6E 2DB2A 3MSWA 4DR7E 4DR6E 4DV6E 1XMQE 1DQ3A 3JTZA 4OOGC 4X62E 2UUCE 1IBKE 3J7AG 4L5NC 2UUAE 2ODRD 1J5EE 4WFTA 2LJHA 3T1YE 5T6JA 2DMYA 2B7VA 1WHQA 4JI4E 4LF7E 1WXRA 1GQEA 4B3TE 4X64E 1WHNA 4WSPA 1YYKA 2UXDE 2K4VA 4DV7E 1XNRE 2KONA 2NA2A 4DMIA 2LUQA 2CPNA 3P1XA 1FKAE 2UXCE 3IWBA 4WPYA 3F6GA 2E1MA 2KOUA 3ZOQB 5LMNE 4DR3E 2H36X 4LF5E 2JOXA 3FIGA 4KZSA 4DV4E 2NUGA 4M2ZA 2JVAA 4LFBE 4B3RE 2M7QA 4JI0E 2N3HA 2V87A 4J8ZA 3IWCA 4X66E 1HNZE 5F3WA 2F8BA 1RC7A 3RMPA 5A2QC 4DV2E 1STUA 2VQFE 3J7Yp 2NUEA 2IHR1 5FLXC 4F54A 5AE3A 2B9DA 2F4VE 3HPZA 2FTXB 4TUIA 4M30A 1IBLE 2L33A 4LF4E 2JWOA 4DUYE 1J26A 1T4NA 2RS7A 4R03A 3IWDA 3AUZA 4DV0E 3HQ1A 4JYAE 3HPSA 2V88A 5AASA 1ZBQA 1N32E 2VF1A 2WZOA 2LTSA 4NXME 2MDRA 4DR4E 2LBSB 4WYQB 2LMZA 2YZTA 4R8OA 2M1SA 4X8WA 4BS9A 3H09A 4DV1E 4LFCE 2L6MA 1YYOA 4X65E 3DF6A 4GEQB 4LF9E 2NUFA 3ADGA 2ODRC 4F9BB 2EZ6A 3ADIA 2V86A 2VQEE 1N33E 4YHHE 1UILA 1HR0E 3ADLA 2UUBE 2EWLA 3ADJA 5DNYA 4LF8E 1HNXE 2JOBA 2L2KB 2V89A 4P78A 4JI3E 1N34E 2MC5A 4GKJE 1DI2A 4JI1E 3AV0A 2UXBE 4DR5E 4B3ME 4TUGA 3VK6A 4NXNE 2L2NA 4DV3E 4DV5E 2RTXA 4OX9E 4DKKA 4F9AB 3LMLA 2FV4B 2HHHE 2UU9E 4DR2E 1UHZA 5LL6R 2MC6A 4L8NA 5AE1A 4F9CB 1I94E 1T4OA 1EKZA 4LFAE 2E5LE 1IBME 1RQ0A 4BMJA 1X49A 4YY3E 2LE2A 1XNQE 1T4LB 2JR1A 2L2MA 2V83A 1PKPA 3T1HE 2G7HA 2LTRA 2VE7C 3OMLA 2KHXA 5ADZA 4KHPE 2LRSA 2RSMA 3KWRA 4JI8E 1GZ6A 1N36E 2RS6A 4B3SE 4LF6E 2DIXA 3C4TA 3DJWA 5CFFE 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU6 A;  2B7T A;  4AQY E;  4JI2 E;  2L3J A;  3VYX A;  4DR1 E;  4JV5 E;  1X47 A;  3LLH A;  2B3T B;  2YT4 A;  5LMU E;  1O0W A;  3C4B A;  4JI6 E;  1FJG E;  1YYW A;  2JY9 A;  1HNW E;  2L3C A;  4DUZ E;  1YZ9 A;  4K0K E;  1XMO E;  2N3G A;  5BR8 E;  1ZBT A;  3OTO E;  5IWA E;  4GKK E;  3HTX A;  1X48 A;  4JI7 E;  3VYY A;  2LUP B;  4JI5 E;  2ZM6 E;  2DB2 A;  4DR7 E;  4DR6 E;  4DV6 E;  1XMQ E;  4X62 E;  4OOG C;  2UUC E;  4GKJ E;  1IBK E;  2UUA E;  1J5E E;  4WFT A;  2LJH A;  3T1Y E;  2DMY A;  2B7V A;  1WHQ A;  4JI4 E;  4LF7 E;  4B3T E;  1GQE A;  4X64 E;  1WHN A;  1YYK A;  2UXD E;  4DV7 E;  1XNR E;  2NA2 A;  2LUQ A;  2CPN A;  3P1X A;  1FKA E;  2UXC E;  5LMN E;  4DR3 E;  4LF5 E;  4DV4 E;  2NUG A;  4M2Z A;  2JVA A;  4LFB E;  4B3R E;  4JI0 E;  2N3H A;  4X66 E;  1HNZ E;  1RC7 A;  4DV2 E;  1STU