3ECRA

Structure of human porphobilinogen deaminase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
339
structure length
318
Chain Sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLECSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
publication title Structural insight into acute intermittent porphyria.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 318
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3ecrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA02
2Z23A 3MZ9A 2O6AA 1AOVA 2DP8A 1CB6A 3K6WA 2Z8FA 2REJA 5F7VA 1LFIA 3DLNA 2F34A 3RLFE 2ANJA 3PPPA 1LCFA 5CC2A 5HBCA 1NNPA 3A09A 2F78A 2OLBA 1MDP1 3HCQA 1MH3A 2QS4A 2I58A 3MP8A 3VXBA 1UIUA 4GOTA 1B2HA 2QPQA 4N13A 4KCCA 4OETA 4NF6A 3KOTA 3R6UA 1JEVA 1VE4A 5M2VA 3T96B 4BDMA 1TT1A 3K1PA 1DMBA 4P0GA 1LFGA 2GRVA 3SEXA 1A40A 1JW1A 3CI8A 4U1OA 1ELJA 1PB9A 3WAFA 1SW2A 3FUZA 1BTJA 5ELVA 3EQ1A 3PPNA 1VSOA 3IORA 2O51A 2VP1A 2AYSA 2QS2A 2O68A 3S9LC 4R9FA 2D3IA 3VDFA 4UA8A 1A8FA 4QFPA 2XX7A 3FV2A 5I2NB 4ZZEA 3LC8A 2O7IA 1B3LA 1N84A 1I6BA 4ELRA 4PE5B 3VVDA 1AMFA 4EF2A 4M4GA 1GVCA 2XD2A 2RC9A 4F1UA 3KZGA 1B32A 1TFDA 4R9GA 3FJ7A 2PMSA 3BFUA 1JNFA 4DE8A 1M5CA 1BKAA 1L5TA 3TEPA 2DVCA 2FA7A 2V3QA 3ILUB 1NFTA 3O97A 1N7XA 5DEXA 3EPEA 2F8DA 3IR1A 4NEDA 3C36A 1JEUA 3LBSA 3CR9A 4U2RA 3F11A 4OEUA 3S2VA 2QS3A 1DTZA 2ZMBA 1B3EA 3KN8A 3HN0A 2DQVA 4ECFA 3KFMA 4YMBA 2DWAA 3VXCA 1N3WA 3UN6A 2Z8EA 4EQ7A 1YCJA 4LQ2A 3V8XB 4H1XA 4Q0CA 1GGGA 3ECRA 1FTKA 3CFZA 2O7UA 2RC8A 1LB8A 2I0BA 4OEVA 3PUYE 1H45A 2M8CA 1QULA 3K0VA 1M5BA 1MS7A 4X9TA 3PUWE 3PD9A 4YB6A 2HCAA 2Q88A 1USYE 4H65A 4N6PA 1NNFA 3U94A 1B3GA 3UP9A 3THIA 4ZEDA 3ZS6A 3PMVA 3MVWA 2PT1A 2UXAA 5AA4A 3SEWA 2IA4A 5EHSA 3SEYA 4N07A 3TTMA 1YTVA 1IIWA 4QF9A 