2JY9A

Nmr structure of putative trna hydrolase domain from salmonella typhimurium. northeast structural genomics consortium target str220
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
b'MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLDLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium.
rcsb
molecule keywords Putative tRNA hydrolase domain
source organism Salmonella typhimurium lt2
molecule tags Hydrolase
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jy9A01
4JI1E 1UHZA 2JY9A 2UUCE 4DR5E 2NUFA 1XMQE 4LF7E 1T4OA 4AQYE 4DV6E 1HNXE 4DR6E 4DR1E 1N36E 4LF9E 1XNRE 4DV1E 2UUAE 1N34E 1J26A 2L33A 2RTXA 4LFCE 4JYAE 4JI5E 3HTXA 4X65E 4DR4E 2VQFE 2EZ6A 4LF4E 4DV3E 2UU9E 1RC7A 2DB2A 1IBLE 4LFAE 5LMUE 4B3RE 4DUYE 1T4NA 2B7TA 4OX9E 4OOGC 1EKZA 1X47A 1T4LB 3C4TA 3OTOE 4DKKA 2IHR1 2RSMA 2UXDE 1YZ9A 4DV7E 1UILA 1X49A 4DR2E 2LTSA 5CFFE 1WHQA 2MDRA 2NA2A 4NXME 2L3CA 2RS6A 2DIXA 4YY3E 4M30A 4LFBE 1HNZE 1I94E 4JI3E 4JI8E 4X64E 1RQ0A 2E5LE 2NUGA 4YHHE 1IBME 1X48A 3LLHA 1J5EE 1IBKE 5BR8E 4DR7E 3ADIA 3J7Yp 1YYWA 4NXNE 4WYQB 3ADLA 2RS7A 1FJGE 1N33E 2LUPB 4LF6E 4JI6E 4X62E 4X66E 2LJHA 2L3JA 4GKKE 4X8WA 2N3GA 2JVAA 2CPNA 4DV4E 2F4VE 1HNWE 3ADGA 4KHPE 4B3ME 3VYYA 4JI2E 1DI2A 1O0WA 2L2KB 2NUEA 2LRSA 4GKJE 4JI4E 4DV5E 4K0KE 2LUQA 2HHHE 4M2ZA 3ADJA 2YT4A 1N32E 2LTRA 2DMYA 1GQEA 2ZM6E 2UXBE 4B3TE 4DV2E 4DUZE 1PKPA 2L2MA 4LF8E 3VYXA 4JV5E 1WHNA 5IWAE 4WFTA 2VQEE 1STUA 2UXCE 1XMOE 2B7VA 3C4BA 4DR3E 1QU6A 2N3HA 1YYKA 2L2NA 1FKAE 1YYOA 2B3TB 3T1HE 2LBSB 5LMNE 3P1XA 2UUBE 4JI0E 3T1YE 4LF5E 2KHXA 1HR0E 4DV0E 4B3SE 1XNQE 4JI7E 1ZBTA
chains in the Genus database with same CATH superfamily
1UHZA 3AV0A 2JY9A 2ADRA 2KONA 2NUFA 4RHBB 2EOSA 2EOMA 4DV6E 4R03A 4Q28A 4DR6E 4J8ZA 2FTXB 4DV1E 2N8XA 2EN2A 2YRKA 4F9BB 4GEQB 5AC5A 2E1MA 5FLXC 4DR4E 2VQFE 2EMLA 4LF4E 4DV3E 2UU9E 2DB2A 4F9AB 2EN4A 1A1FA 1T4NA 2B7TA 1B69A 1EKZA 4KWYA 1T4LB 2L92A 2IHR1 2JYAA 2YRHA 1T38A 1UILA 1X49A 1TN9A 2I13A 1X3CA 2NA2A 2GPIA 1X6HA 2L6MA 1TF6A 2JWOA 5KL4A 4F2JC 4HTGA 1A1KA 2WCC3 4JI8E 2YPNA 2LV2A 1IBME 1EH8A 5BR8E 4DR7E 5AE1A 1YYWA 4NXNE 1N33E 2YTGA 4ZYDA 4LF6E 2V86A 5DNYA 