2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
b'MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tRNA hydrolase domain
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
4DKKA 2N3GA 4LF9E 4B3ME 4JI7E 2UXCE 1PKPA 3HTXA 1XMQE 4LFCE 4DR1E 2CPNA 4JI3E 2YT4A 4OX9E 4X65E 4JI0E 1YYKA 4DUYE 1FJGE 4DV4E 3LLHA 4JI4E 3ADGA 1N32E 4DV2E 2LJHA 1XNRE 4OOGC 4JV5E 4LF6E 3C4TA 1T4NA 4LFBE 4X8WA 3ADLA 4JI8E 1O0WA 1GQEA 5IWAE 1ZBTA 1HNXE 1J5EE 1UILA 2UXBE 4JI6E 2N3HA 2EZ6A 1DI2A 1YYOA 4M30A 2UUCE 2L2MA 4LF4E 1X49A 2ZM6E 2UXDE 2NUEA 5LMUE 4DV0E 2RSMA 4DR4E 4DR7E 2DB2A 2NA2A 1IBKE 2NUFA 1T4LB 2UU9E 4LF5E 1RQ0A 1EKZA 2L3CA 1XNQE 3ADIA 3VYXA 2B7VA 5LMNE 2HHHE 2NUGA 2B7TA 4DUZE 2L2KB 1RC7A 1N33E 4DV3E 2LBSB 1QU6A 2RS6A 4DV5E 4AQYE 1HR0E 1FKAE 4GKKE 1T4OA 5CFFE 2LTSA 2LUPB 2F4VE 1YZ9A 2RS7A 4K0KE 3ADJA 4B3TE 3P1XA 2VQEE 4NXNE 3VYYA 4DV7E 1XMOE 1HNWE 4LF7E 4M2ZA 2L2NA 2VQFE 2B3TB 2LTRA 3OTOE 4B3SE 4WFTA 4DR2E 2L3JA 1X47A 2UUBE 4KHPE 2IHR1 1HNZE 2RTXA 4X64E 1IBLE 4LF8E 4LFAE 2E5LE 2DIXA 2LUQA 1WHNA 1X48A 4YY3E 4WYQB 2JVAA 2UUAE 4JYAE 2KHXA 4X62E 4NXME 4JI5E 1UHZA 4DR6E 1STUA 2L33A 1YYWA 4JI1E 1WHQA 4DR5E 4DV6E 4JI2E 4YHHE 3J7Yp 4B3RE 3C4BA 4DR3E 4DV1E 2DMYA 4X66E 1I94E 3T1YE 1IBME 1N36E 1J26A 1N34E 5BR8E 2LRSA 2MDRA 3T1HE 4GKJE 2JY9A
chains in the Genus database with same CATH superfamily
4BBYA 1PDAA 4LF9E 2EPRA 5A6JA 2EMIA 2EM4A 2EPLX 2K4VA 4DR1E 2ADRA 2EPNA 2CPNA 2EOIA 4JI3E 2YT4A 4OX9E 2EOOA 2I9IA 2JXPA 3C6MA 1FJGE 4DV4E 2EMAA 3IWBA 2YWQA 5AC5A 1N32E 2YTDA 4JV5E 2YPNA 3C4TA 3ADLA 1O0WA 2YU5A 1ZBTA 2EM6A 2ODRC 4ZYHA 2EN2A 1X49A 1YPNA 2EPPA 2MKDA 4DV0E 3M99B 4DR7E 4BHCA 4WXCA 5AE2A 2UU9E 2WZOA 2L3CA 2EM9A 1PJTA 5AE3A 3VYXA 2V85A 5A6KA 4R2QA 5LMNE 4X9JA 2B7TA 3KWRA 2R76A 2L2KB 3JAMC 2LBSB 4DV5E 2DSYA 2A25A 1BBGA 2EMBA 2DLQA 5KL6A 1JK1A 2LUPB 2EMFA 4K0KE 4WSGA 3TQMA 3P1XA 4F2JC 2J7JA 1TF6A 3VK6A 2V83A 2LTRA 5IV8B 4WFTA 4RHBB 4DR2E 5A6BD 3EPHA 1X6EA 2NABA 1HNZE 2YTJA 2RTXA 3HXLA 2ENHA 1MGTA 2EN4A 4YY3E 2V86A 2JR1A 2EWLA 4JYAE 2KHXA 3VHTB 4X62E 2WCC3 4JI5E 4ZYGA 4DR6E 4R2DA 2MDGA 1STUA 4GZNC 1YYWA 1GTKA 