A;  2VQF E;  3J7Y p;  2NUE A;  2IHR 1;  2F4V E;  4LF4 E;  4M30 A;  1IBL E;  2L33 A;  4DUY E;  1J26 A;  1T4N A;  2RS7 A;  4DV0 E;  4JYA E;  1N32 E;  2LTS A;  4NXM E;  2MDR A;  4DR4 E;  2LBS B;  4WYQ B;  4X8W A;  4DV1 E;  4LFC E;  1YYO A;  4X65 E;  4LF9 E;  2NUF A;  3ADG A;  2EZ6 A;  3ADI A;  2VQE E;  1N33 E;  4YHH E;  1UIL A;  1HR0 E;  3ADL A;  2UUB E;  3ADJ A;  4LF8 E;  1HNX E;  2L2K B;  4JI3 E;  1DI2 A;  1N34 E;  2UXB E;  4JI1 E;  4DR5 E;  4B3M E;  4NXN E;  2L2N A;  4DV3 E;  4DV5 E;  2RTX A;  4OX9 E;  4DKK A;  2UU9 E;  2HHH E;  4DR2 E;  1UHZ A;  1I94 E;  1T4O A;  1EKZ A;  4LFA E;  2E5L E;  1IBM E;  1RQ0 A;  1X49 A;  4YY3 E;  1XNQ E;  1T4L B;  2L2M A;  1PKP A;  3T1H E;  2LTR A;  4KHP E;  2KHX A;  2LRS A;  2RSM A;  4JI8 E;  1N36 E;  2RS6 A;  4B3S E;  4LF6 E;  2DIX A;  3C4T A;  5CFF E; 
#chains in the Genus database with same CATH topology
 1EH8 A;  3ECR A;  2L3J A;  4DR1 E;  2GPI A;  1O0W A;  3C4B A;  2EOZ A;  2YRK A;  4BC9 A;  4BBY A;  2DSY A;  3JAM C;  3MHS C;  2FGG A;  1FJG E;  2N8X A;  1X3C A;  1YZ9 A;  5IT9 C;  2EN6 A;  1A1F A;  5BR8 E;  2V85 A;  2EPZ A;  2EQ1 A;  5AE2 A;  1JK1 A;  1X48 A;  4BC7 A;  4M0V A;  2ZM6 E;  4NZV A;  3BF2 A;  3TQM A;  4DR7 E;  1YUJ A;  1XMQ E;  3JTZ A;  2WBS A;  1EH6 A;  1IBK E;  4L5N C;  2UUA E;  1A1I A;  1DGC A;  3T1Y E;  2EPK X;  4LF7 E;  1WXR A;  4B3T E;  5KL2 A;  4WSP A;  1XNR E;  2LT7 A;  2YTE A;  1UN6 B;  2LUQ A;  1WJP A;  2YTP A;  2E1M A;  2KOU A;  2YTQ A;  4KWY A;  3ZOQ B;  5A6B D;  2H36 X;  2EMH A;  4M2Z A;  2A25 A;  4B3R E;  2RSI A;  2K7I A;  4R2D A;  3RMP A;  4DV2 E;  2VQF E;  3KZY A;  2EN1 A;  2EQ3 A;  2B9D A;  3HPZ A;  2FTX B;  1IBL E;  2EPX A;  2JWO A;  4DUY E;  1J26 A;  2RS7 A;  4R03 A;  2LV2 A;  2EPN A;  3HQ1 A;  5KL3 A;  2CTD A;  1ZBQ A;  2VF1 A;  3QG5 C;  4NXM E;  4O4K A;  2R1F A;  4X8W A;  4IJD A;  4X65 E;  2EOQ A;  4LF9 E;  2EZ6 A;  4F9B B;  1YUI A;  1HR0 E;  2GLI A;  2EN7 A;  2V89 A;  5AC4 A;  2UXB E;  2EPC A;  2MC5 A;  4JI1 E;  2EPL X;  5KL5 A;  3UK3 C;  1IQO A;  4DV3 E;  1BBO A;  1X6E A;  2FV4 B;  3THO B;  2HJJ A;  2EMX A;  1T4O A;  1IBM E;  2YWQ A;  2EM3 A;  2EM8 A;  2EPA A;  1XNQ E;  5A6B A;  3T1H E;  2G7H A;  1A1J A;  4KHP E;  1GZ6 A;  2WCC 3;  4P7D A;  2VRD A;  4AQY E;  4JI2 E;  2B3T B;  5LMU E;  2MDG