3ECRA

Structure of human porphobilinogen deaminase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
339
structure length
318
Chain Sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLECSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into acute intermittent porphyria.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 101
structure length 318
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3ecrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA02
3H4ZA 3CI8A 3K4UA 3K1PA 3TTRA 3RT6B 4C1TA 4DDDA 3S9NC 4NF4A 4U2RA 3E9XA 2Z22A 1MXWA 1FW0A 4DZ1A 3PV0E 4EF1A 4EUOA 4LQ5A 3SEYA 4HCWA 1VE4A 3G3FA 3UA8A 3VLUA 3KSJA 1NH7A 5H8QA 4G68A 1Z7NE 1PB8A 2B3FA 1QUKA 3C35A 3C34A 4Q0CA 3TKDA 1P1OA 2F7AA 4GL8A 3FVOA 2UVHA 5J1DA 1ZU0A 3K6UA 3M8UA 1IXHA 3RN8A 4YKJA 2H5YA 1B7UA 1LBBA 3TODA 5JTYA 1NH8A 2Z8EA 1HSJA 2P2AA 3PUWE 4U21A 1PB9A 2V3UA 2F5XA 3Q27A 1MY1A 1VR5A 1XT8A 4KYSA 1MRPA 3TTLA 3U93A 4XKNA 1B0HA 5BWJA 4DIGA 4POWA 4C0RA 2D3IA 1AOVA 3FXUA 3WAEA 2UXAA 3SEXA 3BKIB 2I49A 2V25A 1OMPA 1USYE 3OO8A 4RYAA 2DWIA 4F3PA 2LAOA 1FTMA 2Q9TA 2QS3A 3FJ7A 3SKPA 1JETA 1ZBMA 4DLDA 4F2QA 4JWXA 3FGSA 1EU8A 1SYIA 3IOWA 1XVYA 3FV1A 4Z0IA 3T9UA 3FJMA 1IXGA 4PQJA 2O69A 1LCTA 1LB8A 1JQFA 4RPNA 1RYOA 3VLWA 1ELJA 1GR2A 1DTGA 1UTBB 3CG1A 5I56B 2QPQA 1GGGA 4IGTA 4QFLA 2DYXA 2QSXA 3OENA 2REGA 3OO7A 5L9SA 1B6HA 3QYTA 2XXXA 1IXCA 1EZ9A 1N7WA 3ZKLA 1PBPA 5FHMA 4WXJA 4F22A 2P0SA 1ZLQA 2HCAA 5TP9A 3TTMA 3IOVA 5CC2A 1MXZA 3Q26A 3DP6A 3K0VA 1I6QA 4P0IA 1Y9UA 2F78A 4ZZEA 5A5XA 3FVGA 1A8FA 2E1SA 2I58A 3CIJA 3OMBA 3PUYE 1HSLA 3EHUA 3GZGA 3K00A 3MP1A 5H8FA 1N0TA 5AA4A 3IJXB 2DE3A 4FECA 5KDTA 1H43A 4FJPA 3R6UA 4JSOA 3EHTA 4WEDA 4FAJA 1A99A 3CVGA 4TLLB 3I6VA 5EHSA 2H9BA 5HPQA 2HXWA 2M8CA 2RINA 5A5XB 1B58A 1B3FA 2OJTA 2IA4A 3IO6A 3SEVA 3KEIA 5KCJA 1DOTA 4M4GA 4XKPA 2F36A 2QS1A 3W15C 2ONKE 5DYHA 4HS7A 4R6HA 2ABHA 1KWHA 5KDTB 2Y7RA 4OXVA 1B52A 2OZZA 4N07A 1MQIA 5EYFA 3UP9A 5JEIA 3HO7A 2I3VA 2DWJA 4MF3A 4DXCA 4X1DA 1OIBA 3ILTB 3K1NA 5DTBA 5I2KB 1FTKA 3AXFA 1B0LA 4KCDA 1B51A 1FQFA 2DP8A 2ONRA 1SW5A 4P0GA 1MM7A 3VVFA 2I0BA 3DLNA 1DSNA 1NNTA 5F1QA 2GHBA 4QSDA 4MBPA 3TMGA 3RTFB 2XXPA 4ZZAA 3RQTA 3HHGA 2AIXA 3A3UA 4R2BA 1XS5A 1AL3A 1MY4A 3BFUA 1JVXA 3OSQA 4GFRA 3PD9A 3C36A 3T96B 3C4MA 2RCAA 1OLCA 3QSLA 3SEWA 2ANJA 1IEJA 2F35A 3C9HA 3FV2A 3IX1A 4RXLA 4NF5B 4H1XA 4H8IA 4G4PA 1POY1 1B5HA 1MY3A 1PB7A 2RC8A 4IB2A 1MPDA 1WDNA 5AA2D 4RA1A 1MQDA 5I58A 4OYVA 2XX7A 4LZ7A 1BIYA 3CRBA 1H45A 4GOTA 4PFUA 3K6VA 2B3BA 3D4CA 4I8CA 1XHYA 2NWJA 4EQBA 1JW5A 3A09A 3IB0A 3IB2A 5DT6A 4BDLA 3RGYA 4ESXA 2REJA 2DSFA 3N6TA 3K6XA 5M2VA 4Q30B 4WKMA 2G29A 3TDJA 1P1NA 2AYSA 3JV9A 4G8HA 2NVUB 4ELRA 4FIMA 1URGA 4YB6A 3TPAA 3O29A 1YPNA 1TFDA 1ATGA 3KOTA 1B3LA 4QFKA 2I0CA 2RF1A 3VE1B 1NMUA 1B5IA 1RKMA 3ODBA 4JBZA 3T93B 1D9VA 1VFEA 4DCXA 5IKBA 1SDXA 3HCQA 5DEXB 1ZJLA 3ZSFA 3OEMA 1N76A 4G8MA 4GQOA 4HCYA 4KD5A 4R2FA 2VHAA 3SETA 1GVCA 3VVEA 3IOTA 2OLBA 3T9XB 2CMOA 4H67A 5F7VA 3UIFA 1VSOA 3W9WA 4BDMA 4X48A 4EXKA 1EZPA 5EHMA 4XXUA 2Y7IA 5H8HA 1FTJA 3HHFA 1B9JA 2GRVA 4X9TA 1FQEA 4OENA 4OMBA 3BBRA 1FTOA 2DVZA 1M5EA 3PMWA 4R9FA 2UVJA 3RNNA 4ZE9A 1MDQA 1L5TA 1AIVA 1OVTA 3G3HA 1RYXA 1UIVA 2DE4A 4IO7A 1PC3A 2P1SA 1JW1A 2YJPA 4OEVA 1D4NA 2Q2AA 3LUYA 2HEUA 4OTEA 3CSGA 5H8SA 5H8HB 3VLVA 3V83A 1CB6A 3PMXA 2W7YA 4ESWA 3KG2A 1USYH 3N26A 4NF8A 3IB1A 4EXLA 4OETA 5CMBA 1PBQA 5CRYA 4F1YA 4N6PA 4KYEA 3V89B 3TQLA 4JXIA 4Z7EA 2F34A 3V8XB 4XTCQ 1ZMGA 4ZS9A 2H4IA 3M3KA 3TYHA 1S7YA 4G68B 3H03A 2F7BA 4ONYA 4R6KA 2UYFA 3MZBA 2HAUA 2OCUA 1P1WA 5CMMA 4HW8A 1VFDA 4KQPA 3T22A 4P11A 3OOAA 3LR1A 5DVJA 2VOZA 1GV8A 4MLQA 2HAVA 2ZNSA 4G68C 2ZYOA 4IO4A 3VVDA 3IO4A 1P1UA 3ONMA 1R9LA 1MY0A 1XC1A 4TLMB 1QKAA 3E4RA 1Y4TA 4F1UA 4I1DA 3PPQA 1LAHE 1D9YA 3G7WA 1FQAA 2DQVA 1MXVA 2OWSA 5HBCA 2XD3A 3C33A 3RTWB 2PYYA 2CZLA 3T66A 3OEKA 1LFGA 2ONSA 4U1OA 4H6DA 2F7CA 2XXHA 1DPEA 1N3XA 3T9VA 4EF2A 5H8NB 1B5JA 3B7DA 4THIA 4H65A 1M5DA 2RC9A 2NXOA 4F1VA 4H5FA 4IO6A 1MPCA 1OQGA 3K6WA 1A7LA 5I2NA 5CM6A 3O66A 3ILUB 1B4HA 2Y7WA 3KN8A 2THIA 4H8JA 3MWBA 4JSDA 3H06B 2DWHA 4KYDA 2ZYMA 2DS9A 4TQUQ 4IY6A 4NWCA 4ZEBA 2OBGA 1LFHA 3KFMA 4U22A 4AQ4A 4QSCA 3MZ1A 4JWYA 1S9TA 1ZKBA 3H6UA 1Q35A 5AA4B 4YKIA 2H98A 4GF8A 3S4UA 3R7XA 3TAJA 1IQ7A 3GXAA 2BJJX 3PUXE 1SI0A 3LSLA 2DWAA 3TCHA 4RY1A 1BKAA 1MQHA 2Q2CA 1EZOA 4IGRA 4LA9A 1JNFA 1MXUA 3S2VA 3MC2A 4EQ7A 4ZEDA 2XX8A 2H99A 3UORA 4IO3A 1Y4CA 3HSTA 3T9HB 4R9GA 1BP5A 2XXTA 3HPIA 4ISUA 3CG3A 5FHNA 5AA3A 1MM6A 1FQDA 3RPWA 2XX9A 2V93A 4YU0A 3VDFA 3GLBA 4RK9A 3PU5A 3MP8A 2VD3A 4IY5A 5ISUA 2YPNA 1UIUA 3I5OA 3KZGA 1M5FA 4YKPA 1A40A 2QMXA 1NNFA 3IJOB 5KCJB 1TXFA 5LOMA 2HFBA 3JYRA 1B3GA 4KCCA 4BDRA 4OHNA 4R72A 2F97A 2FYIA 4NWDA 1SBPA 3HN0A 1XOCA 2XXUA 3K1MA 2R71A 2F6GA 3IK6B 3EF7A 4OESA 1F9BA 1MQGA 3EN3A 4OWDA 5AA2B 3ECRA 3KBRA 2OK2A 5TU0A 3U72A 1BLFA 2AL4A 2O7UA 3MQ9A 2Z8FA 4GXSB 3IR1A 1B7HA 2X7QA 3GBAA 4YAHX 4YICA 3LSFB 4LQ2A 2QJEA 4DCYA 1B2HA 4HTGA 1I69A 3UK4A 3FJGA 4OFJA 3UGWA 5I2NB 1WVJA 1US5A 1B05A 2DXRA 2I3WA 4JB7A 4OQOA 3QUJA 4WEPA 2Q8JA 2UVGA 3H6WA 2GHAA 3PPOA 4KFQA 2V84A 3LBSA 1B3HA 1SI1A 4X1BA 5H8FB 2ZXTA 4XKQA 2DXYA 4BDNA 3FATA 3MVWA 3F11A 3N5LA 3TTKA 3O9PA 4XKRA 4F39A 4EDPA 3MJNA 1ZTYA 4U4XA 4ZECA 1US4A 1Y3NA 2DVCA 5FTHA 3FVNA 5I59B 1YAEA 3KGCA 3KJ7A 1Y20A 5B7DA 1URSA 2G93A 3A3CA 1O64A 4LZ5A 2FNCA 3KN3A 4ECFA 1IZ1A 4RPOA 1B3EA 4IO5A 4U4SA 1B46A 2UYEA 3B6TA 2NUVA 4QF9A 2Y84A 1QKBA 2FA7A 2B65A 3KOSA 3RT8A 4U1ZA 5CMKA 1P1QA 3FZVA 5ELVA 3S9LC 1I6AA 3BFTA 1Q1KA 1SW4A 3Q28A 3TEPA 1I6BA 4Q8RA 1B7ZA 1IXIA 2HQ0A 1SD3A 1LBCA 2A5TB 2GH9A 4ZEKA 4YMBA 2HZLA 1B1HA 2F8DA 4DXBA 2IEEA 4KR5A 2PBWA 3H7MA 1N04A 2XXWA 1LAGE 3OO9A 1OQHA 4GIZA 1P99A 4ND9A 2XD2A 3H3GA 5L9MA 4G77A 4I62A 5B70A 4OZ9A 5TPAA 1QJMA 3G3IA 4M1VA 5BUUA 2PMSA 4QFPA 1M5BA 2V3QA 3G3KA 1OLAA 2PVUA 4QRZA 2F6PA 3KSXA 2VP1A 4F18A 4NF4B 1OVBA 2VGQA 2ZYNA 1NNKA 3OELA 1B4ZA 4GL0A 3SERA 1SW2A 3TELA 1FCKA 3QAXA 2QS2A 3QUFA 4MFIA 5I2KA 5KZTA 2Q88A 1SYHA 2ZNTA 3U8QA 3G3GA 3EQ1A 2E0SA 3OXNA 2Z23A 3Q25A 4K3FA 4AB6A 1IUDA 4FE8A 1UTHB 3LSWA 4TOZA 5I57B 1B40A 3KN7A 4KPTA 4NTLA 5AA2A 4YB5A 1H3DA 3TZAA 2QMWA 1D3KA 5I58B 5TP9B 4MH5A 4F3BA 1T0KA 3PPPA 2Y7KA 4H5GA 4H0WA 3C32A 2NOOA 4NE4A 3MVXA 3PPNA 5K2XA 4BLAA 3DP8A 4O3AA 4F19A 2I4CA 1YTVA 1N7XA 1ANFA 3VXCA 1PEBA 3O2AA 4O3CA 5FTIA 2OWTA 4FEDA 4EQ9A 3QXMA 1XVXA 3MW0A 1R9QA 1N3WA 4BDQA 4F29A 4ZEIA 1QW0A 4OFLA 3RY3A 1NL5A 5CBRA 3CFZA 2ZMBA 5ITOA 4KI0E 2O68A 4YKKA 3THIA 5DVFA 1MG1A 1DTZA 1MH4A 3MUQA 4PETA 3TFLA 5HM4B 1UTBA 3P7IA 2H25A 2Y7PA 1PDAA 3FD3A 3M3FA 3FXRA 4G2ZA 3VXBA 3ZKKA 4PP0A 2Q89A 3ZS6A 5CI5A 1B1XA 1II5A 2VD2A 3USDA 3SESA 5I59A 4OFOA 2QL3A 4C1UA 1Y3QA 1CE2A 4R73A 1LLSA 2D5WA 3QIMA 1AH5A 2O51A 4NF8B 4PFWA 1QUIA 3RLFE 2ZNUA 4NF5A 3LSXA 1LB9A 1URDA 3CFLA 1HSEA 1JVYA 3B6QA 4LUBA 2O1LA 3DP4A 1GTKA 5CMCA 3MZ9A 4L17A 2GFEA 3R26A 1NNPA 1A55A 4OERA 1MY2A 3K2DA 3OSRA 3PGFA 2X7PA 1TWYA 3L6HA 3PPRA 1B32A 1LAXA 1R6ZA 4LZ8A 3TUSA 3MP6A 4LVQA 1BTJA 2QS4A 3OD7A 5DVIA 3UN6A 4FATA 3I3VA 3O28A 5IAIA 3RUMA 4AB5A 4U23A 2A5TA 1WODA 2O1MA 2DOJA 2PX1A 3B6WA 4LONB 4R74A 1MS7A 4UACA 3MAMA 4E0XA 4F31B 1ZIUA 4R6YA 1SVXB 3FVKA 3K02A 3QK6A 1O63A 1AMFA 3U94A 1MXXA 5TPAB 3PUZE 1SQYA 4ELOA 4GWOA 4F3GA 5AE4A 5I56A 1MXYA 4QFOA 3S9EA 1DPPA 3H6VA 4E0WA 1EH3A 3EHSA 1MDP1 5JTYB 1TT1A 2V3TA 4FEBA 4JWOA 5FHOA 3MVZA 3N94A 4ZEFA 1LGBC 2UVIA 2ZYKA 4DE8A 4GD5A 1JEVA 3IOUA 2DE2A 1LSTA 2HZKA 1SW1A 1Y3PA 4OEUA 5I57A 1LAFE 1JW4A 3EPEA 3MPKA 4PFYA 4RK2A 5H8NA 1S50A 5DEXA 1N84A 5AA1A 1Y1MA 4LATA 4KHZE 4I9DA 1QULA 4RJZA 2R9JA 5L9OA 1FTLA 2WKYA 2XXIA 3W9VA 1LFIA 1IITA 2PT2A 1JEUA 1MPBA 2KLFA 3LC8A 3TCFA 3E3KA 4IO2A 2RC7A 4FORA 1H44A 3PMVA 4RNSA 2PT1A 3O6HA 3CSBA 2ALUA 4PE5B 4YB7A 4NF6A 2RKMA 3DELB 1UQWA 4OVJA 2I4BA 3V5AA 3FIRA 1QVSA 3FUZA 3N6UA 2A5SA 3IAZA 4F2OA 3S9MC 4NMYA 3D4GA 4YMAA 3OO6A 4O3BA 3PUVE 4NEDA 3IL1B 3MVYA 5H8QB 3WAFA 1TFAA 2XXYA 3FXQA 3H6TA 3M3LA 4Q5TA 2QRYA 1DMBA 2O6AA 2R6GE 2RCBA 4GLIA 4LP2B 1IIWA 3O6IA 2XHDA 4NF6B 1POTA 3KJTA 3PD8A 4DXUA 4POXA 4ZDMA 5ICTA 2AL5A 1FQCA 1J1NA 1Z7ME 3HV1A 4R75A 5ICQA 1NKXA 3JZJA 5I84A 1A8EA 3DM0A 3G3JA 3CFXA 1H76A 1UTHA 2Z8DA 1NFTA 3Q29A 3O97A 4ELQA 2X26A 4MLVA 3MPLA 2YLNA 4QSEA 1M5CA 3SEUA 3U1OA 4GVOA 5JK4A 1O7TA 3SDFA 3FASA 1MQJA 3IORA 4ELPA 1R1NA 2D21A 4GXAA 4PFTA 1MH3A 3E13X 1YCJA 3L6GA 3O6GA 2O84X 5L8DA 3U92A 4QHQA 4F3SA 1FQBA 2ESNA 4GRKA 2XXVA 2I48A 3K01A 4XIGQ 5K2YA 5CBSA 1QUJA 4BDOA 5ITPA 4G8NA 4JDFA 4QFNA 4N13A 4ZE8A 1LCFA 4UA8A 2XXQA 2XXRA 3MBPA 3TCGA 3TTNA 2I6EA 3GBBA 1A54A 3C31A 3VFJA 4YZZA 3CR9A 3TQWA 1Y1ZA 3VV5A 2O7IA
chains in the Genus database with same CATH superfamily