3LSWA 4LQ5A 1MQDA 2F36A 1MXXA 4DXBA 2B3BA 2DE4A 1Y3NA 1Y3QA 5AA2A 2GHBA 4RY1A 2V93A 2FYIA 3ZSFA 1R9QA 1FQCA 2E0SA 1B1HA 4KCDA 1MM7A 3SKPA 4IO4A 3PV0E 4F22A 4DXUA 4F39A 5L9SA 3LSFB 1URSA 1PEBA 4OHNA 5I2KB 2X7PA 2XXRA 4LZ7A 1N0TA 4NF4B 4MF3A 1H76A 2QMWA 2ONRA 1A8EA 4JWYA 4BDLA 3MW0A 3VVEA 4G77A 4TLMB 1SD3A 3PUXE 3ZKLA 1AIVA 3KJTA 4LZ5A 3QSLA 1ATGA 2FNCA 1N3XA 3K00A 4LA9A 5I58B 1ANFA 1QKBA 2G29A 3R7XA 2OZZA 5CMKA 1JW5A 3U1OA 3K2DA 2UVJA 3TKDA 5H8HA 4XKQA 5K2YA 2DXRA 4OZ9A 1B05A 2HZLA 1JVXA 4KR5A 5BWJA 1Z7NE 4IY5A 4FEDA 1JW4A 1MDQA 3FXQA 2ONSA 5IKBA 2UVIA 1SBPA 3OEMA 4OWDA 3T9HB 2XXPA 3IB2A 3MP1A 4U1ZA 3H6TA 1IZ1A 2DWJA 3MZ1A 1MQJA 2F7BA 1B0HA 1MM6A 5J1DA 2XXVA 4ZEIA 1B58A 4IY6A 3LR1A 3KBRA 4FAJA 3B7DA 1US5A 1OLAA 4H67A 5HM4B 1B4ZA 3DP4A 4NMYA 2O69A 1O64A 1MQHA 4TLLB 4AB5A 4BDQA 4R6HA 3FGSA 4PFWA 3FJGA 5AE4A 1B5HA 3TCHA 4ESXA 3CFXA 1LBBA 1MXVA 3O66A 1UTHA 1B1XA 4PETA 4BDOA 5FHOA 2F6PA 2RCAA 2Q8JA 2VOZA 1N76A 3PU5A 3FVGA 3TCFA 5I56A 1SQYA 3GXAA 5I59B 3G3IA 1ZKBA 4ONYA 5I57A 3QK6A 1EU8A 4IO6A 2H99A 3N6UA 1BP5A 2OJTA 1XHYA 4FORA 1MY2A 4KQPA 4F31B 3K6UA 5H8SA 1FTOA 3RTWB 4NWCA 5JTYA 4MH5A 2V3TA 3IOUA 4HCYA 4X48A 2Y84A 2Y7WA 5KDTA 4EF1A 4E0WA 4OQOA 1FTMA 4KYEA 2DWHA 3DP6A 1MQGA 3RUMA 1JETA 5FTHA 4P11A 4QHQA 4U23A 1NH7A 3EHUA 2BJJX 4O3AA 4ZEFA 4DCXA 1SVXB 1RYOA 2Y7KA 3K6XA 4I9DA 2DSFA 2O1MA 4G68B 1B3HA 1EH3A 3E9XA 2OK2A 1FQDA 4U22A 3SESA 3H6UA 4YKJA 4M1VA 3JZJA 3IO6A 4XXUA 4F1VA 1MQIA 1A99A 4O3CA 1HSEA 3UORA 1F9BA 3RN8A 3OSQA 5CBSA 3KG2A 5H8QA 2XX9A 4EQBA 1DTGA 2QSXA 3C34A 1IXGA 1P99A 3PUVE 3USDA 3OMBA 3VLVA 2ZNTA 1IEJA 1QUJA 2ZYOA 3ILTB 1SW5A 4XIGQ 4GLIA 2GHAA 1P1NA 3PPOA 4YB7A 3QXMA 1AH5A 1N7WA 1SI0A 1WVJA 2H25A 5ISUA 2X26A 3UGWA 4RJZA 4NF5A 3B6WA 4EXKA 