A;  2EMW A;  3J81 C;  1YYW A;  1SR9 A;  1HNW E;  4DUZ E;  2EMB A;  3EPH A;  4K0K E;  2N3G A;  1ZU1 A;  1PJT A;  4O5G A;  4BCA A;  3HXL A;  2M4I A;  1IMU A;  1YSA C;  2LUP B;  2EPO A;  2ELY A;  3BGH A;  2EM9 A;  2DLQ A;  4DV6 E;  2UUC E;  2DLK A;  2R76 A;  5AC5 A;  1J5E E;  2MKN A;  5T6J A;  4JI4 E;  2UXD E;  4DV7 E;  2CT1 A;  3P1X A;  2YU8 A;  4WPY A;  2HC5 A;  3THN A;  2EOF A;  2JOX A;  2YTJ A;  4KZS A;  2JVA A;  1WRJ A;  2ENH A;  1X5W A;  2N3H A;  1RMD A;  2F8B A;  4R2R A;  1RC7 A;  2EN4 A;  4O43 A;  1A1H A;  4WXD A;  1NEI A;  5FLX C;  1N3G A;  1T4N A;  1L4S A;  4DV0 E;  2EM5 A;  2YU5 A;  4F2J C;  2D9H A;  3HPS A;  2V88 A;  2EL6 A;  5AAS A;  2LTS A;  2MDR A;  4RHB B;  4DR4 E;  4WYQ B;  1LLM C;  4R8O A;  4DV1 E;  3M99 B;  4LFC E;  2EOO A;  5A6J A;  1YYO A;  1TF6 A;  2NUF A;  1UBD C;  2EOM A;  3L00 A;  4GZN C;  3ADL A;  2GHF A;  2MKD A;  4HEI A;  1A1G A;  3ADJ A;  4BHC A;  4M9V C;  5A69 A;  4DR5 E;  4TUG A;  2YTI A;  2EPM X;  2EMK A;  2YRH A;  2UU9 E;  3LML A;  2HHH E;  2RQL A;  4F6N A;  2YSP A;  1UHZ A;  5LL6 R;  2JP9 A;  4L8N A;  1EKZ A;  4LFA E;  1AAY A;  1X49 A;  2YTN A;  2JR1 A;  2L2M A;  1PKP A;  2LTR A;  2LRS A;  2EL4 A;  3KWR A;  2J7J A;  2RS6 A;  1TN9 A;  5LLQ A;  4B3S E;  4LF6 E;  2EM4 A;  5IV8 B;  1ZR9 A;  2B7T A;  1TF3 A;  1QNT A;  2YTG A;  1T39 A;  4R2P A;  1A1L A;  3EPK A;  1X6H A;  2JY9 A;  2YRM A;  1BBG A;  3J80 C;  2EJ4 A;  2L92 A;  1XMO E;  3OTO E;  1KJK A;  5KL7 A;  4LU9 A;  4BHB A;  2YTD A;  3HTX A;  4GKK E;  1P47 A;  3VYY A;  4JI5 E;  4MLV A;  2ELZ A;  2DB2 A;  1IQS A;  4DR6 E;  4R2E A;  1DQ3 A;  1X6F A;  4GKJ E;  2EMA A;  2ODR D;  4WFT A;  2EM6 A;  2DMY A;  2B7V A;  2E72 A;  2BB8 A;  2BBG A;  4NHR A;  1YYK A;  2K4V A;  3VHT B;  2YTF A;  2KON A;  1PDA A;  2NA2 A;  5A6K A;  3IWB A;  3F6G A;  1YFH A;  4DR3 E;  4LF5 E;  2Q8U A;  3FIG A;  4DV4 E;  1G2D C;  2PRT A;  4LFB E;  2EOS A;  2EM7 A;  4JI0 E;  2DGC A;  3IWC A;  2I13 A;  1HNZ E;  4WX9 A;  5A2Q C;  1STU A;  2EMY A;  4ZYH A;  3BID A;  2NUE A;  2EMI A;  2F4V E;  2EM2 A;  4M30 A;  3IWD A;  1MEY C;  3KZZ A;  2EE8 A;  4JYA E;  2WZO A;  2LBS B;  2LMZ A;  2EMZ A;  4BS9 A;  2EMF A;  4WSG A;  2EPU A;  3ADG A;  4HTG A;  4IS1 C;  1PJQ A;  2V86 A;  2VQE E;  2EN2 A;  2WBT A;  1UIL A;  1SFE A;  1JK2 