4ZYHA 4BC9A 3RT6B 4DDDA 2H36X 1N34E 2Z22A 2DB2A 4DZ1A 4EUOA 5KL3A 2VPNA 5A6KA 1NH7A 1Z7NE 1PB8A 2B3FA 1QUKA 3C34A 1P1OA 2UVHA 1A1FA 4YKJA 4DUYE 4PAKA 1NH8A 1HSJA 3PUWE 4U21A 2V3UA 4I3EA 3TTLA 1VR5A 1XT8A 4P56A 3U93A 4XKNA 4I40A 4BS9A 4WSGA 1YXIA 4DIGA 1YYKA 3BKIB 2I49A 4JI3E 1OMPA 4F3PA 2DWIA 2Q9TA 3FJ7A 3SKPA 4JWXA 2BJIA 1EU8A 3T9UA 1IXGA 1ZR9A 2JP9A 2WEFA 3NOHA 4NG7A 1RYOA 1GR2A 1FPGA 4IGTA 5L9SA 3QYTA 1RDZA 1EZ9A 1N7WA 4F22A 2P0SA 3FIGA 5IZZA 2F8BA 5A5XA 4DI4B 4JSOA 5IZ3B 4FAJA 1A99A 3CVGA 2M8CA 2OJTA 2N3GA 3IO6A 3BF2A 4M4GA 4XKPA 4GBVA 4HS7A 4GEQB 1KWHA 2Y7RA 1B52A 2OZZA 1MQIA 5JEIA 3HO7A 1OIBA 3AXFA 3VVFA 3GYYA 4QSDA 1YUIA 3RTFB 4N8GA 1J26A 1MY4A 3PD9A 2XWKA 1OLCA 2ANJA 1IEJA 3FV2A 4H1XA 4O5GA 4G4PA 1PB7A 5KL4A 4LZ7A 4KXPA 3CRBA 1LLMC 3K6VA 3D4CA 4I8CA 2ELYA 4EQBA 3A09A 4BDLA 2EOMA 2ADRA 2NVUB 3TPAA 1YPNA 1TFDA 2EM4A 1B3LA 2HC5A 3VYYA 3K6QA 4QFKA 2I0CA 4DCXA 1B5IA 3ODBA 3ZSFA 4F9BB 3SETA 4KD5A 4R2FA 2VHAA 2OLBA 2CMOA 4XXUA 5H8HA 1UBDC 4N15A 2GRVA 2GQ1A 2B7VA 3RNNA 1MDQA 1FPJA 1L5TA 4IO7A 4P9KA 2YJPA 4OEVA 5H8SA 1NCSA 4OTEA 3CSGA 1LBVA 2FTXB 1USYH 1IBKE 2F34A 3V8XB 4XTCQ 4ZS9A 2H4IA 1S7YA 4B3RE 3MZBA 3JAMC 2HAUA 4KQPA 4P11A 2KOUA 4JI7E 2VOZA 4HE0A 4OANA 3VVDA 1MY0A 1LAHE 4PDDA 3G7WA 2DQVA 1MXVA 3MSWA 5AE3A 3C33A 2CZLA 1LFGA 1CNQA 2CTDA 4QXDA 5I7IA 2EN2A 4IO6A 1OQGA 3E79A 1NEIA 4H8JA 4JSDA 2DWHA 3RPLA 2YTEA 2GHFA 1EH7A 4Q28A 1LFHA 4LN5A 1ZKBA 5AA4B 4YKIA 1G0IA 3IWDA 4RY1A 2Q2CA 1MQHA 5AE1A 5FBPA 4EQ7A 2M7QA 3C4BA 4IO3A 2XXTA 3EPHA 2NUEA 2V93A 4YU0A 4MHFA 2VD3A 2YPNA 4YKPA 3EPLA 3I5OA 3KZGA 2FGGA 5LOMA 3DJWA 2QVRA 1SPIA 2F97A 2V86A 4NWDA 1SBPA 3K1MA 2XXUA 2R71A 3IK6B 3EF7A 1SR9A 3ECRA 3U72A 1FPIA 2AL4A 2X7QA 3LSFB 3H09A 4DCYA 4HTGA 3UGWA 1US5A 1IMBA 1B05A 2DXRA 3QUJA 2UVGA 3M99B 3H6WA 2EPNA 1B3HA 4X1BA 1AWBA 4XKQA 4BDNA 3MVWA 1ZTYA 2EM6A 1Y20A 1URSA 2G93A 4LZ5A 1B46A 2WBTA 3B6TA 4J8ZA 2NUVA 2KQZA 1I6AA 3BFTA 3Q28A 1I6BA 4GWUA 5F24A 1X49A 2LCEA 4DXBA 1KZ8A 2OWZA 2PBWA 4GIZA 1P99A 2VF1A 4I62A 2EMKA 1QJMA 2NABA 4QFPA 1M5BA 3G3KA 2EPZA 4WX9A 1JK1A 2F6PA 3KSXA 4F18A 3OELA 2B4MA 4MJOA 3TELA 1FCKA 2LRSA 4MFIA 2MDGA 3U8QA 2E0SA 3OXNA 4TOZA 4KPTA 4PTKA 2ZZVA 4PF6A 2Y7KA 2VQFE 2NOOA 5K2XA 4F19A 2NA2A 1N7XA 4H45A 4O3CA 1IMEA 2OWTA 4FEDA 4KHPE 1R9QA 1HNXE 1YZ0A 4ZEIA 3RY3A 2EPLX 3KWRA 2QFLA 4OVQA 3IWBA 2O68A 4P1EA 5DVFA 3FXBA 1PJQA 1MH4A 4LFBE 1NV0A 5ESYA 1UTBA 3P7IA 2H25A 4G2ZA 2EOIA 4PP0A 3ZS6A 2FHYA 1II5A 4M0VA 5I59A 2UXDE 4F9CB 3U65A 1AH5A 1FJ9A 2YSOA 3B6QA 4O7MA 3DP4A 1GTKA 4L17A 1XMQE 1NNPA 4Q30B 1TWYA 2E72A 3PPRA 1LAXA 3HPZA 3EKIA 3MP6A 4LVQA 5DVIA 3OD7A 1KJKA 1NUYA 1DGCA 2O1MA 4R74A 4G61A 2CT1A 4F31B 1O63A 2VRDA 3U94A 1MXXA 4PFBA 5J16A 2EPMX 4GWOA 4AQYE 4QFOA 1DPPA 3S9EA 3EHSA 2V3TA 4JWOA 5FHOA 5CFFE 3HQ1A 2B4LA 1SW1A 4OEUA 3MPKA 3EPEA 4PFYA 1N84A 2EWLA 2EMIA 4LATA 4I9DA 2R9JA 4B3TE 2PT2A 1EH8A 3PMVA 3MHHC 4ZYEA 4MNIA 3O6HA 4L5NC 2ALUA 3DELB 4OVJA 2LVHA 3FIRA 2JJKA 2LT7A 2A5SA 3D4GA 3OO6A 3MVYA 1TFAA 3H6TA 4Q5TA 2R6GE 4OFOA 4DXUA 4IJDA 1IIWA 1POTA 4POXA 1Z7ME 3BIDA 3JZJA 5IWAE 5I84A 1FBHA 2WX9A 3DM0A 2YRKA 1H76A 1UTHA 2CZIA 2Z8DA 3LV0A 2YLNA 2LO3A 3SEUA 3FASA 3T0JA 4PFTA 1MH3A 3E13X 5CBSA 1FQBA 4GRKA 2XXVA 1PJTA 1FPFA 2EMCA 4GBWA 4F2JC 4GX3A 1X6HA 1J5EE 3C4TA 1Y1ZA 5AA2B 2IHR1 3H4ZA 5IT9C 3S9NC 4NF4A 4RHBB 4U2RA 1MXWA 4NHRA 4PAFA 3SEYA 1VE4A 4MIJA 5ET7A 3UA8A 4GX6A 3C35A 1UILA 4MCOA 1FRPA 2ELZA 1XI6A 3K6UA 4DMIA 1IXHA 3C6KA 1B7UA 3UK3C 2P2AA 1PB9A 3HFUA 2F5XA 3Q27A 2EMYA 5BWJA 4C0RA 2UXAA 2V25A 2DSYA 2LAOA 1ZBMA 4DLDA 4LF4E 3FGSA 1XVYA 5LDZA 2O69A 2YTFA 3SZPA 5EQAA 4DR4E 3CG1A 5I56B 2QPQA 2QSXA 2YRHA 2DMIA 1IXCA 2WCC3 5FHMA 4GZNC 2KONA 3K0VA 3C6MA 1Y9UA 2E1SA 3E78A 3GZGA 2EOQA 1N0TA 3L00A 4HEIA 3I6VA 5EHSA 2H9BA 2RINA 1B58A 5KCJA 1DOTA 2ABHA 5KDTB 4OXVA 4N07A 5EYFA 3UP9A 4MF3A 1FSAA 4X1DA 3ILTB 3K1NA 1B0LA 5KL5A 2ONRA 2LTSA 1MM7A 2I0BA 4O43A 5F1QA 1NV6A 3RQTA 4R2BA 1XNRE 4GFRA 2DRPA 3C4MA 2RCAA 5EYGA 3C9HA 2JYAA 3ADLA 1YYOA 4I8OA 4H8IA 4I3YA 1MY3A 4RA1A 1MQDA 4PFUA 1H45A 2B3BA 1G2FC 2JXPA 2LJHA 2REJA 4NX1A 1X6EA 2G29A 4WKMA 2L33A 2AYSA 3JV9A 5A6JA 4B3ME 4FIMA 1URGA 4PC9A 1NV3A 4YB6A 3O29A 3KOTA 5EQ9A 2RTXA 2LMZA 1N36E 1NMUA 1RKMA 1D9VA 2A25A 1SDXA 3FBPA 1ZJLA 5IV8B 3OEMA 4GQOA 5A2QC 3W9WA 4EXKA 4F3GA 1NV2A 5EHMA 1BK4A 2YZTA 2Y7IA 3HHFA 4X9TA 3BBRA 2CPNA 2HGHA 2DVZA 4O7IA 2ENAA 4JVIA 1OVTA 1PC3A 3T1YE 1GQEA 2RSIA 1CB6A 2EMZA 1TF3A 4ESWA 2EMHA 3KG2A 3N26A 4OETA 5CMBA 1DI2A 4N6PA 3V89B 3TQLA 2CEXA 1ZMGA 2E5LE 2YRMA 3KC1A 3TYHA 2UYFA 4NZVA 4BMJA 4GWSA 1F2IG 4IO4A 2MKZA 3E4RA 4F1UA 1D9YA 4IS1C 1FQAA 4WSPA 5HBCA 4YY3E 5IGAA 2XD3A 3RTWB 3BBGA 3OEKA 2ONSA 1DPEA 4DR3E 2N3HA 3B7DA 1A1GA 4THIA 4F1VA 2NXOA 2YTOA 4P8BA 1MPCA 4YHHE 1A7LA 3O66A 4MX6A 2EM3A 4NAPA 2EPOA 2THIA 2EMFA 4F6MA 1XMOE 3MZ1A 1Q35A 2H98A 3R7XA 3GXAA 3LSLA 2DWAA 2EMGA 4LA9A 1JNFA 1MXUA 3S2VA 3MC2A 1ZU1A 4ZEDA 2H99A 1FBFA 1Y4CA 3MSTA 3VHTB 1N32E 3GLBA 4RK9A 3MP8A 1RDYA 5AC5A 4IY5A 4WXDA 2ZZXA 1A40A 3JYRA 4KCCA 4OHNA 3ZKKA 1XOCA 2F6GA 4OWDA 5HPQA 3EN3A 2DLKA 1F9BA 2CZHA 4P7DA 2EOEA 1BLFA 4DV2E 2O7UA 1QU6A 3MQ9A 1HNZE 4NN3A 4GXSB 3IR1A 4YAHX 4LQ2A 2QJEA 5IZ1A 1I69A 3UK4A 4OFJA 2JWOA 1WVJA 1HNWE 4JB7A 2K4VA 4N91A 3F6GA 2Q8JA 1X6FA 3BGHA 4KFQA 5H8FB 2ZXTA 3F6HA 4OX9E 3OTOE 4N4UA 2UU9E 3TTKA 3F11A 3O9PA 1FPKA 1A1LA 4XKRA 4U4XA 5I59B 1O64A 2FNCA 2UXBE 2CZKA 4QBAA 2Q8UA 5AE2A 1QKBA 3BIGA 1NUXA 1T38A 1Q1KA 2RSMA 1LBCA 2GH9A 2HZLA 2IEEA 3H7MA 1LAGE 4ND9A 2XD2A 4G77A 2JR1A 1LBXA 2WYKA 3J7Yp 3G3IA 4M1VA 5BUUA 4QRZA 4BBYA 4GL0A 1SW2A 5KZTA 2Q88A 1SYHA 1NI9A 2ZNTA 4X62E 2LTRA 1IUDA 1UTHB 2UUCE 4NTLA 5DNYA 4YB5A 2G7HA 3TZAA 1D3KA 4MH5A 3LMLA 1T0KA 4NE4A 2EM8A 3PPNA 4BLAA 4O3AA 2K7IA 4JI4E 5FTIA 1JP4A 1KA1A 4F29A 4PF8A 5A5LA 1NL5A 4JV5E 4GKKE 5CBRA 4LF9E 4YKKA 2EE8A 1MG1A 5I3SA 3JTZA 2EPXA 2Y7PA 1PDAA 4DUZE 3JU0A 4WPYA 5A6BA 2EPKX 3SESA 1CE2A 4R73A 3QIMA 4NF8B 4OVSA 1GZ6A 2O1LA 1ZBQA 2ENHA 5ET5A 4WXCA 3OSRA 4LZ8A 1B32A 2QS4A 5IAIA 3I3VA 5A6BD 3B6WA 4XF5A 1MS7A 3MAMA 2LV2A 1T4OA 4R6YA 2VQEE 1YYZA 3PUZE 4R8OA 2XWOA 4RH8A 4ELOA 5I56A 2HPGA 3H6VA 2Y5LA 2HJJA 4JVDA 2YTIA 5JTYB 2R76A 3N94A 4ZEFA 1LGBC 2ZYKA 4GD5A 2JY9A 4DV1E 3ADIA 1Y3PA 5I57A 1JW4A 2EM5A 5AA1A 4WFTA 4KHZE 4RJZA 2WKYA 2XXIA 4ECFA 1IITA 3LC8A 1JEUA 1MPBA 3TCFA 4IO2A 4FORA 1H44A 1PJSA 4P78A 4YB7A 3HPSA 3V5AA 3S9MC 4NMYA 4YMAA 5H8QB 2XXYA 2L92A 3FXQA 2QRYA 2V4CA 5ICQA 5ICTA 4L8NA 2AL5A 1FQCA 3HV1A 2CEYA 2P3VA 1A8EA 3G3JA 3O97A 5ET6A 2X26A 4MLVA 3MPLA 5JK4A 3U1OA 4ELPA 1YCJA 4F3SA 3O6GA 3U92A 2EMAA 4XIGQ 3K01A 4B3SE 2PFZA 4BDOA 4G8NA 4JDFA 4ZE8A 2BB8A 1SFEA 3TCGA 2XXRA 3MBPA 4MMPA 4JI2E 1FBGA 1A1IA 3VFJA 2YTQA 3CI8A 3K1PA 4LU9A 2FVZA 3E9XA 1XNQE 4EF1A 4LQ5A 2B7TA 3G3FA 3KSJA 3J7AG 2WYPA 4G68A 4Q0CA 3TKDA 4XEQA 4GL8A 3M8UA 2V85A 3RN8A 2EJ4A 2RS6A 2H5YA 3TODA 5JTYA 4KZSA 1WJPA 2WBSA 3FXUA 3WAEA 3SEXA 3OO8A 3VK6A 1FTMA 2QS3A 1JETA 1RDXA 4F2QA 2F3BA 1SYIA 2WBUA 3FV1A 2I9IA 4PQJA 1VDWA 1JQFA 4RPNA 1ELJA 1UTBB 1GGGA 2DYXA 3OO7A 5A6AA 2XXXA 2LUQA 3ZKLA 3CHGA 2EL4A 4WXJA 1ZLQA 2HCAA 2EMWA 3DP6A 1I6QA 4ZZEA 1A1KA 3PUYE 1HSLA 3EHUA 3K00A 3MP1A 4PGPA 5H8FA 3IJXB 5KDTA 4FJPA 2OX3A 3R6UA 3EHTA 2HHMA 2L5VA 1FBEA 2HXWA 2FBPA 2EN1A 2EL6A 3IFCA 2F36A 1NV5A 2R8TA 2ONKE 2YTNA 1FTAA 4MAGA 2I3VA 3T1BA 4DXCA 1NUWA 5DTBA 5I2KB 1FTKA 4KCDA 1B51A 1FQFA 4P0GA 1SW5A 4R2RA 2J7JA 3DLNA 4N17A 1IBME 2GHBA 4MBPA 2ENCA 1JK2A 4ZZAA 2AIXA 3A3UA 3QSLA 4OVPA 2EMXA 3IX1A 4NF5B 4MNCA 1QNTA 2KR0A 1POY1 4HXVA 2RC8A 5AA2D 1MPDA 2XX7A 2WZOA 5ADZA 4N6DA 3N6TA 3RMPA 3K6XA 5IXMB 3TDJA 1P1NA 4ELRA 4G8HA 2JPAA 1STUA 1ATGA 2EOXA 3VE1B 3T93B 5IKBA 1VFEA 4N6KA 3HCQA 4PBQA 1N76A 3VVEA 3IOTA 3UIFA 4H67A 5F7VA 1VSOA 2EOSA 1FQEA 4OENA 4OMBA 4R2SA 1FTOA 3PMWA 3THNA 4R9FA 4ZE9A 2DE4A 2P1SA 1JW1A 4X04A 4DR1E 2Q2AA 2HEUA 3V83A 2EN8A 3PMXA 4P3LA 4NF8A 3IB1A 5CRYA 4KYEA 4JXIA 4Z7EA 1Q9DA 3M3KA 4MNPA 4R6KA 5CMMA 2OCUA 1P1WA 4HW8A 1RC7A 5F3WA 4DR7E 4OVTA 4LF6E 3IO4A 4TLMB 1XC1A 1Y4TA 4I1DA 2OWSA 1ZAAC 4U1OA 4JI0E 1N3XA 4EF2A 2JVAA 1X5WA 1M5DA 2RC9A 4H5FA 3IFAA 2LE2A 3K6WA 5I2NA 2VPOA 1AAYA 3ILUB 3KN8A 3MWBA 4KYDA 3B8BA 4IY6A 4NWCA 4R2PA 4DR2E 1DQ3A 2OBGA 5BR8E 4TUIA 4U22A 4ZEBA 4JWYA 1S9TA 3H6UA 4P47A 4GF8A 4F54A 3PUXE 1SI0A 1EZOA 3TCHA 1BKAA 4IGRA 3RYDA 2XX8A 3HSTA 1BP5A 2I13A 3HPIA 4ISUA 3CG3A 1MM6A 1FQDA 3EPKA 3VDFA 5ISUA 4BC7A 1M5FA 2QMXA 1LBYA 1NNFA 4ZYGA 1TXFA 5KCJB 2HFBA 1B3GA 4O94A 2FYIA 3SEVA 4OESA 4R6HA 1EYIA 3KBRA 1NUZA 4OOGC 1X47A 3GBAA 4YICA 1IMUA 1YFHA 3FJGA 2P3NA 4WEPA 2L3CA 2GHAA 3LBSA 1SI1A 2DXYA 1FBDA 3N5LA 4EDPA 2RQLA 3MJNA 1US4A 5FTHA 1FPEA 3KJ7A 5B7DA 4R2EA 3A3CA 2GLIA 3VYXA 1FBPA 3KN3A 4IR8A 4RPOA 4UABA 4U4SA 1TF6A 2UYEA 2UXCE 4X8WA 2FA7A 2B65A 5CMKA 5ELVA 3S9LC 4N81A 3TEPA 4Q8RA 2Q8MA 2HQ0A 1WXRA 1SD3A 2A5TB 4ZEKA 4YMBA 4BCAA 1B1HA 2F8DA 4LF7E 2F4VE 2L2NA 1EKZA 4X9JA 1N04A 2XXWA 1OQHA 5L9MA 3H3GA 1N33E 2L6MA 2PMSA 1A1JA 5LMNE 5ET8A 2PVUA 2VP1A 3SERA 4GWYA 1NNKA 3LUZA 1B4ZA 3B50A 3HXLA 1FKAE 3QUFA 2EMBA 1A1HA 2Z23A 3Q25A 4K3FA 4FE8A 2MDRA 3LSWA 5I57B 1BBOA 4DV0E 1H3DA 2QMWA 5I58B 4F3BA 2UUAE 4H5GA 1IMAA 4DR6E 4H0WA 3C32A 4NF0A 3D1RA 5T3JA 3DF6A 2I4CA 1YTVA 4X64E 2ODRD 1PEBA 3J81C 4GKJE 4O24A 1N3WA 4GWWA 1QW0A 2ZMBA 1WRJA 5ITOA 4KI0E 3THIA 3MUQA 1FJGE 3TFLA 2L8TA 3M3FA 3VXBA 1B1XA 4DV4E 4M30A 2QL3A 4C1UA 1Y3QA 1LLSA 2D5WA 4PFWA 3A29A 3RLFE 4NF5A 3LSXA 4LTYA 1URDA 1JVYA 1K9ZA 4LUBA 3MZ9A 1A55A 1MY2A 2B9DA 3PGFA 1R6ZA 1BTJA 2EQ0A 1T4NA 4U23A 3RUMA 2L3JA 1WODA 2PX1A 2ZZWA 4LONB 1EYJA 4R03A 4N4RB 1SVXB 2Y5KA 3QK6A 2VT5A 5IM2A 5TPAB 5AE4A 1MXYA 1UN6B 1NV1A 1EH3A 2VE7C 1MDP1 1TT1A 4DV3E 2LBSB 3MVZA 3ADGA 2UVIA 4DE8A 1JEVA 3IOUA 4F6NA 2DE2A 2HZKA 5T6JA 1LAFE 3UN6A 5H8NA 1NV4A 1Y1MA 5L9OA 3W9VA 3BIHA 3E3KA 2EN7A 4RNSA 2PT1A 2RKMA 4PGNA 2EPAA 3N6UA 3IAZA 4NHBA 4NEDA 3IL1B 4BDMA 5CM6A 3M3LA 2V89A 1DMBA 2RCBA 3QMFA 4NF6B 3O6IA 3KJTA 4MEVA 3PD8A 4ZDMA 1J1NA 4R75A 2V87A 4N8YA 3CFXA 2EOYA 3Q29A 4ELQA 1NFTA 1ZBTA 1G2DC 4F2OA 5L8DA 3L6GA 2O84X 4QHQA 2ESNA 2EOZA 2I48A 5ITPA 2FIXA 5K2YA 1QUJA 3MHSC 4QFNA 4N13A 1LCFA 4UA8A 3GBBA 3ADJA 1A54A 3C31A 4AS5A 4YZZA 3CR9A 3KFMA 2O7IA 3K4UA 3TTRA 4C1TA 1QGXA 1YSAC 4JI8E 1FJ6A 1FW0A 1EH6A 3PV0E 4HCWA 2XA5A 3VLUA 