3K4UA 4H0WA 1NKXA 4F2QA 3OEKA 1B52A 1MY4A 3N5LA 1LBCA 4G8HA 3S9EA 3S9MC 3I3VA 2GFEA 4WEPA 3OO6A 3IB1A 4K3FA 1VFDA 3KN7A 3H06B 1A55A 4ZS9A 3RTFB 4NF8A 4Q30B 4Z7EA 1Z7ME 1B9JA 1GTKA 4JSDA 1M5EA 2I3WA 3IX1A 4HTGA 4R6KA 1MXUA 3T9UA 2I4CA 1SW4A 4YMAA 3HPIA 1PC3A 4PFYA 4ZE9A 4PP0A 2YPNA 2F35A 3RT8A 2RKMA 2I3VA 3RNNA 1HSLA 4L17A 2Z22A 4ELPA 2RCBA 4R2FA 2V3UA 5B70A 4FJPA 4OVJA 1OVBA 2R6GE 3T66A 3GBAA 3FATA 4ELOA 3FASA 2XXYA 5TPAB 2DWIA 1P1QA 1US4A 3LSXA 3KSJA 2Z8DA 2REGA 3DELB 1CE2A 5A5XA 4BDNA 3H03A 5EYFA 3MVYA 2LAOA 4NTLA 2PX1A 1D9VA 1Y4TA 1FTLA 2DS9A 1I6AA 1MPCA 1URDA 1POY1 3MAMA 3TQWA 1IXCA 1UTBB 3C32A 1SI1A 1ZJLA 4OTEA 5LOMA 1ZTYA 3FIRA 3ODBA 4ESWA 4Z0IA 3OOAA 1S7YA 4DXCA 4XKRA 5ITPA 2O1LA 2A5SA 2XXQA 1LAHE 3PD8A 4I62A 4PQJA 1MPDA 4OENA 4XTCQ 4IGTA 1XVYA 3HHFA 5TP9A 4G4PA 1LSTA 2XXIA 2NXOA 3MVZA 2ZYMA 3K1MA 3G3KA 1RYXA 3KGCA 1BIYA 2HEUA 4NF6B 2Q9TA 4AQ4A 1FQEA 5F1QA 4G8NA 5CMCA 2DXYA 4EQ9A 1EZOA 2I4BA 2NWJA 2H4IA 5B7DA 3T93B 1LCTA 3MQ9A 4POXA 2ZYKA 4I8CA 3Q25A 1R6ZA 3I5OA 3QYTA 4ZDMA 4QFKA 4NF8B 4DZ1A 1LB9A 4DIGA 1D4NA 4KPTA 4TQUQ 2HAUA 3ONMA 4ZE8A 2GH9A 2RC7A 2Q2CA 3H4ZA 4GVOA 4KD5A 1B3FA 3AXFA 4DLDA 5H8FA 3B6QA 2HXWA 3MWBA 4RK9A 5IAIA 3IO4A 3MJNA 5DVJA 3C9HA 4MBPA 1MG1A 3CIJA 2THIA 4ZZAA 4F3SA 1OQGA 1TXFA 3SDFA 3Q29A 2CMOA 2DVZA 2XXXA 2VGQA 1S50A 3PGFA 4C0RA 2PVUA 2A5TA 2AIXA 4QSCA 2VD2A 1B7HA 5FTIA 3FVNA 3FVKA 1Y20A 3BKIB 5DEXB 1TWYA 1XOCA 2RINA 4H8JA 4DDDA 2I6EA 3M8UA 4H6DA 3N94A 3PMXA 3EN3A 3Q26A 5ICTA 1IUDA 3D4GA 3O9PA 2UVGA 1NNTA 1MY0A 5KCJA 1XT8A 3KEIA 5TU0A 4GRKA 3IJOB 4OMBA 4ZEKA 4JDFA 1B5JA 2P1SA 3CRBA 2QS1A 4WXJA 3PUZE 4KYDA 1XVXA 2UYFA 3TTKA 3P7IA 3TCGA 3G3GA 4QFOA 4OXVA 3TUSA 2NUVA 5H8NA 4HCWA 5L9MA 3M3FA 3U8QA 3H6WA 5AA4B 2V84A 4MLQA 3W9VA 