A;  3BBG A;  2EWL A;  2UUB E;  2ENC A;  4MLQ A;  5DNY A;  4LF8 E;  1HNX E;  2JOB A;  1F2I G;  4P78 A;  4JI3 E;  3AV0 A;  4B3M E;  4WXC A;  2EMC A;  1MGT A;  2L2N A;  2RTX A;  1NCS A;  4F9A B;  1I94 E;  2MC6 A;  2JYA A;  4F9C B;  1RQ0 A;  2EPR A;  4YY3 E;  1T4L B;  2EOI A;  1YPN A;  2EN3 A;  2VE7 C;  2KHX A;  2RSM A;  2YPN A;  2RPC A;  4JI8 E;  1N36 E;  2M9A A;  3C6M A;  3C4T A;  3DJW A;  2EPP A;  2V8Q B;  2LO3 A;  5CFF E;  1QU6 A;  2L8T A;  2LJU A;  3VYX A;  4JV5 E;  2HGH A;  1X47 A;  3LLH A;  4Q28 A;  2YT4 A;  2YSO A;  5KL6 A;  4JI6 E;  3JU0 A;  4ZYG A;  2DMI A;  2L3C A;  4I8O A;  3K6Q A;  1ZBT A;  2YTO A;  4FK5 C;  5IWA E;  4LTY A;  2LVH A;  3F6H A;  4JI7 E;  1A1K A;  4Q35 B;  5KL4 A;  3MSW A;  4O24 A;  2EOH A;  2ENA A;  3J7A G;  4X62 E;  4OOG C;  3EPL A;  2EML A;  2LJH A;  1WHQ A;  1GQE A;  4X64 E;  1WHN A;  4DMI A;  2CPN A;  1FKA E;  2UXC E;  4F6M A;  2I9I A;  4RH8 A;  2EN8 A;  2EOJ A;  5LMN E;  4ZYE A;  1ZAA C;  2NUG A;  2M7Q A;  2V87 A;  3C6K A;  4J8Z A;  4X66 E;  5F3W A;  3MHH C;  1KYQ A;  4N4R B;  5TSE A;  3J7Y p;  2NAB A;  2IHR 1;  4F54 A;  5AE3 A;  2EOR A;  4TUI A;  2EQ0 A;  4R2C A;  2EM0 A;  2L33 A;  4LF4 E;  1B69 A;  3AUZ A;  1BB8 A;  1N32 E;  2EP3 A;  1G2F C;  2JPA A;  2YZT A;  2M1S A;  2EL5 A;  3H09 A;  2L6M A;  1EH7 A;  3DF6 A;  4GEQ B;  2ODR C;  5IXM B;  3ADI A;  3EPJ A;  1N33 E;  4YHH E;  2DRP A;  1T38 A;  1GTK A;  1Z1B A;  2ADR A;  2EMG A;  2EOE A;  1PJS A;  4ZYD A;  2L2K B;  1N34 E;  1DI2 A;  3VK6 A;  2EOX A;  4NXN E;  4DV5 E;  4OX9 E;  4DKK A;  3EQ1 A;  4DR2 E;  2WBU A;  5AE1 A;  2LCE A;  2E5L E;  4BMJ A;  2CSH A;  2LE2 A;  4R2A A;  1AH5 A;  2V83 A;  2EOY A;  4X9J A;  3OML A;  5ADZ A;  5A6A A;  4R2Q A;  2DIX A;  4R2S A;  2JXP A; 
#chains in the Genus database with same CATH homology
 4P7D A;  1QU6 A;  2L8T A;  2B7T A;  4AQY E;  4JI2 E;  2L3J A;  3VYX A;  4DR1 E;  4JV5 E;  1X47 A;  3LLH A;  4Q28 A;  2B3T B;  2YT4 A;  5LMU E;  1O0W A;  3C4B A;  3JAM C;  4BC9 A;  4BBY A;  4JI6 E;  2DSY A;  3J81 C;  2FGG A;  1FJG E;  3JU0 A;  2JY9 A;  1SR9 A;  1YYW A;  1HNW E;  2L3C A;  4DUZ E;  3J80 C;  5IT9 C;  1YZ9 A;  4I8O A;  2L92 A;  4K0K E;  1XMO E;  2N3G A;  3K6Q A;  1ZBT A;  5BR8 E;  2V85 A;  2M4I A;  3HXL A;  4BCA A;  3OTO E;  5IWA E;  5AE2 A;  4LTY A;  