5H8QA 1RMDA 2F7AA 3FVOA 5J1DA 1ZU0A 2WBDA 2MC6A 3ISPA 1LBBA 2HXRA 2Z8EA 2YSPA 4KYSA 1MY1A 1MRPA 4F9AB 1B0HA 4R2CA 4POWA 1AOVA 2D3IA 1USYE 4RYAA 1X3CA 4JI6E 2LUPB 1IQSA 4Q35B 3IOWA 4Z0IA 3OMLA 3FJMA 2V8QB 2EQ3A 1LCTA 1LB8A 1IMCA 3VLWA 1DTGA 4QFLA 3OENA 2REGA 4BHBA 1B6HA 1HR0E 5AASA 1PBPA 3TTMA 5TP9A 3IOVA 5CC2A 2M1SA 1DCUA 1MXZA 3Q26A 4P0IA 2F78A 4PBHA 2EL5A 3FVGA 1A8FA 3CIJA 2I58A 3OMBA 5FLXC 4X8RA 4PAIA 4LFCE 2DE3A 3J80C 2PRTA 4FECA 1H43A 4WEDA 4TLLB 5A5XB 1B3FA 2IA4A 3KEIA 2EN6A 2RPCA 1IMDA 4KWYA 3W15C 2QS1A 4JVCA 5DYHA 5EQ8A 1TN9A 1WHNA 2DWJA 5KL2A 1KA0A 2MKNA 4PFIA 2DP8A 1DSNA 3KZYA 1NNTA 2EM2A 3TMGA 2XXPA 3TQMA 3HHGA 2YU5A 1AL3A 1XS5A 3BFUA 1JVXA 3OSQA 3C36A 3T96B 3SEWA 2E1MA 2F35A 4DV5E 1IMFA 3T1HE 4DV6E 1B5HA 4IB2A 1WDNA 5I58A 4OYVA 1IBLE 1BIYA 4GOTA 4NXNE 1EYKA 1XHYA 2NWJA 1JW5A 3IB0A 3IB2A 5DT6A 4ESXA 3RGYA 5KL6A 2DSFA 5M2VA 2UUBE 1K9YA 4FK5C 2RF1A 5LL6R 2EN3A 2DDKA 4JBZA 4X65E 5DEXB 1FPBA 4HCYA 4G8MA 1GVCA 3T9XB 4JI5E 2LJUA 3KC0A 4X48A 1EZPA 4PFRA 1FTJA 1B9JA 4PDHA 1M5EA 2UVJA 2N8XA 5IZ3A 1AIVA 3G3HA 4NQ8A 1RYXA 1UIVA 2KHXA 2PFYA 2CSHA 2EM9A 1YZ9A 1D4NA 3LUYA 3VLVA 5H8HB 2R1FA 4TUGA 2W7YA 2WBBA 4R2DA 3LLHA 4EXLA 4F1YA 5AA4A 1PBQA 2EORA 4G68B 3H03A 2F7BA 2ZM6E 4ONYA 1VFDA 3T22A 2EM7A 3OOAA 3LR1A 5DVJA 2FV4B 1GV8A 4MLQA 2HAVA 2ZNSA 4G68C 5LTCA 2ZYOA 3ONMA 1P1UA 1R9LA 4DKKA 1Z1BA 1QKAA 3PPQA 4OA4A 1UHZA 2PYYA 3T66A 4ZYDA 3T9VA 4H6DA 2F7CA 2XXHA 5H8NB 1B5JA 4H65A 2EPPA 1B4HA 2Y7WA 2YT4A 3H06B 2ZYMA 2DS9A 4R2AA 2YTJA 2EZ6A 4TQUQ 2YTDA 4AQ4A 4QSCA 1IQOA 3S4UA 3TAJA 2EPUA 1IQ7A 5TSEA 2BJJX 2JOBA 4LF8E 4M9VC 3UORA 4R9GA 5LLQA 1YUJA 5FHNA 5AA3A 1MEYC 1RQ0A 3RPWA 2XX9A 3PU5A 1UIUA 3IJOB 4BDRA 4LFAE 4R72A 5AA2A 3HN0A 4O4KA 2NUGA 1MQGA 1KYQA 1N3GA 2OK2A 4FBPA 5TU0A 4PE3A 2YTGA 2PCRA 2Z8FA 1B7HA 2EP3A 2XWIA 1B2HA 5I2NB 1YYWA 2I3WA 4OQOA 3PPOA 3ZOQB 2V84A 2DMYA 4AS4A 1L4SA 3FATA 4R2QA 4P1LA 1BB8A 4F39A 2EOJA 3AUZA 2YWQA 4ZECA 2DVCA 1Y3NA 2V83A 3FVNA 1YAEA 3KGCA 2EPRA 1IZ1A 4DV7E 2FIEA 1B3EA 4IO5A 4PCDA 4QF9A 2Y84A 3KOSA 3RT8A 1PKPA 4U1ZA 1P1QA 3FZVA 1SW4A 1B7ZA 2F3DA 1IXIA 1P47A 2NUFA 1DK4A 2XWVA 1LBZA 4KR5A 3OO9A 1BBGA 1FPLA 5B70A 4LF5E 4WYQB 5A69A 1D9QA 4OZ9A 5TPAA 1NV7A 2QVUA 2V3QA 1OLAA 2V88A 2HHHE 4NF4B 1OVBA 2VGQA 1O0WA 2ZYNA 3QAXA 2QS2A 5I2KA 5I5PA 2YU8A 3EQ1A 3G3GA 4HE1A 4AB6A 2ODRC 4DI3D 5LMUE 3KZZA 1B40A 3KN7A 5TP9B 3PPPA 4JI1E 2XXKA 3MVXA 3DP8A 1MGTA 1ANFA 1B69A 3VXCA 2DIXA 3O2AA 4EQ9A 3QXMA 1XVXA 3MW0A 5AC4A 4BDQA 1DBZA 2EMLA 4OFLA 4JYAE 2MKDA 1I94E 3CFZA 4GWZA 4GX4A 2DGCA 2L2MA 1DTZA 4PETA 5HM4B 4K0KE 4O8MA 3P1XA 2B3TB 3FD3A 3FXRA 2Q89A 4BHCA 5CI5A 4HE2A 2VD2A 3USDA 4GWXA 1LEVA 2O51A 1T39A 1QUIA 2ZNUA 1LB9A 3CFLA 1HSEA 3HTXA 5CMCA 2BBGA 2GFEA 3R26A 4OERA 3K2DA 2X7PA 1INPA 3L6HA 3TUSA 4FATA 2EOHA 3O28A 4AB5A 2A5TA 4X66E 1T4LB 2DOJA 4UACA 3EPJA 4E0XA 1ZIUA 2Q74A 3FVKA 3K02A 1AMFA 3MYUA 1SQYA 3THOB 2EOFA 4NGUA 2M9AA 4E0WA 4DR5E 4FEBA 4NXME 1FPDA 4OVRA 1LSTA 4RK2A 1S50A 4XFEA 5DEXA 3RPLB 5EQ7A 1QULA 1FTLA 1X48A 1LFIA 2EQ1A 2KLFA 2D9HA 2RC7A 2YTPA 3CSBA 2GPIA 4PE5B 1G0HA 2QVVA 2EM0A 4NF6A 1UQWA 2I4BA 3KBZA 2RS7A 1QVSA 3FUZA 5EYHA 1FBCA 3IWCA 5KL7A 3PTYA 2EOOA 4O3BA 3PUVE 3WAFA 4RXLA 4LP2B 2O6AA 4GLIA 2EN4A 2XHDA 2JOXA 2MC5A 1NKXA 5DW8A 1LBWA 3AV0A 4QSEA 1M5CA 2DLQA 4GVOA 1O7TA 2EPCA 4H46A 3SDFA 3ROJA 1MQJA 3IORA 1R1NA 2D21A 4GXAA 2L2KB 2M4IA 1WHQA 4M2ZA 2XXQA 3TTNA 2I6EA 3QG5C 3T9HB 3TQWA 3VV5A
chains in the Genus database with same CATH topology
3H4ZA 3CI8A 3K4UA 3K1PA 3TTRA 3RT6B 4C1TA 4DDDA 3S9NC 4NF4A 4U2RA 3E9XA 2Z22A 1MXWA 1FW0A 4DZ1A 3PV0E 4EF1A 4EUOA 4LQ5A 3SEYA 4HCWA 1VE4A 3G3FA 3UA8A 3VLUA 3KSJA 1NH7A 5H8QA 4G68A 1Z7NE 1PB8A 2B3FA 1QUKA 3C35A 3C34A 4Q0CA 3TKDA 1P1OA 2F7AA 4GL8A 3FVOA 2UVHA 5J1DA 1ZU0A 3K6UA 3M8UA 1IXHA 3RN8A 4YKJA 2H5YA 1B7UA 1LBBA 3TODA 5JTYA 1NH8A 2Z8EA 1HSJA 2P2AA 3PUWE 4U21A 1PB9A 2V3UA 2F5XA 3Q27A 1MY1A 1VR5A 1XT8A 4KYSA 1MRPA 3TTLA 3U93A 4XKNA 1B0HA 5BWJA 4DIGA 4POWA 4C0RA 2D3IA 1AOVA 3FXUA 3WAEA 2UXAA 3SEXA 3BKIB 2I49A 2V25A 1OMPA 1USYE 3OO8A 4RYAA 2DWIA 4F3PA 2LAOA 1FTMA 2Q9TA 2QS3A 3FJ7A 3SKPA 1JETA 1ZBMA 4DLDA 4F2QA 4JWXA 3FGSA 1EU8A 1SYIA 3IOWA 1XVYA 3FV1A 4Z0IA 3T9UA 3FJMA 1IXGA 4PQJA 2O69A 1LCTA 1LB8A 1JQFA 4RPNA 1RYOA 3VLWA 1ELJA 1GR2A 1DTGA 1UTBB 3CG1A 5I56B 2QPQA 1GGGA 4IGTA 4QFLA 2DYXA 2QSXA 3OENA 2REGA 3OO7A 5L9SA 1B6HA 3QYTA 2XXXA 1IXCA 1EZ9A 1N7WA 3ZKLA 1PBPA 5FHMA 4WXJA 4F22A 2P0SA 1ZLQA 2HCAA 5TP9A 3TTMA 3IOVA 5CC2A 1MXZA 3Q26A 3DP6A 3K0VA 1I6QA 4P0IA 1Y9UA 2F78A 4ZZEA 5A5XA 3FVGA 1A8FA 2E1SA 2I58A 3CIJA 3OMBA 3PUYE 1HSLA 3EHUA 3GZGA 3K00A 3MP1A 5H8FA 1N0TA 5AA4A 3IJXB 2DE3A 4FECA 5KDTA 1H43A 4FJPA 3R6UA 4JSOA 3EHTA 4WEDA 4FAJA 1A99A 3CVGA 4TLLB 3I6VA 5EHSA 2H9BA 5HPQA 2HXWA 2M8CA 2RINA 5A5XB 1B58A 1B3FA 2OJTA 2IA4A 3IO6A 3SEVA 3KEIA 5KCJA 1DOTA 4M4GA 4XKPA 2F36A 2QS1A 3W15C 2ONKE 5DYHA 4HS7A 4R6HA 2ABHA 1KWHA 5KDTB 2Y7RA 4OXVA 1B52A 2OZZA 4N07A 1MQIA 5EYFA 3UP9A 5JEIA 3HO7A 2I3VA 2DWJA 4MF3A 4DXCA 4X1DA 1OIBA 3ILTB 3K1NA 5DTBA 5I2KB 1FTKA 3AXFA 1B0LA 4KCDA 1B51A 1FQFA 2DP8A 2ONRA 1SW5A 4P0GA 1MM7A 3VVFA 2I0BA 3DLNA 1DSNA 1NNTA 5F1QA 2GHBA 4QSDA 4MBPA 3TMGA 3RTFB 2XXPA 4ZZAA 3RQTA 3HHGA 2AIXA 3A3UA 4R2BA 1XS5A 1AL3A 1MY4A 3BFUA 1JVXA 3OSQA 4GFRA 3PD9A 3C36A 3T96B 3C4MA 2RCAA 1OLCA 3QSLA 3SEWA 2ANJA 1IEJA 2F35A 3C9HA 3FV2A 3IX1A 4RXLA 4NF5B 4H1XA 4H8IA 4G4PA 1POY1 1B5HA 1MY3A 1PB7A 2RC8A 4IB2A 1MPDA 1WDNA 5AA2D 4RA1A 1MQDA 5I58A 4OYVA 2XX7A 4LZ7A 1BIYA 3CRBA 1H45A 4GOTA 4PFUA 3K6VA 2B3BA 3D4CA 4I8CA 1XHYA 2NWJA 4EQBA 1JW5A 3A09A 3IB0A 3IB2A 5DT6A 4BDLA 3RGYA 4ESXA 2REJA 2DSFA 3N6TA 3K6XA 5M2VA 4Q30B 4WKMA 2G29A 3TDJA 1P1NA 2AYSA 3JV9A 4G8HA 2NVUB 4ELRA 4FIMA 1URGA 4YB6A 3TPAA 3O29A 1YPNA 1TFDA 1ATGA 3KOTA 1B3LA 4QFKA 2I0CA 2RF1A 3VE1B 1NMUA 1B5IA 1RKMA 3ODBA 4JBZA 3T93B 1D9VA 1VFEA 4DCXA 5IKBA 1SDXA 3HCQA 5DEXB 1ZJLA 3ZSFA 3OEMA 1N76A 4G8MA 4GQOA 4HCYA 4KD5A 4R2FA 2VHAA 3SETA 1GVCA 3VVEA 3IOTA 2OLBA 3T9XB 2CMOA 4H67A 5F7VA 3UIFA 1VSOA 3W9WA 4BDMA 4X48A 4EXKA 1EZPA 5EHMA 4XXUA 2Y7IA 5H8HA 1FTJA 3HHFA 1B9JA 2GRVA 4X9TA 1FQEA 4OENA 4OMBA 3BBRA 1FTOA 2DVZA 1M5EA 3PMWA 4R9FA 2UVJA 3RNNA 4ZE9A 1MDQA 1L5TA 1AIVA 1OVTA 3G3HA 1RYXA 1UIVA 2DE4A 4IO7A 1PC3A 2P1SA 1JW1A 2YJPA 4OEVA 1D4NA 2Q2AA 3LUYA 2HEUA 4OTEA 3CSGA 5H8SA 5H8HB 3VLVA 3V83A 1CB6A 3PMXA 2W7YA 4ESWA 3KG2A 1USYH 3N26A 4NF8A 3IB1A 4EXLA 4OETA 5CMBA 1PBQA 5CRYA 4F1YA 4N6PA 4KYEA 3V89B 3TQLA 4JXIA 4Z7EA 2F34A 3V8XB 4XTCQ 1ZMGA 4ZS9A 2H4IA 3M3KA 3TYHA 1S7YA 4G68B 3H03A 2F7BA 4ONYA 4R6KA 2UYFA 3MZBA 2HAUA 2OCUA 1P1WA 5CMMA 4HW8A 1VFDA 4KQPA 3T22A 4P11A 3OOAA 3LR1A 5DVJA 2VOZA 1GV8A 4MLQA 2HAVA 2ZNSA 4G68C 2ZYOA 4IO4A 3VVDA 3IO4A 1P1UA 3ONMA 1R9LA 1MY0A 1XC1A 4TLMB 1QKAA 3E4RA 1Y4TA 4F1UA 4I1DA 3PPQA 1LAHE 1D9YA 3G7WA 1FQAA 2DQVA 1MXVA 2OWSA 5HBCA 2XD3A 3C33A 3RTWB 2PYYA 2CZLA 3T66A 3OEKA 1LFGA 2ONSA 4U1OA 4H6DA 2F7CA 2XXHA 1DPEA 1N3XA 3T9VA 4EF2A 5H8NB 1B5JA 3B7DA 4THIA 4H65A 1M5DA 2RC9A 2NXOA 4F1VA 4H5FA 4IO6A 1MPCA 1OQGA 3K6WA 1A7LA 5I2NA 5CM6A 3O66A 3ILUB 1B4HA 2Y7WA 3KN8A 2THIA 4H8JA 3MWBA 4JSDA 3H06B 2DWHA 4KYDA 2ZYMA 2DS9A 4TQUQ 4IY6A 4NWCA 4ZEBA 2OBGA 1LFHA 3KFMA 4U22A 4AQ4A 4QSCA 3MZ1A 4JWYA 1S9TA 1ZKBA 3H6UA 1Q35A 5AA4B 4YKIA 2H98A 4GF8A 3S4UA 3R7XA 3TAJA 1IQ7A 3GXAA 2BJJX 3PUXE 1SI0A 3LSLA 2DWAA 3TCHA 4RY1A 1BKAA 1MQHA 2Q2CA 1EZOA 4IGRA 4LA9A 1JNFA 1MXUA 3S2VA 3MC2A 4EQ7A 4ZEDA 2XX8A 2H99A 3UORA 4IO3A 1Y4CA 3HSTA 3T9HB 4R9GA 1BP5A 2XXTA 3HPIA 4ISUA 3CG3A 5FHNA 5AA3A 1MM6A 1FQDA 3RPWA 2XX9A 2V93A 4YU0A 3VDFA 3GLBA 4RK9A 3PU5A 3MP8A 2VD3A 4IY5A 5ISUA 2YPNA 1UIUA 3I5OA 3KZGA 1M5FA 4YKPA 1A40A 2QMXA 1NNFA 3IJOB 5KCJB 1TXFA 5LOMA 2HFBA 3JYRA 1B3GA 4KCCA 4BDRA 4OHNA 4R72A 2F97A 2FYIA 4NWDA 1SBPA 3HN0A 1XOCA 2XXUA 3K1MA 2R71A 2F6GA 3IK6B 3EF7A 4OESA 1F9BA 1MQGA 3EN3A 4OWDA 5AA2B 3ECRA 3KBRA 2OK2A 5TU0A 3U72A 1BLFA 2AL4A 2O7UA 3MQ9A 2Z8FA 4GXSB 3IR1A 1B7HA 2X7QA 3GBAA 4YAHX 4YICA 3LSFB 4LQ2A 2QJEA 4DCYA 1B2HA 4HTGA 1I69A 3UK4A 3FJGA 4OFJA 3UGWA 5I2NB 1WVJA 1US5A 1B05A 2DXRA 2I3WA 4JB7A 4OQOA 3QUJA 4WEPA 2Q8JA 2UVGA 3H6WA 2GHAA 3PPOA 4KFQA 2V84A 3LBSA 1B3HA 1SI1A 4X1BA 5H8FB 2ZXTA 4XKQA 2DXYA 4BDNA 3FATA 3MVWA 3F11A 3N5LA 3TTKA 3O9PA 4XKRA 4F39A 4EDPA 3MJNA 1ZTYA 4U4XA 4ZECA 1US4A 1Y3NA 2DVCA 5FTHA 3FVNA 5I59B 1YAEA 3KGCA 3KJ7A 1Y20A 5B7DA 1URSA 2G93A 3A3CA 1O64A 4LZ5A 2FNCA 3KN3A 4ECFA 1IZ1A 4RPOA 1B3EA 4IO5A 4U4SA 1B46A 2UYEA 3B6TA 2NUVA 4QF9A 2Y84A 1QKBA 2FA7A 2B65A 3KOSA 3RT8A 4U1ZA 5CMKA 1P1QA 3FZVA 5ELVA 3S9LC 1I6AA 3BFTA 1Q1KA 1SW4A 3Q28A 3TEPA 1I6BA 4Q8RA 1B7ZA 1IXIA 2HQ0A 1SD3A 1LBCA 2A5TB 2GH9A 4ZEKA 4YMBA 2HZLA 1B1HA 2F8DA 4DXBA 2IEEA 4KR5A 2PBWA 3H7MA 1N04A 2XXWA 1LAGE 3OO9A 1OQHA 4GIZA 1P99A 4ND9A 2XD2A 3H3GA 5L9MA 4G77A 4I62A 5B70A 4OZ9A 5TPAA 1QJMA 3G3IA 4M1VA 5BUUA 2PMSA 4QFPA 1M5BA 2V3QA 3G3KA 1OLAA 2PVUA 4QRZA 2F6PA 3KSXA 2VP1A 4F18A 4NF4B 1OVBA 2VGQA 2ZYNA 1NNKA 3OELA 1B4ZA 4GL0A 3SERA 1SW2A 3TELA 1FCKA 3QAXA 2QS2A 3QUFA 4MFIA 5I2KA 5KZTA 2Q88A 1SYHA 2ZNTA 3U8QA 3G3GA 3EQ1A 2E0SA 3OXNA 2Z23A 3Q25A 4K3FA 4AB6A 1IUDA 4FE8A 1UTHB 3LSWA 4TOZA 5I57B 1B40A 3KN7A 4KPTA 4NTLA 5AA2A 4YB5A 1H3DA 3TZAA 2QMWA 1D3KA 5I58B 5TP9B 4MH5A 4F3BA 1T0KA 3PPPA 2Y7KA 4H5GA 4H0WA 3C32A 2NOOA 4NE4A 3MVXA 3PPNA 5K2XA 4BLAA 3DP8A 4O3AA 4F19A 2I4CA 1YTVA 1N7XA 1ANFA 3VXCA 1PEBA 3O2AA 4O3CA 5FTIA 2OWTA 4FEDA 4EQ9A 3QXMA 1XVXA 3MW0A 1R9QA 1N3WA 4BDQA 4F29A 4ZEIA 1QW0A 4OFLA 3RY3A 1NL5A 