2ODRD 4M9VC 4DV6E 2EQ3A 4YHHE 2EPXA 4DR3E 4DV1E 3T1YE 2YTEA 3DJWA 4KWYA 1IBME 4NZVA 5BR8E 2LMZA 2EMXA 2JOXA 2EMGA 4O4KA 4F9BB 4O24A 3IWCA 1F2IG 2B9DA 4LU9A 1ZU1A 4JI7E 2EOQA 2ELYA 4BMJA 4F54A 1PKPA 3HTXA 4LFCE 2R1FA 2HJJA 2EOEA 2VF1A 4FK5C 4JI0E 2F8BA 5IT9C 2M7QA 1YYKA 2MC6A 4DUYE 4F6NA 1YUJA 2D9HA 2CTDA 4DV2E 2LJHA 1XNRE 1L4SA 4OOGC 2EOHA 2M9AA 4JI8E 2WBSA 1GQEA 2M1SA 1J5EE 2EORA 1A1IA 2UXBE 2E1MA 1AH5A 4P78A 4JI6E 2EPUA 2EM8A 2EM7A 2EZ6A 2GHFA 3JU0A 1YYOA 2L2MA 2UUCE 2UXDE 2NUEA 5LMUE 2EN1A 4DR4E 3BF2A 1G2FC 1YSAC 1ZR9A 2EP3A 4ZYEA 4HTGA 2EMYA 2L8TA 1XNQE 4R03A 4BCAA 2B7VA 2HHHE 2BB8A 2NUGA 2EOYA 4DV3E 1QU6A 2YSPA 2RS6A 1FKAE 4DMIA 5CFFE 3AV0A 4F6MA 2F4VE 2RS7A 3MSWA 4NXNE 3VYYA 4BS9A 4LF7E 1A1HA 1X6HA 4M2ZA 2L2NA 1X3CA 2FV4B 1ZAAC 1X5WA 4B3SE 1PJQA 2L3JA 1X47A 2EL5A 2PRTA 4RH8A 4X64E 3AUZA 5A6BA 2EPZA 5LL6R 2LUQA 2WBUA 1WHNA 4WYQB 1NCSA 2N8XA 3F6GA 2UUAE 2EOZA 2EMZA 3C6KA 1GZ6A 4NXME 3IWDA 1EH8A 5TSEA 1Z1BA 4BHBA 1WHQA 4BC9A 2DGCA 4DR5E 2FTXB 4JI2E 2KONA 2EN7A 1MEYC 5A6AA 2DMYA 4X66E 2L6MA 1I94E 4R2EA 1N36E 4WSPA 2EOSA 3F6HA 1N34E 2G7HA 5A69A 4GKJE 4LTYA 2JY9A 1A1FA 5A2QC 3FIGA 3BBGA 3BIDA 3L00A 4R2SA 1XMQE 5KL3A 4KZSA 3ECRA 3ZOQB 1IQOA 4TUIA 3LLHA 4WXDA 4F9AB 2EL6A 2YRMA 2YRKA 1T4NA 4X8WA 2JPAA 5IWAE 1HNXE 1KJKA 1DGCA 4IS1C 1UILA 1TF3A 4Q35B 2N3HA 1DI2A 2BBGA 4M30A 2RSIA 2MKNA 2YU8A 4GEQB 2JOBA 1PJSA 1P47A 2DB2A 2NA2A 3J7AG 3MHHC 2EN8A 1IBKE 2NUFA 2JP9A 4R8OA 2YTQA 2EOXA 1DQ3A 1NEIA 4DUZE 2YTNA 5F3WA 3H09A 1N33E 4AQYE 3EPLA 2VE7C 2K7IA 1A1JA 2YZTA 4R2AA 2FGGA 1SR9A 2I13A 3J80C 4WX9A 2YSOA 4R2CA 1G2DC 4NHRA 2VQFE 5IXMB 2B3TB 2ENCA 2YRHA 3OTOE 2V88A 4Q28A 2LCEA 4KHPE 2EMWA 3KZYA 2E72A 1IBLE 2WBTA 4LFAE 2DIXA 2MC5A 3HPSA 4IJDA 2YTPA 3K6QA 4J8ZA 2HC5A 3OMLA 1UHZA 3THOB 1YFHA 4JI1E 5AASA 2DLKA 1BBOA 1JK2A 2V8QB 4B3RE 5KL2A 1YUIA 1A1KA 5KL7A 1A1GA 2HGHA 3BGHA 2JWOA 2KOUA 2MDRA 2EMKA 2EPOA 2DRPA 4L8NA 3THNA 4DKKA 2N3GA 2LV2A 2EMLA 4B3ME 2LO3A 2LJUA 3RMPA 2UXCE 2EN3A 2EPCA 3HPZA 1T38A 2YTOA 3JTZA 4X65E 2LE2A 2M4IA 3DF6A 4JI4E 2CSHA 2DMIA 3ADGA 1EH7A 4LF6E 2RQLA 4LFBE 4L5NC 2EM0A 2EM5A 2EMCA 2EM2A 