2EMAA 4JI6E 2GHFA 3HPZA 4X66E 2DLKA 4F54A 1JK1A 4X8WA 2N3GA 1HNWE 2CPNA 1ZU1A 2ODRD 4BS9A 4KHPE 2MKDA 4B3ME 3ZOQB 2VRDA 5IXMB 2M4IA 2NUEA 2EN7A 5IV8B 3KZZA 4DV5E 2EOYA 2EPKX 2D9HA 1N32E 1IQOA 2EOIA 2LTRA 1TF3A 2EJ4A 2ZM6E 3HXLA 4JV5E 4LF8E 1WHNA 2CTDA 5IWAE 4GZNC 1G2FC 2VQEE 2UXCE 4O24A 4MLQA 1XMOE 4DR3E 4M0VA 2N3HA 1A1LA 4R2RA 2K4VA 1IQSA 2UUBE 2EN8A 4BCAA 4DV0E 2WZOA 4WXDA 1SR9A 1P47A 2A25A 2LCEA 1L4SA 1G2DC 2M1SA 2EPNA 2EM9A 4AQYE 3IWDA 1N36E 4NHRA 5KL6A 2UUAE 5IT9C 3AUZA 4I8OA 2L33A 2YU8A 3QG5C 5ADZA 2EQ1A 2R76A 5AASA 4R2DA 2ELYA 2M7QA 2DLQA 4IS1C 2YTIA 4TUIA 4F6MA 2WBSA 4NZVA 4LFAE 3DJWA 2EPXA 4OX9E 4KZSA 5LLQA 3OTOE 2BB8A 4DKKA 3KZYA 2RSMA 2VF1A 1YZ9A 2LTSA 5CFFE 1AAYA 1BB8A 2RPCA 2KOUA 1T39A 4NXME 3J7AG 3FIGA 2JPAA 2DIXA 2EM6A 4YY3E 2DGCA 4M30A 2RSIA 1BBOA 1QNTA 3MSWA 4X64E 2E5LE 4BBYA 4YHHE 1WJPA 1X48A 3LLHA 4BMJA 1IBKE 3ADIA 2MC6A 3J80C 4RH8A 4WX9A 3EPHA 4WYQB 2EORA 3ADLA 2RS7A 1FJGE 4ZYHA 1N3GA 4BHCA 2FV4B 5AE3A 2LJHA 2JP9A 1GZ6A 2V88A 3IWCA 2EMGA 2G7HA 2EOFA 2EWLA 3ECRA 3EPLA 2WBUA 5AE2A 4JI2E 4M9VC 4GKJE 2EMXA 2EPLX 2LUQA 5AC4A 2HHHE 2EMHA 2HGHA 2EN3A 1GQEA 1DQ3A 4B3TE 2EPUA 5A6BA 3C6MA 2L2MA 1A1GA 4ZYEA 5A69A 2EOEA 2ODRC 3C4BA 4LTYA 1YYKA 1FKAE 3T1HE 2LBSB 2EL4A 1PDAA 2EM8A 3P1XA 3T1YE 1HR0E 2I9IA 3EPKA 3BIDA 2HJJA 4MLVA 1XNQE 2EMWA 4JI7E 1AH5A 2YSOA 2EMBA 4DR5E 5TSEA 2CSHA 1XMQE 3IWBA 4DMIA 1HNXE 2ENAA 4LF9E 2Q8UA 1UN6B 2EQ3A 1J26A 3L00A 2M9AA 4LFCE 4JYAE 2YTDA 4BHBA 2EL6A 4R2QA 4JI5E 1X6EA 5KL5A 4X65E 2EZ6A 3J81C 2YZTA 2R1FA 2EPPA 2RQLA 4O43A 1YFHA 1MEYC 2V87A 3RMPA 2EM2A 1EH7A 2LJUA 5LMUE 4DUYE 4B3RE 2EPRA 1X47A 3C4TA 1A1HA 2YTEA 2DMIA 3JU0A 2MDRA 2V83A 5KL7A 4Q35B 2E72A 2L3CA 2EM7A 2VE7C 2YWQA 4R2CA 4LFBE 1BBGA 4JI3E 3C6KA 2EMCA 1RQ0A 1NEIA 3H09A 2EPOA 2MDGA 1KJKA 4LU9A 3JAMC 3J7Yp 2EM5A 2LO3A 4R2EA 2YRMA 4P78A 2LUPB 2EN6A 1UBDC 2ENHA 4BC9A 1MGTA 4GKKE 2JVAA 3MHHC 3ADGA 1YPNA 1PJSA 2V8QB 3K6QA 2ENCA 2EL5A 1O0WA 1Z1BA 2LRSA 4JI4E 4K0KE 4M2ZA 2YT4A 3VK6A 1A1JA 2EPZA 5KL2A 4WXCA 2DMYA 2UXBE 1YUIA 4DV2E 3BF2A 4DUZE 1PKPA 2PRTA 1DGCA 4P7DA 5A6AA 3LMLA 2V89A 2H36X 2J7JA 1ZR9A 3HPSA 2LE2A 2EOXA 1ZAAC 4IJDA 3UK3C 