5CBRA 3CFZA 2ZMBA 5ITOA 4KI0E 2O68A 4YKKA 3THIA 5DVFA 1MG1A 1DTZA 1MH4A 3MUQA 4PETA 3TFLA 5HM4B 1UTBA 3P7IA 2H25A 2Y7PA 1PDAA 3FD3A 3M3FA 3FXRA 4G2ZA 3VXBA 3ZKKA 4PP0A 2Q89A 3ZS6A 5CI5A 1B1XA 1II5A 2VD2A 3USDA 3SESA 5I59A 4OFOA 2QL3A 4C1UA 1Y3QA 1CE2A 4R73A 1LLSA 2D5WA 3QIMA 1AH5A 2O51A 4NF8B 4PFWA 1QUIA 3RLFE 2ZNUA 4NF5A 3LSXA 1LB9A 1URDA 3CFLA 1HSEA 1JVYA 3B6QA 4LUBA 2O1LA 3DP4A 1GTKA 5CMCA 3MZ9A 4L17A 2GFEA 3R26A 1NNPA 1A55A 4OERA 1MY2A 3K2DA 3OSRA 3PGFA 2X7PA 1TWYA 3L6HA 3PPRA 1B32A 1LAXA 1R6ZA 4LZ8A 3TUSA 3MP6A 4LVQA 1BTJA 2QS4A 3OD7A 5DVIA 3UN6A 4FATA 3I3VA 3O28A 5IAIA 3RUMA 4AB5A 4U23A 2A5TA 1WODA 2O1MA 2DOJA 2PX1A 3B6WA 4LONB 4R74A 1MS7A 4UACA 3MAMA 4E0XA 4F31B 1ZIUA 4R6YA 1SVXB 3FVKA 3K02A 3QK6A 1O63A 1AMFA 3U94A 1MXXA 5TPAB 3PUZE 1SQYA 4ELOA 4GWOA 4F3GA 5AE4A 5I56A 1MXYA 4QFOA 3S9EA 1DPPA 3H6VA 4E0WA 1EH3A 3EHSA 1MDP1 5JTYB 1TT1A 2V3TA 4FEBA 4JWOA 5FHOA 3MVZA 3N94A 4ZEFA 1LGBC 2UVIA 2ZYKA 4DE8A 4GD5A 1JEVA 3IOUA 2DE2A 1LSTA 2HZKA 1SW1A 1Y3PA 4OEUA 5I57A 1LAFE 1JW4A 3EPEA 3MPKA 4PFYA 4RK2A 5H8NA 1S50A 5DEXA 1N84A 5AA1A 1Y1MA 4LATA 4KHZE 4I9DA 1QULA 4RJZA 2R9JA 5L9OA 1FTLA 2WKYA 2XXIA 3W9VA 1LFIA 1IITA 2PT2A 1JEUA 1MPBA 2KLFA 3LC8A 3TCFA 3E3KA 4IO2A 2RC7A 4FORA 1H44A 3PMVA 4RNSA 2PT1A 3O6HA 3CSBA 2ALUA 4PE5B 4YB7A 4NF6A 2RKMA 3DELB 1UQWA 4OVJA 2I4BA 3V5AA 3FIRA 1QVSA 3FUZA 3N6UA 2A5SA 3IAZA 4F2OA 3S9MC 4NMYA 3D4GA 4YMAA 3OO6A 4O3BA 3PUVE 4NEDA 3IL1B 3MVYA 5H8QB 3WAFA 1TFAA 2XXYA 3FXQA 3H6TA 3M3LA 4Q5TA 2QRYA 1DMBA 2O6AA 2R6GE 2RCBA 4GLIA 4LP2B 1IIWA 3O6IA 2XHDA 4NF6B 1POTA 3KJTA 3PD8A 4DXUA 4POXA 4ZDMA 5ICTA 2AL5A 1FQCA 1J1NA 1Z7ME 3HV1A 4R75A 5ICQA 1NKXA 3JZJA 5I84A 1A8EA 3DM0A 3G3JA 3CFXA 1H76A 1UTHA 2Z8DA 1NFTA 3Q29A 3O97A 4ELQA 2X26A 4MLVA 3MPLA 2YLNA 4QSEA 1M5CA 3SEUA 3U1OA 4GVOA 5JK4A 1O7TA 3SDFA 3FASA 1MQJA 3IORA 4ELPA 1R1NA 2D21A 4GXAA 4PFTA 1MH3A 3E13X 1YCJA 3L6GA 3O6GA 2O84X 5L8DA 3U92A 4QHQA 4F3SA 1FQBA 2ESNA 4GRKA 2XXVA 2I48A 3K01A 4XIGQ 5K2YA 5CBSA 1QUJA 4BDOA 5ITPA 4G8NA 4JDFA 4QFNA 4N13A 4ZE8A 1LCFA 4UA8A 2XXQA 2XXRA 3MBPA 3TCGA 3TTNA 2I6EA 3GBBA 1A54A 3C31A 3VFJA 4YZZA 3CR9A 3TQWA 1Y1ZA 3VV5A 2O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4Z A;  3CI8 A;  3K4U A;  3K1P A;  3TTR A;  3RT6 B;  4C1T A;  4DDD A;  3S9N C;  4NF4 A;  4U2R A;  3E9X A;  2Z22 A;  1MXW A;  1FW0 A;  4DZ1 A;  3PV0 E;  4EF1 A;  4EUO A;  4LQ5 A;  3SEY A;  4HCW A;  1VE4 A;  3G3F A;  3UA8 A;  3VLU A;  3KSJ A;  1NH7 A;  5H8Q A;  4G68 A;  1Z7N E;  1PB8 A;  2B3F A;  1QUK A;  3C35 A;  3C34 A;  4Q0C A;  3TKD A;  1P1O A;  2F7A A;  4GL8 A;  3FVO A;  2UVH A;  5J1D A;  1ZU0 A;  3K6U A;  3M8U A;  1IXH A;  3RN8 A;  4YKJ A;  2H5Y A;  1B7U A;  1LBB A;  3TOD A;  5JTY A;  1NH8 A;  2Z8E A;  1HSJ A;  2P2A A;  3PUW E;  4U21 A;  1PB9 A;  2V3U A;  2F5X A;  3Q27 A;  1MY1 A;  1VR5 A;  1XT8 A;  4KYS A;  1MRP A;  3TTL A;  3U93 A;  4XKN A;  1B0H A;  5BWJ A;  4DIG A;  4POW A;  4C0R A;  2D3I A;  1AOV A;  3FXU A;  3WAE A;  2UXA A;  3SEX A;  3BKI B;  2I49 A;  2V25 A;  1OMP A;  1USY E;  3OO8 A;  4RYA A;  2DWI A;  4F3P A;  2LAO A;  1FTM A;  2Q9T A;  2QS3 A;  3FJ7 A;  3SKP A;  1JET A;  1ZBM A;  4DLD A;  4F2Q A;  4JWX A;  3FGS A;  1EU8 A;  1SYI A;  3IOW A;  1XVY A;  3FV1 A;  4Z0I A;  3T9U A;  3FJM A;  1IXG A;  4PQJ A;  2O69 A;  1LCT A;  1LB8 A;  1JQF A;  4RPN A;  1RYO A;  3VLW A;  1ELJ A;  1GR2 A;  1DTG A;  1UTB B;  3CG1 A;  5I56 B;  2QPQ A;  1GGG A;  4IGT A;  4QFL A;  2DYX A;  2QSX A;  3OEN A;  2REG A;  3OO7 A;  5L9S A;  1B6H A;  3QYT A;  2XXX A;  1IXC A;  1EZ9 A;  1N7W A;  3ZKL A;  1PBP A;  5FHM A;  4WXJ A;  4F22 A;  2P0S A;  1ZLQ A;  2HCA A;  5TP9 A;  3TTM A;  3IOV A;  5CC2 A;  1MXZ A;  3Q26 A;  3DP6 A;  3K0V A;  1I6Q A;  4P0I A;  1Y9U A;  2F78 A;  4ZZE A;  5A5X A;  3FVG A;  1A8F A;  2E1S A;  2I58 A;  3CIJ A;  3OMB A;  3PUY E;  1HSL A;  3EHU A;  3GZG A;  3K00 A;  3MP1 A;  5H8F A;  1N0T A;  5AA4 A;  3IJX B;  2DE3 A;  4FEC A;  5KDT A;  1H43 A;  4FJP A;  3R6U A;  4JSO A;  3EHT A;  4WED A;  4FAJ A;  1A99 A;  3CVG A;  4TLL B;  3I6V A;  5EHS A;  2H9B A;  5HPQ A;  2HXW A;  2M8C A;  2RIN A;  5A5X B;  1B58 A;  1B3F A;  2OJT A;  2IA4 A;  3IO6 A;  3SEV A;  3KEI A;  5KCJ A;  1DOT A;  4M4G A;  4XKP A;  2F36 A;  2QS1 A;  3W15 C;  2ONK E;  5DYH A;  4HS7 A;  4R6H A;  2ABH A;  1KWH A;  5KDT B;  2Y7R A;  4OXV A;  1B52 A;  2OZZ A;  4N07 A;  1MQI A;  5EYF A;  3UP9 A;  5JEI A;  3HO7 A;  2I3V A;  2DWJ A;  4MF3 A;  4DXC A;  4X1D A;  1OIB A;  3ILT B;  3K1N A;  5DTB A;  5I2K B;  1FTK A;  3AXF A;  1B0L A;  4KCD A;  1B51 A;  1FQF A;  2DP8 A;  2ONR A;  1SW5 A;  4P0G A;  1MM7 A;  3VVF A;  2I0B A;  3DLN A;  1DSN A;  1NNT A;  5F1Q A;  2GHB A;  4QSD A;  4MBP A;  3TMG A;  3RTF B;  2XXP A;  4ZZA A;  3RQT A;  3HHG A;  2AIX A;  3A3U A;  4R2B A;  1XS5 A;  1AL3 A;  1MY4 A;  3BFU A;  1JVX A;  3OSQ A;  4GFR A;  3PD9 A;  3C36 A;  3T96 B;  3C4M A;  2RCA A;  1OLC A;  3QSL A;  3SEW A;  2ANJ A;  1IEJ A;  2F35 A;  3C9H A;  3FV2 A;  3IX1 A;  4RXL A;  4NF5 B;  4H1X A;  4H8I A;  4G4P A;  1POY 1;  1B5H A;  1MY3 A;  1PB7 A;  2RC8 A;  4IB2 A;  1MPD A;  1WDN A;  5AA2 D;  4RA1 A;  1MQD A;  5I58 A;  4OYV A;  2XX7 A;  4LZ7 A;  1BIY A;  3CRB A;  1H45 A;  4GOT A;  4PFU A;  3K6V A;  2B3B A;  3D4C A;  4I8C A;  1XHY A;  2NWJ A;  4EQB A;  1JW5 A;  3A09 A;  3IB0 A;  3IB2 A;  5DT6 A;  4BDL A;  3RGY A;  4ESX A;  2REJ A;  2DSF A;  3N6T A;  3K6X A;  5M2V A;  4Q30 B;  4WKM A;  2G29 A;  3TDJ A;  1P1N A;  2AYS A;  3JV9 A;  4G8H A;  2NVU B;  4ELR A;  4FIM A;  1URG A;  4YB6 A;  3TPA A;  3O29 A;  1YPN A;  1TFD A;  1ATG A;  3KOT A;  1B3L A;  4QFK A;  2I0C A;  2RF1 A;  3VE1 B;  1NMU A;  1B5I A;  1RKM A;  3ODB A;  4JBZ A;  3T93 B;  1D9V A;  1VFE A;  4DCX A;  5IKB A;  1SDX A;  3HCQ A;  5DEX B;  1ZJL A;  3ZSF A;  3OEM A;  1N76 A;  4G8M A;  4GQO A;  4HCY A;  4KD5 A;  4R2F A;  2VHA A;  3SET A;  1GVC A;  3VVE A;  3IOT A;  2OLB A;  3T9X B;  2CMO A;  4H67 A;  5F7V A;  3UIF A;  1VSO A;  3W9W A;  4BDM A;  4X48 A;  4EXK A;  1EZP A;  5EHM A;  4XXU A;  2Y7I A;  5H8H A;  1FTJ A;  3HHF A;  1B9J A;  2GRV A;  4X9T A;  1FQE A;  4OEN A;  4OMB A;  3BBR A;  1FTO A;  2DVZ A;  1M5E A;  3PMW A;  4R9F A;  2UVJ A;  3RNN A;  4ZE9 A;  1MDQ A;  1L5T A;  1AIV A;  1OVT A;  3G3H A;  1RYX A;  1UIV A;  2DE4 A;  4IO7 A;  1PC3 A;  2P1S A;  1JW1 A;  2YJP A;  4OEV A;  1D4N A;  2Q2A A;  3LUY A;  2HEU A;  4OTE A;  3CSG A;  5H8S A;  5H8H B;  3VLV A;  3V83 A;  1CB6 A;  3PMX A;  2W7Y A;  4ESW A;  3KG2 A;  1USY H;  3N26 A;  4NF8 A;  3IB1 A;  4EXL A;  4OET A;  5CMB A;  1PBQ A;  5CRY A;  4F1Y A;  4N6P A;  4KYE A;  3V89 B;  3TQL A;  4JXI A;  4Z7E A;  2F34 A;  3V8X B;  4XTC Q;  1ZMG A;  4ZS9 A;  2H4I A;  3M3K A;  3TYH A;  1S7Y A;  4G68 B;  3H03 A;  2F7B A;  4ONY A;  4R6K A;  2UYF A;  3MZB A;  2HAU A;  2OCU A;  1P1W A;  5CMM A;  4HW8 A;  1VFD A;  4KQP A;  3T22 A;  4P11 A;  3OOA A;  3LR1 A;  5DVJ A;  2VOZ A;  1GV8 A;  4MLQ A;  2HAV A;  2ZNS A;  4G68 C;  2ZYO A;  4IO4 A;  3VVD A;  3IO4 A;  1P1U A;  3ONM A;  1R9L A;  1MY0 A;  1XC1 A;  4TLM B;  1QKA A;  3E4R A;  1Y4T A;  4F1U A;  4I1D A;  3PPQ A;  1LAH E;  1D9Y A;  3G7W A;  1FQA A;  2DQV A;  1MXV A;  2OWS A;  5HBC A;  2XD3 A;  3C33 A;  3RTW B;  2PYY A;  2CZL A;  3T66 A;  3OEK A;  1LFG A;  2ONS A;  4U1O A;  4H6D A;  2F7C A;  2XXH A;  1DPE A;  1N3X A;  3T9V A;  4EF2 A;  5H8N B;  1B5J A;  3B7D A;  4THI A;  4H65 A;  1M5D A;  2RC9 A;  2NXO A;  4F1V A;  4H5F A;  4IO6 A;  1MPC A;  1OQG A;  3K6W A;  1A7L A;  5I2N A;  5CM6 A;  3O66 A;  3ILU B;  1B4H A;  2Y7W A;  3KN8 A;  2THI A;  4H8J A;  3MWB A;  4JSD A;  3H06 B;  2DWH A;  4KYD A;  2ZYM A;  2DS9 A;  4TQU Q;  4IY6 A;  4NWC A;  4ZEB A;  2OBG A;  1LFH A;  3KFM A;  4U22 A;  4AQ4 A;  4QSC A;  3MZ1 A;  4JWY A;  1S9T A;  1ZKB A;  3H6U A;  1Q35 A;  5AA4 B;  4YKI A;  2H98 A;  4GF8 A;  3S4U A;  3R7X A;  3TAJ A;  1IQ7 A;  3GXA A;  2BJJ X;  3PUX E;  1SI0 A;  3LSL A;  2DWA A;  3TCH A;  4RY1 A;  1BKA A;  1MQH A;  2Q2C A;  1EZO A;  4IGR A;  4LA9 A;  1JNF A;  1MXU A;  3S2V A;  3MC2 A;  4EQ7 A;  4ZED A;  2XX8 A;  2H99 A;  3UOR A;  4IO3 A;  1Y4C A;  3HST A;  3T9H B;  4R9G A;  1BP5 A;  2XXT A;  3HPI A;  4ISU A;  3CG3 A;  5FHN A;  5AA3 A;  1MM6 A;  1FQD A;  3RPW A;  2XX9 A;  2V93 A;  4YU0 A;  3VDF A;  3GLB A;  4RK9 A;  3PU5 A;  3MP8 A;  2VD3 A;  4IY5 A;  5ISU A;  2YPN A;  1UIU A;  3I5O A;  3KZG A;  1M5F A;  4YKP A;  1A40 A;  2QMX A;  1NNF A;  3IJO B;  5KCJ B;  1TXF A;  5LOM A;  2HFB A;  3JYR A;  1B3G A;  4KCC A;  4BDR A;  4OHN A;  4R72 A;  2F97 A;  2FYI A;  4NWD A;  1SBP A;  3HN0 A;  1XOC A;  2XXU A;  3K1M A;  2R71 A;  2F6G A;  3IK6 B;  3EF7 A;  4OES A;  1F9B A;  1MQG A;  3EN3 A;  4OWD A;  5AA2 B;  3ECR A;  3KBR A;  2OK2 A;  5TU0 A;  3U72 A;  1BLF A;  2AL4 A;  2O7U A;  3MQ9 A;  2Z8F A;  4GXS B;  3IR1 A;  1B7H A;  2X7Q A;  3GBA A;  4YAH X;  4YIC A;  3LSF B;  4LQ2 A;  2QJE A;  4DCY A;  1B2H A;  4HTG A;  1I69 A;  3UK4 A;  3FJG A;  4OFJ A;  3UGW A;  5I2N B;  1WVJ A;  1US5 A;  1B05 A;  2DXR A;  2I3W A;  4JB7 A;  4OQO A;  3QUJ A;  4WEP A;  2Q8J A;  2UVG A;  3H6W A;  2GHA A;  3PPO A;  4KFQ A;  2V84 A;  3LBS A;  1B3H A;  1SI1 A;  4X1B A;  5H8F B;  2ZXT A;  4XKQ A;  2DXY A;  4BDN A;  3FAT A;  3MVW A;  3F11 A;  3N5L A;  3TTK A;  3O9P A;  4XKR A;  4F39 A;  4EDP A;  3MJN A;  1ZTY A;  4U4X A;  4ZEC A;  1US4 A;  1Y3N A;  2DVC A;  5FTH A;  3FVN A;  5I59 B;  1YAE A;  3KGC A;  3KJ7 