2RPCA 4MLVA 1RMDA 3QG5C 1AAYA 2EM3A 3EQ1A 1WXRA 2EOJA 1T39A 1B69A 2EOMA 4LF4E 2ZM6E 1BB8A 2EPKX 1UBDC 2RSMA 5AC4A 3J81C 1LLMC 1EH6A 1A1LA 4WPYA 1T4LB 2YTIA 4HEIA 4LF5E 1RQ0A 4O43A 1EKZA 2EE8A 2ENAA 4R2RA 1SFEA 3ADIA 4ZYDA 3EPKA 1RC7A 2ELZA 4GKKE 4R2PA 1HR0E 1T4OA 4P7DA 2JYAA 4M0VA 2EOFA 4TUGA 2LTSA 1IQSA 1YZ9A 3ADJA 2LT7A 4B3TE 2VQEE 2EPMX 4DV7E 1XMOE 1HNWE 4I8OA 3HQ1A 2Q8UA 3MHSC 1WRJA 5ADZA 5KL5A 5FLXC 2V87A 2UUBE 1IMUA 4F9CB 2IHR1 5DNYA 3EPJA 2LVHA 2YTGA 4O5GA 5LLQA 2EN6A 4LF8E 2E5LE 1X48A 5AE1A 1UN6B 2JVAA 1QNTA 2CT1A 1WJPA 5KL4A 2L92A 2GLIA 1KYQA 1N3GA 1X6FA 4BC7A 3KZZA 2L33A 2EPAA 2H36X 2EMHA 2GPIA 2V89A 3J7Yp 2EJ4A 3C4BA 4N4RB 1TN9A 2YTFA 4MLQA 2VRDA 5T6JA 1ZBQA 2EL4A 2EQ1A 1J26A 3UK3C 2LRSA 3LMLA 3T1HE 2EQ0A
chains in the Genus database with same CATH topology
4BBYA 2N3GA 3FIGA 4DKKA 4LF9E 2B9DA 4LU9A 4B3ME 4JI7E 3RMPA 4BMJA 4F54A 2UXCE 1PKPA 2K4VA 3HTXA 1XMQE 4LFCE 4DR1E 3HPZA 2CPNA 4KZSA 4JI3E 2VF1A 2YT4A 3ZOQB 4OX9E 3JTZA 4X65E 2F8BA 5IT9C 2LE2A 2M7QA 2MC6A 4JI0E 4DUYE 4TUIA 4DV4E 1FJGE 1YYKA 3IWBA 3LLHA 2M4IA 3DF6A 4JI4E 3ADGA 1N32E 4DV2E 4F9AB 2LJHA 1XNRE 4OOGC 4JV5E 4LF6E 3C4TA 1T4NA 4LFBE 4L5NC 4X8WA 3ADLA 4JI8E 1O0WA 1GQEA 5IWAE 1ZBTA 1HNXE 2M1SA 1J5EE 1UILA 2UXBE 2ODRC 2E1MA 4P78A 4JI6E 1WXRA 2N3HA 2EZ6A 1DI2A 3JU0A 4M30A 1YYOA 2L2MA 2UUCE 4LF4E 1X49A 2ZM6E 2UXDE 2NUEA 5LMUE 4DV0E 2RSMA 4GEQB 3J81C 4DR4E 2JOBA 4DR7E 2DB2A 2NA2A 3J7AG 4WPYA 1IBKE 2NUFA 1T4LB 5AE2A 2UU9E 2L8TA 1RQ0A 2WZOA 4R8OA 1EKZA 4LF5E 2L3CA 4R03A 1XNQE 3ADIA 5AE3A 3VYXA 1DQ3A 2V85A 4BCAA 2B7VA 5LMNE 2HHHE 2NUGA 2B7TA 4DUZE 3KWRA 2L2KB 5F3WA 3H09A 3JAMC 4DV3E 1RC7A 1N33E 2LBSB 1QU6A 2RS6A 4DV5E 2DSYA 4AQYE 1FKAE 1HR0E 4GKKE 1T4OA 4P7DA 4DMIA 2VE7C 4M0VA 5CFFE 3AV0A 4TUGA 2LTSA 2LUPB 2F4VE 1YZ9A 2RS7A 2YZTA 3ADJA 4B3TE 4K0KE 2FGGA 1SR9A 3MSWA 3P1XA 2VQEE 3VYYA 3J80C 4DV7E 3VK6A 1XMOE 4NXNE 2V83A 4I8OA 4BS9A 4LF7E 1HNWE 4M2ZA 3HQ1A 2L2NA 2VQFE 2FV4B 2B3TB 2LTRA 3OTOE 5ADZA 4B3SE 2V88A 4WFTA 4Q28A 4DR2E 2L3JA 1X47A 5FLXC 2V87A 2UUBE 4KHPE 4F9CB 2IHR1 5DNYA 1HNZE 2RTXA 4X64E 1IBLE 4LF8E 3AUZA 4LFAE 3HXLA 