2EMYA 2L2NA 1YYOA 4R2AA 1SFEA 2B3TB 5LMNE 4JI0E 2B9DA 4LF5E 4B3SE 2EMZA 4X9JA 1F2IG 2DSYA 2JXPA 4JI1E 1A1IA 2HC5A 2UUCE 3BGHA 1YSAC 4BC7A 2EMKA 2MKNA 1WXRA 4LF7E 2DRPA 1T4OA 3EPJA 1YUJA 3THOB 3DF6A 4DR1E 1PJQA 4O4KA 1XNRE 3TQMA 1N34E 4F6NA 2RTXA 2NABA 2YTPA 2EOJA 3KWRA 2BBGA 2GLIA 2EPMX 1EH6A 3HTXA 1PJTA 4FK5C 4WSGA 2EN1A 2YTOA 3JTZA 2WBTA 4F9CB 3THNA 1RC7A 1IBLE 1RMDA 1WRJA 1KYQA 2EMIA 2YTFA 5A6JA 2JR1A 4HEIA 4OOGC 2F8BA 2EP3A 2UXDE 2EM0A 2YSPA 4DV7E 4DR2E 3HQ1A 1WHQA 4O5GA 2JOXA 4WPYA 2RS6A 5A6KA 2EOHA 1LLMC 3F6HA 2ELZA 4N4RB 1HNZE 1I94E 5T6JA 1X5WA 2NUGA 4TUGA 2EOQA 2LT7A 2FGGA 4ZYGA 1J5EE 4L5NC 2EOZA 2YTJA 2EQ0A 1NCSA 5KL3A 3BBGA 5F3WA 2YTNA 2JOBA 5A6BD 4X62E 4WSPA 2L3JA 2K7IA 4DV4E 2F4VE 5A2QC 1IMUA 2YTQA 3VYYA 2CT1A 3OMLA 2EM4A 1DI2A 2LMZA 2L2KB 4R8OA 2V85A 3MHSC 3ADJA 3F6GA 2EPAA 2LVHA 5LL6R 3VHTB 4R2SA 3VYXA 1ZBQA 4WFTA 1STUA 4R2PA 2B7VA 3EQ1A 2MC5A 1QU6A 1GTKA 4L8NA 2EMFA 2L8TA 2YU5A 1X6FA 2EM3A 2EPCA 3M99B 2KHXA 2EE8A 1JK2A 1ZBTA 2EOOA
chains in the Genus database with same CATH topology
4JI1E 1UHZA 3AV0A 2JY9A 2UUCE 4BC7A 2KONA 2M1SA 4DR5E 1XMQE 2NUFA 3IWBA 1WXRA 4LF7E 1T4OA 4DMIA 4AQYE 4DV6E 1HNXE 3IWDA 4Q28A 4R03A 3DF6A 4DR1E 4J8ZA 2FTXB 1N36E 4LF9E 4DR6E 1XNRE 4DV1E 2UUAE 1N34E 1J26A 5IT9C 3AUZA 2L33A 2RTXA 4I8OA 4LFCE 4JYAE 3KWRA 5ADZA 4F9BB 4GEQB 2E1MA 4JI5E 5AASA 3HTXA 5FLXC 4X65E 4DR4E 2VQFE 2EZ6A 3J81C 2M7QA 4LF4E 4DV3E 3JTZA 2UU9E 1RC7A 4F9CB 2YZTA 2DB2A 4DR3E 1IBLE 4TUIA 2V87A 4F9AB 4LFAE 3RMPA 3DJWA 5LMUE 2JR1A 4DUYE 4B3RE 1T4NA 2B7TA 4OX9E 4OOGC 4KZSA 1X47A 1T4LB 3C4TA 2F8BA 2L92A 4DKKA 3OTOE 2IHR1 2RSMA 2VF1A 2UXDE 1YZ9A 4DV7E 1UILA 1X49A 4DR2E 2LTSA 3HQ1A 1WHQA 3JU0A 2JOXA 5CFFE 2MDRA 2KOUA 2NA2A 2V83A 4WPYA 4NXME 3J7AG 3FIGA 2L3CA 2RS6A 2DIXA 4YY3E 2VE7C 2L6MA 2JWOA 4M30A 3F6HA 4LFBE 1HNZE 1I94E 5T6JA 4JI3E 4JI8E 3MSWA 1RQ0A 4X64E 4TUGA 4BBYA 4YHHE 1IBME 2E5LE 2NUGA 1X48A 3H09A 3LLHA 2FGGA 1J5EE 4L5NC 4BMJA 1IBKE 5BR8E 4DR7E 4LU9A 3JAMC 2MC6A 5AE1A 3J80C 3J7Yp 3ADIA 1YYWA 4NXNE 4P78A 4WYQB 3ADLA 2RS7A 1FJGE 1N33E 2LUPB 4LF6E 2V86A 5F3WA 5DNYA 4JI6E 2JOBA 2FV4B 3HPZA 4BC9A 5AE3A 4X62E 4X66E 2LJHA 4WSPA 