3ECRA

Structure of human porphobilinogen deaminase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
339
structure length
318
Chain Sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLECSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into acute intermittent porphyria.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 101
structure length 318
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3ecrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA02
1TT1A 4HCWA 3VE1B 2Z8DA 1DOTA 3EPEA 1PBQA 3ILUB 1TFDA 1YAEA 3M3LA 3SEUA 3QSLA 3LSWA 1SYHA 2ONRA 1II5A 1MY1A 1GTKA 2VGQA 3IB0A 1MPCA 3IOVA 3R6UA 2Q2CA 2OLBA 3CVGA 4GWOA 4NF6B 4OERA 5I84A 4E0XA 3I5OA 4GL8A 4ELOA 3RUMA 1LBBA 4R6HA 1NNKA 2CZLA 2NXOA 3KN3A 4IO3A 1M5EA 4KCCA 5LOMA 2DSFA 1USYE 4BDOA 1JVXA 4PFTA 3RT8A 4IO4A 2D21A 4OEVA 1Y1ZA 1D9YA 2R6GE 3O28A 5I59B 1GR2A 3BBRA 1MH4A 1M5BA 2H9BA 1OQGA 4X48A 3G3KA 1POY1 2THIA 3QXMA 1IITA 4ZEDA 1Y4CA 1I69A 3DP4A 2REJA 1A8FA 3OXNA 2DXYA 4IO7A 2H25A 3WAFA 4KPTA 3TCFA 3OEMA 1B5HA 4G2ZA 3UK4A 1VFEA 1LSTA 4JWXA 1O7TA 1PC3A 1Y3QA 3DP8A 3LC8A 3MZBA 1URGA 4R9GA 4XIGQ 3FJGA 4RXLA 5DT6A 5B7DA 1QVSA 4RYAA 3FXRA 4N13A 1FTKA 1FQCA 4P11A 4QFPA 5DYHA 3IOWA 3RGYA 4C1UA 4PP0A 5KCJB 1DSNA 3H03A 3RNNA 3U8QA 4LONB 4F3PA 2RC9A 4F18A 1B52A 5TU0A 2DQVA 4EXKA 3KFMA 3OSRA 1B7ZA 1SI0A 2XX8A 1GGGA 2XX7A 5ICTA 1YTVA 4IY6A 3Q27A 5L8DA 1MQHA 3MC2A 3FXUA 2PT1A 1NNPA 1A8EA 2QSXA 4F3BA 2GHAA 5JTYB 4OFLA 1MH3A 3C35A 3K02A 4H65A 4KQPA 4RPNA 5EHMA 4BLAA 5KDTA 2ZNTA 1VSOA 5BWJA 1H76A 3TEPA 4OQOA 4R2FA 5EHSA 5AA1A 5I2KB 1SBPA 4AQ4A 4NF6A 3GBBA 2DE2A 3HCQA 3KZGA 1P1NA 3SEWA 4GOTA 3CSGA 4GIZA 1RYOA 4WXJA 2ZMBA 4OFOA 3TZAA 1EU8A 3H6TA 1N7WA 1FQBA 3T93B 5AA2A 2HCAA 3PPQA 4O3AA 4O3BA 1Y3PA 3K6VA 3ONMA 2UVIA 1NH7A 3PPRA 4G68A 1UTBB 2NVUB 3S9EA 2GH9A 4OZ9A 2F35A 4JSOA 3CFLA 3SERA 1J1NA 5KDTB 3OENA 3G3GA 4F1VA 4ZE9A 4NE4A 2HFBA 3RTFB 4BDNA 3C33A 4QSCA 3SDFA 5H8SA 3VXBA 4PE5B 3TCGA 3EHSA 1SYIA 4YKJA 5CMKA 4M4GA 1ZLQA 2GHBA 1US5A 3OSQA 4R2BA 1I6QA 1MY4A 4RPOA 4F22A 4H0WA 1MQDA 1FQEA 4KCDA 4XTCQ 2OK2A 5AA4A 1FTMA 3S9NC 3UA8A 1BIYA 1I6AA 1XVYA 4OYVA 3OO8A 3L6HA 1H43A 3VVFA 2QS2A 3TCHA 5H8FB 5A5XB 1AL3A 1N7XA 1KWHA 1XC1A 4WKMA 3H6VA 3ZKKA 3LSXA 3MVZA 4PFWA 1PB7A 4OTEA 1B3GA 4JXIA 2HXWA 4GFRA 2I49A 4DCXA 4I8CA 5CMBA 3QIMA 4U4XA 4BDRA 4R74A 4N6PA 3V8XB 1B32A 2AL5A 4MH5A 3UORA 2Z22A 3LR1A 1LFIA 3E13X 3K6XA 3G3IA 3MP1A 3P7IA 2DYXA 2F5XA 3V5AA 1B1HA 3MPKA 2QS4A 4F19A 1Y4TA 2X26A 2Y7IA 3IB2A 3TTRA 3HO7A 4QFNA 4OEUA 1Y1MA 5ELVA 4MF3A 4DZ1A 1A54A 3HSTA 1MM6A 1D4NA 4PQJA 3T96B 4AB6A 3EN3A 2I6EA 2P0SA 1Y9UA 3OOAA 5ITPA 1QKBA 3JV9A 5AA4B 4XKRA 1FTJA 1B3FA 2ZYOA 4ZZAA 3W9VA 3TODA 1JEVA 1M5DA 1JETA 3C4MA 2H99A 4Z7EA 4ZEIA 2DP8A 5I59A 2V25A 1B0LA 2XX9A 4RK2A 1FCKA 2RC8A 1B4HA 1FQFA 2Q89A 3MJNA 3S2VA 3SEXA 4FIMA 1URDA 1LAGE 2AL4A 3KSJA 4H5GA 3H7MA 1RYXA 1ELJA 3HPIA 1B40A 5DVJA 5AA3A 4AB5A 3K0VA 5K2YA 5IAIA 1OLCA 2DS9A 3MVXA 4KD5A 3IJXB 3PUXE 4NF4B 3VVEA 2BJJX 4TQUQ 1ANFA 2FA7A 5DEXA 4XKPA 4P0IA 5CRYA 2O51A 5J1DA 1MQJA 2O6AA 2Y7PA 3FZVA 4YB6A 3VXCA 3Q26A 1MDQA 2P1SA 4LUBA 2HZKA 2PVUA 4FECA 5H8HA 1POTA 3T9HB 4ELRA 2KLFA 1FTOA 3S4UA 4UA8A 5CC2A 2UVJA 4ELPA 1UQWA 2O1MA 3TTNA 2HAUA 5CI5A 1IXIA 4OFJA 1FQAA 3SESA 1N3WA 4U23A 4EUOA 5KZTA 1JNFA 1EZOA 2F97A 2Y7WA 4H8JA 3TTLA 3TYHA 5I2NB 1H44A 1MQGA 1UIUA 2D5WA 1N0TA 4YU0A 3K2DA 3Q25A 4LATA 2PBWA 4RK9A 1PB9A 3FD3A 2HEUA 4YKIA 4DCYA 3TQLA 3FASA 1Y3NA 2AYSA 2XXWA 3CI8A 3IAZA 5H8QA 3VLVA 1L5TA 4E0WA 2ZYMA 2Q88A 2XXRA 3D4CA 4R75A 4ZZEA 1LFGA 1MY3A 5K2XA 2X7PA 5ISUA 3O6GA 3KJTA 4G4PA 4WEPA 5FHMA 2A5TB 4HCYA 1EH3A 3FVGA 1B9JA 4BDQA 3RQTA 1IXCA 1S50A 1VE4A 2PMSA 2XXYA 4BDMA 4ESWA 4ZS9A 3ZKLA 3FVNA 5FHOA 2M8CA 5DVFA 3KN7A 1JEUA 3MWBA 3ILTB 3O29A 3I3VA 1B1XA 4I1DA 2QS3A 4OETA 4EF2A 3IB1A 4OHNA 3R7XA 1EZPA 2B65A 1B4ZA 3A3CA 2R71A 1MY2A 1WVJA 1R9QA 3RTWB 2OJTA 3PMWA 5I57B 4C1TA 4RA1A 4NMYA 4NEDA 1CE2A 1YCJA 2PT2A 2ZNUA 3N5LA 5FTHA 1UIVA 2XHDA 1P99A 3QAXA 3VLWA 2F6GA 4DXBA 1HSJA 3TELA 5IKBA 4ZEBA 2DE3A 2XD3A 3H4ZA 2UYFA 3IOTA 3K1MA 2OWSA 5TPAA 3ZSFA 1NFTA 4OESA 2V93A 3FVKA 1SW2A 2V84A 4NWDA 4XKNA 4DXUA 2ZNSA 5JEIA 2O7UA 4LZ7A 3FJMA 4IO5A 2F7BA 2H5YA 5HBCA 3U93A 3W9WA 4DDDA 3N94A 2PX1A 4PFYA 5JTYA 1MPBA 2I0BA 3O6IA 1US4A 3TUSA 3K6UA 4ISUA 5I56A 1OQHA 1ZTYA 1MM7A 4OWDA 1GV8A 2I48A 3KJ7A 4QFLA 2XD2A 3M3KA 1IIWA 1MXWA 2RC7A 3OELA 4QRZA 5A5XA 2GRVA 5H8FA 2H98A 1B3HA 1LLSA 3JZJA 3TAJA 4NF5A 1UTBA 4L17A 3TKDA 3QUJA 4LZ8A 1OIBA 3OO7A 5AA2B 4KYSA 1DPEA 2I3VA 4NF4A 1QKAA 3OD7A 1IZ1A 2RCBA 2X7QA 5ICQA 4LP2B 2F7CA 2ZXTA 4ND9A 1IQ7A 3E4RA 2OCUA 4G8MA 3VVDA 3SKPA 1H3DA 3CFZA 2XXTA 4X1BA 3TQWA 5I58B 1A55A 3G3JA 1FQDA 3FUZA 3H06B 4TLMB 3ZS6A 1LCFA 1B05A 5DVIA 3CIJA 3LSFB 4C0RA 1P1OA 3ECRA 2UVGA 3I6VA 3TDJA 3TTMA 2REGA 3MZ9A 4G68B 3MQ9A 3ODBA 3PMVA 2D3IA 3C34A 1DPPA 1NL5A 4POXA 1LAFE 2GFEA 3IX1A 1O63A 2DVZA 1JW1A 1F9BA 1SQYA 4H6DA 4KR5A 1AMFA 4OENA 4R72A 3T9VA 5CM6A 2XXIA 1XT8A 3K1NA 3UIFA 4EQBA 4Q0CA 5I2KA 2Y84A 3CG1A 4THIA 2Z23A 3B6QA 1URSA 2DE4A 3FGSA 4HS7A 3WAEA 5AA2D 5L9OA 1QUKA 2CMOA 2RKMA 1YPNA 2ANJA 1I6BA 2IA4A 2RF1A 3H6WA 3R26A 1N76A 3FATA 3A3UA 3N26A 4FJPA 4RJZA 1OMPA 3C32A 4YAHX 3BKIB 4YMAA 3BFTA 1NNFA 2VD2A 1M5FA 4X9TA 3OO9A 1MXUA 3FIRA 3PUWE 3G3HA 1ATGA 1LBCA 4U21A 4GL0A 3TMGA 1T0KA 1XS5A 2Q2AA 4FORA 4KI0E 3IOUA 1Z7ME 3KGCA 3PPNA 1MXYA 4QFOA 5TP9A 1GVCA 1S7YA 1VR5A 2Y7KA 3LUYA 4U22A 2HQ0A 2NWJA 2V3UA 1UTHA 3FV1A 3OO6A 3SEVA 3GBAA 4FAJA 5JK4A 3Q29A 5L9SA 4Q5TA 4Z0IA 4EDPA 1B3EA 1NH8A 5H8NA 1JQFA 2QRYA 3DELB 4GF8A 1N84A 1BLFA 3N6UA 1TWYA 1B5JA 1OVBA 2E0SA 2F78A 3RN8A 2ESNA 3E3KA 4KFQA 4X1DA 4YB7A 1BP5A 3KN8A 3IO4A 2Q9TA 1XHYA 2VHAA 1NNTA 3Q28A 1SDXA 2O84X 2PYYA 3JYRA 4JB7A 5TP9B 3SETA 3U1OA 5HPQA 1AIVA 3TFLA 1P1UA 3C9HA 3VDFA 3USDA 4FATA 5BUUA 2QJEA 4XXUA 2DVCA 1Q35A 4GRKA 3MW0A 3MP6A 5I58A 4FEDA 1PB8A 4LZ5A 3FV2A 2YPNA 1MPDA 4K3FA 3EF7A 1MXVA 1TFAA 1Z7NE 3PU5A 2QS1A 3H3GA 2NUVA 3K4UA 1QUJA 4MBPA 4QSDA 2VD3A 2O7IA 4R6KA 1IXHA 3T9XB 2O69A 4F31B 4JWYA 1R1NA 1S9TA 3GXAA 3PV0E 3O97A 4GXAA 2FNCA 4NF8B 5KCJA 4EXLA 4G77A 1NMUA 5F1QA 2XXXA 3H6UA 1DTZA 4NF5B 2ABHA 2Z8FA 1P1WA 2F36A 3O9PA 3DLNA 3S9MC 3RT6B 1NKXA 1D3KA 1P1QA 4P0GA 2DWIA 4GQOA 4F39A 4ONYA 5F7VA 4IO2A 5TPAB 4Q30B 2QMWA 4U2RA 2QMXA 3IORA 1EZ9A 1SW4A 2F7AA 2R9JA 3HHFA 1XVXA 1SD3A 3O6HA 1SVXB 3FJ7A 3V89B 1AOVA 1BTJA 3K6WA 2P2AA 4YICA 2XXVA 1MG1A 2A5SA 2HAVA 4YKPA 1B46A 1O64A 3N6TA 4IB2A 3T66A 3LSLA 4LQ5A 5DTBA 1Q1KA 4M1VA 4JDFA 1LAXA 3E9XA 4NTLA 3TTKA 2DWJA 5HM4B 3LBSA 4F2QA 3BFUA 1HSLA 2VP1A 3RLFE 4EQ9A 1B2HA 1ZU0A 2Y7RA 1ZBMA 1SW1A 4YKKA 2B3BA 3UGWA 4DLDA 4F3SA 3PD9A 3K01A 1DTGA 3MVWA 4OMBA 4O3CA 3SEYA 1B6HA 4JWOA 1CB6A 1H45A 2V3QA 2W7YA 3KOTA 2DXRA 2OBGA 2G93A 2HZLA 3T22A 4YMBA 5AE4A 1B0HA 2ALUA 3IR1A 4H1XA 3FXQA 4R73A 4RY1A 2F34A 3CSBA 2ZYKA 3OEKA 4PETA 3CRBA 2ONKE 2V3TA 1JVYA 3TPAA 5L9MA 5B70A 4U1OA 1SI1A 3EHTA 1PDAA 3F11A 4XKQA 1B7HA 3UP9A 2DWHA 4JBZA 2OWTA 3G7WA 3S9LC 1WODA 5ITOA 5I2NA 4R6YA 3MUQA 3VV5A 4YZZA 4U4SA 4IGTA 1N04A 1PEBA 4ESXA 1ZIUA 3L6GA 4YB5A 2I58A 2VOZA 5EYFA 5FHNA 4F29A 1OLAA 3C31A 3MPLA 1PBPA 3OMBA 4MLQA 3MP8A 2G29A 3AXFA 3FVOA 4GVOA 5H8QB 3IK6B 2O68A 3KEIA 1B58A 3CR9A 2WKYA 3IJOB 2NOOA 3PMXA 1D9VA 1SW5A 3PUVE 1HSEA 4GXSB 1M5CA 4OXVA 4DIGA 3RPWA 5CBRA 5I56B 3EQ1A 3PGFA 4ZEFA 4F3GA 1LFHA 1FTLA 5CMMA 5I57A 4LA9A 4ZEKA 1FW0A 1BKAA 1XOCA 2OZZA 4LVQA 1JW4A 1ZMGA 2LAOA 3G3FA 4KYDA 3PPPA 2Q8JA 1LB8A 1MY0A 1Y20A 2AIXA 3HV1A 2QL3A 2I4BA 2YLNA 2YJPA 4TOZA 5H8HB 3B6TA 3K1PA 4ZECA 3C36A 1IEJA 4ECFA 4BDLA 3V83A 4U1ZA 1JW5A 1USYH 3KG2A 3QYTA 4DXCA 3M3FA 3GLBA 4FEBA 3THIA 3PD8A 4HTGA 2I0CA 4OVJA 5DEXB 1A7LA 2QPQA 1LAHE 1MXXA 3UN6A 1WDNA 5FTIA 4NF8A 4R9FA 2E1SA 3DP6A 3KOSA 3W15C 1MQIA 3QK6A 4IO6A 4QF9A 4QSEA 1B51A 4KYEA 2DOJA 1LGBC 2UVHA 2XXUA 3MVYA 3U94A 4I62A 1B7UA 3PPOA 3B7DA 4G8HA 3QUFA 2Z8EA 4NWCA 2B3FA 2ONSA 3VFJA 4DE8A 2FYIA 1N3XA 5CMCA 1QUIA 1QULA 1UTHB 3B6WA 1IXGA 4EF1A 2XXHA 4HW8A 4UACA 4I9DA 1R9LA 2F6PA 3M8UA 4WEDA 4MLVA 1VFDA 1OVTA 4G68C 4ZDMA 2O1LA 2RINA 4GLIA 4QFKA 3U72A 2A5TA 4QHQA 4ELQA 3PUYE 1B5IA 1LB9A 2F8DA 1QJMA 4H5FA 4Q8RA 3U92A 1LCTA 2I4CA 4G8NA 1QW0A 4TLLB 4F1UA 4IY5A 4N07A 3CFXA 4PFUA 3GZGA 2ZYNA 3K00A 2RCAA 3A09A 4F1YA 1MS7A 5H8NB 1R6ZA 1ZKBA 4LQ2A 3MAMA 4FE8A 3T9UA 3IO6A 1AH5A 2UYEA 2XXQA 3KBRA 5M2VA 5CBSA 4H8IA 3KSXA 4F2OA 3O66A 1MXZA 3MBPA 3MZ1A 4ZE8A 1IUDA 2XXPA 3IL1B 1TXFA 2H4IA 4H67A 4IGRA 2DWAA 4RNSA 1A99A 3HN0A 1B3LA 1A40A 2UXAA 4KHZE 3HHGA 1DMBA 3D4GA 3PUZE 4GD5A 4JSDA 2IEEA 1ZJLA 2I3WA 3CG3A 3RY3A 1MRPA 4MFIA 4POWA 4EQ7A 1RKMA 3VLUA 3EHUA 1MDP1 3O2AA 3DM0A
chains in the Genus database with same CATH superfamily