5LL6R 2E5LE 2DIXA 2MC5A 2LUQA 1WHNA 1X48A 5AE1A 3HPSA 4YY3E 4WYQB 2V86A 2JVAA 3F6GA 2JR1A 2UUAE 2EWLA 4JYAE 2KHXA 3K6QA 1GZ6A 4J8ZA 4X62E 4NXME 3IWDA 4JI5E 3OMLA 1UHZA 4DR6E 2L92A 4BC7A 1STUA 2L33A 1YYWA 4JI1E 5AASA 2ODRD 2H36X 1WHQA 4BC9A 4DR5E 2FTXB 2V89A 4DV6E 4JI2E 2KONA 4YHHE 2V8QB 3J7Yp 4B3RE 3C4BA 4DR3E 4DV1E 2DMYA 4X66E 2L6MA 5T6JA 1I94E 3T1YE 1ZBQA 3DJWA 1IBME 1N36E 4WSPA 1J26A 2JWOA 3F6HA 1N34E 2KOUA 5BR8E 2LMZA 2LRSA 2JOXA 2G7HA 2MDRA 3LMLA 3T1HE 4F9BB 4LTYA 2JY9A 4GKJE 4L8NA 3IWCA 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKK A;  2N3G A;  4LF9 E;  4B3M E;  4JI7 E;  2UXC E;  1PKP A;  3HTX A;  1XMQ E;  4LFC E;  4DR1 E;  2CPN A;  4JI3 E;  2YT4 A;  4OX9 E;  4X65 E;  4JI0 E;  1YYK A;  4DUY E;  1FJG E;  4DV4 E;  3LLH A;  4JI4 E;  3ADG A;  1N32 E;  4DV2 E;  2LJH A;  1XNR E;  4OOG C;  4JV5 E;  4LF6 E;  3C4T A;  1T4N A;  4LFB E;  4X8W A;  3ADL A;  4JI8 E;  1O0W A;  1GQE A;  5IWA E;  1ZBT A;  1HNX E;  1J5E E;  1UIL A;  2UXB E;  4JI6 E;  2N3H A;  2EZ6 A;  1DI2 A;  1YYO A;  4M30 A;  2UUC E;  2L2M A;  4LF4 E;  1X49 A;  2ZM6 E;  2UXD E;  2NUE A;  5LMU E;  4DV0 E;  2RSM A;  4DR4 E;  4DR7 E;  2DB2 A;  2NA2 A;  1IBK E;  2NUF A;  1T4L B;  2UU9 E;  4LF5 E;  1RQ0 A;  1EKZ A;  2L3C A;  1XNQ E;  3ADI A;  3VYX A;  2B7V A;  5LMN E;  2HHH E;  2NUG A;  2B7T A;  4DUZ E;  2L2K B;  1RC7 A;  1N33 E;  4DV3 E;  2LBS B;  1QU6 A;  2RS6 A;  4DV5 E;  4AQY E;  1HR0 E;  1FKA E;  4GKK E;  1T4O A;  5CFF E;  2LTS A;  2LUP B;  2F4V E;  1YZ9 A;  2RS7 A;  4K0K E;  3ADJ A;  4B3T E;  3P1X A;  2VQE E;  4NXN E;  3VYY A;  4DV7 E;  1XMO E;  1HNW E;  4LF7 E;  4M2Z A;  2L2N A;  2VQF E;  2B3T B;  2LTR A;  3OTO E;  4B3S E;  4WFT A;  4DR2 E;  2L3J A;  1X47 A;  2UUB E;  4KHP E;  2IHR 1;  1HNZ E;  2RTX A;  4X64 E;  1IBL E;  4LF8 E;  4LFA E;  2E5L E;  2DIX A;  2LUQ A;  1WHN A;  1X48 A;  4YY3 E;  4WYQ B;  2JVA A;  2UUA E;  4JYA E;  2KHX A;  4X62 E;  4NXM E;  4JI5 E;  1UHZ A;  4DR6 E;  1STU A;  2L33 A;  1YYW A;  4JI1 E;  1WHQ A;  4DR5 E;  4DV6 E;  4JI2 E;  4YHH E;  3J7Y p;  4B3R E;  3C4B A;  4DR3 E;  4DV1 E;  2DMY A;  4X66 E;  1I94 E;  3T1Y E;  1IBM E;  1N36 E;  1J26 A;  1N34 E;  5BR8 E;  2LRS A;  2MDR A;  3T1H E;  4GKJ E;  2JY9 A; 