4F54A 2L3JA 4GKKE 4X8WA 2N3GA 2JVAA 2CPNA 1GZ6A 4DV4E 2F4VE 1HNWE 2V88A 3ADGA 3IWCA 5A2QC 2G7HA 2ODRD 4BS9A 4KHPE 2EWLA 2V8QB 3K6QA 4B3ME 3ZOQB 3VYYA 3OMLA 5AE2A 4JI2E 1DI2A 2LMZA 1O0WA 2M4IA 2L2KB 2NUEA 2LRSA 4R8OA 4GKJE 4JI4E 4DV5E 4K0KE 2V85A 2LUQA 2HHHE 4M2ZA 2YT4A 3ADJA 1EKZA 1N32E 3VK6A 3F6GA 2LTRA 5LL6R 2DMYA 1GQEA 1DQ3A 2ZM6E 4B3TE 2UXBE 4DV2E 3HXLA 4DUZE 1PKPA 2L2MA 4LF8E 3VYXA 4JV5E 1WHNA 1ZBQA 5IWAE 4WFTA 2VQEE 1STUA 4P7DA 2UXCE 1XMOE 2B7VA 2ODRC 2H36X 2V89A 3C4BA 3LMLA 2MC5A 2LE2A 3HPSA 1QU6A 2N3HA 4LTYA 4M0VA 4L8NA 2L8TA 1YYKA 2L2NA 1FKAE 1YYOA 2K4VA 2B3TB 3T1HE 2LBSB 5LMNE 3P1XA 2UUBE 4JI0E 2B9DA 3T1YE 4BCAA 2KHXA 1HR0E 4LF5E 4DV0E 2WZOA 4B3SE 1XNQE 1SR9A 4JI7E 1ZBTA 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  1UHZ A;  2JY9 A;  2UUC E;  4DR5 E;  2NUF A;  1XMQ E;  4LF7 E;  1T4O A;  4AQY E;  4DV6 E;  1HNX E;  4DR6 E;  4DR1 E;  1N36 E;  4LF9 E;  1XNR E;  4DV1 E;  2UUA E;  1N34 E;  1J26 A;  2L33 A;  2RTX A;  4LFC E;  4JYA E;  4JI5 E;  3HTX A;  4X65 E;  4DR4 E;  2VQF E;  2EZ6 A;  4LF4 E;  4DV3 E;  2UU9 E;  1RC7 A;  2DB2 A;  1IBL E;  4LFA E;  5LMU E;  4B3R E;  4DUY E;  1T4N A;  2B7T A;  4OX9 E;  4OOG C;  1EKZ A;  1X47 A;  1T4L B;  3C4T A;  3OTO E;  4DKK A;  2IHR 1;  2RSM A;  2UXD E;  1YZ9 A;  4DV7 E;  1UIL A;  1X49 A;  4DR2 E;  2LTS A;  5CFF E;  1WHQ A;  2MDR A;  2NA2 A;  4NXM E;  2L3C A;  2RS6 A;  2DIX A;  4YY3 E;  4M30 A;  4LFB E;  1HNZ E;  1I94 E;  4JI3 E;  4JI8 E;  4X64 E;  1RQ0 A;  2E5L E;  2NUG A;  4YHH E;  1IBM E;  1X48 A;  3LLH A;  1J5E E;  1IBK E;  5BR8 E;  4DR7 E;  3ADI A;  3J7Y p;  1YYW A;  4NXN E;  4WYQ B;  3ADL A;  2RS7 A;  1FJG E;  1N33 E;  2LUP B;  4LF6 E;  4JI6 E;  4X62 E;  4X66 E;  2LJH A;  2L3J A;  4GKK E;  4X8W A;  2N3G A;  2JVA A;  2CPN A;  4DV4 E;  2F4V E;  1HNW E;  3ADG A;  4KHP E;  4B3M E;  3VYY A;  4JI2 E;  1DI2 A;  1O0W A;  2L2K B;  2NUE A;  2LRS A;  4GKJ E;  4JI4 E;  4DV5 E;  4K0K E;  2LUQ A;  2HHH E;  4M2Z A;  3ADJ A;  2YT4 A;  1N32 E;  2LTR A;  2DMY A;  1GQE A;  2ZM6 E;  2UXB E;  4B3T E;  4DV2 E;  4DUZ E;  1PKP A;  2L2M A;  4LF8 E;  3VYX A;  4JV5 E;  1WHN A;  5IWA E;  4WFT A;  2VQE E;  1STU A;  2UXC E;  1XMO E;  2B7V A;  3C4B A;  4DR3 E;  1QU6 A;  2N3H A;  1YYK A;  2L2N A;  1FKA E;  1YYO A;  2B3T B;  3T1H E;  2LBS B;  5LMN E;  3P1X A;  2UUB E;  4JI0 E;  3T1Y E;  4LF5 E;  2KHX A;  1HR0 E;  4DV0 E;  4B3S E;  1XNQ E;  4JI7 E;  1ZBT A; 