3CSGA 2E1SA 2F5XA 2ABHA 3C33A 4THIA 1WODA 1SDXA 1URGA 4EDPA 1VFEA 3TPAA 3C35A 3FD3A 4YAHX 4G8MA 3CG3A 2UVHA 3OENA 2WKYA 2QL3A 5AA2B 3K1NA 3GLBA 3UIFA 1D3KA 4U4XA 4YB5A 5L9OA 4XKPA 1BLFA 2HQ0A 4GQOA 1POTA 4RK2A 3OO9A 3MP6A 3RY3A 1P1OA 1B46A 1PBPA 1IITA 1I69A 4R75A 1EZPA 4X1BA 4F29A 1M5FA 2A5TB 3MPLA 3EF7A 1YAEA 4R74A 3E4RA 4QFLA 3OELA 4YICA 2HFBA 4TOZA 3GZGA 3TAJA 2Q2AA 3U93A 4QSDA 5I2NA 4G2ZA 2B65A 2UYEA 1OQHA 2ZNUA 3G7WA 3HSTA 1ZMGA 3G3HA 5H8HB 3K02A 3KJ7A 3VV5A 2AL5A 1OIBA 2D5WA 1Q35A 4FIMA 3IOVA 3CFLA 2HZKA 3E13X 3QUFA 4QSEA 4POWA 1B6HA 2QRYA 1LAXA 3KOSA 1ZIUA 4ELQA 3HO7A 3O29A 4NE4A 1Y3PA 2ONKE 4E0XA 3JYRA 4OFLA 1Q1KA 3C4MA 4GXAA 3E3KA 2Y7RA 4ND9A 4JWOA 3VVFA 4BDRA 5HPQA 3U72A 1A54A 3OSRA 4U21A 1MPBA 3QUJA 4GL0A 1ZU0A 1UTHB 4OESA 2Q89A 3MZBA 1Y1ZA 3B6TA 2DE2A 3SETA 3VLUA 4YKKA 4H8IA 1FTJA 3MBPA 4F1YA 2ALUA 3CSBA 3TDJA 3TTLA 3SERA 4R73A 1KWHA 5I56B 2OBGA 4H5GA 5FHNA 1UIVA 2RF1A 1B7ZA 4LATA 4YZZA 1FQFA 3KN3A 4GWOA 3MC2A 4QFNA 4RNSA 4U4SA 5I57B 1QVSA 1SW1A 3KSXA 3DM0A 3IL1B 4F3PA 5JK4A 2H5YA 3EHSA 3OO8A 3IK6B 4IO2A 4GXSB 1SYHA 4OERA 1XS5A 2VHAA 4IB2A 5JTYB 1P1WA 4R72A 3PPRA 3CVGA 4JSOA 4LUBA 1I6QA 5KDTB 1XC1A 5AA2D 1FW0A 4JBZA 5I2KA 4IO5A 4GF8A 2XXTA 2YJPA 4NF4A 4R2BA 5ITOA 3K01A 3L6HA 2XXUA 3VE1B 3IAZA 3MUQA 3LSLA 1USYH 4MLVA 2DYXA 1T0KA 5JEIA 1D9YA 4IGRA 2F6GA 4F3GA 4H5FA 5I58A 2OCUA 4BLAA 2OWSA 5AA3A 5H8QB 1MRPA 3A3CA 2B3FA 3VFJA 4C1TA 3K6VA 4KHZE 1AL3A 1B5IA 4FE8A 1PDAA 1MXZA 2IEEA 1M5DA 3M3KA 3SEVA 3TELA 3FZVA 3H6VA 4HW8A 4PFTA 3EHTA 4FATA 3M3LA 4RPOA 1DSNA 5BUUA 4DCYA 1YPNA 3IB0A 3S4UA 4R6YA 1FCKA 4I1DA 4ZECA 4QRZA 2XXWA 4NF5B 3TMGA 4EXLA 2XXHA 4Q5TA 1QJMA 4Q8RA 2I0CA 3HV1A 2ZNSA 4X1DA 4JXIA 4G68C 1ZLQA 3Q27A 3UK4A 1PB8A 2X7QA 3GBBA 2ZXTA 