#chains in the Genus database with same CATH topology
 4BBY A;  1PDA A;  4LF9 E;  2EPR A;  5A6J A;  2EMI A;  2EM4 A;  2EPL X;  2K4V A;  4DR1 E;  2ADR A;  2EPN A;  2CPN A;  2EOI A;  4JI3 E;  2YT4 A;  4OX9 E;  2EOO A;  2I9I A;  2JXP A;  3C6M A;  1FJG E;  4DV4 E;  2EMA A;  3IWB A;  2YWQ A;  5AC5 A;  1N32 E;  2YTD A;  4JV5 E;  2YPN A;  3C4T A;  3ADL A;  1O0W A;  2YU5 A;  1ZBT A;  2EM6 A;  2ODR C;  4ZYH A;  2EN2 A;  1X49 A;  1YPN A;  2EPP A;  2MKD A;  4DV0 E;  3M99 B;  4DR7 E;  4BHC A;  4WXC A;  5AE2 A;  2UU9 E;  2WZO A;  2L3C A;  2EM9 A;  1PJT A;  5AE3 A;  3VYX A;  2V85 A;  5A6K A;  4R2Q A;  5LMN E;  4X9J A;  2B7T A;  3KWR A;  2R76 A;  2L2K B;  3JAM C;  2LBS B;  4DV5 E;  2DSY A;  2A25 A;  1BBG A;  2EMB A;  2DLQ A;  5KL6 A;  1JK1 A;  2LUP B;  2EMF A;  4K0K E;  4WSG A;  3TQM A;  3P1X A;  4F2J C;  2J7J A;  1TF6 A;  3VK6 A;  2V83 A;  2LTR A;  5IV8 B;  4WFT A;  4RHB B;  4DR2 E;  5A6B D;  3EPH A;  1X6E A;  2NAB A;  1HNZ E;  2YTJ A;  2RTX A;  3HXL A;  2ENH A;  1MGT A;  2EN4 A;  4YY3 E;  2V86 A;  2JR1 A;  2EWL A;  4JYA E;  2KHX A;  3VHT B;  4X62 E;  2WCC 3;  4JI5 E;  4ZYG A;  4DR6 E;  4R2D A;  2MDG A;  1STU A;  4GZN C;  1YYW A;  1GTK A;  2ODR D;  4M9V C;  4DV6 E;  2EQ3 A;  4YHH E;  2EPX A;  4DR3 E;  4DV1 E;  3T1Y E;  2YTE A;  3DJW A;  4KWY A;  1IBM E;  4NZV A;  5BR8 E;  2LMZ A;  2EMX A;  2JOX A;  2EMG A;  4O4K A;  4F9B B;  4O24 A;  3IWC A;  1F2I G;  2B9D A;  4LU9 A;  1ZU1 A;  4JI7 E;  2EOQ A;  2ELY A;  4BMJ A;  4F54 A;  1PKP A;  3HTX A;  4LFC E;  2R1F A;  2HJJ A;  2EOE A;  2VF1 A;  4FK5 C;  4JI0 E;  2F8B A;  5IT9 C;  2M7Q A;  1YYK A;  2MC6 A;  4DUY E;  4F6N A;  1YUJ A;  2D9H A;  2CTD A;  4DV2 E;  2LJH A;  1XNR E;  1L4S A;  4OOG C;  2EOH A;  2M9A A;  4JI8 E;  2WBS A;  1GQE A;  2M1S A;  1J5E E;  2EOR A;  1A1I A;  2UXB E;  2E1M A;  1AH5 A;  4P78 A;  4JI6 E;  2EPU A;  2EM8 A;  2EM7 A;  2EZ6 A;  2GHF A;  3JU0 A;  1YYO A;  2L2M A;  2UUC E;  2UXD E;  2NUE A;  5LMU E;  2EN1 A;  4DR4 E;  3BF2 A;  1G2F C;  