#chains in the Genus database with same CATH topology
 1UHZ A;  3AV0 A;  2JY9 A;  2ADR A;  2KON A;  2NUF A;  4RHB B;  2EOS A;  2EOM A;  4DV6 E;  4R03 A;  4Q28 A;  4DR6 E;  4J8Z A;  2FTX B;  4DV1 E;  2N8X A;  2EN2 A;  2YRK A;  4F9B B;  4GEQ B;  5AC5 A;  2E1M A;  5FLX C;  4DR4 E;  2VQF E;  2EML A;  4LF4 E;  4DV3 E;  2UU9 E;  2DB2 A;  4F9A B;  2EN4 A;  1A1F A;  1T4N A;  2B7T A;  1B69 A;  1EKZ A;  4KWY A;  1T4L B;  2L92 A;  2IHR 1;  2JYA A;  2YRH A;  1T38 A;  1UIL A;  1X49 A;  1TN9 A;  2I13 A;  1X3C A;  2NA2 A;  2GPI A;  1X6H A;  2L6M A;  1TF6 A;  2JWO A;  5KL4 A;  4F2J C;  4HTG A;  1A1K A;  2WCC 3;  4JI8 E;  2YPN A;  2LV2 A;  1IBM E;  1EH8 A;  5BR8 E;  4DR7 E;  5AE1 A;  1YYW A;  4NXN E;  1N33 E;  2YTG A;  4ZYD A;  4LF6 E;  2V86 A;  5DNY A;  2EMA A;  4JI6 E;  2GHF A;  3HPZ A;  4X66 E;  2DLK A;  4F54 A;  1JK1 A;  4X8W A;  2N3G A;  1HNW E;  2CPN A;  1ZU1 A;  2ODR D;  4BS9 A;  4KHP E;  2MKD A;  4B3M E;  3ZOQ B;  2VRD A;  5IXM B;  2M4I A;  2NUE A;  2EN7 A;  5IV8 B;  3KZZ A;  4DV5 E;  2EOY A;  2EPK X;  2D9H A;  1N32 E;  1IQO A;  2EOI A;  2LTR A;  1TF3 A;  2EJ4 A;  2ZM6 E;  3HXL A;  4JV5 E;  4LF8 E;  1WHN A;  2CTD A;  5IWA E;  4GZN C;  1G2F C;  2VQE E;  2UXC E;  4O24 A;  4MLQ A;  1XMO E;  4DR3 E;  4M0V A;  2N3H A;  1A1L A;  4R2R A;  2K4V A;  1IQS A;  2UUB E;  2EN8 A;  4BCA A;  4DV0 E;  2WZO A;  4WXD A;  1SR9 A;  1P47 A;  2A25 A;  2LCE A;  1L4S A;  1G2D C;  2M1S A;  2EPN A;  2EM9 A;  4AQY E;  3IWD A;  1N36 E;  4NHR A;  5KL6 A;  2UUA E;  5IT9 C;  3AUZ A;  4I8O A;  2L33 A;  2YU8 A;  3QG5 C;  5ADZ A;  2EQ1 A;  2R76 A;  5AAS A;  4R2D A;  2ELY A;  2M7Q A;  2DLQ A;  4IS1 C;  2YTI A;  4TUI A;  4F6M A;  2WBS A;  4NZV A;  4LFA E;  3DJW A;  2EPX A;  4OX9 E;  4KZS A;  5LLQ A;  3OTO E;  2BB8 A;  4DKK A;  3KZY A;  2RSM A;  2VF1 A;  1YZ9 A;  2LTS A;  5CFF E;  1AAY A;  1BB8 A;  2RPC A;  2KOU A;  1T39 A;  4NXM E;  3J7A G;  3FIG A;  2JPA A;  2DIX A;  2EM6 A;  4YY3 E;  2DGC A;  4M30 A;  2RSI A;  1BBO A;  1QNT A;  3MSW A;  4X64 E;  2E5L E;  4BBY A;  4YHH E;  1WJP A;  1X48 A;  3LLH A;  4BMJ A;  1IBK E;  3ADI A;  2MC6 A;  3J80 C;  4RH8 A;  4WX9 A;  3EPH A;  4WYQ B;  2EOR A;  3ADL A;  2RS7 A;  1FJG E;  4ZYH A;  1N3G A;  4BHC A;  2FV4 B;  5AE3 A;  2LJH A;  2JP9 A;  1GZ6 A;  2V88 A;  3IWC A;  2EMG A;  2G7H A;  2EOF A;  2EWL A;  3ECR A;  3EPL A;  2WBU A;  5AE2 A;  4JI2 E;  4M9V C;  4GKJ E;  2EMX A;  2EPL X;  2LUQ A;  5AC4 A;  2HHH E;  2EMH A;  2HGH A;  2EN3 A;  1GQE A;  1DQ3 A;  4B3T E;  2EPU A;  5A6B A;  3C6M A;  2L2M A;  1A1G A;  4ZYE A;  5A69 A;  2EOE A;  2ODR C;  3C4B A;  4LTY A;  1YYK A;  1FKA E;  3T1H E;  2LBS B;  2EL4 A;  1PDA A;  2EM8 A;  3P1X A;  3T1Y E;  1HR0 E;  2I9I A;  3EPK A;  3BID A;  2HJJ A;  4MLV A;  1XNQ E;  2EMW A;  4JI7 E;  1AH5 A;  2YSO A;  2EMB A;  4DR5 E;  5TSE A;  2CSH A;  1XMQ E;  3IWB A;  4DMI A;  1HNX E;  2ENA A;  4LF9 E;  2Q8U A;  1UN6 B;  2EQ3 A;  1J26 A;  3L00 A;  2M9A A;  4LFC E;  4JYA E;  2YTD A;  4BHB A;  2EL6 A;  4R2Q A;  4JI5 E;  1X6E A;  5KL5 A;  4X65 E;  2EZ6 A;  3J81 C;  2YZT A;  2R1F A;  2EPP A;  2RQL A;  4O43 A;  1YFH A;  1MEY C;  2V87 A;  3RMP A;  2EM2 A;  1EH7 A;  2LJU A;  5LMU E;  4DUY E;  4B3R E;  2EPR A;  1X47 A;  3C4T A;  1A1H A;  2YTE A;  2DMI A;  3JU0 A;  2MDR A;  2V83 A;  5KL7 A;  4Q35 B;  2E72 A;  2L3C A;  2EM7 A;  2VE7 C;  2YWQ A;  4R2C A;  4LFB E;  1BBG A;  4JI3 E;  3C6K A;  2EMC A;  1RQ0 A;  1NEI A;  3H09 A;  2EPO A;  2MDG A;  1KJK A;  4LU9 A;  3JAM C;  3J7Y p;  2EM5 A;  2LO3 A;  4R2E A;  2YRM A;  4P78 A;  2LUP B;  2EN6 A;  1UBD C;  2ENH A;  4BC9 A;  1MGT A;  4GKK E;  2JVA A;  3MHH C;  3ADG A;  1YPN A;  1PJS A;  2V8Q B;  3K6Q A;  2ENC A;  2EL5 A;  1O0W A;  1Z1B A;  2LRS A;  4JI4 E;  4K0K E;  4M2Z A;  2YT4 A;  3VK6 A;  1A1J A;  2EPZ A;  5KL2 A;  4WXC A;  2DMY A;  2UXB E;  1YUI A;  4DV2 E;  3BF2 A;  4DUZ E;  1PKP A;  2PRT A;  1DGC A;  4P7D A;  5A6A A;  3LML A;  2V89 A;  2H36 X;  2J7J A;  1ZR9 A;  3HPS A;  2LE2 A;  2EOX A;  1ZAA C;  4IJD A;  3UK3 C;  2EMY A;  2L2N A;  1YYO A;  4R2A