A;  1Y20 A;  5B7D A;  1URS A;  2G93 A;  3A3C A;  1O64 A;  4LZ5 A;  2FNC A;  3KN3 A;  4ECF A;  1IZ1 A;  4RPO A;  1B3E A;  4IO5 A;  4U4S A;  1B46 A;  2UYE A;  3B6T A;  2NUV A;  4QF9 A;  2Y84 A;  1QKB A;  2FA7 A;  2B65 A;  3KOS A;  3RT8 A;  4U1Z A;  5CMK A;  1P1Q A;  3FZV A;  5ELV A;  3S9L C;  1I6A A;  3BFT A;  1Q1K A;  1SW4 A;  3Q28 A;  3TEP A;  1I6B A;  4Q8R A;  1B7Z A;  1IXI A;  2HQ0 A;  1SD3 A;  1LBC A;  2A5T B;  2GH9 A;  4ZEK A;  4YMB A;  2HZL A;  1B1H A;  2F8D A;  4DXB A;  2IEE A;  4KR5 A;  2PBW A;  3H7M A;  1N04 A;  2XXW A;  1LAG E;  3OO9 A;  1OQH A;  4GIZ A;  1P99 A;  4ND9 A;  2XD2 A;  3H3G A;  5L9M A;  4G77 A;  4I62 A;  5B70 A;  4OZ9 A;  5TPA A;  1QJM A;  3G3I A;  4M1V A;  5BUU A;  2PMS A;  4QFP A;  1M5B A;  2V3Q A;  3G3K A;  1OLA A;  2PVU A;  4QRZ A;  2F6P A;  3KSX A;  2VP1 A;  4F18 A;  4NF4 B;  1OVB A;  2VGQ A;  2ZYN A;  1NNK A;  3OEL A;  1B4Z A;  4GL0 A;  3SER A;  1SW2 A;  3TEL A;  1FCK A;  3QAX A;  2QS2 A;  3QUF A;  4MFI A;  5I2K A;  5KZT A;  2Q88 A;  1SYH A;  2ZNT A;  3U8Q A;  3G3G A;  3EQ1 A;  2E0S A;  3OXN A;  2Z23 A;  3Q25 A;  4K3F A;  4AB6 A;  1IUD A;  4FE8 A;  1UTH B;  3LSW A;  4TOZ A;  5I57 B;  1B40 A;  3KN7 A;  4KPT A;  4NTL A;  5AA2 A;  4YB5 A;  1H3D A;  3TZA A;  2QMW A;  1D3K A;  5I58 B;  5TP9 B;  4MH5 A;  4F3B A;  1T0K A;  3PPP A;  2Y7K A;  4H5G A;  4H0W A;  3C32 A;  2NOO A;  4NE4 A;  3MVX A;  3PPN A;  5K2X A;  4BLA A;  3DP8 A;  4O3A A;  4F19 A;  2I4C A;  1YTV A;  1N7X A;  1ANF A;  3VXC A;  1PEB A;  3O2A A;  4O3C A;  5FTI A;  2OWT A;  4FED A;  4EQ9 A;  3QXM A;  1XVX A;  3MW0 A;  1R9Q A;  1N3W A;  4BDQ A;  4F29 A;  4ZEI A;  1QW0 A;  4OFL A;  3RY3 A;  1NL5 A;  5CBR A;  3CFZ A;  2ZMB A;  5ITO A;  4KI0 E;  2O68 A;  4YKK A;  3THI A;  5DVF A;  1MG1 A;  1DTZ A;  1MH4 A;  3MUQ A;  4PET A;  3TFL A;  5HM4 B;  1UTB A;  3P7I A;  2H25 A;  2Y7P A;  1PDA A;  3FD3 A;  3M3F A;  3FXR A;  4G2Z A;  3VXB A;  3ZKK A;  4PP0 A;  2Q89 A;  3ZS6 A;  5CI5 A;  1B1X A;  1II5 A;  2VD2 A;  3USD A;  3SES A;  5I59 A;  4OFO A;  2QL3 A;  4C1U A;  1Y3Q A;  1CE2 A;  4R73 A;  1LLS A;  2D5W A;  3QIM A;  1AH5 A;  2O51 A;  4NF8 B;  4PFW A;  1QUI A;  3RLF E;  2ZNU A;  4NF5 A;  3LSX A;  1LB9 A;  1URD A;  3CFL A;  1HSE A;  1JVY A;  3B6Q A;  4LUB A;  2O1L A;  3DP4 A;  1GTK A;  5CMC A;  3MZ9 A;  4L17 A;  2GFE A;  3R26 A;  1NNP A;  1A55 A;  4OER A;  1MY2 A;  3K2D A;  3OSR A;  3PGF A;  2X7P A;  1TWY A;  3L6H A;  3PPR A;  1B32 A;  1LAX A;  1R6Z A;  4LZ8 A;  3TUS A;  3MP6 A;  4LVQ A;  1BTJ A;  2QS4 A;  3OD7 A;  5DVI A;  3UN6 A;  4FAT A;  3I3V A;  3O28 A;  5IAI A;  3RUM A;  4AB5 A;  4U23 A;  2A5T A;  1WOD A;  2O1M A;  2DOJ A;  2PX1 A;  3B6W A;  4LON B;  4R74 A;  1MS7 A;  4UAC A;  3MAM A;  4E0X A;  4F31 B;  1ZIU A;  4R6Y A;  1SVX B;  3FVK A;  3K02 A;  3QK6 A;  1O63 A;  1AMF A;  3U94 A;  1MXX A;  5TPA B;  3PUZ E;  1SQY A;  4ELO A;  4GWO A;  4F3G A;  5AE4 A;  5I56 A;  1MXY A;  4QFO A;  3S9E A;  1DPP A;  3H6V A;  4E0W A;  1EH3 A;  3EHS A;  1MDP 1;  5JTY B;  1TT1 A;  2V3T A;  4FEB A;  4JWO A;  5FHO A;  3MVZ A;  3N94 A;  4ZEF A;  1LGB C;  2UVI A;  2ZYK A;  4DE8 A;  4GD5 A;  1JEV A;  3IOU A;  2DE2 A;  1LST A;  2HZK A;  1SW1 A;  1Y3P A;  4OEU A;  5I57 A;  1LAF E;  1JW4 A;  3EPE A;  3MPK A;  4PFY A;  4RK2 A;  5H8N A;  1S50 A;  5DEX A;  1N84 A;  5AA1 A;  1Y1M A;  4LAT A;  4KHZ E;  4I9D A;  1QUL A;  4RJZ A;  2R9J A;  5L9O A;  1FTL A;  2WKY A;  2XXI A;  3W9V A;  1LFI A;  1IIT A;  2PT2 A;  1JEU A;  1MPB A;  2KLF A;  3LC8 A;  3TCF A;  3E3K A;  4IO2 A;  2RC7 A;  4FOR A;  1H44 A;  3PMV A;  4RNS A;  2PT1 A;  3O6H A;  3CSB A;  2ALU A;  4PE5 B;  4YB7 A;  4NF6 A;  2RKM A;  3DEL B;  1UQW A;  4OVJ A;  2I4B A;  3V5A A;  3FIR A;  1QVS A;  3FUZ A;  3N6U A;  2A5S A;  3IAZ A;  4F2O A;  3S9M C;  4NMY A;  3D4G A;  4YMA A;  3OO6 A;  4O3B A;  3PUV E;  4NED A;  3IL1 B;  3MVY A;  5H8Q B;  3WAF A;  1TFA A;  2XXY A;  3FXQ A;  3H6T A;  3M3L A;  4Q5T A;  2QRY A;  1DMB A;  2O6A A;  2R6G E;  2RCB A;  4GLI A;  4LP2 B;  1IIW A;  3O6I A;  2XHD A;  4NF6 B;  1POT A;  3KJT A;  3PD8 A;  4DXU A;  4POX A;  4ZDM A;  5ICT A;  2AL5 A;  1FQC A;  1J1N A;  1Z7M E;  3HV1 A;  4R75 A;  5ICQ A;  1NKX A;  3JZJ A;  5I84 A;  1A8E A;  3DM0 A;  3G3J A;  3CFX A;  1H76 A;  1UTH A;  2Z8D A;  1NFT A;  3Q29 A;  3O97 A;  4ELQ A;  2X26 A;  4MLV A;  3MPL A;  2YLN A;  4QSE A;  1M5C A;  3SEU A;  3U1O A;  4GVO A;  5JK4 A;  1O7T A;  3SDF A;  3FAS A;  1MQJ A;  3IOR A;  4ELP A;  1R1N A;  2D21 A;  4GXA A;  4PFT A;  1MH3 A;  3E13 X;  1YCJ A;  3L6G A;  3O6G A;  2O84 X;  5L8D A;  3U92 A;  4QHQ A;  4F3S A;  1FQB A;  2ESN A;  4GRK A;  2XXV A;  2I48 A;  3K01 A;  4XIG Q;  5K2Y A;  5CBS A;  1QUJ A;  4BDO A;  5ITP A;  4G8N A;  4JDF A;  4QFN A;  4N13 A;  4ZE8 A;  1LCF A;  4UA8 A;  2XXQ A;  2XXR A;  3MBP A;  3TCG A;  3TTN A;  2I6E A;  3GBB A;  1A54 A;  3C31 A;  3VFJ A;  4YZZ A;  3CR9 A;  3TQW A;  1Y1Z A;  3VV5 A;  2O7I A; 
#chains in the Genus database with same CATH topology
 4ZYH A;  4BC9 A;  3RT6 B;  4DDD A;  2H36 X;  1N34 E;  2Z22 A;  2DB2 A;  4DZ1 A;  4EUO A;  5KL3 A;  2VPN A;  5A6K A;  1NH7 A;  1Z7N E;  1PB8 A;  2B3F A;  1QUK A;  3C34 A;  1P1O A;  2UVH A;  1A1F A;  4YKJ A;  4DUY E;  4PAK A;  1NH8 A;  1HSJ A;  3PUW E;  4U21 A;  2V3U A;  4I3E A;  3TTL A;  1VR5 A;  1XT8 A;  4P56 A;  3U93 A;  4XKN A;  4I40 A;  4BS9 A;  4WSG A;  1YXI A;  4DIG A;  1YYK A;  3BKI B;  2I49 A;  4JI3 E;  1OMP A;  4F3P A;  2DWI A;  2Q9T A;  3FJ7 A;  3SKP A;  4JWX A;  2BJI A;  1EU8 A;  3T9U A;  1IXG A;  1ZR9 A;  2JP9 A;  2WEF A;  3NOH A;  4NG7 A;  1RYO A;  1GR2 A;  1FPG A;  4IGT A;  5L9S A;  3QYT A;  1RDZ A;  1EZ9 A;  1N7W A;  4F22 A;  2P0S A;  3FIG A;  5IZZ A;  2F8B A;  5A5X A;  4DI4 B;  4JSO A;  5IZ3 B;  4FAJ A;  1A99 A;  3CVG A;  2M8C A;  2OJT A;  2N3G A;  3IO6 A;  3BF2 A;  4M4G A;  4XKP A;  4GBV A;  4HS7 A;  4GEQ B;  1KWH A;  2Y7R A;  1B52 A;  2OZZ A;  1MQI A;  5JEI A;  3HO7 A;  1OIB A;  3AXF A;  3VVF A;  3GYY A;  4QSD A;  1YUI A;  3RTF B;  4N8G A;  1J26 A;  1MY4 A;  3PD9 A;  2XWK A;  1OLC A;  2ANJ A;  1IEJ A;  3FV2 A;  4H1X A;  4O5G A;  4G4P A;  1PB7 A;  5KL4 A;  4LZ7 A;  4KXP A;  3CRB A;  1LLM C;  3K6V A;  3D4C A;  4I8C A;  2ELY A;  4EQB A;  3A09 A;  4BDL A;  2EOM A;  2ADR A;  2NVU B;  3TPA A;  1YPN A;  1TFD A;  2EM4 A;  1B3L A;  2HC5 A;  3VYY A;  3K6Q A;  4QFK A;  2I0C A;  4DCX A;  1B5I A;  3ODB A;  3ZSF A;  4F9B B;  3SET A;  4KD5 A;  4R2F A;  2VHA A;  2OLB A;  2CMO A;  4XXU A;  5H8H A;  1UBD C;  4N15 A;  2GRV A;  2GQ1 A;  2B7V A;  3RNN A;  1MDQ A;  1FPJ A;  1L5T A;  4IO7 A;  4P9K A;  2YJP A;  4OEV A;  5H8S A;  1NCS A;  4OTE A;  3CSG A;  1LBV A;  2FTX B;  1USY H;  1IBK E;  2F34 A;  3V8X B;  4XTC Q;  4ZS9 A;  2H4I A;  1S7Y A;  4B3R E;  3MZB A;  3JAM C;  2HAU A;  4KQP A;  4P11 A;  2KOU A;  4JI7 E;  2VOZ A;  4HE0 A;  4OAN A;  3VVD A;  1MY0 A;  1LAH E;  4PDD A;  3G7W A;  2DQV A;  1MXV A;  3MSW A;  5AE3 A;  3C33 A;  2CZL A;  1LFG A;  1CNQ A;  2CTD A;  4QXD A;  5I7I A;  2EN2 A;  4IO6 A;  1OQG A;  3E79 A;  1NEI A;  4H8J A;  4JSD A;  2DWH A;  3RPL A;  2YTE A;  2GHF A;  1EH7 A;  4Q28 A;  1LFH A;  4LN5 A;  1ZKB A;  5AA4 B;  4YKI A;  1G0I A;  3IWD A;  4RY1 A;  2Q2C A;  1MQH A;  5AE1 A;  5FBP A;  4EQ7 A;  2M7Q A;  3C4B A;  4IO3 A;  2XXT A;  3EPH A;  2NUE A;  2V93 A;  4YU0 A;  4MHF A;  2VD3 A;  2YPN A;  4YKP A;  3EPL A;  3I5O A;  3KZG A;  2FGG A;  5LOM A;  3DJW A;  2QVR A;  1SPI A;  2F97 A;  2V86 A;  4NWD A;  1SBP A;  3K1M A;  2XXU A;  2R71 A;  3IK6 B;  3EF7 A;  1SR9 A;  3ECR A;  3U72 A;  1FPI A;  2AL4 A;  2X7Q A;  3LSF B;  3H09 A;  4DCY A;  4HTG A;  3UGW A;  1US5 A;  1IMB A;  1B05 A;  2DXR A;  3QUJ A;  2UVG A;  3M99 B;  3H6W A;  2EPN A;  1B3H A;  4X1B A;  1AWB A;  4XKQ A;  4BDN A;  3MVW A;  1ZTY A;  2EM6 A;  1Y20 A;  1URS A;  2G93 A;  4LZ5 A;  1B46 A;  2WBT A;  3B6T A;  4J8Z A;  2NUV A;  2KQZ A;  1I6A A;  3BFT A;  3Q28 A;  1I6B A;  4GWU A;  5F24 A;  1X49 A;  2LCE A;  4DXB A;  1KZ8 A;  2OWZ A;  2PBW A;  4GIZ A;  1P99 A;  2VF1 A;  4I62 A;  2EMK A;  1QJM A;  2NAB A;  4QFP A;  1M5B A;  3G3K A;  2EPZ A;  4WX9 A;  1JK1 A;  2F6P A;  3KSX A;  4F18 A;  3OEL A;  2B4M A;  4MJO A;  3TEL A;  1FCK A;  2LRS A;  4MFI A;  2MDG A;  3U8Q A;  2E0S A;  3OXN A;  4TOZ A;  4KPT A;  4PTK A;  2ZZV A;  4PF6 A;  2Y7K A;  2VQF E;  2NOO A;  5K2X A;  4F19 A;  2NA2 A;  1N7X A;  4H45 A;  4O3C A;  1IME A;  2OWT A;  4FED A;  4KHP E;  1R9Q A;  1HNX E;  1YZ0 A;  4ZEI A;  3RY3 A;  2EPL X;  3KWR A;  2QFL A;  4OVQ A;  3IWB A;  2O68 A;  4P1E A;  5DVF A;  3FXB A;  1PJQ A;  1MH4 A;  4LFB E;  1NV0 A;  5ESY A;  1UTB A;  3P7I A;  2H25 A;  4G2Z A;  2EOI A;  4PP0 A;  3ZS6 A;  2FHY A;  1II5 A;  4M0V A;  5I59 A;  2UXD E;  4F9C B;  3U65 A;  1AH5 A;  1FJ9 A;  2YSO A;  3B6Q A;  4O7M A;  3DP4 A;  1GTK A;  4L17 A;  1XMQ E;  1NNP A;  4Q30 B;  1TWY A;  2E72 A;  3PPR A;  1LAX A;  3HPZ A;  3EKI A;  3MP6 A;  4LVQ A;  5DVI A;  3OD7 A;  1KJK A;  1NUY A;  1DGC A;  2O1M A;  4R74 A;  4G61 A;  2CT1 A;  4F31 B;  1O63 A;  2VRD A;  3U94 A;  1MXX A;  4PFB A;  5J16 A;  2EPM X;  4GWO A;  4AQY E;  4QFO A;  1DPP A;  3S9E A;  3EHS A;  2V3T A;  4JWO A;  5FHO A;  5CFF E;  3HQ1 A;  2B4L A;  1SW1 A;  4OEU A;  3MPK A;  3EPE A;  4PFY A;  1N84 A;  2EWL A;  2EMI A;  4LAT A;  4I9D A;  2R9J A;  4B3T E;  2PT2 A;  1EH8 A;  3PMV A;  3MHH C;  4ZYE A;  4MNI A;  3O6H A;  4L5N C;  2ALU A;  3DEL B;  4OVJ A;  2LVH