1YSA C;  1ZR9 A;  2EP3 A;  4ZYE A;  4HTG A;  2EMY A;  2L8T A;  1XNQ E;  4R03 A;  4BCA A;  2B7V A;  2HHH E;  2BB8 A;  2NUG A;  2EOY A;  4DV3 E;  1QU6 A;  2YSP A;  2RS6 A;  1FKA E;  4DMI A;  5CFF E;  3AV0 A;  4F6M A;  2F4V E;  2RS7 A;  3MSW A;  4NXN E;  3VYY A;  4BS9 A;  4LF7 E;  1A1H A;  1X6H A;  4M2Z A;  2L2N A;  1X3C A;  2FV4 B;  1ZAA C;  1X5W A;  4B3S E;  1PJQ A;  2L3J A;  1X47 A;  2EL5 A;  2PRT A;  4RH8 A;  4X64 E;  3AUZ A;  5A6B A;  2EPZ A;  5LL6 R;  2LUQ A;  2WBU A;  1WHN A;  4WYQ B;  1NCS A;  2N8X A;  3F6G A;  2UUA E;  2EOZ A;  2EMZ A;  3C6K A;  1GZ6 A;  4NXM E;  3IWD A;  1EH8 A;  5TSE A;  1Z1B A;  4BHB A;  1WHQ A;  4BC9 A;  2DGC A;  4DR5 E;  2FTX B;  4JI2 E;  2KON A;  2EN7 A;  1MEY C;  5A6A A;  2DMY A;  4X66 E;  2L6M A;  1I94 E;  4R2E A;  1N36 E;  4WSP A;  2EOS A;  3F6H A;  1N34 E;  2G7H A;  5A69 A;  4GKJ E;  4LTY A;  2JY9 A;  1A1F A;  5A2Q C;  3FIG A;  3BBG A;  3BID A;  3L00 A;  4R2S A;  1XMQ E;  5KL3 A;  4KZS A;  3ECR A;  3ZOQ B;  1IQO A;  4TUI A;  3LLH A;  4WXD A;  4F9A B;  2EL6 A;  2YRM A;  2YRK A;  1T4N A;  4X8W A;  2JPA A;  5IWA E;  1HNX E;  1KJK A;  1DGC A;  4IS1 C;  1UIL A;  1TF3 A;  4Q35 B;  2N3H A;  1DI2 A;  2BBG A;  4M30 A;  2RSI A;  2MKN A;  2YU8 A;  4GEQ B;  2JOB A;  1PJS A;  1P47 A;  2DB2 A;  2NA2 A;  3J7A G;  3MHH C;  2EN8 A;  1IBK E;  2NUF A;  2JP9 A;  4R8O A;  2YTQ A;  2EOX A;  1DQ3 A;  1NEI A;  4DUZ E;  2YTN A;  5F3W A;  3H09 A;  1N33 E;  4AQY E;  3EPL A;  2VE7 C;  2K7I A;  1A1J A;  2YZT A;  4R2A A;  2FGG A;  1SR9 A;  2I13 A;  3J80 C;  4WX9 A;  2YSO A;  4R2C A;  1G2D C;  4NHR A;  2VQF E;  5IXM B;  2B3T B;  2ENC A;  2YRH A;  3OTO E;  2V88 A;  4Q28 A;  2LCE A;  4KHP E;  2EMW A;  3KZY A;  2E72 A;  1IBL E;  2WBT A;  4LFA E;  2DIX A;  2MC5 A;  3HPS A;  4IJD A;  2YTP A;  3K6Q A;  4J8Z A;  2HC5 A;  3OML A;  1UHZ A;  3THO B;  1YFH A;  4JI1 E;  5AAS A;  2DLK A;  1BBO A;  1JK2 A;  2V8Q B;  4B3R E;  5KL2 A;  1YUI A;  1A1K A;  5KL7 A;  1A1G A;  2HGH A;  3BGH A;  2JWO A;  2KOU A;  2MDR A;  2EMK A;  2EPO A;  2DRP A;  4L8N A;  3THN A;  4DKK A;  2N3G A;  2LV2 A;  2EML A;  4B3M E;  