A;  1SFE A;  2B3T B;  5LMN E;  4JI0 E;  2B9D A;  4LF5 E;  4B3S E;  2EMZ A;  4X9J A;  1F2I G;  2DSY A;  2JXP A;  4JI1 E;  1A1I A;  2HC5 A;  2UUC E;  3BGH A;  1YSA C;  4BC7 A;  2EMK A;  2MKN A;  1WXR A;  4LF7 E;  2DRP A;  1T4O A;  3EPJ A;  1YUJ A;  3THO B;  3DF6 A;  4DR1 E;  1PJQ A;  4O4K A;  1XNR E;  3TQM A;  1N34 E;  4F6N A;  2RTX A;  2NAB A;  2YTP A;  2EOJ A;  3KWR A;  2BBG A;  2GLI A;  2EPM X;  1EH6 A;  3HTX A;  1PJT A;  4FK5 C;  4WSG A;  2EN1 A;  2YTO A;  3JTZ A;  2WBT A;  4F9C B;  3THN A;  1RC7 A;  1IBL E;  1RMD A;  1WRJ A;  1KYQ A;  2EMI A;  2YTF A;  5A6J A;  2JR1 A;  4HEI A;  4OOG C;  2F8B A;  2EP3 A;  2UXD E;  2EM0 A;  2YSP A;  4DV7 E;  4DR2 E;  3HQ1 A;  1WHQ A;  4O5G A;  2JOX A;  4WPY A;  2RS6 A;  5A6K A;  2EOH A;  1LLM C;  3F6H A;  2ELZ A;  4N4R B;  1HNZ E;  1I94 E;  5T6J A;  1X5W A;  2NUG A;  4TUG A;  2EOQ A;  2LT7 A;  2FGG A;  4ZYG A;  1J5E E;  4L5N C;  2EOZ A;  2YTJ A;  2EQ0 A;  1NCS A;  5KL3 A;  3BBG A;  5F3W A;  2YTN A;  2JOB A;  5A6B D;  4X62 E;  4WSP A;  2L3J A;  2K7I A;  4DV4 E;  2F4V E;  5A2Q C;  1IMU A;  2YTQ A;  3VYY A;  2CT1 A;  3OML A;  2EM4 A;  1DI2 A;  2LMZ A;  2L2K B;  4R8O A;  2V85 A;  3MHS C;  3ADJ A;  3F6G A;  2EPA A;  2LVH A;  5LL6 R;  3VHT B;  4R2S A;  3VYX A;  1ZBQ A;  4WFT A;  1STU A;  4R2P A;  2B7V A;  3EQ1 A;  2MC5 A;  1QU6 A;  1GTK A;  4L8N A;  2EMF A;  2L8T A;  2YU5 A;  1X6F A;  2EM3 A;  2EPC A;  3M99 B;  2KHX A;  2EE8 A;  1JK2 A;  1ZBT A;  2EOO A; 
#chains in the Genus database with same CATH homology
 4JI1 E;  1UHZ A;  3AV0 A;  2JY9 A;  2UUC E;  4BC7 A;  2KON A;  2M1S A;  4DR5 E;  1XMQ E;  2NUF A;  3IWB A;  1WXR A;  4LF7 E;  1T4O A;  4DMI A;  4AQY E;  4DV6 E;  1HNX E;  3IWD A;  4Q28 A;  4R03 A;  3DF6 A;  4DR1 E;  4J8Z A;  2FTX B;  1N36 E;  4LF9 E;  4DR6 E;  1XNR E;  4DV1 E;  2UUA E;  1N34 E;  1J26 A;  5IT9 C;  3AUZ A;  2L33 A;  2RTX A;  4I8O A;  4LFC E;  4JYA E;  3KWR A;  5ADZ A;  4F9B B;  4GEQ B;  2E1M A;  4JI5 E;  5AAS A;  3HTX A;  5FLX C;  4X65 E;  4DR4 E;  2VQF E;  2EZ6 A;  3J81 C;  2M7Q A;  4LF4 E;  4DV3 E;  3JTZ A;  2UU9 E;  1RC7 A;  4F9C B;  2YZT A;  2DB2 A;  4DR3 E;  1IBL E;  4TUI A;  