4DKKA 1DOTA 1YAEA 3M3LA 3QSLA 1SYHA 1II5A 2LE2A 2EPMX 3R6UA 1FPGA 2Q2CA 2EMCA 4E0XA 3I5OA 4GL8A 4ELOA 1NNKA 3VHTB 3BIGA 4PFTA 3HTXA 2EMLA 1D9YA 2R6GE 1GR2A 3BBRA 1M5BA 4X48A 1Y4CA 1I69A 3DP4A 3F6GA 5AC5A 2H25A 3UK4A 1LSTA 4KHPE 1O7TA 2B3TB 1PC3A 3LC8A 5B7DA 2V85A 3RNNA 4DV4E 4LONB 5TU0A 3KFMA 3OSRA 1SI0A 5ICTA 2N8XA 2ENCA 1YTVA 4WPYA 3Q27A 5L8DA 1MQHA 2YWQA 1N3GA 2PT1A 1NNPA 4OFLA 1WRJA 1MH3A 3K02A 5KDTA 1VSOA 4R2FA 3SZPA 2ODRC 5I2KB 3THOB 4IR8A 4WXJA 5AA2A 4O3AA 1Z1BA 3K6VA 2NVUB 3PPRA 3S9EA 2GH9A 5KDTB 3CFLA 3OENA 4F1VA 4NE4A 4BDNA 3SDFA 1K9ZA 4PE5B 2CEYA 3EHSA 1FQEA 2G7HA 4DUYE 3S9NC 1BIYA 4OYVA 1XVYA 1PKPA 3TQMA 1H43A 2DB2A 1KWHA 2DSYA 4ZYDA 4JV5E 1PB7A 1B3GA 1ZBTA 2LO3A 4GFRA 2I49A 5CMBA 2MKDA 2NUEA 2Z22A 3K6XA 3MP1A 4JVCA 2DYXA 1EKZA 1B1HA 1Y4TA 3HQ1A 2X26A 4OEUA 4DZ1A 1A54A 1MM6A 3EN3A 2I6EA 2P0SA 2CZKA 4XKRA 1NUWA 1M5DA 4GX3A 4Z7EA 2DP8A 5I59A 2XX9A 4I40A 3MJNA 4FIMA 4H5GA 2J7JA 1RYXA 1ELJA 3K0VA 4PF8A 4KD5A 3VVEA 4TQUQ 4XKPA 4P0IA 2O6AA 2Y7PA 3VXCA 2CPNA 1MDQA 2VPOA 4ELRA 1FTOA 4MHFA 4LU9A 2B7VA 3SESA 4PFIA 3TYHA 3QMFA 4H8JA 1H44A 4IS1C 1LBZA 3T1YE 4RK9A 3FD3A 4DCYA 3IAZA 5H8QA 3VLVA 2VF1A 1FJGE 3LLHA 4R75A 5K2XA 4GWYA 5ISUA 3O6GA 3KJTA 4WEPA 1EH3A 4P56A 1ZAAC 2PMSA 3FVNA 5FHOA 5CFFE 3ILTB 3MWBA 1YXIA 2QS3A 2L3CA 3A3CA 3RTWB 2N3GA 2UXBE 1YCJA 1UIVA 2VQFE 4GWXA 1HSJA 4I3EA 5IKBA 2EOXA 1DCUA 2XD3A 2UYFA 2NA2A 5IZ3B 4J8ZA 2YT4A 1K9YA 3FVKA 2HGHA 4BHCA 1SW2A 4NWDA 4DUZE 4PF6A 4WYQB 1UBDC 4XKNA 2L2MA 2F7BA 5FLXC 5JTYA 1MPBA 1RDZA 2I0BA 1US4A 5I56A 1OQHA 4GBVA 4QFLA 5AASA 2V89A 2EM6A 1B3HA 3TAJA 3TKDA 2EMGA 3QUJA 1YUIA 1QKAA 3OD7A 2EJ4A 2EMXA 2ZXTA 1IQ7A 4NHRA 2L2KB 2XXTA 1PJQA 4X1BA 3TQWA 5I58B 4TLMB 4PBHA 4O94A 4PGNA 4WXCA 2GFEA 3IX1A 2MC5A 4KR5A 4GKKE 1XT8A 1T4OA 3UIFA 4THIA 2Z23A 4HS7A 1URSA 2DE4A 3FGSA 3WAEA 2CMOA 1YPNA 2RF1A 3H6WA 2HXRA 4YAHX 1OMPA 3C32A 3OO9A 1LBCA 3TMGA 2WBUA 1T0KA 1XS5A 2Q2AA 4FORA 1Z7ME 4C1UA 2Y7KA 2HQ0A 3Q29A 5H8NA 1NH8A 4N4RB 3HPSA 2Q8MA 1OVBA 1NV4A 4F6MA 4KFQA 4ZYGA 2EM4A 4BHBA 1BP5A 3IO4A 2Q9TA 1DGCA 3JYRA 2Y5KA 1P1UA 3VDFA 4GRKA 4X62E 5I58A 4FEDA 4LZ5A 4PFRA 1Z7NE 3PU5A 2L5VA 4R6KA 1IXHA 2O69A 4F31B 2LTRA 2EOSA 3GXAA 4NF8B 2EQ3A 5T6JA 5F24A 1SFEA 5F1QA 3H6UA 4X65E 4NF5B 1PJSA 4BCAA 4PGPA 4JI7E 2F36A 3O9PA 3S9MC 3RT6B 1NKXA 4F39A 1A1GA 4NF0A 4G61A 2V4CA 2QMWA 1LBYA 2QMXA 5IXMB 4FAJA 2F7AA 3HHFA 2EOZA 3RYDA 1B46A 1O64A 2UXCE 1T4NA 4IB2A 3T66A 3LSLA 3LUZA 2RTXA 1FBDA 2VP1A 3RLFE 4EQ9A 1ZU0A 4H46A 1ZBMA 1SW1A 2FIXA 3PD9A 1NV6A 4OMBA 4R2RA 4JWOA 3KOTA 2YTPA 2OBGA 2G93A 2HZLA 2EMKA 2ALUA 4O7IA 4R73A 2LMZA 2ZYKA 1X5WA 4PETA 4HXVA 3AV0A 5L9MA 4BC9A 1SI1A 1ZBQA 1B7HA 4R2QA 2DWHA 3UP9A 2OWTA 1WODA 4YZZA 4IGTA 4ESXA 2EWLA 3L6GA 3FIGA 4OOGC 4F29A 1OLAA 4LF7E 3MPLA 4GVOA 3FVOA 3IK6B 3KEIA 5CMCA 3IJOB 1SW5A 2GLIA 4MAGA 1M5CA 2R1FA 3EQ1A 4M2ZA 1D9QA 1LFHA 5A6JA 1G0IA 3DJWA 1X3CA 2DMYA 1XOCA 2OZZA 2BBGA 1JW4A 2HHHE 3G3FA 2EPZA 3PPPA 2QL3A 2I4BA 2YLNA 5H8HB 4XF5A 4ZECA 1NUZA 4BDLA 3V83A 1USYH 2KQZA 3THIA 1UHZA 3GLBA 4FBPA 1FPBA 2QPQA 1WDNA 4F6NA 3KOSA 5LMUE 1NV0A 3W15C 4QSEA 5DW8A 1LGBC 4DE8A 2B3FA 4R2SA 1QUIA 1QULA 2DGCA 4B3SE 4ZDMA 4MLVA 4PE3A 2O1LA 4GLIA 4QFKA 1LB9A 3DF6A 4WFTA 4H5FA 1LCTA 4PAKA 2ELYA 2NABA 2BB8A 2WEFA 1JK2A 2I4CA 5A6BD 1QW0A 4P78A 1R6ZA 1L4SA 4LQ2A 4FE8A 4HE1A 3A29A 4DR5E 1FPFA 2XXQA 3KBRA 4O24A 5ET5A 3KSXA 3O66A 3MBPA 1IBME 2XXPA 2EMWA 3IFCA 3IWBA 1YUJA 4GD5A 2I3WA 2YRHA 3CG3A 2JWOA 4O43A 1J5EE 1FTAA 4HCWA 2Z8DA 3EPEA 3SEUA 2MKZA 3LSWA 2EPUA 5I84A 1LBBA 4IO4A 4OEVA 1AWBA 1Y1ZA 3O28A 2DRPA 1KYQA 1IITA 2REJA 3WAFA 2DXYA 4KPTA 2YTFA 4JWXA 3DP8A 2JY9A 4N13A 3RGYA 4P11A 1QNTA 5KCJB 4PP0A 1DSNA 3H03A 3U8QA 4F3PA 2VT5A 4PFBA 4F18A 4LF8E 5IWAE 4BC7A 3MC2A 4JI5E 2GHAA 5JTYB 4BLAA 2MDRA 2LVHA 5EYGA 3TEPA 5ADZA 4OQOA 1IMFA 4PDHA 3B8BA 3KZGA 1P1NA 3CSGA 1RYOA 2ZMBA 2UU9E 2I9IA 4O4KA 1N7WA 3P1XA 2HCAA 1Y3PA 3ONMA 2UVIA 4OZ9A 3SERA 3MHHC 1J1NA 2CEXA 4ZE9A 3C33A 3VXBA 1SYIA 5CMKA 1US5A 3OSQA 4R2BA 4L5NC 3VYYA 4RPOA 4X8RA 4H0WA 2OK2A 1FTMA 1BB8A 1I6AA 2V86A 3L6HA 2IHR1 2EZ6A 1N7XA 2JOBA 4XFEA 3H6VA 4JXIA 4DCXA 4I8CA 2AL5A 3UORA 1LFIA 1FPEA 1RDXA 2F5XA 2Q74A 5EQ8A 4F19A 3HO7A 1X6HA 1Y1MA 3KBZA 4OANA 4PQJA 1YFHA 1D4NA 2M1SA 2KHXA 2K4VA 1Y9UA 2B4MA 1QKBA 3JV9A 3OOAA 2L6MA 5ET6A 1JETA 2V25A 1B0LA 3S2VA 2WBTA 1FCKA 1FQFA 2RC8A 2Q89A 2JYAA 4WXDA 3KSJA 1LAGE 1NV3A 2AL4A 3RPLB 2WYKA 1TF6A 2DS9A 3PUXE 2BJJX 5CRYA 4JYAE 3RMPA 5J1DA 2FGGA 4LUBA 2PVUA 4FECA 1Q9DA 3T9HB 4OVSA 3S4UA 1UQWA 5CI5A 4OFJA 4DV0E 1N3WA 2EL6A 1UIUA 1MQGA 3IFAA 1RMDA 1N0TA 4P1EA 2HEUA 3FASA 2AYSA 3CI8A 1WXRA 2Q88A 1LFGA 1MY3A 1SPIA 2X7PA 3OTOE 2EOHA 5FHMA 3FVGA 1A1LA 1B9JA 3MYUA 4BDQA 1IXCA 1VE4A 2XXYA 2YTDA 3ZKLA 3MHSC 3KN7A 1MY2A 1WVJA 1N34E 3PMWA 4RA1A 4NMYA 4R2AA 4BS9A 2ZNUA 5FTHA 2XHDA 1P99A 3EPKA 4ZEBA 2DE3A 4LF5E 1IBKE 1NFTA 4OESA 2HC5A 2EM9A 4DXUA 4GKJE 4LZ7A 3FJMA 2EM7A 2H5YA 1YYOA 4PFYA 3O6IA 2P3VA 3K6UA 1ZTYA 3EKIA 4OWDA 1GV8A 2XD2A 3M3KA 1IIWA 2JJKA 4B3ME 2RC7A 2GRVA 2H98A 1LLSA 3JZJA 1YYZA 1UTBA 4L17A 1FPIA 4LZ8A 4F54A 5AA2B 3OO7A 5A6KA 4LP2B 1N36E 2CZIA 2OCUA 4G8MA 4JVIA 3VVDA 4GX6A 3G3JA 3H06B 4JI0E 1B05A 1NV5A 3LSFB 4MMPA 3TTMA 3B50A 2M4IA 4G68B 2ENAA 3C34A 2EQ1A 1DPPA 4TLLB 5AA4A 2DVZA 3T9VA 1JW1A 5IZ1A 2XWKA 1NEIA 2EM0A 4Q0CA 5I2KA 2Y84A 2WZOA 1BBGA 5AE1A 1I6BA 3D1RA 3J81C 3N26A 2FBPA 3BKIB 1NNFA 1M5FA 3FIRA 3G3HA 4U21A 4GL0A 3IOUA 3KGCA 3OMLA 2L33A 4QFOA 2EPOA 4U22A 2L92A 2CTDA 2V3UA 1UTHA 3KC0A 5L9SA 4Q5TA 4EDPA 2QRYA 2H36X 4GF8A 3HPZA 2E0SA 2F78A 3E3KA 2FTXB 1NNTA 2VPNA 1SDXA 2O84X 4JB7A 1AIVA 1EYIA 2LUQA 2QJEA 4XXUA 2DVCA 4JI4E 1PB8A 2LCEA 3FV2A 2YPNA 1MPDA 5EYHA 2VD3A 4YY3E 3PV0E 4GXAA 4NHBA 2FNCA 1I94E 1NMUA 2MC6A 5IZZA 1P1WA 5LDZA 3VK6A 3ISPA 4NZVA 1IMBA 4ONYA 5F7VA 4IO2A 5TPAB 2LT7A 4U2RA 3IORA 3V89B 1XVXA 1SVXB 3IWCA 1BTJA 2XXVA 2A5SA 4YKPA 2LRSA 4AQYE 5DTBA 4M1VA 3E9XA 3LBSA 3BFUA 1HSLA 2Y7RA 2B3BA 4DLDA 3K01A 3MVWA 4O3CA 3BGHA 5KL5A 3C6KA 4H1XA 3OEKA 3CRBA 4NQ8A 2YTJA 2EPNA 1X6EA 4X64E 3F11A 3S9LC 4JBZA 5ITOA 2ZZVA 5I2NA 4R6YA 3MUQA 2ADRA 2FV4B 4YB5A 1FBFA 1YSAC 4OA4A 1PBPA 3T9XB 2O68A 3PUVE 2JVAA 2LBSB 3PMXA 2ELZA 4P3LA 2LJUA 5JEIA 2KONA 4ZEFA 4AS5A 5KL3A 1BKAA 4LVQA 1ZMGA 2LAOA 3U65A 5I3SA 2EOOA 1Y20A 2AIXA 3HV1A 3FXBA 1FSAA 1IEJA 2YU5A 4U1ZA 1JW5A 4DXCA 2PFZA 4FEBA 4N4UA 3PTYA 3PD8A 4OVJA 2I0CA 2XWOA 1LAHE 1MXXA 2JXPA 5A2QC 2WBBA 3DP6A 4IO6A 1B51A 2ZZXA 2DOJA 1IMUA 5I7IA 4I62A 3B7DA 2UXDE 1X48A 2Z8EA 3QUFA 4NGUA 1UTHB 2YTOA 1IXGA 4EF1A 4I9DA 3MSWA 1R9LA 2F6PA 4X66E 1VFDA 3SEXA 5BUUA 3U72A 2EOQA 4QHQA 4G8NA 4F1UA 3CFXA 4PFUA 2ZYNA 3BBGA 4F1YA 1MS7A 3MAMA 1HNXE 4UABA 2WBDA 5I5PA 3MZ1A 4ZE8A 2P3NA 1IUDA 4DV2E 4DR7E 1TXFA 4IGRA 1A99A 2EOMA 4NG7A 1B3LA 3HHGA 2IEEA 1LBXA 3RY3A 4EQ7A 3VLUA 1MDP1 2EM5A 1TT1A 1GQEA 3VE1B 4JVDA 3JAMC 3ILUB 1TFDA 1FBCA 2ONRA 2YTNA 1MY1A 2YTIA 1GTKA 2VGQA 1KA1A 1MPCA 3IB0A 4OERA 4ZYEA 3CVGA 2GQ1A 3RUMA 4R6HA 2CZLA 1NCSA 2NXOA 3KN3A 4IO3A 4KCCA 2EMYA 4OVTA 2D21A 3ADIA 1POY1 3QXMA 1A8FA 3OXNA 4IO7A 3TCFA 3OEMA 1B5HA 4G2ZA 3FJGA 4RXLA 5DT6A 3KWRA 2WYPA 4RYAA 4QFPA 5LMNE 5DYHA 2RS7A 5EQ7A 1JK1A 1XNRE 2KOUA 2KR0A 1YZ9A 2RC9A 5LTCA 1GGGA 1FRPA 4IY6A 1X49A 1A8EA 2QSXA 4X9JA 3E79A 4Q28A 2ZNTA 4JI6E 2YZTA 1DQ3A 5EHSA 4DR2E 5AA1A 1SBPA 5DNYA 4AQ4A 3GBBA 2DE2A 3SEWA 4GOTA 4R03A 4F9CB 4NN3A 1NUYA 4QBAA 1EU8A 3H6TA 2EPKX 3PPQA 4O3BA 4DR4E 1NH7A 1UTBB 4JSOA 3G3GA 4OX9E 3E78A 3RTFB 4QSCA 2LTSA 4M4GA 1ZLQA 2GHBA 1I6QA 1MY4A 1UN6B 4KCDA 2FVZA 2E1MA 5KL7A 1KA0A 3TCHA 5H8FB 5A5XB 1AL3A 4WKMA 1XC1A 3ZKKA 3MVZA 4PFWA 1B69A 4OTEA 2CSHA 1FBGA 3QIMA 4U4XA 4BDRA 4R74A 2NUFA 4N6PA 2RQLA 3P7IA 2YSPA 2XXKA 3V5AA 2EOEA 2Y7IA 3TTRA 3HSTA 5IZ3A 2YU8A 1A1JA 5AA4B 2XWIA 1FTJA 4DR1E 4ZZAA 4LFBE 3W9VA 3C4MA 2H99A 2EM2A 2V83A 2XA5A 4ZEIA 5A6AA 1B4HA 5KZTA 3F6HA 2EN7A 1N33E 3H7MA 5DVJA 1LLMC 5AA3A 4AB5A 1IQSA 1G0HA 1OLCA 3MVXA 4TUIA 2EM8A 5KL6A 2FA7A 4DV1E 5DEXA 1AAYA 5A6BA 4PCDA 2RS6A 1MQJA 3Q26A 4PBQA 2HZKA 1A1KA 1WHQA 3C4TA 2KLFA 4UA8A 5CC2A 1FBEA 2UVJA 4ELPA 5LL6R 4NXNE 4O7MA 3TTNA 2HAUA 1IXIA 1FQAA 4EUOA 1EZOA 1TF3A 3Q25A 4LATA 4GBWA 4X8WA 2PBWA 1PB9A 1XI6A 2XXRA 3D4CA 4ZZEA 4G4PA 4DR3E 1NI9A 1YZ0A 1S50A 4BDMA 4ZS9A 2M8CA 5DVFA 3O29A 1KZ8A 4OETA 4EF2A 3IB1A 4OHNA 2B65A 1B4ZA 2R71A 4M0VA 4C1TA 2PT2A 1T4LB 3QAXA 2F6GA 3THNA 3TELA 3H4ZA 2OWSA 2EMBA 3ZSFA 2WX9A 5ET8A 2O7UA 4FK5C 4IO5A 2HHMA 5HBCA 3N94A 2PX1A 2V87A 3C4BA 4L8NA 1FKAE 3KJ7A 5T3JA 3OELA 4QRZA 5A5XA 5H8FA 2A25A 2YSOA 4NF5A 3C6MA 4R2PA 4LTYA 2R8TA 4NF4A 2RCBA 3FBPA 2X7QA 2EOYA 1HNZE 4ND9A 3E4RA 3SKPA 2EN8A 3CFZA 1LBWA 1A55A 1FQDA 3FUZA 5DVIA 4C0RA 1P1OA 2UVGA 3I6VA 3MQ9A 3PMVA 4KXPA 2D3IA 1NL5A 1LAFE 1O63A 1SQYA 1F9BA 4H6DA 5EQAA 2MDGA 4K0KE 2EL5A 3K1NA 4EQBA 3CG1A 3B6QA 1F2IG 2RKMA 2IA4A 2DLQA 3FATA 4NXME 4FJPA 4RJZA 3BFTA 1MXUA 3PUWE 1ATGA 3UK3C 2DDKA 2HPGA 4KI0E 3T96B 1MXYA 5TP9A 2L3JA 1S7YA 3LUYA 2NWJA 3FV1A 5BR8E 3GBAA 5JK4A 4Z0IA 1B3EA 3BF2A 1N84A 4GZNC 3JTZA 1BLFA 3RN8A 2EMFA 2ESNA 4PDDA 2EN6A 1XHYA 2M9AA 1LEVA 2VHAA 4JI2E 2K7IA 3U1OA 5HPQA 3TFLA 2FIEA 2ZM6E 1YYWA 1FPLA 3USDA 2ZZWA 4FATA 2LJHA 1Q35A 1A1FA 4N8GA 3CHGA 1STUA 1MXVA 4BMJA 1WJPA 2QS1A 2RPCA 2NUVA 3K4UA 4MBPA 1R1NA 5KCJA 4MEVA 4EXLA 2XWVA 1X6FA 1DTZA 2ABHA 2Z8FA 4N6DA 3DLNA 2YTEA 4OVRA 1D3KA 1P1QA 4P0GA 4R2CA 2YRKA 1XNQE 4PAIA 1GZ6A 4Q30B 1EZ9A 1SW4A 2R9JA 3O6HA 1SD3A 3FJ7A 2HAVA 2EN1A 4LQ5A 1Q1KA 2EORA 1LAXA 4NTLA 1EH7A 3ZOQB 2YTGA 4H45A 4N91A 1B2HA 1A1IA 2DIXA 4F3SA 3SEYA 1B6HA 4N6KA 4B3RE 2W7YA 3IWDA 2V3QA 5AE4A 3VYXA 1B0HA 3IR1A 4RY1A 3FXQA 3CSBA 4P1LA 2M7QA 2ONKE 3J7AG 3NOHA 3TPAA 3EHTA 4DV3E 2JPAA 1PDAA 4N81A 4XKQA 3HFUA 4P47A 2EMIA 1SR9A 4GWZA 1N04A 1ZIUA 4HE2A 5FHNA 2VOZA 5EYFA 2G29A 2CT1A 1B58A 2WKYA 4DIGA 1D9VA 5I56B 5CBRA 1HR0E 3H09A 1YYKA 3PGFA 4F3GA 5CMMA 3ADGA 5I57A 4LA9A 1FW0A 4KYDA 2Q8JA 4TOZA 4LF9E 1XMQE 2N3HA 3B6TA 3K1PA 3C36A 4ECFA 2ENHA 3M3FA 1ZU1A 1RC7A 4HTGA 4LFAE 3UN6A 5FTIA 4NF8A 1MQIA 3QK6A 4QF9A 3RPLA 1CNQA 4KYEA 3BIHA 3MVYA 2EN3A 2EP3A 1B7UA 4KZSA 4G8HA 4NWCA 1N3XA 3KC1A 3B6WA 2XXHA 1QGXA 4HW8A 1KJKA 3M8UA 4G68C 4ELQA 2DMIA 2RINA 3PUYE 2F8DA 1QJMA 4Q8RA 3U92A 5A69A 2UUBE 1FJ6A 2EN2A 4IY5A 4N07A 2DLKA 3GZGA 5H8NB 1RDYA 3IO6A 2UYEA 