4OFOA 3TYHA 4OYVA 1NH8A 4IO7A 3Q28A 4FECA 4P0IA 2QJEA 4LP2B 2I49A 4RYAA 3V83A 1O63A 5CI5A 1EZ9A 2CZLA 1MH4A 3T22A 1H44A 1UQWA 3IOWA 4ZEBA 3IOTA 1B40A 3G3JA 1R9LA 2Y7PA 1MXYA 2D21A 3WAEA 5DTBA 2H9BA 3O6GA 4LZ8A 2F7CA 3OD7A 5I59A 1NMUA 1NL5A 1LAGE 2XHDA 2QMXA 5AA1A 1FQAA 3S9NC 4YKIA 1ZBMA 1FQBA 3DP8A 2Y7IA 1H3DA 3R26A 4YU0A 4PFUA 2KLFA 2DE3A 3H7MA 5A5XB 1JVYA 4UACA 3D4CA 1QW0A 2PT2A 1WDNA 3O28A 3SEUA 3FJMA 3VLWA 3TODA 3U92A 1HSJA 1R1NA 2V25A 3RQTA 3MVXA 4XKNA 5EHMA 4YKPA 3TTRA 1B0LA 3QIMA 2P2AA 4KI0E 1MY3A 3RT6B 4FEBA 3H3GA 2F97A 3QAXA 4IO3A 2P0SA 4G68A 2G93A 1LLSA 2R9JA 1N04A 3L6GA 1RKMA 3PMWA 5TP9B 4JWXA 5DT6A 4F19A 3IJXB 1OVTA 1OLCA 4WKMA 1A7LA 1DPEA 3TFLA 1GR2A 5CMMA 3ZKKA 1GV8A 4KFQA 2VD3A 1H43A 2ESNA 2NVUB 4NWDA 1IXHA 3C31A 4KYSA 2XX8A 3LUYA 2R71A 2I48A 3TZAA 1S9TA 4AB6A 1QKAA 5ICQA 1NNKA 4JB7A 2OWTA 3W9WA 1J1NA 5CMBA 3T9VA 3FXRA 3V5AA 3JV9A 1Y1MA 5FHMA 3A3UA 3FXUA 1II5A 3RGYA 1OMPA 2W7YA 1LGBC 5KZTA 2H98A 3TQLA 4HS7A 1VR5A 3G3FA 4RXLA 4O3BA 2HAVA 3BFTA 1P1UA 1TFAA 2XD3A 3W15C 1IXIA 4WEDA 3PPQA 4ISUA 1Y4CA 3O6HA 5H8FB 2AL4A 5CM6A 1O7TA 4OFJA 1B7UA 2YLNA 1LAFE 3O6IA 5DVIA 3V89B 2DOJA 1LFHA 5L8DA 1DOTA 2PYYA 4F3BA 1MXWA 2F7AA 1QUIA 4LVQA 3N6TA 1IQ7A 3MPKA 3N26A 3UA8A 4RA1A 4F2OA 1B51A 1MY1A 2ZYNA 5DVFA 3OXNA 1PB7A 4EUOA 1DPPA 3BBRA 5KCJB 4C1UA 3I6VA 1QUKA 3T9XB 4LONB 4RPNA 4MFIA 4GD5A 4GIZA 3OO7A 1JQFA 5K2XA 3HHGA 5TPAA 3FV1A 1SYIA 4F18A 3TTNA 2NOOA 5CBRA 1Y9UA 3O2AA 1PBQA 5H8NB 5I84A 3RPWA 4GFRA 3CG1A 2PBWA 3FVOA 4GL8A 1B4HA 5DYHA 5CRYA 1UTBA 2O84X
chains in the Genus database with same CATH superfamily