2V87 A;  4F9A B;  4LFA E;  3RMP A;  3DJW A;  5LMU E;  2JR1 A;  4DUY E;  4B3R E;  1T4N A;  2B7T A;  4OX9 E;  4OOG C;  4KZS A;  1X47 A;  1T4L B;  3C4T A;  2F8B A;  2L92 A;  4DKK A;  3OTO E;  2IHR 1;  2RSM A;  2VF1 A;  2UXD E;  1YZ9 A;  4DV7 E;  1UIL A;  1X49 A;  4DR2 E;  2LTS A;  3HQ1 A;  1WHQ A;  3JU0 A;  2JOX A;  5CFF E;  2MDR A;  2KOU A;  2NA2 A;  2V83 A;  4WPY A;  4NXM E;  3J7A G;  3FIG A;  2L3C A;  2RS6 A;  2DIX A;  4YY3 E;  2VE7 C;  2L6M A;  2JWO A;  4M30 A;  3F6H A;  4LFB E;  1HNZ E;  1I94 E;  5T6J A;  4JI3 E;  4JI8 E;  3MSW A;  1RQ0 A;  4X64 E;  4TUG A;  4BBY A;  4YHH E;  1IBM E;  2E5L E;  2NUG A;  1X48 A;  3H09 A;  3LLH A;  2FGG A;  1J5E E;  4L5N C;  4BMJ A;  1IBK E;  5BR8 E;  4DR7 E;  4LU9 A;  3JAM C;  2MC6 A;  5AE1 A;  3J80 C;  3J7Y p;  3ADI A;  1YYW A;  4NXN E;  4P78 A;  4WYQ B;  3ADL A;  2RS7 A;  1FJG E;  1N33 E;  2LUP B;  4LF6 E;  2V86 A;  5F3W A;  5DNY A;  4JI6 E;  2JOB A;  2FV4 B;  3HPZ A;  4BC9 A;  5AE3 A;  4X62 E;  4X66 E;  2LJH A;  4WSP A;  4F54 A;  2L3J A;  4GKK E;  4X8W A;  2N3G A;  2JVA A;  2CPN A;  1GZ6 A;  4DV4 E;  2F4V E;  1HNW E;  2V88 A;  3ADG A;  3IWC A;  5A2Q C;  2G7H A;  2ODR D;  4BS9 A;  4KHP E;  2EWL A;  2V8Q B;  3K6Q A;  4B3M E;  3ZOQ B;  3VYY A;  3OML A;  5AE2 A;  4JI2 E;  1DI2 A;  2LMZ A;  1O0W A;  2M4I A;  2L2K B;  2NUE A;  2LRS A;  4R8O A;  4GKJ E;  4JI4 E;  4DV5 E;  4K0K E;  2V85 A;  2LUQ A;  2HHH E;  4M2Z A;  2YT4 A;  3ADJ A;  1EKZ A;  1N32 E;  3VK6 A;  3F6G A;  2LTR A;  5LL6 R;  2DMY A;  1GQE A;  1DQ3 A;  2ZM6 E;  4B3T E;  2UXB E;  4DV2 E;  3HXL A;  4DUZ E;  1PKP A;  2L2M A;  4LF8 E;  3VYX A;  4JV5 E;  1WHN A;  1ZBQ A;  5IWA E;  4WFT A;  2VQE E;  1STU A;  4P7D A;  2UXC E;  1XMO E;  2B7V A;  2ODR C;  2H36 X;  2V89 A;  3C4B A;  3LML A;  2MC5 A;  2LE2 A;  3HPS A;  1QU6 A;  2N3H A;  4LTY A;  4M0V A;  4L8N A;  2L8T A;  1YYK A;  2L2N A;  1FKA E;  1YYO A;  2K4V A;  2B3T B;  3T1H E;  2LBS B;  5LMN E;  3P1X A;  2UUB E;  4JI0 E;  2B9D A;  3T1Y E;  4BCA A;  2KHX A;  1HR0 E;  4LF5 E;  4DV0 E;  2WZO A;  4B3S E;  1XNQ E;  1SR9 A;  4JI7 E;  1ZBT A;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...