5CBSA 4H8IA 4F2OA 1MXZA 3IL1B 4H67A 2EPAA 3HN0A 1A40A 3D4GA 4JSDA 4MFIA 5KL4A 4POWA 1RKMA 3A09A 3EHUA 4OXVA 3O2AA 3DM0A 2V8QB 3KZZA 5A5LA 1FPKA 1O0WA 3L00A 1PBQA 1IBLE 3IOVA 4GWOA 2PFYA 4NF6B 2OLBA 4JI3E 1FJ9A 2D9HA 4F9BB 2UUCE 3K6QA 5LOMA 1M5EA 4DI3D 2DSFA 1USYE 4BDOA 1JVXA 3RT8A 5I59B 1MH4A 2H9BA 1OQGA 3G3KA 2THIA 4ZEDA 4RH8A 4I3YA 1MGTA 4OVQA 5ICQA 1VFEA 1Y3QA 3MZBA 4R9GA 1URGA 4XIGQ 5IM2A 1QVSA 2EPPA 3FXRA 1FTKA 4IJDA 4LF4E 1FQCA 2V88A 3IOWA 3ROJA 4PAFA 4LF6E 1B52A 2DQVA 4EXKA 3ADJA 1B7ZA 2XX8A 2XX7A 3FXUA 4WSGA 4F3BA 3C35A 4H65A 4KQPA 1UILA 4RPNA 5EHMA 5BWJA 4P7DA 1H76A 2MKNA 4NF6A 3HCQA 2I13A 5ESYA 4F9AB 4OFOA 3TZAA 1FQBA 3T93B 2EPCA 4G68A 3QG5C 2F35A 2QVUA 5IGAA 2HFBA 2EMHA 5H8SA 3TCGA 2L8TA 3AUZA 4YKJA 1WHNA 1IMEA 3ADLA 4F22A 1MQDA 4XTCQ 4R2DA 3UA8A 1J26A 1INPA 3OO8A 2EL4A 3VVFA 2RSMA 2QS2A 3LSXA 2JP9A 2HXWA 5LLQA 5KL2A 3V8XB 1B32A 2BJIA 4MH5A 3LR1A 3E13X 5IT9C 3G3IA 1G2FC 3MPKA 2QS4A 1P47A 3IB2A 4QFNA 5ELVA 2F3BA 2L2NA 4MF3A 4AB6A 5ITPA 1MEYC 1B3FA 2ZYOA 4QXDA 3TODA 1JEVA 1EYKA 1IQOA 4N17A 2EPXA 2QVRA 2EE8A 2UUAE 4RK2A 4E0WA 1URDA 4DR6E 2Q8UA 3HPIA 1B40A 1EH6A 2EPRA 5K2YA 5IAIA 3IJXB 4NF4B 1ANFA 2EPLX 2O51A 4YB6A 3FZVA 2P1SA 3J80C 4GEQB 4PTKA 5H8HA 1POTA 2CZHA 2O1MA 2B9DA 1JP4A 4MJOA 4U23A 1JNFA 2RSIA 2F97A 2Y7WA 3TTLA 5I2NB 2D5WA 2F3DA 5IV8B 4YU0A 2PCRA 3K2DA 4YKIA 3TQLA 1NV7A 3LV0A 1Y3NA 2XXWA 2ODRD 2YRMA 2ZYMA 2EQ0A 2JOXA 3KZYA 3J7Yp 3T0JA 5FBPA 2EN4A 2A5TB 4HCYA 3RQTA 1G2DC 3LMLA 4ESWA 1FPJA 1JEUA 3I3VA 1B1XA 4I1DA 1N32E 1ZR9A 3R7XA 1EZPA 5AC4A 1R9QA 4N8YA 2OJTA 5I57B 4NEDA 1CE2A 3N5LA 3VLWA 2Y5LA 4DXBA 3IOTA 5TPAA 3K1MA 1BBOA 2JR1A 2LV2A 2V93A 3BIDA 1TN9A 4DMIA 4M9VC 2V84A 2WCC3 2ZNSA 3U93A 3W9WA 4DDDA 3TUSA 4ISUA 1MM7A 2I48A 2F8BA 4MNCA 1MXWA 2GPIA 4MIJA 1XMOE 1RQ0A 4MCOA 4M30A 4BBYA 1OIBA 2VRDA 4KYSA 1DPEA 2I3VA 2EM3A 4MNPA 1IZ1A 4XEQA 2F7CA 1IMAA 2QFLA 1H3DA 3ZS6A 1LCFA 2E5LE 3CIJA 3ECRA 2REGA 3MZ9A 3ODBA 4POXA 4OENA 4R72A 1AMFA 5CM6A 4AS4A 2XXIA 1IMDA 4ZYHA 4RHBB 5AA2D 5L9OA 4F2JC 1QUKA 4P8BA 1FPDA 2ANJA 1N76A 3A3UA 5TSEA 4YMAA 1FBPA 4GWWA 4O5GA 2VD2A 2WBSA 4X9TA 4GX4A 2F4VE 3JU0A 3PPNA 1GVCA 3MSTA 3TDJA 4GWUA 1VR5A 4R8OA 1VDWA 3SEVA 3OO6A 1JQFA 3DELB 4HE0A 3N6UA 1TWYA 1B5JA 4X1DA 4YB7A 3KN8A 3Q28A 2PYYA 3SETA 5TP9B 4LFCE 3C9HA 1DK4A 5F3WA 2B4LA 3MW0A 3MP6A 1DI2A 4K3FA 3EF7A 1TFAA 1DBZA 3H3GA 1QUJA 4QSDA 2O7IA 4JWYA 1S9TA 3O97A 4G77A 2XXXA 2EMAA 1NV1A 3EPJA 2DWIA 1FBHA 4GQOA 2OX3A 3R26A 1AOVA 3M99B 3K6WA 2P2AA 4YICA 1MG1A 3N6TA 4DV5E 4GWSA 4R2EA 4JDFA 3TTKA 2DWJA 5HM4B 4F2QA 5EQ9A 4Q35B 4YKKA 4JI1E 3UGWA 1DTGA 2EOIA 1CB6A 1H45A 3T22A 2DXRA 4YMBA 2F34A 2EOFA 4KWYA 1A1HA 2V3TA 1JVYA 1LBVA 5B70A 1BK4A 4U1OA 1X47A 1HNWE 2HJJA 1EYJA 4P9KA 4YHHE 3G7WA 3VV5A 4U4SA 3EPLA 1PEBA 2I58A 2QVVA 3C31A 3OMBA 4MLQA 1T39A 2B7TA 3AXFA 3MP8A 5H8QB 1L5TA 3CR9A 4GIZA 5J16A 1NV2A 2NOOA 1HSEA 2YTQA 4GXSB 3RPWA 2GHFA 4OVPA 1FTLA 4MNIA 4TUGA 2E72A 4ZEKA 3EPHA 1NUXA 4HEIA 4WSPA 2VQEE 1LB8A 1MY0A 5ET7A 2YJPA 4DV7E 4WX9A 3KG2A 3QYTA 2OWZA 5DEXB 1A7LA 5AE2A 4LN5A 4R9FA 2LUPB 2E1SA 1QU6A 2UVHA 3HXLA 4NX1A 2XXUA 3U94A 3PPOA 3T1BA 3VFJA 2ONSA 2R76A 1PJTA 2FYIA 2FHYA 4UACA 4WEDA 2NUGA 1OVTA 2A5TA 1B5IA 4X04A 5AE3A 2VE7C 2PRTA 1IMCA 3K00A 4N15A 2RCAA 4B3TE 1EH8A 1ZKBA 1T38A 4NAPA 3T9UA 4O8MA 1AH5A 4DI4B 4JI8E 4MX6A 5M2VA 3GYYA 2EMZA 4PC9A 2H4IA 4RNSA 2DWAA 2UXAA 4KHZE 3T1HE 3PUZE 1DMBA 4I8OA 1ZJLA 4DV6E 1MRPA 2EOJA
chains in the Genus database with same CATH topology
1TT1A 4HCWA 3VE1B 2Z8DA 1DOTA 3EPEA 1PBQA 3ILUB 1TFDA 1YAEA 3M3LA 3SEUA 3QSLA 3LSWA 1SYHA 2ONRA 1II5A 1MY1A 1GTKA 2VGQA 3IB0A 1MPCA 3IOVA 3R6UA 2Q2CA 2OLBA 3CVGA 4GWOA 4NF6B 4OERA 5I84A 4E0XA 3I5OA 4GL8A 4ELOA 3RUMA 1LBBA 4R6HA 1NNKA 2CZLA 2NXOA 3KN3A 4IO3A 1M5EA 4KCCA 5LOMA 2DSFA 1USYE 4BDOA 1JVXA 4PFTA 3RT8A 4IO4A 2D21A 4OEVA 1Y1ZA 1D9YA 2R6GE 3O28A 5I59B 1GR2A 3BBRA 1MH4A 1M5BA 2H9BA 1OQGA 4X48A 3G3KA 1POY1 2THIA 3QXMA 1IITA 4ZEDA 1Y4CA 1I69A 3DP4A 2REJA 1A8FA 3OXNA 2DXYA 4IO7A 2H25A 3WAFA 4KPTA 3TCFA 3OEMA 1B5HA 4G2ZA 3UK4A 1VFEA 1LSTA 4JWXA 1O7TA 1PC3A 1Y3QA 3DP8A 3LC8A 3MZBA 1URGA 4R9GA 4XIGQ 3FJGA 4RXLA 5DT6A 5B7DA 1QVSA 4RYAA 3FXRA 4N13A 1FTKA 1FQCA 4P11A 4QFPA 5DYHA 3IOWA 3RGYA 4C1UA 4PP0A 5KCJB 1DSNA 3H03A 3RNNA 3U8QA 4LONB 4F3PA 2RC9A 4F18A 1B52A 5TU0A 2DQVA 4EXKA 3KFMA 3OSRA 1B7ZA 1SI0A 2XX8A 1GGGA 2XX7A 5ICTA 1YTVA 4IY6A 3Q27A 5L8DA 1MQHA 3MC2A 3FXUA 2PT1A 1NNPA 1A8EA 2QSXA 4F3BA 2GHAA 5JTYB 4OFLA 1MH3A 3C35A 3K02A 4H65A 4KQPA 4RPNA 5EHMA 4BLAA 5KDTA 2ZNTA 1VSOA 5BWJA 1H76A 3TEPA 4OQOA 4R2FA 5EHSA 5AA1A 5I2KB 1SBPA 4AQ4A 4NF6A 3GBBA 2DE2A 3HCQA 3KZGA 1P1NA 3SEWA 4GOTA 3CSGA 4GIZA 1RYOA 4WXJA 2ZMBA 4OFOA 3TZAA 1EU8A 3H6TA 1N7WA 1FQBA 3T93B 5AA2A 2HCAA 3PPQA 4O3AA 4O3BA 1Y3PA 3K6VA 3ONMA 2UVIA 1NH7A 3PPRA 4G68A 1UTBB 2NVUB 3S9EA 2GH9A 4OZ9A 2F35A 4JSOA 3CFLA 3SERA 1J1NA 5KDTB 3OENA 3G3GA 4F1VA 4ZE9A 4NE4A 2HFBA 3RTFB 4BDNA 3C33A 4QSCA 3SDFA 5H8SA 3VXBA 4PE5B 3TCGA 3EHSA 1SYIA 4YKJA 5CMKA 4M4GA 1ZLQA 2GHBA 1US5A 3OSQA 4R2BA 1I6QA 1MY4A 4RPOA 4F22A 4H0WA 1MQDA 1FQEA 4KCDA 4XTCQ 2OK2A 5AA4A 1FTMA 3S9NC 3UA8A 1BIYA 1I6AA 1XVYA 4OYVA 3OO8A 3L6HA 1H43A 3VVFA 2QS2A 3TCHA 5H8FB 5A5XB 1AL3A 1N7XA 1KWHA 1XC1A 4WKMA 3H6VA 3ZKKA 3LSXA 3MVZA 4PFWA 1PB7A 4OTEA 1B3GA 4JXIA 2HXWA 4GFRA 2I49A 4DCXA 4I8CA 5CMBA 3QIMA 4U4XA 4BDRA 4R74A 4N6PA 3V8XB 1B32A 2AL5A 4MH5A 3UORA 2Z22A 3LR1A 1LFIA 3E13X 3K6XA 3G3IA 3MP1A 3P7IA 2DYXA 2F5XA 3V5AA 1B1HA 3MPKA 2QS4A 4F19A 1Y4TA 2X26A 2Y7IA 3IB2A 3TTRA 3HO7A 4QFNA 4OEUA 1Y1MA 5ELVA 4MF3A 4DZ1A 1A54A 3HSTA 1MM6A 1D4NA 4PQJA 3T96B 4AB6A 3EN3A 2I6EA 2P0SA 1Y9UA 3OOAA 5ITPA 1QKBA 3JV9A 5AA4B 4XKRA 1FTJA 1B3FA 2ZYOA 4ZZAA 3W9VA 3TODA 1JEVA 1M5DA 1JETA 3C4MA 2H99A 4Z7EA 4ZEIA 2DP8A 5I59A 2V25A 1B0LA 2XX9A 4RK2A 1FCKA 2RC8A 1B4HA 1FQFA 2Q89A 3MJNA 3S2VA 3SEXA 4FIMA 1URDA 1LAGE 2AL4A 3KSJA 4H5GA 3H7MA 1RYXA 1ELJA 3HPIA 1B40A 5DVJA 5AA3A 4AB5A 3K0VA 5K2YA 5IAIA 1OLCA 2DS9A 3MVXA 4KD5A 3IJXB 3PUXE 4NF4B 3VVEA 2BJJX 4TQUQ 1ANFA 2FA7A 5DEXA 4XKPA 4P0IA 5CRYA 2O51A 5J1DA 1MQJA 2O6AA 2Y7PA 3FZVA 4YB6A 3VXCA 3Q26A 1MDQA 2P1SA 4LUBA 2HZKA 2PVUA 4FECA 5H8HA 1POTA 3T9HB 4ELRA 2KLFA 1FTOA 3S4UA 4UA8A 5CC2A 2UVJA 4ELPA 1UQWA 2O1MA 3TTNA 2HAUA 5CI5A 1IXIA 4OFJA 1FQAA 3SESA 1N3WA 4U23A 4EUOA 5KZTA 1JNFA 1EZOA 2F97A 2Y7WA 4H8JA 3TTLA 3TYHA 5I2NB 1H44A 1MQGA 1UIUA 2D5WA 1N0TA 4YU0A 3K2DA 3Q25A 4LATA 2PBWA 4RK9A 1PB9A 3FD3A 2HEUA 4YKIA 4DCYA 3TQLA 3FASA 1Y3NA 2AYSA 2XXWA 3CI8A 3IAZA 5H8QA 3VLVA 1L5TA 4E0WA 2ZYMA 2Q88A 2XXRA 3D4CA 4R75A 4ZZEA 1LFGA 1MY3A 5K2XA 2X7PA 5ISUA 3O6GA 3KJTA 4G4PA 4WEPA 5FHMA 2A5TB 4HCYA 1EH3A 3FVGA 1B9JA 4BDQA 3RQTA 1IXCA 1S50A 1VE4A 2PMSA 2XXYA 4BDMA 4ESWA 4ZS9A 3ZKLA 3FVNA 5FHOA 2M8CA 5DVFA 3KN7A 1JEUA 3MWBA 3ILTB 3O29A 3I3VA 1B1XA 4I1DA 2QS3A 4OETA 4EF2A 3IB1A 4OHNA 3R7XA 1EZPA 2B65A 1B4ZA 3A3CA 2R71A 1MY2A 1WVJA 1R9QA 3RTWB 2OJTA 3PMWA 5I57B 4C1TA 4RA1A 4NMYA 4NEDA 1CE2A 1YCJA 2PT2A 2ZNUA 3N5LA 5FTHA 1UIVA 2XHDA 1P99A 3QAXA 3VLWA 2F6GA 4DXBA 1HSJA 3TELA 5IKBA 4ZEBA 2DE3A 2XD3A 3H4ZA 2UYFA 3IOTA 3K1MA 2OWSA 5TPAA 3ZSFA 1NFTA 4OESA 2V93A 3FVKA 1SW2A 2V84A 4NWDA 4XKNA 4DXUA 2ZNSA 5JEIA 2O7UA 4LZ7A 3FJMA 4IO5A 2F7BA 2H5YA 5HBCA 3U93A 3W9WA 4DDDA 3N94A 2PX1A 4PFYA 5JTYA 1MPBA 2I0BA 3O6IA 1US4A 3TUSA 3K6UA 4ISUA 5I56A 1OQHA 1ZTYA 1MM7A 4OWDA 1GV8A 2I48A 3KJ7A 4QFLA 2XD2A 3M3KA 1IIWA 1MXWA 2RC7A 3OELA 4QRZA 5A5XA 2GRVA 5H8FA 2H98A 1B3HA 1LLSA 3JZJA 3TAJA 4NF5A 1UTBA 4L17A 3TKDA 3QUJA 4LZ8A 1OIBA 3OO7A 5AA2B 4KYSA 1DPEA 2I3VA 4NF4A 1QKAA 3OD7A 1IZ1A 2RCBA 2X7QA 5ICQA 4LP2B 2F7CA 2ZXTA 4ND9A 1IQ7A 3E4RA 2OCUA 4G8MA 3VVDA 3SKPA 1H3DA 3CFZA 2XXTA 4X1BA 3TQWA 5I58B 1A55A 3G3JA 1FQDA 3FUZA 3H06B 4TLMB 3ZS6A 1LCFA 1B05A 5DVIA 3CIJA 3LSFB 4C0RA 1P1OA 3ECRA 2UVGA 3I6VA 3TDJA 3TTMA 2REGA 3MZ9A 4G68B 3MQ9A 3ODBA 3PMVA 2D3IA 3C34A 1DPPA 1NL5A 4POXA 1LAFE 2GFEA 3IX1A 1O63A 2DVZA 1JW1A 1F9BA 1SQYA 4H6DA 4KR5A 1AMFA 4OENA 4R72A 3T9VA 5CM6A 2XXIA 1XT8A 3K1NA 3UIFA 4EQBA 4Q0CA 5I2KA 2Y84A 3CG1A 4THIA 2Z23A 3B6QA 1URSA 2DE4A 3FGSA 4HS7A 3WAEA 5AA2D 5L9OA 1QUKA 2CMOA 2RKMA 1YPNA 2ANJA 1I6BA 2IA4A 2RF1A 3H6WA 3R26A 1N76A 3FATA 3A3UA 3N26A 4FJPA 4RJZA 1OMPA 3C32A 4YAHX 3BKIB 4YMAA 3BFTA 1NNFA 2VD2A 1M5FA 4X9TA 3OO9A 1MXUA 3FIRA 3PUWE 3G3HA 1ATGA 1LBCA 4U21A 4GL0A 3TMGA 1T0KA 1XS5A 2Q2AA 4FORA 4KI0E 3IOUA 1Z7ME 3KGCA 3PPNA 1MXYA 4QFOA 5TP9A 1GVCA 1S7YA 1VR5A 2Y7KA 3LUYA 4U22A 2HQ0A 2NWJA 2V3UA 1UTHA 3FV1A 3OO6A 3SEVA 3GBAA 4FAJA 5JK4A 3Q29A 5L9SA 4Q5TA 4Z0IA 4EDPA 1B3EA 1NH8A 5H8NA 1JQFA 2QRYA 3DELB 4GF8A 1N84A 1BLFA 3N6UA 1TWYA 1B5JA 1OVBA 2E0SA 2F78A 3RN8A 2ESNA 3E3KA 4KFQA 4X1DA 4YB7A 1BP5A 3KN8A 3IO4A 2Q9TA 1XHYA 2VHAA 1NNTA 3Q28A 1SDXA 2O84X 2PYYA 3JYRA 4JB7A 5TP9B 3SETA 3U1OA 5HPQA 1AIVA 3TFLA 1P1UA 3C9HA 3VDFA 3USDA 4FATA 5BUUA 2QJEA 4XXUA 2DVCA 1Q35A 4GRKA 3MW0A 3MP6A 5I58A 4FEDA 1PB8A 4LZ5A 3FV2A 2YPNA 1MPDA 4K3FA 3EF7A 1MXVA 1TFAA 1Z7NE 3PU5A 2QS1A 3H3GA 2NUVA 3K4UA 1QUJA 4MBPA 4QSDA 2VD3A 2O7IA 4R6KA 1IXHA 3T9XB 2O69A 4F31B 4JWYA 1R1NA 1S9TA 3GXAA 3PV0E 3O97A 4GXAA 2FNCA 4NF8B 5KCJA 4EXLA 4G77A 1NMUA 5F1QA 2XXXA 3H6UA 1DTZA 4NF5B 2ABHA 2Z8FA 1P1WA 2F36A 3O9PA 3DLNA 3S9MC 3RT6B 1NKXA 1D3KA 1P1QA 4P0GA 2DWIA 4GQOA 4F39A 4ONYA 5F7VA 4IO2A 5TPAB 4Q30B 2QMWA 4U2RA 2QMXA 3IORA 1EZ9A 1SW4A 2F7AA 2R9JA 3HHFA 1XVXA 1SD3A 3O6HA 1SVXB 3FJ7A 3V89B 1AOVA 1BTJA 3K6WA 2P2AA 4YICA 2XXVA 1MG1A 2A5SA 2HAVA 4YKPA 1B46A 1O64A 3N6TA 