A;  3FIR A;  2JJK A;  2LT7 A;  2A5S A;  3D4G A;  3OO6 A;  3MVY A;  1TFA A;  3H6T A;  4Q5T A;  2R6G E;  4OFO A;  4DXU A;  4IJD A;  1IIW A;  1POT A;  4POX A;  1Z7M E;  3BID A;  3JZJ A;  5IWA E;  5I84 A;  1FBH A;  2WX9 A;  3DM0 A;  2YRK A;  1H76 A;  1UTH A;  2CZI A;  2Z8D A;  3LV0 A;  2YLN A;  2LO3 A;  3SEU A;  3FAS A;  3T0J A;  4PFT A;  1MH3 A;  3E13 X;  5CBS A;  1FQB A;  4GRK A;  2XXV A;  1PJT A;  1FPF A;  2EMC A;  4GBW A;  4F2J C;  4GX3 A;  1X6H A;  1J5E E;  3C4T A;  1Y1Z A;  5AA2 B;  2IHR 1;  3H4Z A;  5IT9 C;  3S9N C;  4NF4 A;  4RHB B;  4U2R A;  1MXW A;  4NHR A;  4PAF A;  3SEY A;  1VE4 A;  4MIJ A;  5ET7 A;  3UA8 A;  4GX6 A;  3C35 A;  1UIL A;  4MCO A;  1FRP A;  2ELZ A;  1XI6 A;  3K6U A;  4DMI A;  1IXH A;  3C6K A;  1B7U A;  3UK3 C;  2P2A A;  1PB9 A;  3HFU A;  2F5X A;  3Q27 A;  2EMY A;  5BWJ A;  4C0R A;  2UXA A;  2V25 A;  2DSY A;  2LAO A;  1ZBM A;  4DLD A;  4LF4 E;  3FGS A;  1XVY A;  5LDZ A;  2O69 A;  2YTF A;  3SZP A;  5EQA A;  4DR4 E;  3CG1 A;  5I56 B;  2QPQ A;  2QSX A;  2YRH A;  2DMI A;  1IXC A;  2WCC 3;  5FHM A;  4GZN C;  2KON A;  3K0V A;  3C6M A;  1Y9U A;  2E1S A;  3E78 A;  3GZG A;  2EOQ A;  1N0T A;  3L00 A;  4HEI A;  3I6V A;  5EHS A;  2H9B A;  2RIN A;  1B58 A;  5KCJ A;  1DOT A;  2ABH A;  5KDT B;  4OXV A;  4N07 A;  5EYF A;  3UP9 A;  4MF3 A;  1FSA A;  4X1D A;  3ILT B;  3K1N A;  1B0L A;  5KL5 A;  2ONR A;  2LTS A;  1MM7 A;  2I0B A;  4O43 A;  5F1Q A;  1NV6 A;  3RQT A;  4R2B A;  1XNR E;  4GFR A;  2DRP A;  3C4M A;  2RCA A;  5EYG A;  3C9H A;  2JYA A;  3ADL A;  1YYO A;  4I8O A;  4H8I A;  4I3Y A;  1MY3 A;  4RA1 A;  1MQD A;  4PFU A;  1H45 A;  2B3B A;  1G2F C;  2JXP A;  2LJH A;  2REJ A;  4NX1 A;  1X6E A;  2G29 A;  4WKM A;  2L33 A;  2AYS A;  3JV9 A;  5A6J A;  4B3M E;  4FIM A;  1URG A;  4PC9 A;  1NV3 A;  4YB6 A;  3O29 A;  3KOT A;  5EQ9 A;  2RTX A;  2LMZ A;  1N36 E;  1NMU A;  1RKM A;  1D9V A;  2A25 A;  1SDX A;  3FBP A;  1ZJL A;  5IV8 B;  3OEM A;  4GQO A;  5A2Q C;  3W9W A;  4EXK A;  4F3G A;  1NV2 A;  5EHM A;  1BK4 A;  2YZT A;  2Y7I A;  3HHF A;  4X9T A;  3BBR A;  2CPN A;  2HGH A;  2DVZ A;  4O7I A;  2ENA A;  4JVI A;  1OVT A;  1PC3 A;  3T1Y E;  1GQE A;  2RSI A;  1CB6 A;  2EMZ A;  1TF3 A;  4ESW A;  2EMH A;  3KG2 A;  3N26 A;  4OET A;  5CMB A;  1DI2 A;  4N6P A;  3V89 B;  3TQL A;  2CEX A;  1ZMG A;  2E5L E;  2YRM A;  3KC1 A;  3TYH A;  2UYF A;  4NZV A;  4BMJ A;  4GWS A;  1F2I G;  4IO4 A;  2MKZ A;  3E4R A;  4F1U A;  1D9Y A;  4IS1 C;  1FQA A;  4WSP A;  5HBC A;  4YY3 E;  5IGA A;  2XD3 A;  3RTW B;  3BBG A;  3OEK A;  2ONS A;  1DPE A;  4DR3 E;  2N3H A;  3B7D A;  1A1G A;  4THI A;  4F1V A;  2NXO A;  2YTO A;  4P8B A;  1MPC A;  4YHH E;  1A7L A;  3O66 A;  4MX6 A;  2EM3 A;  4NAP A;  2EPO A;  2THI A;  2EMF A;  4F6M A;  1XMO E;  3MZ1 A;  1Q35 A;  2H98 A;  3R7X A;  3GXA A;  3LSL A;  2DWA A;  2EMG A;  4LA9 A;  1JNF A;  1MXU A;  3S2V A;  3MC2 A;  1ZU1 A;  4ZED A;  2H99 A;  1FBF A;  1Y4C A;  3MST A;  3VHT B;  1N32 E;  3GLB A;  4RK9 A;  3MP8 A;  1RDY A;  5AC5 A;  4IY5 A;  4WXD A;  2ZZX A;  1A40 A;  3JYR A;  4KCC A;  4OHN A;  3ZKK A;  1XOC A;  2F6G A;  4OWD A;  5HPQ A;  3EN3 A;  2DLK A;  1F9B A;  2CZH A;  4P7D A;  2EOE A;  1BLF A;  4DV2 E;  2O7U A;  1QU6 A;  3MQ9 A;  1HNZ E;  4NN3 A;  4GXS B;  3IR1 A;  4YAH X;  4LQ2 A;  2QJE A;  5IZ1 A;  1I69 A;  3UK4 A;  4OFJ A;  2JWO A;  1WVJ A;  1HNW E;  4JB7 A;  2K4V A;  4N91 A;  3F6G A;  2Q8J A;  1X6F A;  3BGH A;  4KFQ A;  5H8F B;  2ZXT A;  3F6H A;  4OX9 E;  3OTO E;  4N4U A;  2UU9 E;  3TTK A;  3F11 A;  3O9P A;  1FPK A;  1A1L A;  4XKR A;  4U4X A;  5I59 B;  1O64 A;  2FNC A;  2UXB E;  2CZK A;  4QBA A;  2Q8U A;  5AE2 A;  1QKB A;  3BIG A;  1NUX A;  1T38 A;  1Q1K A;  2RSM A;  1LBC A;  2GH9 A;  2HZL A;  2IEE A;  3H7M A;  1LAG E;  4ND9 A;  2XD2 A;  4G77 A;  2JR1 A;  1LBX A;  2WYK A;  3J7Y p;  3G3I A;  4M1V A;  5BUU A;  4QRZ A;  4BBY A;  4GL0 A;  1SW2 A;  5KZT A;  2Q88 A;  1SYH A;  1NI9 A;  2ZNT A;  4X62 E;  2LTR A;  1IUD A;  1UTH B;  2UUC E;  4NTL A;  5DNY A;  4YB5 A;  2G7H A;  3TZA A;  1D3K A;  4MH5 A;  3LML A;  1T0K A;  4NE4 A;  2EM8 A;  3PPN A;  4BLA A;  4O3A A;  2K7I A;  4JI4 E;  5FTI A;  1JP4 A;  1KA1 A;  4F29 A;  4PF8 A;  5A5L A;  1NL5 A;  4JV5 E;  4GKK E;  5CBR A;  4LF9 E;  4YKK A;  2EE8 A;  1MG1 A;  5I3S A;  3JTZ A;  2EPX A;  2Y7P A;  1PDA A;  4DUZ E;  3JU0 A;  4WPY A;  5A6B A;  2EPK X;  3SES A;  1CE2 A;  4R73 A;  3QIM A;  4NF8 B;  4OVS A;  1GZ6 A;  2O1L A;  1ZBQ A;  2ENH A;  5ET5 A;  4WXC A;  3OSR A;  4LZ8 A;  1B32 A;  2QS4 A;  5IAI A;  3I3V A;  5A6B D;  3B6W A;  4XF5 A;  1MS7 A;  3MAM A;  2LV2 A;  1T4O A;  4R6Y A;  2VQE E;  1YYZ A;  3PUZ E;  4R8O A;  2XWO A;  4RH8 A;  4ELO A;  5I56 A;  2HPG A;  3H6V A;  2Y5L A;  2HJJ A;  4JVD A;  2YTI A;  5JTY B;  2R76 A;  3N94 A;  4ZEF A;  1LGB C;  2ZYK A;  4GD5 A;  2JY9 A;  4DV1 E;  3ADI A;  1Y3P A;  5I57 A;  1JW4 A;  2EM5 A;  5AA1 A;  4WFT A;  4KHZ E;  4RJZ A;  2WKY A;  2XXI A;  4ECF A;  1IIT A;  3LC8 A;  1JEU A;  1MPB A;  3TCF A;  4IO2 A;  4FOR A;  1H44 A;  1PJS A;  4P78 A;  4YB7 A;  3HPS A;  3V5A A;  3S9M C;  4NMY A;  4YMA A;  5H8Q B;  2XXY A;  2L92 A;  3FXQ A;  2QRY A;  2V4C A;  5ICQ A;  5ICT A;  4L8N A;  2AL5 A;  1FQC A;  3HV1 A;  2CEY A;  2P3V A;  1A8E A;  3G3J A;  3O97 A;  5ET6 A;  2X26 A;  4MLV A;  3MPL A;  5JK4 A;  3U1O A;  4ELP A;  1YCJ A;  4F3S A;  3O6G A;  3U92 A;  2EMA A;  4XIG Q;  3K01 A;  4B3S E;  2PFZ A;  4BDO A;  4G8N A;  4JDF A;  4ZE8 A;  2BB8 A;  1SFE A;  3TCG A;  2XXR A;  3MBP A;  4MMP A;  4JI2 E;  1FBG A;  1A1I A;  3VFJ A;  2YTQ A;  3CI8 A;  3K1P A;  4LU9 A;  2FVZ A;  3E9X A;  1XNQ E;  4EF1 A;  4LQ5 A;  2B7T A;  3G3F A;  3KSJ A;  3J7A G;  2WYP A;  4G68 A;  4Q0C A;  3TKD A;  4XEQ A;  4GL8 A;  3M8U A;  2V85 A;  3RN8 A;  2EJ4 A;  2RS6 A;  2H5Y A;  3TOD A;  5JTY A;  4KZS A;  1WJP A;  2WBS A;  3FXU A;  3WAE A;  3SEX A;  3OO8 A;  3VK6 A;  1FTM A;  2QS3 A;  1JET A;  1RDX A;  4F2Q A;  2F3B A;  1SYI A;  2WBU A;  3FV1 A;  2I9I A;  4PQJ A;  1VDW A;  1JQF A;  4RPN A;  1ELJ A;  1UTB B;  1GGG A;  2DYX A;  3OO7 A;  5A6A A;  2XXX A;  2LUQ A;  3ZKL A;  3CHG A;  2EL4 A;  4WXJ A;  1ZLQ A;  2HCA A;  2EMW A;  3DP6 A;  1I6Q A;  4ZZE A;  1A1K A;  3PUY E;  1HSL A;  3EHU A;  3K00 A;  3MP1 A;  4PGP A;  5H8F A;  3IJX B;  5KDT A;  4FJP A;  2OX3 A;  3R6U A;  3EHT A;  2HHM A;  2L5V A;  1FBE A;  2HXW A;  2FBP A;  2EN1 A;  2EL6 A;  3IFC A;  2F36 A;  1NV5 A;  2R8T A;  2ONK E;  2YTN A;  1FTA A;  4MAG A;  2I3V A;  3T1B A;  4DXC A;  1NUW A;  5DTB A;  5I2K B;  1FTK A;  4KCD A;  1B51 A;  1FQF A;  4P0G A;  1SW5 A;  4R2R A;  2J7J A;  3DLN A;  4N17 A;  1IBM E;  2GHB A;  4MBP A;  2ENC A;  1JK2 A;  4ZZA A;  2AIX A;  3A3U A;  3QSL A;  4OVP A;  2EMX A;  3IX1 A;  4NF5 B;  4MNC A;  1QNT A;  2KR0 A;  1POY 1;  4HXV A;  2RC8 A;  5AA2 D;  1MPD A;  2XX7 A;  2WZO A;  5ADZ A;  4N6D A;  3N6T A;  3RMP A;  3K6X A;  5IXM B;  3TDJ A;  1P1N A;  4ELR A;  4G8H A;  2JPA A;  1STU A;  1ATG A;  2EOX A;  3VE1 B;  3T93 B;  5IKB A;  1VFE A;  4N6K A;  3HCQ A;  4PBQ A;  1N76 A;  3VVE A;  3IOT A;  3UIF A;  4H67 A;  5F7V A;  1VSO A;  2EOS A;  1FQE A;  4OEN A;  4OMB A;  4R2S A;  1FTO A;  3PMW A;  3THN A;  4R9F A;  4ZE9 A;  2DE4 A;  2P1S A;  1JW1 A;  4X04 A;  4DR1 E;  2Q2A A;  2HEU A;  3V83 A;  2EN8 A;  3PMX A;  4P3L A;  4NF8 A;  3IB1 A;  5CRY A;  4KYE A;  4JXI A;  4Z7E A;  1Q9D A;  3M3K A;  4MNP A;  4R6K A;  5CMM A;  2OCU A;  1P1W A;  4HW8 A;  1RC7 A;  5F3W A;  4DR7 E;  4OVT A;  4LF6 E;  3IO4 A;  4TLM B;  1XC1 A;  1Y4T A;  4I1D A;  2OWS A;  1ZAA C;  4U1O A;  4JI0 E;  1N3X A;  4EF2 A;  2JVA A;  1X5W A;  1M5D A;  2RC9 A;  4H5F A;  3IFA A;  2LE2 A;  3K6W A;  5I2N A;  2VPO A;  1AAY A;  3ILU B;  3KN8 A;  3MWB A;  4KYD A;  3B8B A;  4IY6 A;  4NWC A;  4R2P A;  4DR2 E;  1DQ3 A;  2OBG A;  5BR8 E;  4TUI A;  4U22 A;  4ZEB A;  4JWY A;  1S9T A;  3H6U A;  4P47 A;  4GF8 A;  4F54 A;  3PUX E;  1SI0 A;  1EZO A;  3TCH A;  1BKA A;  4IGR A;  3RYD A;  2XX8 A;  3HST A;  1BP5 A;  2I13 A;  3HPI A;  4ISU A;  3CG3 A;  1MM6 A;  1FQD A;  3EPK A;  3VDF A;  5ISU A;  4BC7 A;  1M5F A;  2QMX A;  1LBY A;  1NNF A;  4ZYG A;  1TXF A;  5KCJ B;  2HFB A;  1B3G A;  4O94 A;  2FYI A;  3SEV A;  4OES A;  4R6H A;  1EYI A;  3KBR A;  1NUZ A;  4OOG C;  1X47 A;  3GBA A;  4YIC A;  1IMU A;  1YFH A;  3FJG A;  2P3N A;  4WEP A;  2L3C A;  2GHA A;  3LBS A;  1SI1 A;  2DXY A;  1FBD A;  3N5L A;  4EDP A;  2RQL A;  3MJN A;  1US4 A;  5FTH A;  1FPE A;  3KJ7 A;  5B7D A;  4R2E A;  3A3C A;  2GLI A;  3VYX A;  1FBP A;  3KN3 A;  4IR8 A;  4RPO A;  4UAB A;  4U4S A;  1TF6 A;  2UYE A;  2UXC E;  4X8W A;  2FA7 A;  2B65 A;  5CMK A;  5ELV A;  3S9L C;  4N81 A;  3TEP A;  4Q8R A;  2Q8M A;  2HQ0 A;  1WXR A;  1SD3 A;  2A5T B;  4ZEK A;  4YMB A;  4BCA A;  1B1H A;  2F8D A;  4LF7 E;  2F4V E;  2L2N A;  1EKZ A;  4X9J A;  1N04 A;  2XXW A;  1OQH A;  5L9M A;  3H3G A;  1N33 E;  2L6M A;  2PMS A;  1A1J A;  5LMN E;  5ET8 A;  2PVU A;  2VP1 A;  3SER A;  4GWY A;  1NNK A;  3LUZ A;  1B4Z A;  3B50 A;  3HXL A;  1FKA E;  3QUF A;  2EMB A;  1A1H A;  2Z23 A;  3Q25 A;  4K3F A;  4FE8 A;  2MDR A;  3LSW A;  5I57 B;  1BBO A;  4DV0 E;  1H3D A;  2QMW A;  5I58 B;  4F3B A;  2UUA E;  4H5G A;  1IMA A;  4DR6 E;  4H0W A;  3C32 A;  4NF0 A;  3D1R A;  5T3J A;  3DF6 A;  2I4C A;  1YTV A;  4X64 E;  2ODR D;  1PEB A;  3J81 C;  4GKJ E;  4O24 A;  1N3W A;  4GWW A;  1QW0 A;  2ZMB A;  1WRJ A;  5ITO A;  4KI0 E;  3THI A;  3MUQ A;  1FJG E;  3TFL A;  2L8T A;  3M3F A;  3VXB A;  1B1X A;  4DV4 E;  4M30 A;  2QL3 A;  4C1U A;  1Y3Q A;  1LLS A;  2D5W A;  4PFW A;  3A29 A;  3RLF E;  4NF5 A;  3LSX A;  4LTY A;  1URD A;  1JVY A;  1K9Z A;  4LUB A;  3MZ9 A;  1A55 A;  1MY2 A;  2B9D A;  3PGF A;  1R6Z A;  1BTJ A;  2EQ0 A;  1T4N A;  4U23 A;  3RUM A;  2L3J A;  1WOD A;  2PX1 A;  2ZZW A;  4LON B;  1EYJ A;  4R03 A;  4N4R B;  1SVX B;  2Y5K A;  3QK6 A;  2VT5 A;  5IM2 A;  5TPA B;  5AE4 A;  1MXY A;  1UN6 B;  1NV1 A;  1EH3 A;  2VE7 C;  1MDP 1;  1TT1 A;  4DV3 E;  2LBS B;  3MVZ A;  3ADG A;  2UVI A;  4DE8 A;  1JEV A;  3IOU A;  4F6N A;  2DE2 A;  2HZK A;  5T6J A;  1LAF E;  3UN6 A;  5H8N A;  1NV4 A;  1Y1M A;  5L9O A;  3W9V A;  3BIH A;  3E3K A;  2EN7 A;  4RNS A;  2PT1 A;  2RKM A;  4PGN A;  2EPA A;  3N6U A;  3IAZ A;  4NHB A;  4NED A;  3IL1 B;  4BDM A;  5CM6 A;  3M3L A;  2V89 A;  1DMB A;  2RCB A;  3QMF A;  4NF6 B;  3O6I A;  3KJT A;  4MEV A;  3PD8 A;  4ZDM A;  1J1N A;  4R75 A;  2V87 A;  4N8Y A;  3CFX A;  2EOY A;  3Q29 A;  4ELQ A;  1NFT A;  1ZBT A;  1G2D C;  4F2O A;  5L8D A;  3L6G A;  2O84 X;  4QHQ A;  2ESN A;  2EOZ A;  2I48 A;  5ITP A;  2FIX A;  5K2Y A;  1QUJ A;  3MHS C;  4QFN A;  4N13 A;  1LCF A;  4UA8 A;  3GBB A;  3ADJ A;  1A54 A;  3C31 A;  4AS5 A;  4YZZ A;  3CR9 A;  3KFM A;  2O7I A;  3K4U A;  3TTR A;  4C1T A;  1QGX A;  1YSA C;  4JI8 E;  1FJ6 A;  1FW0 A;  1EH6 A;  3PV0 E;  4HCW A;  2XA5 A;  3VLU A;  5H8Q A;  1RMD A;  2F7A A;  3FVO A;  5J1D A;  1ZU0 A;  2WBD A;  2MC6 A;  3ISP A;  1LBB A;  2HXR A;  2Z8E A;  2YSP A;  4KYS A;  1MY1 A;  1MRP A;  4F9A B;  1B0H A;  4R2C A;  4POW A;  1AOV A;  2D3I A;  1USY E;  4RYA A;  1X3C A;  4JI6 E;  2LUP B;  1IQS A;  4Q35 B;  3IOW A;  4Z0I A;  3OML A;  3FJM A;  2V8Q B;  2EQ3 A;  1LCT A;  1LB8 A;  1IMC A;  3VLW A;  1DTG A;  4QFL A;  3OEN A;  2REG A;  4BHB A;  1B6H A;  1HR0 E;  5AAS A;  1PBP A;  3TTM A;  5TP9 A;  3IOV A;  5CC2 A;  2M1S A;  1DCU A;  1MXZ A;  3Q26 A;  4P0I A;  2F78 A;  4PBH A;  2EL5 A;  3FVG A;  1A8F A;  3CIJ A;  2I58 A;  3OMB A;  5FLX C;  4X8R A;  4PAI A;  4LFC E;  2DE3 A;  3J80 C;  2PRT A;  4FEC A;  1H43 A;  4WED A;  4TLL B;  5A5X B;  1B3F A;  2IA4 A;  3KEI A;  2EN6 A;  2RPC A;  1IMD A;  4KWY A;  3W15 C;  2QS1 A;  4JVC A;  5DYH A;  5EQ8 A;  1TN9 A;  1WHN A;  2DWJ A;  5KL2 A;  1KA0 A;  2MKN A;  4PFI A;  2DP8 A;  1DSN A;  3KZY A;  1NNT A;  2EM2 A;  3TMG A;  2XXP A;  3TQM A;  3HHG A;  2YU5 A;  1AL3 A;  1XS5 A;  3BFU A;  1JVX A;  3OSQ A;  3C36 A;  3T96 B;  3SEW A;  2E1M A;  2F35 A;  4DV5 E;  1IMF A;  3T1H E;  4DV6 E;  1B5H A;  4IB2 A;  1WDN A;  5I58 A;  4OYV A;  1IBL E;  1BIY A;  4GOT A;  4NXN E;  1EYK A;  1XHY A;  2NWJ A;  1JW5 A;  3IB0 A;  3IB2 A;  5DT6 A;  4ESX A;  3RGY A;  5KL6 A;  2DSF A;  5M2V A;  2UUB E;  1K9Y A;  4FK5 C;  2RF1 A;  5LL6 R;  2EN3 A;  2DDK A;  4JBZ A;  4X65 E;  5DEX B;  1FPB A;  4HCY A;  4G8M A;  1GVC A;  3T9X B;  4JI5 E;  2LJU A;  3KC0 A;  4X48 A;  1EZP A;  4PFR A;  1FTJ A;  1B9J A;  4PDH A;  1M5E A;  2UVJ A;  2N8X A;  5IZ3 A;  1AIV A;  3G3H A;  4NQ8 A;  1RYX A;  1UIV A;  2KHX A;  2PFY A;  2CSH A;  2EM9 A;  1YZ9 A;  1D4N A;  3LUY A;  3VLV A;  5H8H B;  2R1F A;  4TUG A;  2W7Y A;  2WBB A;  4R2D A;  3LLH A;  4EXL A;  4F1Y A;  5AA4 A;  1PBQ A;  2EOR A;  4G68 B;  3H03 A;  2F7B A;  2ZM6 E;  4ONY A;  1VFD A;  3T22 A;  2EM7 A;  3OOA A;  3LR1 A;  5DVJ A;  2FV4 B;  1GV8 A;  4MLQ A;  2HAV A;  2ZNS A;  4G68 C;  5LTC A;  2ZYO A;  3ONM A;  1P1U A;  1R9L A;  4DKK A;  1Z1B A;  1QKA A;  3PPQ A;  4OA4 A;  1UHZ A;  2PYY A;  3T66 A;  4ZYD A;  3T9V A;  4H6D A;  2F7C A;  2XXH A;  5H8N B;  1B5J A;  4H65 A;  2EPP A;  1B4H A;  2Y7W A;  2YT4 A;  3H06 B;  2ZYM A;  2DS9 A;  4R2A A;  2YTJ A;  2EZ6 A;  4TQU Q;  2YTD A;  4AQ4 A;  4QSC A;  1IQO A;  3S4U A;  3TAJ A;  2EPU A;  1IQ7 A;  5TSE A;  2BJJ X;  2JOB A;  4LF8 E;  4M9V C;  3UOR A;  4R9G A;  5LLQ A;  1YUJ A;  5FHN A;  5AA3 A;  1MEY C;  1RQ0 A;  3RPW A;  2XX9 A;  3PU5 A;  1UIU A;  3IJO B;  4BDR A;  4LFA E;  4R72 A;  5AA2 A;  3HN0 A;  4O4K A;  2NUG A;  1MQG A;  1KYQ A;  1N3G A;  2OK2 A;  4FBP A;  5TU0 A;  4PE3 A;  2YTG A;  2PCR A;  2Z8F A;  1B7H A;  2EP3 A;  2XWI A;  1B2H A;  5I2N B;  1YYW A;  2I3W A;  4OQO A;  3PPO A;  3ZOQ B;  2V84 A;  2DMY A;  4AS4 A;  1L4S A;  3FAT A;  4R2Q A;  4P1L A;  1BB8 A;  4F39 A;  2EOJ A;  3AUZ A;  2YWQ A;  4ZEC A;  2DVC A;  1Y3N A;  2V83 A;  3FVN A;  1YAE A;  3KGC A;  2EPR A;  1IZ1 A;  4DV7 E;  2FIE A;  1B3E A;  4IO5 A;  4PCD A;  4QF9 A;  2Y84 A;  3KOS A;  3RT8 A;  1PKP A;  4U1Z A;  1P1Q A;  3FZV A;  1SW4 A;  1B7Z A;  2F3D A;  1IXI A;  1P47 A;  2NUF A;  1DK4 A;  2XWV A;  1LBZ A;  4KR5 A;  3OO9 A;  1BBG A;  1FPL A;  5B70 A;  4LF5 E;  4WYQ B;  5A69 A;  1D9Q A;  4OZ9 A;  5TPA A;  1NV7 A;  2QVU A;  2V3Q A;  1OLA A;  2V88 A;  2HHH E;  4NF4 B;  1OVB A;  2VGQ A;  1O0W A;  2ZYN A;  3QAX A;  2QS2 A;  5I2K A;  5I5P A;  2YU8 A;  3EQ1 A;  3G3G A;  4HE1 A;  4AB6 A;  2ODR C;  4DI3 D;  5LMU E;  3KZZ A;  1B40 A;  3KN7 A;  5TP9 B;  3PPP A;  4JI1 E;  2XXK A;  3MVX A;  3DP8 A;  1MGT A;  1ANF A;  1B69 A;  3VXC A;  2DIX A;  3O2A A;  4EQ9 A;  3QXM A;  1XVX A;  3MW0 A;  5AC4 A;  4BDQ A;  1DBZ A;  2EML A;  4OFL A;  4JYA E;  2MKD A;  1I94 E;  3CFZ A;  4GWZ A;  4GX4 A;  2DGC A;  2L2M A;  1DTZ A;  4PET A;  5HM4 B;  4K0K E;  4O8M A;  3P1X A;  2B3T B;  3FD3 A;  3FXR A;  2Q89 A;  4BHC A;  5CI5 A;  4HE2 A;  2VD2 A;  3USD A;  4GWX A;  1LEV A;  2O51 A;  1T39 A;  1QUI A;  2ZNU A;  1LB9 A;  3CFL A;  1HSE A;  3HTX A;  5CMC A;  2BBG A;  2GFE A;  3R26 A;  4OER A;  3K2D A;  2X7P A;  1INP A;  3L6H A;  3TUS A;  4FAT A;  2EOH A;  3O28 A;  4AB5 A;  2A5T A;  4X66 E;  1T4L B;  2DOJ A;  4UAC A;  3EPJ A;  4E0X A;  1ZIU A;  2Q74 A;  3FVK A;  3K02 A;  1AMF A;  3MYU A;  1SQY A;  3THO B;  2EOF A;  4NGU A;  2M9A A;  4E0W A;  4DR5 E;  4FEB A;  4NXM E;  1FPD A;  4OVR A;  1LST A;  4RK2 A;  1S50 A;  4XFE A;  5DEX A;  3RPL B;  5EQ7 A;  1QUL A;  1FTL A;  1X48 A;  1LFI A;  2EQ1 A;  2KLF A;  2D9H A;  2RC7 A;  2YTP A;  3CSB A;  2GPI A;  4PE5 B;  1G0H A;  2QVV A;  2EM0 A;  4NF6 A;  1UQW A;  2I4B A;  3KBZ A;  2RS7 A;  1QVS A;  3FUZ A;  5EYH A;  1FBC A;  3IWC A;  5KL7 A;  3PTY A;  2EOO A;  4O3B A;  3PUV E;  3WAF A;  4RXL A;  4LP2 B;  2O6A A;  4GLI A;  2EN4 A;  2XHD A;  2JOX A;  2MC5 A;  1NKX A;  5DW8 A;  1LBW A;  3AV0 A;  4QSE A;  1M5C A;  2DLQ A;  4GVO A;  1O7T A;  2EPC A;  4H46 A;  3SDF A;  3ROJ A;  1MQJ A;  3IOR A;  1R1N A;  2D21 A;  4GXA A;  2L2K B;  2M4I A;  1WHQ A;  4M2Z A;  2XXQ A;  3TTN A;  2I6E A;  3QG5 C;  3T9H B;  3TQW A;  3VV5 A; 
#chains in the Genus database with same CATH homology
 3H4Z A;  3CI8 A;  3K4U A;  3K1P A;  3TTR A;  3RT6 B;  4C1T A;  4DDD A;  3S9N C;  4NF4 A;  4U2R A;  3E9X A;  2Z22 A;  1MXW A;  1FW0 A;  4DZ1 A;  3PV0 E;  4EF1 A;  4EUO A;  4LQ5 A;  3SEY A;  4HCW A;  1VE4 A;  3G3F A;  3UA8 A;  3VLU A;  3KSJ A;  1NH7 A;  5H8Q A;  4G68 A;  1Z7N E;  1PB8 A;  2B3F A;  1QUK A;  3C35 A;  3C34 A;  4Q0C A;  3TKD A;  1P1O A;  2F7A A;  4GL8 A;  3FVO A;  2UVH A;  5J1D A;  1ZU0 A;  3K6U A;  3M8U A;  1IXH A;  3RN8 A;  4YKJ A;  2H5Y A;  1B7U A;  1LBB A;  3TOD A;  5JTY A;  1NH8 A;  2Z8E A;  1HSJ A;  2P2A A;  3PUW E;  4U21 A;  1PB9 A;  2V3U A;  2F5X A;  3Q27 A;  1MY1 A;  1VR5 A;  1XT8 A;  4KYS A;  1MRP A;  3TTL A;  3U93 A;  4XKN A;  1B0H A;  5BWJ A;  4DIG A;  4POW A;  4C0R A;  2D3I A;  1AOV A;  3FXU A;  3WAE A;  2UXA A;  3SEX A;  3BKI B;  2I49 A;  2V25 A;  1OMP A;  1USY E;  3OO8 A;  4RYA A;  2DWI A;  4F3P A;  2LAO A;  1FTM A;  2Q9T A;  2QS3 A;  3FJ7 A;  3SKP A;  1JET A;  1ZBM A;  4DLD A;  4F2Q A;  4JWX A;  3FGS A;  1EU8 A;  1SYI A;  3IOW A;  1XVY A;  3FV1 A;  4Z0I A;  3T9U A;  3FJM A;  1IXG A;  4PQJ A;  2O69 A;  1LCT A;  1LB8 A;  1JQF A;  4RPN A;  1RYO A;  3VLW A;  1ELJ A;  1GR2 A;  1DTG A;  1UTB B;  3CG1 A;  5I56 B;  2QPQ A;  1GGG A;  4IGT A;  4QFL A;  2DYX A;  2QSX A;  3OEN A;  2REG A;  3OO7 A;  5L9S A;  1B6H A;  3QYT A;  2XXX A;  1IXC A;  1EZ9 A;  1N7W A;  3ZKL A;  1PBP A;  5FHM A;  4WXJ A;  4F22 A;  2P0S A;  1ZLQ A;  2HCA A;  5TP9 A;  3TTM A;  3IOV A;  5CC2 A;  1MXZ A;  3Q26 A;  3DP6 A;  3K0V A;  1I6Q A;  4P0I A;  1Y9U A;  2F78 A;  4ZZE A;  5A5X A;  3FVG A;  1A8F A;  2E1S A;  2I58 A;  3CIJ A;  3OMB A;  3PUY E;  1HSL A;  3EHU A;  3GZG A;  3K00 A;  3MP1 A;  5H8F A;  1N0T A;  5AA4 A;  3IJX B;  2DE3 A;  4FEC A;  5KDT A;  1H43 A;  4FJP A;  3R6U A;  4JSO A;  3EHT A;  4WED A;  4FAJ A;  1A99 A;  3CVG A;  4TLL B;  3I6V A;  5EHS A;  2H9B A;  5HPQ A;  2HXW A;  2M8C A;  2RIN A;  5A5X B;  1B58 A;  1B3F A;  2OJT A;  2IA4 A;  3IO6 A;  3SEV A;  3KEI A;  5KCJ A;  1DOT A;  4M4G A;  4XKP A;  2F36 A;  2QS1 A;  3W15 C;  2ONK E;  5DYH A;  4HS7 A;  4R6H A;  2ABH A;  1KWH A;  5KDT B;  2Y7R A;  4OXV A;  1B52 A;  2OZZ A;  4N07 A;  1MQI A;  5EYF A;  3UP9 A;  5JEI A;  3HO7 A;  2I3V A;  2DWJ A;  4MF3 A;  4DXC A;  4X1D A;  1OIB A;  3ILT B;  3K1N A;  5DTB A;  5I2K B;  1FTK A;  3AXF A;  1B0L A;  4KCD A;  1B51 A;  1FQF A;  2DP8 A;  2ONR A;  1SW5 A;  4P0G A;  1MM7 A;  3VVF A;  2I0B A;  3DLN A;  1DSN A;  1NNT A;  5F1Q A;  2GHB A;  4QSD A;  4MBP A;  3TMG A;  3RTF B;  2XXP A;  4ZZA A;  3RQT A;  3HHG A;  2AIX A;  3A3U A;  4R2B A;  1XS5 A;  1AL3 A;  1MY4 A;  3BFU A;  1JVX A;  3OSQ A;  4GFR A;  3PD9 A;  3C36 A;  3T96 B;  3C4M A;  2RCA A;  1OLC A;  3QSL A;  3SEW A;  2ANJ A;  1IEJ A;  2F35 A;  3C9H A;  3FV2 A;  3IX1 