2LO3 A;  2LJU A;  3RMP A;  2UXC E;  2EN3 A;  2EPC A;  3HPZ A;  1T38 A;  2YTO A;  3JTZ A;  4X65 E;  2LE2 A;  2M4I A;  3DF6 A;  4JI4 E;  2CSH A;  2DMI A;  3ADG A;  1EH7 A;  4LF6 E;  2RQL A;  4LFB E;  4L5N C;  2EM0 A;  2EM5 A;  2EMC A;  2EM2 A;  2RPC A;  4MLV A;  1RMD A;  3QG5 C;  1AAY A;  2EM3 A;  3EQ1 A;  1WXR A;  2EOJ A;  1T39 A;  1B69 A;  2EOM A;  4LF4 E;  2ZM6 E;  1BB8 A;  2EPK X;  1UBD C;  2RSM A;  5AC4 A;  3J81 C;  1LLM C;  1EH6 A;  1A1L A;  4WPY A;  1T4L B;  2YTI A;  4HEI A;  4LF5 E;  1RQ0 A;  4O43 A;  1EKZ A;  2EE8 A;  2ENA A;  4R2R A;  1SFE A;  3ADI A;  4ZYD A;  3EPK A;  1RC7 A;  2ELZ A;  4GKK E;  4R2P A;  1HR0 E;  1T4O A;  4P7D A;  2JYA A;  4M0V A;  2EOF A;  4TUG A;  2LTS A;  1IQS A;  1YZ9 A;  3ADJ A;  2LT7 A;  4B3T E;  2VQE E;  2EPM X;  4DV7 E;  1XMO E;  1HNW E;  4I8O A;  3HQ1 A;  2Q8U A;  3MHS C;  1WRJ A;  5ADZ A;  5KL5 A;  5FLX C;  2V87 A;  2UUB E;  1IMU A;  4F9C B;  2IHR 1;  5DNY A;  3EPJ A;  2LVH A;  2YTG A;  4O5G A;  5LLQ A;  2EN6 A;  4LF8 E;  2E5L E;  1X48 A;  5AE1 A;  1UN6 B;  2JVA A;  1QNT A;  2CT1 A;  1WJP A;  5KL4 A;  2L92 A;  2GLI A;  1KYQ A;  1N3G A;  1X6F A;  4BC7 A;  3KZZ A;  2L33 A;  2EPA A;  2H36 X;  2EMH A;  2GPI A;  2V89 A;  3J7Y p;  2EJ4 A;  3C4B A;  4N4R B;  1TN9 A;  2YTF A;  4MLQ A;  2VRD A;  5T6J A;  1ZBQ A;  2EL4 A;  2EQ1 A;  1J26 A;  3UK3 C;  2LRS A;  3LML A;  3T1H E;  2EQ0 A; 
#chains in the Genus database with same CATH homology
 4BBY A;  2N3G A;  3FIG A;  4DKK A;  4LF9 E;  2B9D A;  4LU9 A;  4B3M E;  4JI7 E;  3RMP A;  4BMJ A;  4F54 A;  2UXC E;  1PKP A;  2K4V A;  3HTX A;  1XMQ E;  4LFC E;  4DR1 E;  3HPZ A;  2CPN A;  4KZS A;  4JI3 E;  2VF1 A;  2YT4 A;  3ZOQ B;  4OX9 E;  3JTZ A;  4X65 E;  2F8B A;  5IT9 C;  2LE2 A;  2M7Q A;  2MC6 A;  4JI0 E;  4DUY E;  4TUI A;  4DV4 E;  1FJG E;  1YYK A;  3IWB A;  3LLH A;  2M4I A;  3DF6 A;  4JI4 E;  3ADG A;  1N32 E;  4DV2 E;  4F9A B;  2LJH A;  1XNR E;  4OOG C;  4JV5 E;  4LF6 E;  3C4T A;  1T4N A;  4LFB E;  4L5N C;  4X8W A;  3ADL A;  4JI8 E;  1O0W A;  1GQE A;  5IWA E;  1ZBT A;  1HNX E;  2M1S A;  1J5E E;  1UIL A;  2UXB E;  2ODR C;  