4IB2A 3T66A 3LSLA 4LQ5A 5DTBA 1Q1KA 4M1VA 4JDFA 1LAXA 3E9XA 4NTLA 3TTKA 2DWJA 5HM4B 3LBSA 4F2QA 3BFUA 1HSLA 2VP1A 3RLFE 4EQ9A 1B2HA 1ZU0A 2Y7RA 1ZBMA 1SW1A 4YKKA 2B3BA 3UGWA 4DLDA 4F3SA 3PD9A 3K01A 1DTGA 3MVWA 4OMBA 4O3CA 3SEYA 1B6HA 4JWOA 1CB6A 1H45A 2V3QA 2W7YA 3KOTA 2DXRA 2OBGA 2G93A 2HZLA 3T22A 4YMBA 5AE4A 1B0HA 2ALUA 3IR1A 4H1XA 3FXQA 4R73A 4RY1A 2F34A 3CSBA 2ZYKA 3OEKA 4PETA 3CRBA 2ONKE 2V3TA 1JVYA 3TPAA 5L9MA 5B70A 4U1OA 1SI1A 3EHTA 1PDAA 3F11A 4XKQA 1B7HA 3UP9A 2DWHA 4JBZA 2OWTA 3G7WA 3S9LC 1WODA 5ITOA 5I2NA 4R6YA 3MUQA 3VV5A 4YZZA 4U4SA 4IGTA 1N04A 1PEBA 4ESXA 1ZIUA 3L6GA 4YB5A 2I58A 2VOZA 5EYFA 5FHNA 4F29A 1OLAA 3C31A 3MPLA 1PBPA 3OMBA 4MLQA 3MP8A 2G29A 3AXFA 3FVOA 4GVOA 5H8QB 3IK6B 2O68A 3KEIA 1B58A 3CR9A 2WKYA 3IJOB 2NOOA 3PMXA 1D9VA 1SW5A 3PUVE 1HSEA 4GXSB 1M5CA 4OXVA 4DIGA 3RPWA 5CBRA 5I56B 3EQ1A 3PGFA 4ZEFA 4F3GA 1LFHA 1FTLA 5CMMA 5I57A 4LA9A 4ZEKA 1FW0A 1BKAA 1XOCA 2OZZA 4LVQA 1JW4A 1ZMGA 2LAOA 3G3FA 4KYDA 3PPPA 2Q8JA 1LB8A 1MY0A 1Y20A 2AIXA 3HV1A 2QL3A 2I4BA 2YLNA 2YJPA 4TOZA 5H8HB 3B6TA 3K1PA 4ZECA 3C36A 1IEJA 4ECFA 4BDLA 3V83A 4U1ZA 1JW5A 1USYH 3KG2A 3QYTA 4DXCA 3M3FA 3GLBA 4FEBA 3THIA 3PD8A 4HTGA 2I0CA 4OVJA 5DEXB 1A7LA 2QPQA 1LAHE 1MXXA 3UN6A 1WDNA 5FTIA 4NF8A 4R9FA 2E1SA 3DP6A 3KOSA 3W15C 1MQIA 3QK6A 4IO6A 4QF9A 4QSEA 1B51A 4KYEA 2DOJA 1LGBC 2UVHA 2XXUA 3MVYA 3U94A 4I62A 1B7UA 3PPOA 3B7DA 4G8HA 3QUFA 2Z8EA 4NWCA 2B3FA 2ONSA 3VFJA 4DE8A 2FYIA 1N3XA 5CMCA 1QUIA 1QULA 1UTHB 3B6WA 1IXGA 4EF1A 2XXHA 4HW8A 4UACA 4I9DA 1R9LA 2F6PA 3M8UA 4WEDA 4MLVA 1VFDA 1OVTA 4G68C 4ZDMA 2O1LA 2RINA 4GLIA 4QFKA 3U72A 2A5TA 4QHQA 4ELQA 3PUYE 1B5IA 1LB9A 2F8DA 1QJMA 4H5FA 4Q8RA 3U92A 1LCTA 2I4CA 4G8NA 1QW0A 4TLLB 4F1UA 4IY5A 4N07A 3CFXA 4PFUA 3GZGA 2ZYNA 3K00A 2RCAA 3A09A 4F1YA 1MS7A 5H8NB 1R6ZA 1ZKBA 4LQ2A 3MAMA 4FE8A 3T9UA 3IO6A 1AH5A 2UYEA 2XXQA 3KBRA 5M2VA 5CBSA 4H8IA 3KSXA 4F2OA 3O66A 1MXZA 3MBPA 3MZ1A 4ZE8A 1IUDA 2XXPA 3IL1B 1TXFA 2H4IA 4H67A 4IGRA 2DWAA 4RNSA 1A99A 3HN0A 1B3LA 1A40A 2UXAA 4KHZE 3HHGA 1DMBA 3D4GA 3PUZE 4GD5A 4JSDA 2IEEA 1ZJLA 2I3WA 3CG3A 3RY3A 1MRPA 4MFIA 4POWA 4EQ7A 1RKMA 3VLUA 3EHUA 1MDP1 3O2AA 3DM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT1 A;  4HCW A;  3VE1 B;  2Z8D A;  1DOT A;  3EPE A;  1PBQ A;  3ILU B;  1TFD A;  1YAE A;  3M3L A;  3SEU A;  3QSL A;  3LSW A;  1SYH A;  2ONR A;  1II5 A;  1MY1 A;  1GTK A;  2VGQ A;  3IB0 A;  1MPC A;  3IOV A;  3R6U A;  2Q2C A;  2OLB A;  3CVG A;  4GWO A;  4NF6 B;  4OER A;  5I84 A;  4E0X A;  3I5O A;  4GL8 A;  4ELO A;  3RUM A;  1LBB A;  4R6H A;  1NNK A;  2CZL A;  2NXO A;  3KN3 A;  4IO3 A;  1M5E A;  4KCC A;  5LOM A;  2DSF A;  1USY E;  4BDO A;  1JVX A;  4PFT A;  3RT8 A;  4IO4 A;  2D21 A;  4OEV A;  1Y1Z A;  1D9Y A;  2R6G E;  3O28 A;  5I59 B;  1GR2 A;  3BBR A;  1MH4 A;  1M5B A;  2H9B A;  1OQG A;  4X48 A;  3G3K A;  1POY 1;  2THI A;  3QXM A;  1IIT A;  4ZED A;  1Y4C A;  1I69 A;  3DP4 A;  2REJ A;  1A8F A;  3OXN A;  2DXY A;  4IO7 A;  2H25 A;  3WAF A;  4KPT A;  3TCF A;  3OEM A;  1B5H A;  4G2Z A;  3UK4 A;  1VFE A;  1LST A;  4JWX A;  1O7T A;  1PC3 A;  1Y3Q A;  3DP8 A;  3LC8 A;  3MZB A;  1URG A;  4R9G A;  4XIG Q;  3FJG A;  4RXL A;  5DT6 A;  5B7D A;  1QVS A;  4RYA A;  3FXR A;  4N13 A;  1FTK A;  1FQC A;  4P11 A;  4QFP A;  5DYH A;  3IOW A;  3RGY A;  4C1U A;  4PP0 A;  5KCJ B;  1DSN A;  3H03 A;  3RNN A;  3U8Q A;  4LON B;  4F3P A;  2RC9 A;  4F18 A;  1B52 A;  5TU0 A;  2DQV A;  4EXK A;  3KFM A;  3OSR A;  1B7Z A;  1SI0 A;  2XX8 A;  1GGG A;  2XX7 A;  5ICT A;  1YTV A;  4IY6 A;  3Q27 A;  5L8D A;  1MQH A;  3MC2 A;  3FXU A;  2PT1 A;  1NNP A;  1A8E A;  2QSX A;  4F3B A;  2GHA A;  5JTY B;  4OFL A;  1MH3 A;  3C35 A;  3K02 A;  4H65 A;  4KQP A;  4RPN A;  5EHM A;  4BLA A;  5KDT A;  2ZNT A;  1VSO A;  5BWJ A;  1H76 A;  3TEP A;  4OQO A;  4R2F A;  5EHS A;  5AA1 A;  5I2K B;  1SBP A;  4AQ4 A;  4NF6 A;  3GBB A;  2DE2 A;  3HCQ A;  3KZG A;  1P1N A;  3SEW A;  4GOT A;  3CSG A;  4GIZ A;  1RYO A;  4WXJ A;  2ZMB A;  4OFO A;  3TZA A;  1EU8 A;  3H6T A;  1N7W A;  1FQB A;  3T93 B;  5AA2 A;  2HCA A;  3PPQ A;  4O3A A;  4O3B A;  1Y3P A;  3K6V A;  3ONM A;  2UVI A;  1NH7 A;  3PPR A;  4G68 A;  1UTB B;  2NVU B;  3S9E A;  2GH9 A;  4OZ9 A;  2F35 A;  4JSO A;  3CFL A;  3SER A;  1J1N A;  5KDT B;  3OEN A;  3G3G A;  4F1V A;  4ZE9 A;  4NE4 A;  2HFB A;  3RTF B;  4BDN A;  3C33 A;  4QSC A;  3SDF A;  5H8S A;  3VXB A;  4PE5 B;  3TCG A;  3EHS A;  1SYI A;  4YKJ A;  5CMK A;  4M4G A;  1ZLQ A;  2GHB A;  1US5 A;  3OSQ A;  4R2B A;  1I6Q A;  1MY4 A;  4RPO A;  4F22 A;  4H0W A;  1MQD A;  1FQE A;  4KCD A;  4XTC Q;  2OK2 A;  5AA4 A;  1FTM A;  3S9N C;  3UA8 A;  1BIY A;  1I6A A;  1XVY A;  4OYV A;  3OO8 A;  3L6H A;  1H43 A;  3VVF A;  2QS2 A;  3TCH A;  5H8F B;  5A5X B;  1AL3 A;  1N7X A;  1KWH A;  1XC1 A;  4WKM A;  3H6V A;  3ZKK A;  3LSX A;  3MVZ A;  4PFW A;  1PB7 A;  4OTE A;  1B3G A;  4JXI A;  2HXW A;  4GFR A;  2I49 A;  4DCX A;  4I8C A;  5CMB A;  3QIM A;  4U4X A;  4BDR A;  4R74 A;  4N6P A;  3V8X B;  1B32 A;  2AL5 A;  4MH5 A;  3UOR A;  2Z22 A;  3LR1 A;  1LFI A;  3E13 X;  3K6X A;  3G3I A;  3MP1 A;  3P7I A;  2DYX A;  2F5X A;  3V5A A;  1B1H A;  3MPK A;  2QS4 A;  4F19 A;  1Y4T A;  2X26 A;  2Y7I A;  3IB2 A;  3TTR A;  3HO7 A;  4QFN A;  4OEU A;  1Y1M A;  5ELV A;  4MF3 A;  4DZ1 A;  1A54 A;  3HST A;  1MM6 A;  1D4N A;  4PQJ A;  3T96 B;  4AB6 A;  3EN3 A;  2I6E A;  2P0S A;  1Y9U A;  3OOA A;  5ITP A;  1QKB A;  3JV9 A;  5AA4 B;  4XKR A;  1FTJ A;  1B3F A;  2ZYO A;  4ZZA A;  3W9V A;  3TOD A;  1JEV A;  1M5D A;  1JET A;  3C4M A;  2H99 A;  4Z7E A;  4ZEI A;  2DP8 A;  5I59 A;  2V25 A;  1B0L A;  2XX9 A;  4RK2 A;  1FCK A;  2RC8 A;  1B4H A;  1FQF A;  2Q89 A;  3MJN A;  3S2V A;  3SEX A;  4FIM A;  1URD A;  1LAG E;  2AL4 A;  3KSJ A;  4H5G A;  3H7M A;  1RYX A;  1ELJ A;  3HPI A;  1B40 A;  5DVJ A;  5AA3 A;  4AB5 A;  3K0V A;  5K2Y A;  5IAI A;  1OLC A;  2DS9 A;  3MVX A;  4KD5 A;  3IJX B;  3PUX E;  4NF4 B;  3VVE A;  2BJJ X;  4TQU Q;  1ANF A;  2FA7 A;  5DEX A;  4XKP A;  4P0I A;  5CRY A;  2O51 A;  5J1D A;  1MQJ A;  2O6A A;  2Y7P A;  3FZV A;  4YB6 A;  3VXC A;  3Q26 A;  1MDQ A;  2P1S A;  4LUB A;  2HZK A;  2PVU A;  4FEC A;  5H8H A;  1POT A;  3T9H B;  4ELR A;  2KLF A;  1FTO A;  3S4U A;  4UA8 A;  5CC2 A;  2UVJ A;  4ELP A;  1UQW A;  2O1M A;  3TTN A;  2HAU A;  5CI5 A;  1IXI A;  4OFJ A;  1FQA A;  3SES A;  1N3W A;  4U23 A;  4EUO A;  5KZT A;  1JNF A;  1EZO A;  2F97 A;  2Y7W A;  4H8J A;  3TTL A;  3TYH A;  5I2N B;  1H44 A;  1MQG A;  1UIU A;  2D5W A;  1N0T A;  4YU0 A;  3K2D A;  3Q25 A;  4LAT A;  2PBW A;  4RK9 A;  1PB9 A;  3FD3 A;  2HEU A;  4YKI A;  4DCY A;  3TQL A;  3FAS A;  1Y3N A;  2AYS A;  2XXW A;  3CI8 A;  3IAZ A;  5H8Q A;  3VLV A;  1L5T A;  4E0W A;  2ZYM A;  2Q88 A;  2XXR A;  3D4C A;  4R75 A;  4ZZE A;  1LFG A;  1MY3 A;  5K2X A;  2X7P A;  5ISU A;  3O6G A;  3KJT A;  4G4P A;  4WEP A;  5FHM A;  2A5T B;  4HCY A;  1EH3 A;  3FVG A;  1B9J A;  4BDQ A;  3RQT A;  1IXC A;  1S50 A;  1VE4 A;  2PMS A;  2XXY A;  4BDM A;  4ESW A;  4ZS9 A;  3ZKL A;  3FVN A;  5FHO A;  2M8C A;  5DVF A;  3KN7 A;  1JEU A;  3MWB A;  3ILT B;  3O29 A;  3I3V A;  1B1X A;  4I1D A;  2QS3 A;  4OET A;  4EF2 A;  3IB1 A;  4OHN A;  3R7X A;  1EZP A;  2B65 A;  1B4Z A;  3A3C A;  2R71 A;  1MY2 A;  1WVJ A;  1R9Q A;  3RTW B;  2OJT A;  3PMW A;  5I57 B;  4C1T A;  4RA1 A;  4NMY A;  4NED A;  1CE2 A;  1YCJ A;  2PT2 A;  2ZNU A;  3N5L A;  5FTH A;  1UIV A;  2XHD A;  1P99 A;  3QAX A;  3VLW A;  2F6G A;  4DXB A;  1HSJ A;  3TEL A;  5IKB A;  4ZEB A;  2DE3 A;  2XD3 A;  3H4Z A;  2UYF A;  3IOT A;  3K1M A;  2OWS A;  5TPA A;  3ZSF A;  1NFT A;  4OES A;  2V93 A;  3FVK A;  1SW2 A;  2V84 A;  4NWD A;  4XKN A;  4DXU A;  2ZNS A;  5JEI A;  2O7U A;  4LZ7 A;  3FJM A;  4IO5 A;  2F7B A;  2H5Y A;  5HBC A;  3U93 A;  3W9W A;  4DDD A;  3N94 A;  2PX1 A;  4PFY A;  5JTY A;  1MPB A;  2I0B A;  3O6I A;  1US4 A;  3TUS A;  3K6U A;  4ISU A;  5I56 A;  1OQH A;  1ZTY A;  1MM7 A;  4OWD A;  1GV8 A;  2I48 A;  3KJ7 A;  4QFL A;  2XD2 A;  3M3K A;  1IIW A;  1MXW A;  2RC7 A;  3OEL A;  4QRZ A;  5A5X A;  2GRV A;  5H8F A;  2H98 A;  1B3H A;  1LLS A;  3JZJ A;  3TAJ A;  4NF5 A;  1UTB A;  4L17 A;  3TKD A;  3QUJ A;  4LZ8 A;  1OIB A;  3OO7 A;  5AA2 B;  4KYS A;  1DPE A;  2I3V A;  4NF4 A;  1QKA A;  3OD7 A;  1IZ1 A;  2RCB A;  2X7Q A;  5ICQ A;  4LP2 B;  2F7C A;  2ZXT A;  4ND9 A;  1IQ7 A;  3E4R A;  2OCU A;  4G8M A;  3VVD A;  3SKP A;  1H3D A;  3CFZ A;  2XXT A;  4X1B A;  3TQW A;  5I58 B;  1A55 A;  3G3J A;  1FQD A;  3FUZ A;  3H06 B;  4TLM B;  3ZS6 A;  1LCF A;  1B05 A;  5DVI A;  3CIJ A;  3LSF B;  4C0R A;  1P1O A;  3ECR A;  2UVG A;  3I6V A;  3TDJ A;  3TTM A;  2REG A;  3MZ9 A;  4G68 B;  3MQ9 A;  3ODB A;  3PMV A;  2D3I A;  3C34 A;  1DPP A;  1NL5 A;  4POX A;  1LAF E;  2GFE A;  3IX1 A;  1O63 A;  2DVZ A;  1JW1 A;  1F9B A;  1SQY A;  4H6D A;  4KR5 A;  1AMF A;  4OEN A;  4R72 A;  3T9V A;  5CM6 A;  2XXI A;  1XT8 A;  3K1N A;  3UIF A;  4EQB A;  4Q0C A;  5I2K A;  2Y84 A;  3CG1 A;  4THI A;  2Z23 A;  3B6Q A;  1URS A;  2DE4 A;  3FGS A;  4HS7 A;  3WAE A;  5AA2 D;  5L9O A;  1QUK A;  2CMO A;  2RKM A;  1YPN A;  2ANJ A;  1I6B A;  2IA4 A;  2RF1 A;  3H6W A;  3R26 A;  1N76 A;  3FAT A;  3A3U A;  3N26 A;  4FJP A;  4RJZ A;  1OMP A;  3C32 A;  4YAH X;  3BKI B;  4YMA A;  3BFT A;  1NNF A;  2VD2 A;  1M5F A;  4X9T A;  3OO9 A;  1MXU A;  3FIR A;  3PUW E;  3G3H A;  1ATG A;  1LBC A;  4U21 A;  4GL0 A;  3TMG A;  1T0K