A;  4RXL A;  4NF5 B;  4H1X A;  4H8I A;  4G4P A;  1POY 1;  1B5H A;  1MY3 A;  1PB7 A;  2RC8 A;  4IB2 A;  1MPD A;  1WDN A;  5AA2 D;  4RA1 A;  1MQD A;  5I58 A;  4OYV A;  2XX7 A;  4LZ7 A;  1BIY A;  3CRB A;  1H45 A;  4GOT A;  4PFU A;  3K6V A;  2B3B A;  3D4C A;  4I8C A;  1XHY A;  2NWJ A;  4EQB A;  1JW5 A;  3A09 A;  3IB0 A;  3IB2 A;  5DT6 A;  4BDL A;  3RGY A;  4ESX A;  2REJ A;  2DSF A;  3N6T A;  3K6X A;  5M2V A;  4Q30 B;  4WKM A;  2G29 A;  3TDJ A;  1P1N A;  2AYS A;  3JV9 A;  4G8H A;  2NVU B;  4ELR A;  4FIM A;  1URG A;  4YB6 A;  3TPA A;  3O29 A;  1YPN A;  1TFD A;  1ATG A;  3KOT A;  1B3L A;  4QFK A;  2I0C A;  2RF1 A;  3VE1 B;  1NMU A;  1B5I A;  1RKM A;  3ODB A;  4JBZ A;  3T93 B;  1D9V A;  1VFE A;  4DCX A;  5IKB A;  1SDX A;  3HCQ A;  5DEX B;  1ZJL A;  3ZSF A;  3OEM A;  1N76 A;  4G8M A;  4GQO A;  4HCY A;  4KD5 A;  4R2F A;  2VHA A;  3SET A;  1GVC A;  3VVE A;  3IOT A;  2OLB A;  3T9X B;  2CMO A;  4H67 A;  5F7V A;  3UIF A;  1VSO A;  3W9W A;  4BDM A;  4X48 A;  4EXK A;  1EZP A;  5EHM A;  4XXU A;  2Y7I A;  5H8H A;  1FTJ A;  3HHF A;  1B9J A;  2GRV A;  4X9T A;  1FQE A;  4OEN A;  4OMB A;  3BBR A;  1FTO A;  2DVZ A;  1M5E A;  3PMW A;  4R9F A;  2UVJ A;  3RNN A;  4ZE9 A;  1MDQ A;  1L5T A;  1AIV A;  1OVT A;  3G3H A;  1RYX A;  1UIV A;  2DE4 A;  4IO7 A;  1PC3 A;  2P1S A;  1JW1 A;  2YJP A;  4OEV A;  1D4N A;  2Q2A A;  3LUY A;  2HEU A;  4OTE A;  3CSG A;  5H8S A;  5H8H B;  3VLV A;  3V83 A;  1CB6 A;  3PMX A;  2W7Y A;  4ESW A;  3KG2 A;  1USY H;  3N26 A;  4NF8 A;  3IB1 A;  4EXL A;  4OET A;  5CMB A;  1PBQ A;  5CRY A;  4F1Y A;  4N6P A;  4KYE A;  3V89 B;  3TQL A;  4JXI A;  4Z7E A;  2F34 A;  3V8X B;  4XTC Q;  1ZMG A;  4ZS9 A;  2H4I A;  3M3K A;  3TYH A;  1S7Y A;  4G68 B;  3H03 A;  2F7B A;  4ONY A;  4R6K A;  2UYF A;  3MZB A;  2HAU A;  2OCU A;  1P1W A;  5CMM A;  4HW8 A;  1VFD A;  4KQP A;  3T22 A;  4P11 A;  3OOA A;  3LR1 A;  5DVJ A;  2VOZ A;  1GV8 A;  4MLQ A;  2HAV A;  2ZNS A;  4G68 C;  2ZYO A;  4IO4 A;  3VVD A;  3IO4 A;  1P1U A;  3ONM A;  1R9L A;  1MY0 A;  1XC1 A;  4TLM B;  1QKA A;  3E4R A;  1Y4T A;  4F1U A;  4I1D A;  3PPQ A;  1LAH E;  1D9Y A;  3G7W A;  1FQA A;  2DQV A;  1MXV A;  2OWS A;  5HBC A;  2XD3 A;  3C33 A;  3RTW B;  2PYY A;  2CZL A;  3T66 A;  3OEK A;  1LFG A;  2ONS A;  4U1O A;  4H6D A;  2F7C A;  2XXH A;  1DPE A;  1N3X A;  3T9V A;  4EF2 A;  5H8N B;  1B5J A;  3B7D A;  4THI A;  4H65 A;  1M5D A;  2RC9 A;  2NXO A;  4F1V A;  4H5F A;  4IO6 A;  1MPC A;  1OQG A;  3K6W A;  1A7L A;  5I2N A;  5CM6 A;  3O66 A;  3ILU B;  1B4H A;  2Y7W A;  3KN8 A;  2THI A;  4H8J A;  3MWB A;  4JSD A;  3H06 B;  2DWH A;  4KYD A;  2ZYM A;  2DS9 A;  4TQU Q;  4IY6 A;  4NWC A;  4ZEB A;  2OBG A;  1LFH A;  3KFM A;  4U22 A;  4AQ4 A;  4QSC A;  3MZ1 A;  4JWY A;  1S9T A;  1ZKB A;  3H6U A;  1Q35 A;  5AA4 B;  4YKI A;  2H98 A;  4GF8 A;  3S4U A;  3R7X A;  3TAJ A;  1IQ7 A;  3GXA A;  2BJJ X;  3PUX E;  1SI0 A;  3LSL A;  2DWA A;  3TCH A;  4RY1 A;  1BKA A;  1MQH A;  2Q2C A;  1EZO A;  4IGR A;  4LA9 A;  1JNF A;  1MXU A;  3S2V A;  3MC2 A;  4EQ7 A;  4ZED A;  2XX8 A;  2H99 A;  3UOR A;  4IO3 A;  1Y4C A;  3HST A;  3T9H B;  4R9G A;  1BP5 A;  2XXT A;  3HPI A;  4ISU A;  3CG3 A;  5FHN A;  5AA3 A;  1MM6 A;  1FQD A;  3RPW A;  2XX9 A;  2V93 A;  4YU0 A;  3VDF A;  3GLB A;  4RK9 A;  3PU5 A;  3MP8 A;  2VD3 A;  4IY5 A;  5ISU A;  2YPN A;  1UIU A;  3I5O A;  3KZG A;  1M5F A;  4YKP A;  1A40 A;  2QMX A;  1NNF A;  3IJO B;  5KCJ B;  1TXF A;  5LOM A;  2HFB A;  3JYR A;  1B3G A;  4KCC A;  4BDR A;  4OHN A;  4R72 A;  2F97 A;  2FYI A;  4NWD A;  1SBP A;  3HN0 A;  1XOC A;  2XXU A;  3K1M A;  2R71 A;  2F6G A;  3IK6 B;  3EF7 A;  4OES A;  1F9B A;  1MQG A;  3EN3 A;  4OWD A;  5AA2 B;  3ECR A;  3KBR A;  2OK2 A;  5TU0 A;  3U72 A;  1BLF A;  2AL4 A;  2O7U A;  3MQ9 A;  2Z8F A;  4GXS B;  3IR1 A;  1B7H A;  2X7Q A;  3GBA A;  4YAH X;  4YIC A;  3LSF B;  4LQ2 A;  2QJE A;  4DCY A;  1B2H A;  4HTG A;  1I69 A;  3UK4 A;  3FJG A;  4OFJ A;  3UGW A;  5I2N B;  1WVJ A;  1US5 A;  1B05 A;  2DXR A;  2I3W A;  4JB7 A;  4OQO A;  3QUJ A;  4WEP A;  2Q8J A;  2UVG A;  3H6W A;  2GHA A;  3PPO A;  4KFQ A;  2V84 A;  3LBS A;  1B3H A;  1SI1 A;  4X1B A;  5H8F B;  2ZXT A;  4XKQ A;  2DXY A;  4BDN A;  3FAT A;  3MVW A;  3F11 A;  3N5L A;  3TTK A;  3O9P A;  4XKR A;  4F39 A;  4EDP A;  3MJN A;  1ZTY A;  4U4X A;  4ZEC A;  1US4 A;  1Y3N A;  2DVC A;  5FTH A;  3FVN A;  5I59 B;  1YAE A;  3KGC A;  3KJ7 A;  1Y20 A;  5B7D A;  1URS A;  2G93 A;  3A3C A;  1O64 A;  4LZ5 A;  2FNC A;  3KN3 A;  4ECF A;  1IZ1 A;  4RPO A;  1B3E A;  4IO5 A;  4U4S A;  1B46 A;  2UYE A;  3B6T A;  2NUV A;  4QF9 A;  2Y84 A;  1QKB A;  2FA7 A;  2B65 A;  3KOS A;  3RT8 A;  4U1Z A;  5CMK A;  1P1Q A;  3FZV A;  5ELV A;  3S9L C;  1I6A A;  3BFT A;  1Q1K A;  1SW4 A;  3Q28 A;  3TEP A;  1I6B A;  4Q8R A;  1B7Z A;  1IXI A;  2HQ0 A;  1SD3 A;  1LBC A;  2A5T B;  2GH9 A;  4ZEK A;  4YMB A;  2HZL A;  1B1H A;  2F8D A;  4DXB A;  2IEE A;  4KR5 A;  2PBW A;  3H7M A;  1N04 A;  2XXW A;  1LAG E;  3OO9 A;  1OQH A;  4GIZ A;  1P99 A;  4ND9 A;  2XD2 A;  3H3G A;  5L9M A;  4G77 A;  4I62 A;  5B70 A;  4OZ9 A;  5TPA A;  1QJM A;  3G3I A;  4M1V A;  5BUU A;  2PMS A;  4QFP A;  1M5B A;  2V3Q A;  3G3K A;  1OLA A;  2PVU A;  4QRZ A;  2F6P A;  3KSX A;  2VP1 A;  4F18 A;  4NF4 B;  1OVB A;  2VGQ A;  2ZYN A;  1NNK A;  3OEL A;  1B4Z A;  4GL0 A;  3SER A;  1SW2 A;  3TEL A;  1FCK A;  3QAX A;  2QS2 A;  3QUF A;  4MFI A;  5I2K A;  5KZT A;  2Q88 A;  1SYH A;  2ZNT A;  3U8Q A;  3G3G A;  3EQ1 A;  2E0S A;  3OXN A;  2Z23 A;  3Q25 A;  4K3F A;  4AB6 A;  1IUD A;  4FE8 A;  1UTH B;  3LSW A;  4TOZ A;  5I57 B;  1B40 A;  3KN7 A;  4KPT A;  4NTL A;  5AA2 A;  4YB5 A;  1H3D A;  3TZA A;  2QMW A;  1D3K A;  5I58 B;  5TP9 B;  4MH5 A;  4F3B A;  1T0K A;  3PPP A;  2Y7K A;  4H5G A;  4H0W A;  3C32 A;  2NOO A;  4NE4 A;  3MVX A;  3PPN A;  5K2X A;  4BLA A;  3DP8 A;  4O3A A;  4F19 A;  2I4C A;  1YTV A;  1N7X A;  1ANF A;  3VXC A;  1PEB A;  3O2A A;  4O3C A;  5FTI A;  2OWT A;  4FED A;  4EQ9 A;  3QXM A;  1XVX A;  3MW0 A;  1R9Q A;  1N3W A;  4BDQ A;  4F29 A;  4ZEI A;  1QW0 A;  4OFL A;  3RY3 A;  1NL5 A;  5CBR A;  3CFZ A;  2ZMB A;  5ITO A;  4KI0 E;  2O68 A;  4YKK A;  3THI A;  5DVF A;  1MG1 A;  1DTZ A;  1MH4 A;  3MUQ A;  4PET A;  3TFL A;  5HM4 B;  1UTB A;  3P7I A;  2H25 A;  2Y7P A;  1PDA A;  3FD3 A;  3M3F A;  3FXR A;  4G2Z A;  3VXB A;  3ZKK A;  4PP0 A;  2Q89 A;  3ZS6 A;  5CI5 A;  1B1X A;  1II5 A;  2VD2 A;  3USD A;  3SES A;  5I59 A;  4OFO A;  2QL3 A;  4C1U A;  1Y3Q A;  1CE2 A;  4R73 A;  1LLS A;  2D5W A;  3QIM A;  1AH5 A;  2O51 A;  4NF8 B;  4PFW A;  1QUI A;  3RLF E;  2ZNU A;  4NF5 A;  3LSX A;  1LB9 A;  1URD A;  3CFL A;  1HSE A;  1JVY A;  3B6Q A;  4LUB A;  2O1L A;  3DP4 A;  1GTK A;  5CMC A;  3MZ9 A;  4L17 A;  2GFE A;  3R26 A;  1NNP A;  1A55 A;  4OER A;  1MY2 A;  3K2D A;  3OSR A;  3PGF A;  2X7P A;  1TWY A;  3L6H A;  3PPR A;  1B32 A;  1LAX A;  1R6Z A;  4LZ8 A;  3TUS A;  3MP6 A;  4LVQ A;  1BTJ A;  2QS4 A;  3OD7 A;  5DVI A;  3UN6 A;  4FAT A;  3I3V A;  3O28 A;  5IAI A;  3RUM A;  4AB5 A;  4U23 A;  2A5T A;  1WOD A;  2O1M A;  2DOJ A;  2PX1 A;  3B6W A;  4LON B;  4R74 A;  1MS7 A;  4UAC A;  3MAM A;  4E0X A;  4F31 B;  1ZIU A;  4R6Y A;  1SVX B;  3FVK A;  3K02 A;  3QK6 A;  1O63 A;  1AMF A;  3U94 A;  1MXX A;  5TPA B;  3PUZ E;  1SQY A;  4ELO A;  4GWO A;  4F3G A;  5AE4 A;  5I56 A;  1MXY A;  4QFO A;  3S9E A;  1DPP A;  3H6V A;  4E0W A;  1EH3 A;  3EHS A;  1MDP 1;  5JTY B;  1TT1 A;  2V3T A;  4FEB A;  4JWO A;  5FHO A;  3MVZ A;  3N94 A;  4ZEF A;  1LGB C;  2UVI A;  2ZYK A;  4DE8 A;  4GD5 A;  1JEV A;  3IOU A;  2DE2 A;  1LST A;  2HZK A;  1SW1 A;  1Y3P A;  4OEU A;  5I57 A;  1LAF E;  1JW4 A;  3EPE A;  3MPK A;  4PFY A;  4RK2 A;  5H8N A;  1S50 A;  5DEX A;  1N84 A;  5AA1 A;  1Y1M A;  4LAT A;  4KHZ E;  4I9D A;  1QUL A;  4RJZ A;  2R9J A;  5L9O A;  1FTL A;  2WKY A;  2XXI A;  3W9V A;  1LFI A;  1IIT A;  2PT2 A;  1JEU A;  1MPB A;  2KLF A;  3LC8 A;  3TCF A;  3E3K A;  4IO2 A;  2RC7 A;  4FOR A;  1H44 A;  3PMV A;  4RNS A;  2PT1 A;  3O6H A;  3CSB A;  2ALU A;  4PE5 B;  4YB7 A;  4NF6 A;  2RKM A;  3DEL B;  1UQW A;  4OVJ A;  2I4B A;  3V5A A;  3FIR A;  1QVS A;  3FUZ A;  3N6U A;  2A5S A;  3IAZ A;  4F2O A;  3S9M C;  4NMY A;  3D4G A;  4YMA A;  3OO6 A;  4O3B A;  3PUV E;  4NED A;  3IL1 B;  3MVY A;  5H8Q B;  3WAF A;  1TFA A;  2XXY A;  3FXQ A;  3H6T A;  3M3L A;  4Q5T A;  2QRY A;  1DMB A;  2O6A A;  2R6G E;  2RCB A;  4GLI A;  4LP2 B;  1IIW A;  3O6I A;  2XHD A;  4NF6 B;  1POT A;  3KJT A;  3PD8 A;  4DXU A;  4POX A;  4ZDM A;  5ICT A;  2AL5 A;  1FQC A;  1J1N A;  1Z7M E;  3HV1 A;  4R75 A;  5ICQ A;  1NKX A;  3JZJ A;  5I84 A;  1A8E A;  3DM0 A;  3G3J A;  3CFX A;  1H76 A;  1UTH A;  2Z8D A;  1NFT A;  3Q29 A;  3O97 A;  4ELQ A;  2X26 A;  4MLV A;  3MPL A;  2YLN A;  4QSE A;  1M5C A;  3SEU A;  3U1O A;  4GVO A;  5JK4 A;  1O7T A;  3SDF A;  3FAS A;  1MQJ A;  3IOR A;  4ELP A;  1R1N A;  2D21 A;  4GXA A;  4PFT A;  1MH3 A;  3E13 X;  1YCJ A;  3L6G A;  3O6G A;  2O84 X;  5L8D A;  3U92 A;  4QHQ A;  4F3S A;  1FQB A;  2ESN A;  4GRK A;  2XXV A;  2I48 A;  3K01 A;  4XIG Q;  5K2Y A;  5CBS A;  1QUJ A;  4BDO A;  5ITP A;  4G8N A;  4JDF A;  4QFN A;  4N13 A;  4ZE8 A;  1LCF A;  4UA8 A;  2XXQ A;  2XXR A;  3MBP A;  3TCG A;  3TTN A;  2I6E A;  3GBB A;  1A54 A;  3C31 A;  3VFJ A;  4YZZ A;  3CR9 A;  3TQW A;  1Y1Z A;  3VV5 A;  2O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...