2E1M A;  4P78 A;  4JI6 E;  1WXR A;  2N3H A;  2EZ6 A;  1DI2 A;  3JU0 A;  4M30 A;  1YYO A;  2L2M A;  2UUC E;  4LF4 E;  1X49 A;  2ZM6 E;  2UXD E;  2NUE A;  5LMU E;  4DV0 E;  2RSM A;  4GEQ B;  3J81 C;  4DR4 E;  2JOB A;  4DR7 E;  2DB2 A;  2NA2 A;  3J7A G;  4WPY A;  1IBK E;  2NUF A;  1T4L B;  5AE2 A;  2UU9 E;  2L8T A;  1RQ0 A;  2WZO A;  4R8O A;  1EKZ A;  4LF5 E;  2L3C A;  4R03 A;  1XNQ E;  3ADI A;  5AE3 A;  3VYX A;  1DQ3 A;  2V85 A;  4BCA A;  2B7V A;  5LMN E;  2HHH E;  2NUG A;  2B7T A;  4DUZ E;  3KWR A;  2L2K B;  5F3W A;  3H09 A;  3JAM C;  4DV3 E;  1RC7 A;  1N33 E;  2LBS B;  1QU6 A;  2RS6 A;  4DV5 E;  2DSY A;  4AQY E;  1FKA E;  1HR0 E;  4GKK E;  1T4O A;  4P7D A;  4DMI A;  2VE7 C;  4M0V A;  5CFF E;  3AV0 A;  4TUG A;  2LTS A;  2LUP B;  2F4V E;  1YZ9 A;  2RS7 A;  2YZT A;  3ADJ A;  4B3T E;  4K0K E;  2FGG A;  1SR9 A;  3MSW A;  3P1X A;  2VQE E;  3VYY A;  3J80 C;  4DV7 E;  3VK6 A;  1XMO E;  4NXN E;  2V83 A;  4I8O A;  4BS9 A;  4LF7 E;  1HNW E;  4M2Z A;  3HQ1 A;  2L2N A;  2VQF E;  2FV4 B;  2B3T B;  2LTR A;  3OTO E;  5ADZ A;  4B3S E;  2V88 A;  4WFT A;  4Q28 A;  4DR2 E;  2L3J A;  1X47 A;  5FLX C;  2V87 A;  2UUB E;  4KHP E;  4F9C B;  2IHR 1;  5DNY A;  1HNZ E;  2RTX A;  4X64 E;  1IBL E;  4LF8 E;  3AUZ A;  4LFA E;  3HXL A;  5LL6 R;  2E5L E;  2DIX A;  2MC5 A;  2LUQ A;  1WHN A;  1X48 A;  5AE1 A;  3HPS A;  4YY3 E;  4WYQ B;  2V86 A;  2JVA A;  3F6G A;  2JR1 A;  2UUA E;  2EWL A;  4JYA E;  2KHX A;  3K6Q A;  1GZ6 A;  4J8Z A;  4X62 E;  4NXM E;  3IWD A;  4JI5 E;  3OML A;  1UHZ A;  4DR6 E;  2L92 A;  4BC7 A;  1STU A;  2L33 A;  1YYW A;  4JI1 E;  5AAS A;  2ODR D;  2H36 X;  1WHQ A;  4BC9 A;  4DR5 E;  2FTX B;  2V89 A;  4DV6 E;  4JI2 E;  2KON A;  4YHH E;  2V8Q B;  3J7Y p;  4B3R E;  3C4B A;  4DR3 E;  4DV1 E;  2DMY A;  4X66 E;  2L6M A;  5T6J A;  1I94 E;  3T1Y E;  1ZBQ A;  3DJW A;  1IBM E;  1N36 E;  4WSP A;  1J26 A;  2JWO A;  3F6H A;  1N34 E;  2KOU A;  5BR8 E;  2LMZ A;  2LRS A;  2JOX A;  2G7H A;  2MDR A;  3LML A;  3T1H E;  4F9B B;  4LTY A;  2JY9 A;  4GKJ E;  4L8N A;  3IWC A;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...