A;  1XS5 A;  2Q2A A;  4FOR A;  4KI0 E;  3IOU A;  1Z7M E;  3KGC A;  3PPN A;  1MXY A;  4QFO A;  5TP9 A;  1GVC A;  1S7Y A;  1VR5 A;  2Y7K A;  3LUY A;  4U22 A;  2HQ0 A;  2NWJ A;  2V3U A;  1UTH A;  3FV1 A;  3OO6 A;  3SEV A;  3GBA A;  4FAJ A;  5JK4 A;  3Q29 A;  5L9S A;  4Q5T A;  4Z0I A;  4EDP A;  1B3E A;  1NH8 A;  5H8N A;  1JQF A;  2QRY A;  3DEL B;  4GF8 A;  1N84 A;  1BLF A;  3N6U A;  1TWY A;  1B5J A;  1OVB A;  2E0S A;  2F78 A;  3RN8 A;  2ESN A;  3E3K A;  4KFQ A;  4X1D A;  4YB7 A;  1BP5 A;  3KN8 A;  3IO4 A;  2Q9T A;  1XHY A;  2VHA A;  1NNT A;  3Q28 A;  1SDX A;  2O84 X;  2PYY A;  3JYR A;  4JB7 A;  5TP9 B;  3SET A;  3U1O A;  5HPQ A;  1AIV A;  3TFL A;  1P1U A;  3C9H A;  3VDF A;  3USD A;  4FAT A;  5BUU A;  2QJE A;  4XXU A;  2DVC A;  1Q35 A;  4GRK A;  3MW0 A;  3MP6 A;  5I58 A;  4FED A;  1PB8 A;  4LZ5 A;  3FV2 A;  2YPN A;  1MPD A;  4K3F A;  3EF7 A;  1MXV A;  1TFA A;  1Z7N E;  3PU5 A;  2QS1 A;  3H3G A;  2NUV A;  3K4U A;  1QUJ A;  4MBP A;  4QSD A;  2VD3 A;  2O7I A;  4R6K A;  1IXH A;  3T9X B;  2O69 A;  4F31 B;  4JWY A;  1R1N A;  1S9T A;  3GXA A;  3PV0 E;  3O97 A;  4GXA A;  2FNC A;  4NF8 B;  5KCJ A;  4EXL A;  4G77 A;  1NMU A;  5F1Q A;  2XXX A;  3H6U A;  1DTZ A;  4NF5 B;  2ABH A;  2Z8F A;  1P1W A;  2F36 A;  3O9P A;  3DLN A;  3S9M C;  3RT6 B;  1NKX A;  1D3K A;  1P1Q A;  4P0G A;  2DWI A;  4GQO A;  4F39 A;  4ONY A;  5F7V A;  4IO2 A;  5TPA B;  4Q30 B;  2QMW A;  4U2R A;  2QMX A;  3IOR A;  1EZ9 A;  1SW4 A;  2F7A A;  2R9J A;  3HHF A;  1XVX A;  1SD3 A;  3O6H A;  1SVX B;  3FJ7 A;  3V89 B;  1AOV A;  1BTJ A;  3K6W A;  2P2A A;  4YIC A;  2XXV A;  1MG1 A;  2A5S A;  2HAV A;  4YKP A;  1B46 A;  1O64 A;  3N6T A;  4IB2 A;  3T66 A;  3LSL A;  4LQ5 A;  5DTB A;  1Q1K A;  4M1V A;  4JDF A;  1LAX A;  3E9X A;  4NTL A;  3TTK A;  2DWJ A;  5HM4 B;  3LBS A;  4F2Q A;  3BFU A;  1HSL A;  2VP1 A;  3RLF E;  4EQ9 A;  1B2H A;  1ZU0 A;  2Y7R A;  1ZBM A;  1SW1 A;  4YKK A;  2B3B A;  3UGW A;  4DLD A;  4F3S A;  3PD9 A;  3K01 A;  1DTG A;  3MVW A;  4OMB A;  4O3C A;  3SEY A;  1B6H A;  4JWO A;  1CB6 A;  1H45 A;  2V3Q A;  2W7Y A;  3KOT A;  2DXR A;  2OBG A;  2G93 A;  2HZL A;  3T22 A;  4YMB A;  5AE4 A;  1B0H A;  2ALU A;  3IR1 A;  4H1X A;  3FXQ A;  4R73 A;  4RY1 A;  2F34 A;  3CSB A;  2ZYK A;  3OEK A;  4PET A;  3CRB A;  2ONK E;  2V3T A;  1JVY A;  3TPA A;  5L9M A;  5B70 A;  4U1O A;  1SI1 A;  3EHT A;  1PDA A;  3F11 A;  4XKQ A;  1B7H A;  3UP9 A;  2DWH A;  4JBZ A;  2OWT A;  3G7W A;  3S9L C;  1WOD A;  5ITO A;  5I2N A;  4R6Y A;  3MUQ A;  3VV5 A;  4YZZ A;  4U4S A;  4IGT A;  1N04 A;  1PEB A;  4ESX A;  1ZIU A;  3L6G A;  4YB5 A;  2I58 A;  2VOZ A;  5EYF A;  5FHN A;  4F29 A;  1OLA A;  3C31 A;  3MPL A;  1PBP A;  3OMB A;  4MLQ A;  3MP8 A;  2G29 A;  3AXF A;  3FVO A;  4GVO A;  5H8Q B;  3IK6 B;  2O68 A;  3KEI A;  1B58 A;  3CR9 A;  2WKY A;  3IJO B;  2NOO A;  3PMX A;  1D9V A;  1SW5 A;  3PUV E;  1HSE A;  4GXS B;  1M5C A;  4OXV A;  4DIG A;  3RPW A;  5CBR A;  5I56 B;  3EQ1 A;  3PGF A;  4ZEF A;  4F3G A;  1LFH A;  1FTL A;  5CMM A;  5I57 A;  4LA9 A;  4ZEK A;  1FW0 A;  1BKA A;  1XOC A;  2OZZ A;  4LVQ A;  1JW4 A;  1ZMG A;  2LAO A;  3G3F A;  4KYD A;  3PPP A;  2Q8J A;  1LB8 A;  1MY0 A;  1Y20 A;  2AIX A;  3HV1 A;  2QL3 A;  2I4B A;  2YLN A;  2YJP A;  4TOZ A;  5H8H B;  3B6T A;  3K1P A;  4ZEC A;  3C36 A;  1IEJ A;  4ECF A;  4BDL A;  3V83 A;  4U1Z A;  1JW5 A;  1USY H;  3KG2 A;  3QYT A;  4DXC A;  3M3F A;  3GLB A;  4FEB A;  3THI A;  3PD8 A;  4HTG A;  2I0C A;  4OVJ A;  5DEX B;  1A7L A;  2QPQ A;  1LAH E;  1MXX A;  3UN6 A;  1WDN A;  5FTI A;  4NF8 A;  4R9F A;  2E1S A;  3DP6 A;  3KOS A;  3W15 C;  1MQI A;  3QK6 A;  4IO6 A;  4QF9 A;  4QSE A;  1B51 A;  4KYE A;  2DOJ A;  1LGB C;  2UVH A;  2XXU A;  3MVY A;  3U94 A;  4I62 A;  1B7U A;  3PPO A;  3B7D A;  4G8H A;  3QUF A;  2Z8E A;  4NWC A;  2B3F A;  2ONS A;  3VFJ A;  4DE8 A;  2FYI A;  1N3X A;  5CMC A;  1QUI A;  1QUL A;  1UTH B;  3B6W A;  1IXG A;  4EF1 A;  2XXH A;  4HW8 A;  4UAC A;  4I9D A;  1R9L A;  2F6P A;  3M8U A;  4WED A;  4MLV A;  1VFD A;  1OVT A;  4G68 C;  4ZDM A;  2O1L A;  2RIN A;  4GLI A;  4QFK A;  3U72 A;  2A5T A;  4QHQ A;  4ELQ A;  3PUY E;  1B5I A;  1LB9 A;  2F8D A;  1QJM A;  4H5F A;  4Q8R A;  3U92 A;  1LCT A;  2I4C A;  4G8N A;  1QW0 A;  4TLL B;  4F1U A;  4IY5 A;  4N07 A;  3CFX A;  4PFU A;  3GZG A;  2ZYN A;  3K00 A;  2RCA A;  3A09 A;  4F1Y A;  1MS7 A;  5H8N B;  1R6Z A;  1ZKB A;  4LQ2 A;  3MAM A;  4FE8 A;  3T9U A;  3IO6 A;  1AH5 A;  2UYE A;  2XXQ A;  3KBR A;  5M2V A;  5CBS A;  4H8I A;  3KSX A;  4F2O A;  3O66 A;  1MXZ A;  3MBP A;  3MZ1 A;  4ZE8 A;  1IUD A;  2XXP A;  3IL1 B;  1TXF A;  2H4I A;  4H67 A;  4IGR A;  2DWA A;  4RNS A;  1A99 A;  3HN0 A;  1B3L A;  1A40 A;  2UXA A;  4KHZ E;  3HHG A;  1DMB A;  3D4G A;  3PUZ E;  4GD5 A;  4JSD A;  2IEE A;  1ZJL A;  2I3W A;  3CG3 A;  3RY3 A;  1MRP A;  4MFI A;  4POW A;  4EQ7 A;  1RKM A;  3VLU A;  3EHU A;  1MDP 1;  3O2A A;  3DM0 A; 
#chains in the Genus database with same CATH topology
 4DKK A;  1DOT A;  1YAE A;  3M3L A;  3QSL A;  1SYH A;  1II5 A;  2LE2 A;  2EPM X;  3R6U A;  1FPG A;  2Q2C A;  2EMC A;  4E0X A;  3I5O A;  4GL8 A;  4ELO A;  1NNK A;  3VHT B;  3BIG A;  4PFT A;  3HTX A;  2EML A;  1D9Y A;  2R6G E;  1GR2 A;  3BBR A;  1M5B A;  4X48 A;  1Y4C A;  1I69 A;  3DP4 A;  3F6G A;  5AC5 A;  2H25 A;  3UK4 A;  1LST A;  4KHP E;  1O7T A;  2B3T B;  1PC3 A;  3LC8 A;  5B7D A;  2V85 A;  3RNN A;  4DV4 E;  4LON B;  5TU0 A;  3KFM A;  3OSR A;  1SI0 A;  5ICT A;  2N8X A;  2ENC A;  1YTV A;  4WPY A;  3Q27 A;  5L8D A;  1MQH A;  2YWQ A;  1N3G A;  2PT1 A;  1NNP A;  4OFL A;  1WRJ A;  1MH3 A;  3K02 A;  5KDT A;  1VSO A;  4R2F A;  3SZP A;  2ODR C;  5I2K B;  3THO B;  4IR8 A;  4WXJ A;  5AA2 A;  4O3A A;  1Z1B A;  3K6V A;  2NVU B;  3PPR A;  3S9E A;  2GH9 A;  5KDT B;  3CFL A;  3OEN A;  4F1V A;  4NE4 A;  4BDN A;  3SDF A;  1K9Z A;  4PE5 B;  2CEY A;  3EHS A;  1FQE A;  2G7H A;  4DUY E;  3S9N C;  1BIY A;  4OYV A;  1XVY A;  1PKP A;  3TQM A;  1H43 A;  2DB2 A;  1KWH A;  2DSY A;  4ZYD A;  4JV5 E;  1PB7 A;  1B3G A;  1ZBT A;  2LO3 A;  4GFR A;  2I49 A;  5CMB A;  2MKD A;  2NUE A;  2Z22 A;  3K6X A;  3MP1 A;  4JVC A;  2DYX A;  1EKZ A;  1B1H A;  1Y4T A;  3HQ1 A;  2X26 A;  4OEU A;  4DZ1 A;  1A54 A;  1MM6 A;  3EN3 A;  2I6E A;  2P0S A;  2CZK A;  4XKR A;  1NUW A;  1M5D A;  4GX3 A;  4Z7E A;  2DP8 A;  5I59 A;  2XX9 A;  4I40 A;  3MJN A;  4FIM A;  4H5G A;  2J7J A;  1RYX A;  1ELJ A;  3K0V A;  4PF8 A;  4KD5 A;  3VVE A;  4TQU Q;  4XKP A;  4P0I A;  2O6A A;  2Y7P A;  3VXC A;  2CPN A;  1MDQ A;  2VPO A;  4ELR A;  1FTO A;  4MHF A;  4LU9 A;  2B7V A;  3SES A;  4PFI A;  3TYH A;  3QMF A;  4H8J A;  1H44 A;  4IS1 C;  1LBZ A;  3T1Y E;  4RK9 A;  3FD3 A;  4DCY A;  3IAZ A;  5H8Q A;  3VLV A;  2VF1 A;  1FJG E;  3LLH A;  4R75 A;  5K2X A;  4GWY A;  5ISU A;  3O6G A;  3KJT A;  4WEP A;  1EH3 A;  4P56 A;  1ZAA C;  2PMS A;  3FVN A;  5FHO A;  5CFF E;  3ILT B;  3MWB A;  1YXI A;  2QS3 A;  2L3C A;  3A3C A;  3RTW B;  2N3G A;  2UXB E;  1YCJ A;  1UIV A;  2VQF E;  4GWX A;  1HSJ A;  4I3E A;  5IKB A;  2EOX A;  1DCU A;  2XD3 A;  2UYF A;  2NA2 A;  5IZ3 B;  4J8Z A;  2YT4 A;  1K9Y A;  3FVK A;  2HGH A;  4BHC A;  1SW2 A;  4NWD A;  4DUZ E;  4PF6 A;  4WYQ B;  1UBD C;  4XKN A;  2L2M A;  2F7B A;  5FLX C;  5JTY A;  1MPB A;  1RDZ A;  2I0B A;  1US4 A;  5I56 A;  1OQH A;  4GBV A;  4QFL A;  5AAS A;  2V89 A;  2EM6 A;  1B3H A;  3TAJ A;  3TKD A;  2EMG A;  3QUJ A;  1YUI A;  1QKA A;  3OD7 A;  2EJ4 A;  2EMX A;  2ZXT A;  1IQ7 A;  4NHR A;  2L2K B;  2XXT A;  1PJQ A;  4X1B A;  3TQW A;  5I58 B;  4TLM B;  4PBH A;  4O94 A;  4PGN A;  4WXC A;  2GFE A;  3IX1 A;  2MC5 A;  4KR5 A;  4GKK E;  1XT8 A;  1T4O A;  3UIF A;  4THI A;  2Z23 A;  4HS7 A;  1URS A;  2DE4 A;  3FGS A;  3WAE A;  2CMO A;  1YPN A;  2RF1 A;  3H6W A;  2HXR A;  4YAH X;  1OMP A;  3C32 A;  3OO9 A;  1LBC A;  3TMG A;  2WBU A;  1T0K A;  1XS5 A;  2Q2A A;  4FOR A;  1Z7M E;  4C1U A;  2Y7K A;  2HQ0 A;  3Q29 A;  5H8N A;  1NH8 A;  4N4R B;  3HPS A;  2Q8M A;  1OVB A;  1NV4 A;  4F6M A;  4KFQ A;  4ZYG A;  2EM4 A;  4BHB A;  1BP5 A;  3IO4 A;  2Q9T A;  1DGC A;  3JYR A;  2Y5K A;  1P1U A;  3VDF A;  4GRK A;  4X62 E;  5I58 A;  4FED A;  4LZ5 A;  4PFR A;  1Z7N E;  3PU5 A;  2L5V A;  4R6K A;  1IXH A;  2O69 A;  4F31 B;  2LTR A;  2EOS A;  3GXA A;  4NF8 B;  2EQ3 A;  5T6J A;  5F24 A;  1SFE A;  5F1Q A;  3H6U A;  4X65 E;  4NF5 B;  1PJS A;  4BCA A;  4PGP A;  4JI7 E;  2F36 A;  3O9P A;  3S9M C;  3RT6 B;  1NKX A;  4F39 A;  1A1G A;  4NF0 A;  4G61 A;  2V4C A;  2QMW A;  1LBY A;  2QMX A;  5IXM B;  4FAJ A;  2F7A A;  3HHF A;  2EOZ A;  3RYD A;  1B46 A;  1O64 A;  2UXC E;  1T4N A;  4IB2 A;  3T66 A;  3LSL A;  3LUZ A;  2RTX A;  1FBD A;  2VP1 A;  3RLF E;  4EQ9 A;  1ZU0 A;  4H46 A;  1ZBM A;  1SW1 A;  2FIX A;  3PD9 A;  1NV6 A;  4OMB A;  4R2R A;  4JWO A;  3KOT A;  2YTP A;  2OBG A;  2G93 A;  2HZL A;  2EMK A;  2ALU A;  4O7I A;  4R73 A;  2LMZ A;  2ZYK A;  1X5W A;  4PET A;  4HXV A;  3AV0 A;  5L9M A;  4BC9 A;  1SI1 A;  1ZBQ A;  1B7H A;  4R2Q A;  2DWH A;  3UP9 A;  2OWT A;  1WOD A;  4YZZ A;  4IGT A;  4ESX A;  2EWL A;  3L6G A;  3FIG A;  4OOG C;  4F29 A;  1OLA A;  4LF7 E;  3MPL A;  4GVO A;  3FVO A;  3IK6 B;  3KEI A;  5CMC A;  3IJO B;  1SW5 A;  2GLI A;  4MAG A;  1M5C A;  2R1F A;  3EQ1 A;  4M2Z A;  1D9Q A;  1LFH A;  5A6J A;  1G0I A;  3DJW A;  1X3C A;  2DMY A;  1XOC A;  2OZZ A;  2BBG A;  1JW4 A;  2HHH E;  3G3F A;  2EPZ A;  3PPP