4LU9 A;  4GKK E;  3HTX A;  3F6H A;  1X48 A;  4JI7 E;  4BC7 A;  3VYY A;  2LUP B;  4JI5 E;  4M0V A;  2ZM6 E;  2DB2 A;  3MSW A;  4DR7 E;  4DR6 E;  4DV6 E;  1XMQ E;  1DQ3 A;  3JTZ A;  4OOG C;  4X62 E;  2UUC E;  1IBK E;  3J7A G;  4L5N C;  2UUA E;  2ODR D;  1J5E E;  4WFT A;  2LJH A;  3T1Y E;  5T6J A;  2DMY A;  2B7V A;  1WHQ A;  4JI4 E;  4LF7 E;  1WXR A;  1GQE A;  4B3T E;  4X64 E;  1WHN A;  4WSP A;  1YYK A;  2UXD E;  2K4V A;  4DV7 E;  1XNR E;  2KON A;  2NA2 A;  4DMI A;  2LUQ A;  2CPN A;  3P1X A;  1FKA E;  2UXC E;  3IWB A;  4WPY A;  3F6G A;  2E1M A;  2KOU A;  3ZOQ B;  5LMN E;  4DR3 E;  2H36 X;  4LF5 E;  2JOX A;  3FIG A;  4KZS A;  4DV4 E;  2NUG A;  4M2Z A;  2JVA A;  4LFB E;  4B3R E;  2M7Q A;  4JI0 E;  2N3H A;  2V87 A;  4J8Z A;  3IWC A;  4X66 E;  1HNZ E;  5F3W A;  2F8B A;  1RC7 A;  3RMP A;  5A2Q C;  4DV2 E;  1STU A;  2VQF E;  3J7Y p;  2NUE A;  2IHR 1;  5FLX C;  4F54 A;  5AE3 A;  2B9D A;  2F4V E;  3HPZ A;  2FTX B;  4TUI A;  4M30 A;  1IBL E;  2L33 A;  4LF4 E;  2JWO A;  4DUY E;  1J26 A;  1T4N A;  2RS7 A;  4R03 A;  3IWD A;  3AUZ A;  4DV0 E;  3HQ1 A;  4JYA E;  3HPS A;  2V88 A;  5AAS A;  1ZBQ A;  1N32 E;  2VF1 A;  2WZO A;  2LTS A;  4NXM E;  2MDR A;  4DR4 E;  2LBS B;  4WYQ B;  2LMZ A;  2YZT A;  4R8O A;  2M1S A;  4X8W A;  4BS9 A;  3H09 A;  4DV1 E;  4LFC E;  2L6M A;  1YYO A;  4X65 E;  3DF6 A;  4GEQ B;  4LF9 E;  2NUF A;  3ADG A;  2ODR C;  4F9B B;  2EZ6 A;  3ADI A;  2V86 A;  2VQE E;  1N33 E;  4YHH E;  1UIL A;  1HR0 E;  3ADL A;  2UUB E;  2EWL A;  3ADJ A;  5DNY A;  4LF8 E;  1HNX E;  2JOB A;  2L2K B;  2V89 A;  4P78 A;  4JI3 E;  1N34 E;  2MC5 A;  4GKJ E;  1DI2 A;  4JI1 E;  3AV0 A;  2UXB E;  4DR5 E;  4B3M E;  4TUG A;  3VK6 A;  4NXN E;  2L2N A;  4DV3 E;  4DV5 E;  2RTX A;  4OX9 E;  4DKK A;  4F9A B;  3LML A;  2FV4 B;  2HHH E;  2UU9 E;  4DR2 E;  1UHZ A;  5LL6 R;  2MC6 A;  4L8N A;  5AE1 A;  4F9C B;  1I94 E;  1T4O A;  1EKZ A;  4LFA E;  2E5L E;  1IBM E;  1RQ0 A;  4BMJ A;  1X49 A;  4YY3 E;  2LE2 A;  1XNQ E;  1T4L B;  2JR1 A;  2L2M A;  2V83 A;  1PKP A;  3T1H E;  2G7H A;  2LTR A;  2VE7 C;  3OML A;  2KHX A;  5ADZ A;  4KHP E;  2LRS A;  2RSM A;  3KWR A;  4JI8 E;  1GZ6 A;  1N36 E;  2RS6 A;  4B3S E;  4LF6 E;  2DIX A;  3C4T A;  3DJW A;  5CFF E;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...