A;  2QL3 A;  2I4B A;  2YLN A;  5H8H B;  4XF5 A;  4ZEC A;  1NUZ A;  4BDL A;  3V83 A;  1USY H;  2KQZ A;  3THI A;  1UHZ A;  3GLB A;  4FBP A;  1FPB A;  2QPQ A;  1WDN A;  4F6N A;  3KOS A;  5LMU E;  1NV0 A;  3W15 C;  4QSE A;  5DW8 A;  1LGB C;  4DE8 A;  2B3F A;  4R2S A;  1QUI A;  1QUL A;  2DGC A;  4B3S E;  4ZDM A;  4MLV A;  4PE3 A;  2O1L A;  4GLI A;  4QFK A;  1LB9 A;  3DF6 A;  4WFT A;  4H5F A;  1LCT A;  4PAK A;  2ELY A;  2NAB A;  2BB8 A;  2WEF A;  1JK2 A;  2I4C A;  5A6B D;  1QW0 A;  4P78 A;  1R6Z A;  1L4S A;  4LQ2 A;  4FE8 A;  4HE1 A;  3A29 A;  4DR5 E;  1FPF A;  2XXQ A;  3KBR A;  4O24 A;  5ET5 A;  3KSX A;  3O66 A;  3MBP A;  1IBM E;  2XXP A;  2EMW A;  3IFC A;  3IWB A;  1YUJ A;  4GD5 A;  2I3W A;  2YRH A;  3CG3 A;  2JWO A;  4O43 A;  1J5E E;  1FTA A;  4HCW A;  2Z8D A;  3EPE A;  3SEU A;  2MKZ A;  3LSW A;  2EPU A;  5I84 A;  1LBB A;  4IO4 A;  4OEV A;  1AWB A;  1Y1Z A;  3O28 A;  2DRP A;  1KYQ A;  1IIT A;  2REJ A;  3WAF A;  2DXY A;  4KPT A;  2YTF A;  4JWX A;  3DP8 A;  2JY9 A;  4N13 A;  3RGY A;  4P11 A;  1QNT A;  5KCJ B;  4PP0 A;  1DSN A;  3H03 A;  3U8Q A;  4F3P A;  2VT5 A;  4PFB A;  4F18 A;  4LF8 E;  5IWA E;  4BC7 A;  3MC2 A;  4JI5 E;  2GHA A;  5JTY B;  4BLA A;  2MDR A;  2LVH A;  5EYG A;  3TEP A;  5ADZ A;  4OQO A;  1IMF A;  4PDH A;  3B8B A;  3KZG A;  1P1N A;  3CSG A;  1RYO A;  2ZMB A;  2UU9 E;  2I9I A;  4O4K A;  1N7W A;  3P1X A;  2HCA A;  1Y3P A;  3ONM A;  2UVI A;  4OZ9 A;  3SER A;  3MHH C;  1J1N A;  2CEX A;  4ZE9 A;  3C33 A;  3VXB A;  1SYI A;  5CMK A;  1US5 A;  3OSQ A;  4R2B A;  4L5N C;  3VYY A;  4RPO A;  4X8R A;  4H0W A;  2OK2 A;  1FTM A;  1BB8 A;  1I6A A;  2V86 A;  3L6H A;  2IHR 1;  2EZ6 A;  1N7X A;  2JOB A;  4XFE A;  3H6V A;  4JXI A;  4DCX A;  4I8C A;  2AL5 A;  3UOR A;  1LFI A;  1FPE A;  1RDX A;  2F5X A;  2Q74 A;  5EQ8 A;  4F19 A;  3HO7 A;  1X6H A;  1Y1M A;  3KBZ A;  4OAN A;  4PQJ A;  1YFH A;  1D4N A;  2M1S A;  2KHX A;  2K4V A;  1Y9U A;  2B4M A;  1QKB A;  3JV9 A;  3OOA A;  2L6M A;  5ET6 A;  1JET A;  2V25 A;  1B0L A;  3S2V A;  2WBT A;  1FCK A;  1FQF A;  2RC8 A;  2Q89 A;  2JYA A;  4WXD A;  3KSJ A;  1LAG E;  1NV3 A;  2AL4 A;  3RPL B;  2WYK A;  1TF6 A;  2DS9 A;  3PUX E;  2BJJ X;  5CRY A;  4JYA E;  3RMP A;  5J1D A;  2FGG A;  4LUB A;  2PVU A;  4FEC A;  1Q9D A;  3T9H B;  4OVS A;  3S4U A;  1UQW A;  5CI5 A;  4OFJ A;  4DV0 E;  1N3W A;  2EL6 A;  1UIU A;  1MQG A;  3IFA A;  1RMD A;  1N0T A;  4P1E A;  2HEU A;  3FAS A;  2AYS A;  3CI8 A;  1WXR A;  2Q88 A;  1LFG A;  1MY3 A;  1SPI A;  2X7P A;  3OTO E;  2EOH A;  5FHM A;  3FVG A;  1A1L A;  1B9J A;  3MYU A;  4BDQ A;  1IXC A;  1VE4 A;  2XXY A;  2YTD A;  3ZKL A;  3MHS C;  3KN7 A;  1MY2 A;  1WVJ A;  1N34 E;  3PMW A;  4RA1 A;  4NMY A;  4R2A A;  4BS9 A;  2ZNU A;  5FTH A;  2XHD A;  1P99 A;  3EPK A;  4ZEB A;  2DE3 A;  4LF5 E;  1IBK E;  1NFT A;  4OES A;  2HC5 A;  2EM9 A;  4DXU A;  4GKJ E;  4LZ7 A;  3FJM A;  2EM7 A;  2H5Y A;  1YYO A;  4PFY A;  3O6I A;  2P3V A;  3K6U A;  1ZTY A;  3EKI A;  4OWD A;  1GV8 A;  2XD2 A;  3M3K A;  1IIW A;  2JJK A;  4B3M E;  2RC7 A;  2GRV A;  2H98 A;  1LLS A;  3JZJ A;  1YYZ A;  1UTB A;  4L17 A;  1FPI A;  4LZ8 A;  4F54 A;  5AA2 B;  3OO7 A;  5A6K A;  4LP2 B;  1N36 E;  2CZI A;  2OCU A;  4G8M A;  4JVI A;  3VVD A;  4GX6 A;  3G3J A;  3H06 B;  4JI0 E;  1B05 A;  1NV5 A;  3LSF B;  4MMP A;  3TTM A;  3B50 A;  2M4I A;  4G68 B;  2ENA A;  3C34 A;  2EQ1 A;  1DPP A;  4TLL B;  5AA4 A;  2DVZ A;  3T9V A;  1JW1 A;  5IZ1 A;  2XWK A;  1NEI A;  2EM0 A;  4Q0C A;  5I2K A;  2Y84 A;  2WZO A;  1BBG A;  5AE1 A;  1I6B A;  3D1R A;  3J81 C;  3N26 A;  2FBP A;  3BKI B;  1NNF A;  1M5F A;  3FIR A;  3G3H A;  4U21 A;  4GL0 A;  3IOU A;  3KGC A;  3OML A;  2L33 A;  4QFO A;  2EPO A;  4U22 A;  2L92 A;  2CTD A;  2V3U A;  1UTH A;  3KC0 A;  5L9S A;  4Q5T A;  4EDP A;  2QRY A;  2H36 X;  4GF8 A;  3HPZ A;  2E0S A;  2F78 A;  3E3K A;  2FTX B;  1NNT A;  2VPN A;  1SDX A;  2O84 X;  4JB7 A;  1AIV A;  1EYI A;  2LUQ A;  2QJE A;  4XXU A;  2DVC A;  4JI4 E;  1PB8 A;  2LCE A;  3FV2 A;  2YPN A;  1MPD A;  5EYH A;  2VD3 A;  4YY3 E;  3PV0 E;  4GXA A;  4NHB A;  2FNC A;  1I94 E;  1NMU A;  2MC6 A;  5IZZ A;  1P1W A;  5LDZ A;  3VK6 A;  3ISP A;  4NZV A;  1IMB A;  4ONY A;  5F7V A;  4IO2 A;  5TPA B;  2LT7 A;  4U2R A;  3IOR A;  3V89 B;  1XVX A;  1SVX B;  3IWC A;  1BTJ A;  2XXV A;  2A5S A;  4YKP A;  2LRS A;  4AQY E;  5DTB A;  4M1V A;  3E9X A;  3LBS A;  3BFU A;  1HSL A;  2Y7R A;  2B3B A;  4DLD A;  3K01 A;  3MVW A;  4O3C A;  3BGH A;  5KL5 A;  3C6K A;  4H1X A;  3OEK A;  3CRB A;  4NQ8 A;  2YTJ A;  2EPN A;  1X6E A;  4X64 E;  3F11 A;  3S9L C;  4JBZ A;  5ITO A;  2ZZV A;  5I2N A;  4R6Y A;  3MUQ A;  2ADR A;  2FV4 B;  4YB5 A;  1FBF A;  1YSA C;  4OA4 A;  1PBP A;  3T9X B;  2O68 A;  3PUV E;  2JVA A;  2LBS B;  3PMX A;  2ELZ A;  4P3L A;  2LJU A;  5JEI A;  2KON A;  4ZEF A;  4AS5 A;  5KL3 A;  1BKA A;  4LVQ A;  1ZMG A;  2LAO A;  3U65 A;  5I3S A;  2EOO A;  1Y20 A;  2AIX A;  3HV1 A;  3FXB A;  1FSA A;  1IEJ A;  2YU5 A;  4U1Z A;  1JW5 A;  4DXC A;  2PFZ A;  4FEB A;  4N4U A;  3PTY A;  3PD8 A;  4OVJ A;  2I0C A;  2XWO A;  1LAH E;  1MXX A;  2JXP A;  5A2Q C;  2WBB A;  3DP6 A;  4IO6 A;  1B51 A;  2ZZX A;  2DOJ A;  1IMU A;  5I7I A;  4I62 A;  3B7D A;  2UXD E;  1X48 A;  2Z8E A;  3QUF A;  4NGU A;  1UTH B;  2YTO A;  1IXG A;  4EF1 A;  4I9D A;  3MSW A;  1R9L A;  2F6P A;  4X66 E;  1VFD A;  3SEX A;  5BUU A;  3U72 A;  2EOQ A;  4QHQ A;  4G8N A;  4F1U A;  3CFX A;  4PFU A;  2ZYN A;  3BBG A;  4F1Y A;  1MS7 A;  3MAM A;  1HNX E;  4UAB A;  2WBD A;  5I5P A;  3MZ1 A;  4ZE8 A;  2P3N A;  1IUD A;  4DV2 E;  4DR7 E;  1TXF A;  4IGR A;  1A99 A;  2EOM A;  4NG7 A;  1B3L A;  3HHG A;  2IEE A;  1LBX A;  3RY3 A;  4EQ7 A;  3VLU A;  1MDP 1;  2EM5 A;  1TT1 A;  1GQE A;  3VE1 B;  4JVD A;  3JAM C;  3ILU B;  1TFD A;  1FBC A;  2ONR A;  2YTN A;  1MY1 A;  2YTI A;  1GTK A;  2VGQ A;  1KA1 A;  1MPC A;  3IB0 A;  4OER A;  4ZYE A;  3CVG A;  2GQ1 A;  3RUM A;  4R6H A;  2CZL A;  1NCS A;  2NXO A;  3KN3 A;  4IO3 A;  4KCC A;  2EMY A;  4OVT A;  2D21 A;  3ADI A;  1POY 1;  3QXM A;  1A8F A;  3OXN A;  4IO7 A;  3TCF A;  3OEM A;  1B5H A;  4G2Z A;  3FJG A;  4RXL A;  5DT6 A;  3KWR A;  2WYP A;  4RYA A;  4QFP A;  5LMN E;  5DYH A;  2RS7 A;  5EQ7 A;  1JK1 A;  1XNR E;  2KOU A;  2KR0 A;  1YZ9 A;  2RC9 A;  5LTC A;  1GGG A;  1FRP A;  4IY6 A;  1X49 A;  1A8E A;  2QSX A;  4X9J A;  3E79 A;  4Q28 A;  2ZNT A;  4JI6 E;  2YZT A;  1DQ3 A;  5EHS A;  4DR2 E;  5AA1 A;  1SBP A;  5DNY A;  4AQ4 A;  3GBB A;  2DE2 A;  3SEW A;  4GOT A;  4R03 A;  4F9C B;  4NN3 A;  1NUY A;  4QBA A;  1EU8 A;  3H6T A;  2EPK X;  3PPQ A;  4O3B A;  4DR4 E;  1NH7 A;  1UTB B;  4JSO A;  3G3G A;  4OX9 E;  3E78 A;  3RTF B;  4QSC A;  2LTS A;  4M4G A;  1ZLQ A;  2GHB A;  1I6Q A;  1MY4 A;  1UN6 B;  4KCD A;  2FVZ A;  2E1M A;  5KL7 A;  1KA0 A;  3TCH A;  5H8F B;  5A5X B;  1AL3 A;  4WKM A;  1XC1 A;  3ZKK A;  3MVZ A;  4PFW A;  1B69 A;  4OTE A;  2CSH A;  1FBG A;  3QIM A;  4U4X A;  4BDR A;  4R74 A;  2NUF A;  4N6P A;  2RQL A;  3P7I A;  2YSP A;  2XXK A;  3V5A A;  2EOE A;  2Y7I A;  3TTR A;  3HST A;  5IZ3 A;  2YU8 A;  1A1J A;  5AA4 B;  2XWI A;  1FTJ A;  4DR1 E;  4ZZA A;  4LFB E;  3W9V A;  3C4M A;  2H99 A;  2EM2 A;  2V83 A;  2XA5 A;  4ZEI A;  5A6A A;  1B4H A;  5KZT A;  3F6H A;  2EN7 A;  1N33 E;  3H7M A;  5DVJ A;  1LLM C;  5AA3 A;  4AB5 A;  1IQS A;  1G0H A;  1OLC A;  3MVX A;  4TUI A;  2EM8 A;  5KL6 A;  2FA7 A;  4DV1 E;  5DEX A;  1AAY A;  5A6B A;  4PCD A;  2RS6 A;  1MQJ A;  3Q26 A;  4PBQ A;  2HZK A;  1A1K A;  1WHQ A;  3C4T A;  2KLF A;  4UA8 A;  5CC2 A;  1FBE A;  2UVJ A;  4ELP A;  5LL6 R;  4NXN E;  4O7M A;  3TTN A;  2HAU A;  1IXI A;  1FQA A;  4EUO A;  1EZO A;  1TF3 A;  3Q25 A;  4LAT A;  4GBW A;  4X8W A;  2PBW A;  1PB9 A;  1XI6 A;  2XXR A;  3D4C A;  4ZZE A;  4G4P A;  4DR3 E;  1NI9 A;  1YZ0 A;  1S50 A;  4BDM A;  4ZS9 A;  2M8C A;  5DVF A;  3O29 A;  1KZ8 A;  4OET A;  4EF2 A;  3IB1 A;  4OHN A;  2B65 A;  1B4Z A;  2R71 A;  4M0V A;  4C1T A;  2PT2 A;  1T4L B;  3QAX A;  2F6G A;  3THN A;  3TEL A;  3H4Z A;  2OWS A;  2EMB A;  3ZSF A;  2WX9 A;  5ET8 A;  2O7U A;  4FK5 C;  4IO5 A;  2HHM A;  5HBC A;  3N94 A;  2PX1 A;  2V87 A;  3C4B A;  4L8N A;  1FKA E;  3KJ7 A;  5T3J A;  3OEL A;  4QRZ A;  5A5X A;  5H8F A;  2A25 A;  2YSO A;  4NF5 A;  3C6M A;  4R2P A;  4LTY A;  2R8T A;  4NF4 A;  2RCB A;  3FBP A;  2X7Q A;  2EOY A;  1HNZ E;  4ND9 A;  3E4R A;  3SKP A;  2EN8 A;  3CFZ A;  1LBW A;  1A55 A;  1FQD A;  3FUZ A;  5DVI A;  4C0R A;  1P1O A;  2UVG A;  3I6V A;  3MQ9 A;  3PMV A;  4KXP A;  2D3I A;  1NL5 A;  1LAF E;  1O63 A;  1SQY A;  1F9B A;  4H6D A;  5EQA A;  2MDG A;  4K0K E;  2EL5 A;  3K1N A;  4EQB A;  3CG1 A;  3B6Q A;  1F2I G;  2RKM A;  2IA4 A;  2DLQ A;  3FAT A;  4NXM E;  4FJP A;  4RJZ A;  3BFT A;  1MXU A;  3PUW E;  1ATG A;  3UK3 C;  2DDK A;  2HPG A;  4KI0 E;  3T96 B;  1MXY A;  5TP9 A;  2L3J A;  1S7Y A;  3LUY A;  2NWJ A;  3FV1 A;  5BR8 E;  3GBA A;  5JK4 A;  4Z0I A;  1B3E A;  3BF2 A;  1N84 A;  4GZN C;  3JTZ A;  1BLF A;  3RN8 A;  2EMF A;  2ESN A;  4PDD A;  2EN6 A;  1XHY A;  2M9A A;  1LEV A;  2VHA A;  4JI2 E;  2K7I A;  3U1O A;  5HPQ A;  3TFL A;  2FIE A;  2ZM6 E;  1YYW A;  1FPL A;  3USD A;  2ZZW A;  4FAT A;  2LJH A;  1Q35 A;  1A1F A;  4N8G A;  3CHG A;  1STU A;  1MXV A;  4BMJ A;  1WJP A;  2QS1 A;  2RPC A;  2NUV A;  3K4U A;  4MBP A;  1R1N A;  5KCJ A;  4MEV A;  4EXL A;  2XWV A;  1X6F A;  1DTZ A;  2ABH A;  2Z8F A;  4N6D A;  3DLN A;  2YTE A;  4OVR A;  1D3K A;  1P1Q A;  4P0G A;  4R2C A;  2YRK A;  1XNQ E;  4PAI A;  1GZ6 A;  4Q30 B;  1EZ9 A;  1SW4 A;  2R9J A;  3O6H A;  1SD3 A;  3FJ7 A;  2HAV A;  2EN1 A;  4LQ5 A;  1Q1K A;  2EOR A;  1LAX A;  4NTL A;  1EH7 A;  3ZOQ B;  2YTG A;  4H45 A;  4N91 A;  1B2H A;  1A1I A;  2DIX A;  4F3S A;  3SEY A;  1B6H A;  4N6K A;  4B3R E;  2W7Y A;  3IWD A;  2V3Q A;  5AE4 A;  3VYX A;  1B0H A;  3IR1 A;  4RY1 A;  3FXQ A;  3CSB A;  4P1L A;  2M7Q A;  2ONK E;  3J7A G;  3NOH A;  3TPA A;  3EHT A;  4DV3 E;  2JPA A;  1PDA A;  4N81 A;  4XKQ A;  3HFU A;  4P47 A;  2EMI A;  1SR9 A;  4GWZ A;  1N04 A;  1ZIU A;  4HE2 A;  5FHN A;  2VOZ A;  5EYF A;  2G29 A;  2CT1 A;  1B58 A;  2WKY A;  4DIG A;  1D9V A;  5I56 B;  5CBR A;  1HR0 E;  3H09 A;  1YYK A;  3PGF A;  4F3G A;  5CMM A;  3ADG A;  5I57 A;  4LA9 A;  1FW0 A;  4KYD A;  2Q8J A;  4TOZ A;  4LF9 E;  1XMQ E;  2N3H A;  3B6T A;  3K1P A;  3C36 A;  4ECF A;  2ENH A;  3M3F A;  1ZU1 A;  1RC7 A;  4HTG A;  4LFA E;  3UN6 A;  5FTI A;  4NF8 A;  1MQI A;  3QK6 A;  4QF9 A;  3RPL A;  1CNQ A;  4KYE A;  3BIH A;  3MVY A;  2EN3 A;  2EP3 A;  1B7U A;  4KZS A;  4G8H A;  4NWC A;  1N3X A;  3KC1 A;  3B6W A;  2XXH A;  1QGX A;  4HW8 A;  1KJK A;  3M8U A;  4G68 C;  4ELQ A;  2DMI A;  2RIN A;  3PUY E;  2F8D A;  1QJM A;  4Q8R A;  3U92 A;  5A69 A;  2UUB E;  1FJ6 A;  2EN2 A;  4IY5 A;  4N07 A;  2DLK A;  3GZG A;  5H8N B;  1RDY A;  3IO6 A;  2UYE A;  5CBS A;  4H8I A;  4F2O A;  1MXZ A;  3IL1 B;  4H67 A;  2EPA A;  3HN0 A;  1A40 A;  3D4G A;  4JSD A;  4MFI A;  5KL4 A;  4POW A;  1RKM A;  3A09 A;  3EHU A;  4OXV A;  3O2A A;  3DM0 A;  2V8Q B;  3KZZ A;  5A5L A;  1FPK A;  1O0W A;  3L00 A;  1PBQ A;  1IBL E;  3IOV A;  4GWO A;  2PFY A;  4NF6 B;  2OLB A;  4JI3 E;  1FJ9 A;  2D9H A;  4F9B B;  2UUC E;  3K6Q A;  5LOM A;  1M5E A;  4DI3 D;  2DSF A;  1USY E;  4BDO A;  1JVX A;  3RT8 A;  5I59 B;  1MH4 A;  2H9B A;  1OQG A;  3G3K A;  2THI A;  4ZED A;  4RH8 A;  4I3Y A;  1MGT A;  4OVQ A;  5ICQ A;  1VFE A;  1Y3Q A;  3MZB A;  4R9G A;  1URG A;  4XIG Q;  5IM2 A;  1QVS A;  2EPP A;  3FXR A;  1FTK A;  4IJD A;  4LF4 E;  1FQC A;  2V88 A;  3IOW A;  3ROJ A;  4PAF A;  4LF6 E;  1B52 A;  2DQV A;  4EXK A;  3ADJ A;  1B7Z A;  2XX8 A;  2XX7 A;  3FXU A;  4WSG A;  4F3B A;  3C35 A;  4H65 A;  4KQP A;  1UIL A;  4RPN A;  5EHM A;  5BWJ A;  4P7D A;  1H76 A;  2MKN A;  4NF6 A;  3HCQ A;  2I13 A;  5ESY A;  4F9A B;  4OFO A;  3TZA A;  1FQB A;  3T93 B;  2EPC A;  4G68 A;  3QG5 C;  2F35 A;  2QVU A;  5IGA A;  2HFB A;  2EMH A;  5H8S A;  3TCG A;  2L8T A;  3AUZ A;  4YKJ A;  1WHN A;  1IME A;  3ADL A;  4F22 A;  1MQD A;  4XTC Q;  4R2D A;  3UA8 A;  1J26 A;  1INP A;  3OO8 A;  2EL4 A;  3VVF A;  2RSM A;  2QS2 A;  3LSX A;  2JP9 A;  2HXW A;  5LLQ A;  5KL2 A;  3V8X B;  1B32 A;  2BJI A;  4MH5 A;  3LR1 A;  3E13 X;  5IT9 C;  3G3I A;  1G2F C;  3MPK A;  2QS4 A;  1P47 A;  3IB2 A;  4QFN A;  5ELV A;  2F3B A;  2L2N A;  4MF3 A;  4AB6 A;  5ITP A;  1MEY C;  1B3F A;  2ZYO A;  4QXD A;  3TOD A;  1JEV A;  1EYK A;  1IQO A;  4N17 A;  2EPX A;  2QVR A;  2EE8 A;  2UUA E;  4RK2 A;  4E0W A;  1URD A;  4DR6 E;  2Q8U A;  3HPI A;  1B40 A;  1EH6 A;  2EPR A;  5K2Y A;  5IAI A;  3IJX B;  4NF4 B;  1ANF A;  2EPL X;  2O51 A;  4YB6 A;  3FZV A;  2P1S A;  3J80 C;  4GEQ B;  4PTK A;  5H8H A;  1POT A;  2CZH A;  2O1M A;  2B9D A;  1JP4 A;  4MJO A;  4U23 A;  1JNF A;  2RSI A;  2F97 A;  2Y7W A;  3TTL A;  5I2N B;  2D5W A;  2F3D A;  5IV8 B;  4YU0 A;  2PCR A;  3K2D A;  4YKI A;  3TQL A;  1NV7 A;  3LV0 A;  1Y3N A;  2XXW A;  2ODR D;  2YRM A;  2ZYM A;  2EQ0 A;  2JOX A;  3KZY A;  3J7Y p;  3T0J A;  5FBP A;  2EN4 A;  2A5T B;  4HCY A;  3RQT A;  1G2D C;  3LML A;  4ESW A;  1FPJ A;  1JEU A;  3I3V A;  1B1X A;  4I1D A;  1N32 E;  1ZR9 A;  3R7X A;  1EZP A;  5AC4 A;  1R9Q A;  4N8Y A;  2OJT A;  5I57 B;  4NED A;  1CE2 A;  3N5L A;  3VLW A;  2Y5L A;  4DXB A;  3IOT A;  5TPA A;  3K1M A;  1BBO A;  2JR1 A;  2LV2 A;  2V93 A;  3BID A;  1TN9 A;  4DMI A;  4M9V C;  2V84 A;  2WCC 3;  2ZNS A;  3U93 A;  3W9W A;  4DDD A;  3TUS A;  4ISU A;  1MM7 A;  2I48 A;  2F8B A;  4MNC A;  1MXW A;  2GPI A;  4MIJ A;  1XMO E;  1RQ0 A;  4MCO A;  4M30 A;  4BBY A;  1OIB A;  2VRD A;  4KYS A;  1DPE A;  2I3V A;  2EM3 A;  4MNP A;  1IZ1 A;  4XEQ A;  2F7C A;  1IMA A;  2QFL A;  1H3D A;  3ZS6 A;  1LCF A;  2E5L E;  3CIJ A;  3ECR A;  2REG A;  3MZ9 A;  3ODB A;  4POX A;  4OEN A;  4R72 A;  1AMF A;  5CM6 A;  4AS4 A;  2XXI A;  1IMD A;  4ZYH A;  4RHB B;  5AA2 D;  5L9O A;  4F2J C;  1QUK A;  4P8B A;  1FPD A;  2ANJ A;  1N76 A;  3A3U A;  5TSE A;  4YMA A;  1FBP A;  4GWW A;  4O5G A;  2VD2 A;  2WBS A;  4X9T A;  4GX4 A;  2F4V E;  3JU0 A;  3PPN A;  1GVC A;  3MST A;  3TDJ A;  4GWU A;  1VR5 A;  4R8O A;  1VDW A;  3SEV A;  3OO6 A;  1JQF A;  3DEL B;  4HE0 A;  3N6U A;  1TWY A;  1B5J A;  4X1D A;  4YB7 A;  3KN8 A;  3Q28 A;  2PYY A;  3SET A;  5TP9 B;  4LFC E;  3C9H A;  1DK4 A;  5F3W A;  2B4L A;  3MW0 A;  3MP6 A;  1DI2 A;  4K3F A;  3EF7 A;  1TFA A;  1DBZ A;  3H3G A;  1QUJ A;  4QSD A;  2O7I A;  4JWY A;  1S9T A;  3O97 A;  4G77 A;  2XXX A;  2EMA A;  1NV1 A;  3EPJ A;  2DWI A;  1FBH A;  4GQO A;  2OX3 A;  3R26 A;  1AOV A;  3M99 B;  3K6W A;  2P2A A;  4YIC A;  1MG1 A;  3N6T A;  4DV5 E;  4GWS A;  4R2E A;  4JDF A;  3TTK A;  2DWJ A;  5HM4 B;  4F2Q A;  5EQ9 A;  4Q35 B;  4YKK A;  4JI1 E;  3UGW A;  1DTG A;  2EOI A;  1CB6 A;  1H45 A;  3T22 A;  2DXR A;  4YMB A;  2F34 A;  2EOF A;  4KWY A;  1A1H A;  2V3T A;  1JVY A;  1LBV A;  5B70 A;  1BK4 A;  4U1O A;  1X47 A;  1HNW E;  2HJJ A;  1EYJ A;  4P9K A;  4YHH E;  3G7W A;  3VV5 A;  4U4S A;  3EPL A;  1PEB A;  2I58 A;  2QVV A;  3C31 A;  3OMB A;  4MLQ A;  1T39 A;  2B7T A;  3AXF A;  3MP8 A;  5H8Q B;  1L5T A;  3CR9 A;  4GIZ A;  5J16 A;  1NV2 A;  2NOO A;  1HSE A;  2YTQ A;  4GXS B;  3RPW A;  2GHF A;  4OVP A;  1FTL A;  4MNI A;  4TUG A;  2E72 A;  4ZEK A;  3EPH A;  1NUX A;  4HEI A;  4WSP A;  2VQE E;  1LB8 A;  1MY0 A;  5ET7 A;  2YJP A;  4DV7 E;  4WX9 A;  3KG2 A;  3QYT A;  2OWZ A;  5DEX B;  1A7L A;  5AE2 A;  4LN5 A;  4R9F A;  2LUP B;  2E1S A;  1QU6 A;  2UVH A;  3HXL A;  4NX1 A;  2XXU A;  3U94 A;  3PPO A;  3T1B A;  3VFJ A;  2ONS A;  2R76 A;  1PJT A;  2FYI A;  2FHY A;  4UAC A;  4WED A;  2NUG A;  1OVT A;  2A5T A;  1B5I A;  4X04 A;  5AE3 A;  2VE7 C;  2PRT A;  1IMC A;  3K00 A;  4N15 A;  2RCA A;  4B3T E;  1EH8 A;  1ZKB A;  1T38 A;  4NAP A;  3T9U A;  4O8M A;  1AH5 A;  4DI4 B;  4JI8 E;  4MX6 A;  5M2V A;  3GYY A;  2EMZ A;  4PC9 A;  2H4I A;  4RNS A;  2DWA A;  2UXA A;  4KHZ E;  3T1H E;  3PUZ E;  1DMB A;  4I8O A;  1ZJL A;  4DV6 E;  1MRP A;  2EOJ A; 
#chains in the Genus database with same CATH homology
 1TT1 A;  4HCW A;  3VE1 B;  2Z8D A;  1DOT A;  3EPE A;  1PBQ A;  3ILU B;  1TFD A;  1YAE A;  3M3L A;  3SEU A;  3QSL A;  3LSW A;  1SYH A;  2ONR A;  1II5 A;  1MY1 A;  1GTK A;  2VGQ A;  3IB0 A;  1MPC A;  3IOV A;  3R6U A;  2Q2C A;  2OLB A;  3CVG A;  4GWO A;  4NF6 B;  4OER A;  5I84 A;  4E0X A;  3I5O A;  4GL8 A;  4ELO A;  3RUM A;  1LBB A;  4R6H A;  1NNK A;  2CZL A;  2NXO A;  3KN3 A;  4IO3 A;  1M5E A;  4KCC A;  5LOM A;  2DSF A;  1USY E;  4BDO A;  1JVX A;  4PFT A;  3RT8 A;  4IO4 A;  2D21 A;  4OEV A;  1Y1Z A;  1D9Y A;  2R6G E;  3O28 A;  5I59 B;  1GR2 A;  3BBR A;  1MH4 A;  1M5B A;  2H9B A;  1OQG A;  4X48 A;  3G3K A;  1POY 1;  2THI A;  3QXM A;  1IIT A;  4ZED A;  1Y4C A;  1I69 A;  3DP4 A;  2REJ A;  1A8F A;  3OXN A;  2DXY A;  4IO7 A;  2H25 A;  3WAF A;  4KPT A;  3TCF A;  3OEM A;  1B5H A;  4G2Z A;  3UK4 A;  1VFE A;  1LST A;  4JWX A;  1O7T A;  1PC3 A;  1Y3Q A;  3DP8 A;  3LC8 A;  3MZB A;  1URG A;  4R9G A;  4XIG Q;  3FJG A;  4RXL A;  5DT6 A;  5B7D A;  1QVS A;  4RYA A;  3FXR A;  4N13 A;  1FTK A;  1FQC A;  4P11 A;  4QFP A;  5DYH A;  3IOW A;  3RGY A;  4C1U A;  4PP0 A;  5KCJ B;  1DSN A;  3H03 A;  3RNN A;  3U8Q A;  4LON B;  4F3P A;  2RC9 A;  4F18 A;  1B52 A;  5TU0 A;  2DQV A;  4EXK A;  3KFM A;  3OSR A;  1B7Z A;  1SI0 A;  2XX8 A;  1GGG A;  2XX7 A;  5ICT A;  1YTV A;  4IY6 A;  3Q27 A;  5L8D A;  1MQH A;  3MC2 A;  3FXU A;  2PT1 A;  1NNP A;  1A8E A;  2QSX A;  4F3B A;  2GHA A;  5JTY B;  4OFL A;  1MH3 A;  3C35 A;  3K02 A;  4H65 A;  4KQP A;  4RPN A;  5EHM A;  4BLA A;  5KDT A;  2ZNT A;  1VSO A;  5BWJ A;  1H76 A;  3TEP A;  4OQO A;  4R2F A;  5EHS A;  5AA1 A;  5I2K B;  1SBP A;  4AQ4 A;  4NF6 A;  3GBB A;  2DE2 A;  3HCQ A;  3KZG A;  1P1N A;  3SEW A;  4GOT A;  3CSG A;  4GIZ A;  1RYO A;  4WXJ A;  2ZMB A;  4OFO A;  3TZA A;  1EU8 A;  3H6T A;  1N7W A;  1FQB A;  3T93 B;  5AA2 A;  2HCA A;  3PPQ A;  4O3A A;  4O3B A;  1Y3P A;  3K6V A;  3ONM A;  2UVI A;  1NH7 A;  3PPR A;  4G68 A;  1UTB B;  2NVU B;  3S9E A;  2GH9 A;  4OZ9 A;  2F35 A;  4JSO A;  3CFL A;  3SER A;  1J1N A;  5KDT B;  3OEN A;  3G3G A;  4F1V A;  4ZE9 A;  4NE4 A;  2HFB A;  3RTF B;  4BDN A;  3C33 A;  4QSC A;  3SDF A;  5H8S A;  3VXB A;  4PE5 B;  3TCG A;  3EHS A;  1SYI A;  4YKJ A;  5CMK A;  4M4G A;  1ZLQ A;  2GHB A;  1US5 A;  3OSQ A;  4R2B A;  1I6Q A;  1MY4 A;  4RPO A;  4F22 A;  4H0W A;  1MQD A;  1FQE A;  4KCD A;  4XTC Q;  2OK2 A;  5AA4 A;  1FTM A;  3S9N C;  3UA8 A;  1BIY A;  1I6A A;  1XVY A;  4OYV A;  3OO8 A;  3L6H A;  1H43 A;  3VVF A;  2QS2 A;  3TCH A;  5H8F B;  5A5X B;  1AL3 A;  1N7X A;  1KWH A;  1XC1 A;  4WKM A;  3H6V A;  3ZKK A;  3LSX A;  3MVZ A;  4PFW A;  1PB7 A;  4OTE A;  1B3G A;  4JXI A;  2HXW A;  4GFR A;  2I49 A;  4DCX A;  4I8C A;  5CMB A;  3QIM A;  4U4X A;  4BDR A;  4R74 A;  4N6P A;  3V8X B;  1B32 A;  2AL5 A;  4MH5 A;  3UOR A;  2Z22 A;  3LR1 A;  1LFI A;  3E13 X;  3K6X A;  3G3I A;  3MP1 A;  3P7I A;  2DYX A;  2F5X A;  3V5A A;  1B1H A;  3MPK A;  2QS4 A;  4F19 A;  1Y4T A;  2X26 A;  2Y7I A;  3IB2 A;  3TTR A;  3HO7 A;  4QFN A;  4OEU A;  1Y1M A;  5ELV A;  4MF3 A;  4DZ1 A;  1A54 A;  3HST A;  1MM6 A;  1D4N A;  4PQJ A;  3T96 B;  4AB6 A;  3EN3 A;  2I6E A;  2P0S A;  1Y9U A;  3OOA A;  5ITP A;  1QKB A;  3JV9 A;  5AA4 B;  4XKR A;  1FTJ A;  1B3F A;  2ZYO A;  4ZZA A;  3W9V A;  3TOD A;  1JEV A;  1M5D A;  1JET A;  3C4M A;  2H99 A;  4Z7E A;  4ZEI A;  2DP8 A;  5I59 A;  2V25 A;  1B0L A;  2XX9 A;  4RK2 A;  1FCK A;  2RC8 A;  1B4H A;  1FQF A;  2Q89 A;  3MJN A;  3S2V A;  3SEX A;  4FIM A;  1URD A;  1LAG E;  2AL4 A;  3KSJ A;  4H5G A;  3H7M A;  1RYX A;  1ELJ A;  3HPI A;  1B40 A;  5DVJ A;  5AA3 A;  4AB5 A;  3K0V A;  5K2Y A;  5IAI A;  1OLC A;  2DS9 A;  3MVX A;  4KD5 A;  3IJX B;  3PUX E;  4NF4 B;  3VVE A;  2BJJ X;  4TQU Q;  1ANF A;  2FA7 A;  5DEX A;  4XKP A;  4P0I A;  5CRY A;  2O51 A;  5J1D A;  1MQJ A;  2O6A A;  2Y7P A;  3FZV A;  4YB6 A;  3VXC A;  3Q26 A;  1MDQ A;  2P1S A;  4LUB A;  2HZK A;  2PVU A;  4FEC A;  5H8H A;  1POT A;  3T9H B;  4ELR A;  2KLF A;  1FTO A;  3S4U A;  4UA8 A;  5CC2 A;  2UVJ A;  4ELP A;  1UQW A;  2O1M A;  3TTN A;  2HAU A;  5CI5 A;  1IXI A;  4OFJ A;  1FQA A;  3SES A;  1N3W A;  4U23 A;  4EUO A;  5KZT A;  1JNF A;  1EZO A;  2F97 A;  2Y7W A;  4H8J A;  3TTL A;  3TYH A;  5I2N B;  1H44 A;  1MQG A;  1UIU A;  2D5W A;  1N0T A;  4YU0 A;  3K2D A;  3Q25 A;  4LAT A;  2PBW A;  4RK9 A;  1PB9 A;  3FD3 A;  2HEU A;  4YKI A;  4DCY A;  3TQL A;  3FAS A;  1Y3N A;  2AYS A;  2XXW A;  3CI8 A;  3IAZ A;  5H8Q A;  3VLV A;  1L5T A;  4E0W A;  2ZYM A;  2Q88 A;  2XXR A;  3D4C A;  4R75 A;  4ZZE A;  1LFG A;  1MY3 A;  5K2X A;  2X7P A;  5ISU A;  3O6G A;  3KJT A;  4G4P A;  4WEP A;  5FHM A;  2A5T B;  4HCY A;  1EH3 A;  3FVG A;  1B9J A;  4BDQ A;  3RQT A;  1IXC A;  1S50 A;  1VE4 A;  2PMS A;  2XXY A;  4BDM A;  4ESW A;  4ZS9 A;  3ZKL A;  3FVN A;  5FHO A;  2M8C A;  5DVF A;  3KN7 A;  1JEU A;  3MWB A;  3ILT B;  3O29 A;  3I3V A;  1B1X A;  4I1D A;  2QS3 A;  4OET A;  4EF2 A;  3IB1 A;  4OHN A;  3R7X A;  1EZP A;  2B65 A;  1B4Z A;  3A3C A;  2R71 A;  1MY2 A;  1WVJ A;  1R9Q A;  3RTW B;  2OJT A;  3PMW A;  5I57 B;  4C1T A;  4RA1 A;  4NMY A;  4NED A;  1CE2 A;  1YCJ A;  2PT2 A;  2ZNU A;  3N5L A;  5FTH A;  1UIV A;  2XHD A;  1P99 A;  3QAX A;  3VLW A;  2F6G A;  4DXB A;  1HSJ A;  3TEL A;  5IKB A;  4ZEB A;  2DE3 A;  2XD3 A;  3H4Z A;  2UYF A;  3IOT A;  3K1M A;  2OWS A;  5TPA A;  3ZSF A;  1NFT A;  4OES A;  2V93 A;  3FVK A;  1SW2 A;  2V84 A;  4NWD A;  4XKN A;  4DXU A;  2ZNS A;  5JEI A;  2O7U A;  4LZ7 A;  3FJM A;  4IO5 A;  2F7B A;  2H5Y A;  5HBC A;  3U93 A;  3W9W A;  4DDD A;  3N94 A;  2PX1 A;  4PFY A;  5JTY A;  1MPB A;  2I0B A;  3O6I A;  1US4 A;  3TUS A;  3K6U A;  4ISU A;  5I56 A;  1OQH A;  1ZTY A;  1MM7 A;  4OWD A;  1GV8 A;  2I48 A;  3KJ7 A;  4QFL A;  2XD2 A;  3M3K A;  1IIW A;  1MXW A;  2RC7 A;  3OEL A;  4QRZ A;  5A5X A;  2GRV A;  5H8F A;  2H98 A;  1B3H A;  1LLS A;  3JZJ A;  3TAJ A;  4NF5 A;  1UTB A;  4L17 A;  3TKD A;  3QUJ A;  4LZ8 A;  1OIB A;  3OO7 A;  5AA2 B;  4KYS A;  1DPE A;  2I3V A;  4NF4 A;  1QKA A;  3OD7 A;  1IZ1 A;  2RCB A;  2X7Q A;  5ICQ A;  4LP2 B;  2F7C A;  2ZXT A;  4ND9 A;  1IQ7 A;  3E4R A;  2OCU A;  4G8M A;  3VVD A;  3SKP A;  1H3D A;  3CFZ A;  2XXT A;  4X1B A;  3TQW A;  5I58 B;  1A55 A;  3G3J A;  1FQD A;  3FUZ A;  3H06 B;  4TLM B;  3ZS6 A;  1LCF A;  1B05 A;  5DVI A;  3CIJ A;  3LSF B;  4C0R A;  1P1O A;  3ECR A;  2UVG A;  3I6V A;  3TDJ A;  3TTM A;  2REG A;  3MZ9 A;  4G68 B;  3MQ9 A;  3ODB A;  3PMV A;  2D3I A;  3C34 A;  1DPP A;  1NL5 A;  4POX A;  1LAF E;  2GFE A;  3IX1 A;  1O63 A;  2DVZ A;  1JW1 A;  1F9B A;  1SQY A;  4H6D A;  4KR5 A;  1AMF A;  4OEN A;  4R72 A;  3T9V A;  5CM6 A;  2XXI A;  1XT8 A;  3K1N A;  3UIF A;  4EQB A;  4Q0C A;  5I2K A;  2Y84 A;  3CG1 A;  4THI A;  2Z23 A;  3B6Q A;  1URS A;  2DE4 A;  3FGS A;  4HS7 A;  3WAE A;  5AA2 D;  5L9O A;  1QUK A;  2CMO A;  2RKM A;  1YPN A;  2ANJ A;  1I6B A;  2IA4 A;  2RF1 A;  3H6W A;  3R26 A;  1N76 A;  3FAT A;  3A3U A;  3N26 A;  4FJP A;  4RJZ A;  1OMP A;  3C32 A;  4YAH X;  3BKI B;  4YMA A;  3BFT A;  1NNF A;  2VD2 A;  1M5F A;  4X9T A;  3OO9 A;  1MXU A;  3FIR A;  3PUW E;  3G3H A;  1ATG A;  1LBC A;  4U21 A;  4GL0 A;  3TMG A;  1T0K A;  1XS5 A;  2Q2A A;  4FOR A;  4KI0 E;  3IOU A;  1Z7M E;  3KGC A;  3PPN A;  1MXY A;  4QFO A;  5TP9 A;  1GVC A;  1S7Y A;  1VR5 A;  2Y7K A;  3LUY A;  4U22 A;  2HQ0 A;  2NWJ A;  2V3U A;  1UTH A;  3FV1 A;  3OO6 A;  3SEV A;  3GBA A;  4FAJ A;  5JK4 A;  3Q29 A;  5L9S A;  4Q5T A;  4Z0I A;  4EDP A;  1B3E A;  1NH8 A;  5H8N A;  1JQF A;  2QRY A;  3DEL B;  4GF8 A;  1N84 A;  1BLF A;  3N6U A;  1TWY A;  1B5J A;  1OVB A;  2E0S A;  2F78 A;  3RN8 A;  2ESN A;  3E3K A;  4KFQ A;  4X1D A;  4YB7 A;  1BP5 A;  3KN8 A;  3IO4 A;  2Q9T A;  1XHY A;  2VHA A;  1NNT A;  3Q28 A;  1SDX A;  2O84 X;  2PYY A;  3JYR A;  4JB7 A;  5TP9 B;  3SET A;  3U1O A;  5HPQ A;  1AIV A;  3TFL A;  1P1U A;  3C9H A;  3VDF A;  3USD A;  4FAT A;  5BUU A;  2QJE A;  4XXU A;  2DVC A;  1Q35 A;  4GRK A;  3MW0 A;  3MP6 A;  5I58 A;  4FED A;  1PB8 A;  4LZ5 A;  3FV2 A;  2YPN A;  1MPD A;  4K3F A;  3EF7 A;  1MXV A;  1TFA A;  1Z7N E;  3PU5 A;  2QS1 A;  3H3G A;  2NUV A;  3K4U A;  1QUJ A;  4MBP A;  4QSD A;  2VD3 A;  2O7I A;  4R6K A;  1IXH A;  3T9X B;  2O69 A;  4F31 B;  4JWY A;  1R1N A;  1S9T A;  3GXA A;  3PV0 E;  3O97 A;  4GXA A;  2FNC A;  4NF8 B;  5KCJ A;  4EXL A;  4G77 A;  1NMU A;  5F1Q A;  2XXX A;  3H6U A;  1DTZ A;  4NF5 B;  2ABH A;  2Z8F A;  1P1W A;  2F36 A;  3O9P A;  3DLN A;  3S9M C;  3RT6 B;  1NKX A;  1D3K A;  1P1Q A;  4P0G A;  2DWI A;  4GQO A;  4F39 A;  4ONY A;  5F7V A;  4IO2 A;  5TPA B;  4Q30 B;  2QMW A;  4U2R A;  2QMX A;  3IOR A;  1EZ9 A;  1SW4 A;  2F7A A;  2R9J A;  3HHF A;  1XVX A;  1SD3 A;  3O6H A;  1SVX B;  3FJ7 A;  3V89 B;  1AOV A;  1BTJ A;  3K6W A;  2P2A A;  4YIC A;  2XXV A;  1MG1 A;  2A5S A;  2HAV A;  4YKP A;  1B46 A;  1O64 A;  3N6T A;  4IB2 A;  3T66 A;  3LSL A;  4LQ5 A;  5DTB A;  1Q1K A;  4M1V A;  4JDF A;  1LAX A;  3E9X A;  4NTL A;  3TTK A;  2DWJ A;  5HM4 B;  3LBS A;  4F2Q A;  3BFU A;  1HSL A;  2VP1 A;  3RLF E;  4EQ9 A;  1B2H A;  1ZU0 A;  2Y7R A;  1ZBM A;  1SW1 A;  4YKK A;  2B3B A;  3UGW A;  4DLD A;  4F3S A;  3PD9 A;  3K01 A;  1DTG A;  3MVW A;  4OMB A;  4O3C A;  3SEY A;  1B6H A;  4JWO A;  1CB6 A;  1H45 A;  2V3Q A;  2W7Y A;  3KOT A;  2DXR A;  2OBG A;  2G93 A;  2HZL A;  3T22 A;  4YMB A;  5AE4 A;  1B0H A;  2ALU A;  3IR1 A;  4H1X A;  3FXQ A;  4R73 A;  4RY1 A;  2F34 A;  3CSB A;  2ZYK A;  3OEK A;  4PET A;  3CRB A;  2ONK E;  2V3T A;  1JVY A;  3TPA A;  5L9M A;  5B70 A;  4U1O A;  1SI1 A;  3EHT A;  1PDA A;  3F11 A;  4XKQ A;  1B7H A;  3UP9 A;  2DWH A;  4JBZ A;  2OWT A;  3G7W A;  3S9L C;  1WOD A;  5ITO A;  5I2N A;  4R6Y A;  3MUQ A;  3VV5 A;  4YZZ A;  4U4S A;  4IGT A;  1N04 A;  1PEB A;  4ESX A;  1ZIU A;  3L6G A;  4YB5 A;  2I58 A;  2VOZ A;  5EYF A;  5FHN A;  4F29 A;  1OLA A;  3C31 A;  3MPL A;  1PBP A;  3OMB A;  4MLQ A;  3MP8 A;  2G29 A;  3AXF A;  3FVO A;  4GVO A;  5H8Q B;  3IK6 B;  2O68 A;  3KEI A;  1B58 A;  3CR9 A;  2WKY A;  3IJO B;  2NOO A;  3PMX A;  1D9V A;  1SW5 A;  3PUV E;  1HSE A;  4GXS B;  1M5C A;  4OXV A;  4DIG A;  3RPW A;  5CBR A;  5I56 B;  3EQ1 A;  3PGF A;  4ZEF A;  4F3G A;  1LFH A;  1FTL A;  5CMM A;  5I57 A;  4LA9 A;  4ZEK A;  1FW0 A;  1BKA A;  1XOC A;  2OZZ A;  4LVQ A;  1JW4 A;  1ZMG A;  2LAO A;  3G3F A;  4KYD A;  3PPP A;  2Q8J A;  1LB8 A;  1MY0 A;  1Y20 A;  2AIX A;  3HV1 A;  2QL3 A;  2I4B A;  2YLN A;  2YJP A;  4TOZ A;  5H8H B;  3B6T A;  3K1P A;  4ZEC A;  3C36 A;  1IEJ A;  4ECF A;  4BDL A;  3V83 A;  4U1Z A;  1JW5 A;  1USY H;  3KG2 A;  3QYT A;  4DXC A;  3M3F A;  3GLB A;  4FEB A;  3THI A;  3PD8 A;  4HTG A;  2I0C A;  4OVJ A;  5DEX B;  1A7L A;  2QPQ A;  1LAH E;  1MXX A;  3UN6 A;  1WDN A;  5FTI A;  4NF8 A;  4R9F A;  2E1S A;  3DP6 A;  3KOS A;  3W15 C;  1MQI A;  3QK6 A;  4IO6 A;  4QF9 A;  4QSE A;  1B51 A;  4KYE A;  2DOJ A;  1LGB C;  2UVH A;  2XXU A;  3MVY A;  3U94 A;  4I62 A;  1B7U A;  3PPO A;  3B7D A;  4G8H A;  3QUF A;  2Z8E A;  4NWC A;  2B3F A;  2ONS A;  3VFJ A;  4DE8 A;  2FYI A;  1N3X A;  5CMC A;  1QUI A;  1QUL A;  1UTH B;  3B6W A;  1IXG A;  4EF1 A;  2XXH A;  4HW8 A;  4UAC A;  4I9D A;  1R9L A;  2F6P A;  3M8U A;  4WED A;  4MLV A;  1VFD A;  1OVT A;  4G68 C;  4ZDM A;  2O1L A;  2RIN A;  4GLI A;  4QFK A;  3U72 A;  2A5T A;  4QHQ A;  4ELQ A;  3PUY E;  1B5I A;  1LB9 A;  2F8D A;  1QJM A;  4H5F A;  4Q8R A;  3U92 A;  1LCT A;  2I4C A;  4G8N A;  1QW0 A;  4TLL B;  4F1U A;  4IY5 A;  4N07 A;  3CFX A;  4PFU A;  3GZG A;  2ZYN A;  3K00 A;  2RCA A;  3A09 A;  4F1Y A;  1MS7 A;  5H8N B;  1R6Z A;  1ZKB A;  4LQ2 A;  3MAM A;  4FE8 A;  3T9U A;  3IO6 A;  1AH5 A;  2UYE A;  2XXQ A;  3KBR A;  5M2V A;  5CBS A;  4H8I A;  3KSX A;  4F2O A;  3O66 A;  1MXZ A;  3MBP A;  3MZ1 A;  4ZE8 A;  1IUD A;  2XXP A;  3IL1 B;  1TXF A;  2H4I A;  4H67 A;  4IGR A;  2DWA A;  4RNS A;  1A99 A;  3HN0 A;  1B3L A;  1A40 A;  2UXA A;  4KHZ E;  3HHG A;  1DMB A;  3D4G A;  3PUZ E;  4GD5 A;  4JSD A;  2IEE A;  1ZJL A;  2I3W A;  3CG3 A;  3RY3 A;  1MRP A;  4MFI A;  4POW A;  4EQ7 A;  1RKM A;  3VLU A;  3EHU A;  1MDP 1;  3O2A A;  3DM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...