4M0VA 2Z23A 3MZ9A 2O6AA 1AOVA 2DP8A 1CB6A 3M99B 3K6WA 4P78A 2Z8FA 2EQ1A 2REJA 5F7VA 1LFIA 3DLNA 2F34A 3RLFE 2EPPA 2ANJA 3PPPA 1LCFA 2VE7C 5CC2A 5HBCA 1NNPA 2VQEE 3A09A 2F78A 1HNXE 2MKZA 1SR9A 3P1XA 2OLBA 1SFEA 1MDP1 3HCQA 1MH3A 2QS4A 2I58A 3MP8A 3VXBA 1UIUA 4GOTA 1B2HA 2QPQA 4NXNE 5FBPA 4G61A 2KR0A 2YTOA 4N13A 5IZ3A 4KCCA 2EOQA 4WX9A 5A5LA 1NV6A 4OETA 4GBVA 4N8YA 4NF6A 2L2NA 3KOTA 4DR4E 3R6UA 1JEVA 1VE4A 5M2VA 2PFZA 3T96B 4BDMA 1YXIA 4R2CA 4H46A 1TT1A 4FBPA 3HQ1A 3GYYA 3K1PA 2M4IA 1DMBA 4P0GA 1LFGA 2GRVA 1IMAA 3SEXA 5AC4A 1A40A 1JW1A 3CI8A 4U1OA 1ELJA 4PDDA 1PB9A 3WAFA 1SW2A 2EOJA 3FUZA 2EM5A 4K0KE 1BTJA 5ELVA 2CZHA 4NHBA 3EQ1A 5LDZA 3PPNA 1VSOA 2OWZA 3IORA 1RDYA 2O51A 5EYHA 2VP1A 2ODRC 2R76A 3JAMC 5A6BA 4GWSA 2AYSA 2QS2A 4WPYA 2O68A 3S9LC 4JI8E 4R9FA 1YSAC 2D3IA 2L2MA 2A25A 2ZM6E 5EYGA 3VDFA 4UA8A 2N3HA 1IQOA 1A8FA 4ZYGA 4MAGA 2M1SA 4QFPA 2XX7A 3FV2A 2NUGA 2EOFA 4WSPA 5I2NB 1N33E 4BS9A 2MDGA 4ZZEA 3LC8A 2O7IA 2RS6A 3VYXA 2YTDA 1B3LA 2XWOA 1A1IA 2R1FA 2L92A 1N84A 1I6BA 4ELRA 4PE5B 3VVDA 4I40A 4MHFA 1AMFA 4EF2A 1FPLA 4M4GA 1GVCA 2XD2A 2RC9A 5EQ9A 4F1UA 3KZGA 1B32A 1TFDA 4X64E 4R9GA 3FJ7A 2PMSA 3BFUA 1JNFA 4TUGA 4DE8A 2V87A 4YY3E 1M5CA 1J5EE 1BKAA 1L5TA 2WYKA 3TEPA 2DVCA 2FA7A 2V3QA 3ILUB 4N81A 2B7VA 1NFTA 2LMZA 3B8BA 2ELYA 3O97A 1N7XA 5DEXA 3EPEA 2F8DA 3IR1A 4NEDA 3C36A 2WZOA 1JEUA 3LBSA 3CR9A 3RPLB 4U2RA 3F11A 4OEUA 3S2VA 2EMCA 3EPKA 2QS3A 1DTZA 2ZMBA 1B3EA 1DGCA 5ET5A 2YTGA 2EM7A 3KN8A 3HN0A 1LBWA 2DQVA 4O4KA 4ECFA 3KFMA 4YMBA 2DWAA 1GQEA 3VXCA 4X66E 1N3WA 1NUXA 3UN6A 2Z8EA 2KONA 3HPZA 4EQ7A 3KC1A 5ESYA 1YCJA 2VRDA 1A1HA 4LQ2A 3V8XB 4H1XA 1RDXA 4Q0CA 1UBDC 1GGGA 4DR1E 3ECRA 1FTKA 3CFZA 4X62E 2O7UA 2RC8A 4JI1E 1LB8A 2L3CA 1IBKE 2I0BA 4OEVA 3PUYE 1H45A 1EH8A 2M8CA 1QULA 3K0VA 1M5BA 1MS7A 2F3BA 4X9TA 3PUWE 3PD9A 4YB6A 2HCAA 2Q88A 4DV7E 1USYE 4H65A 4N6PA 1NNFA 3U94A 1B3GA 3UP9A 3THIA 2FBPA 4ZEDA 3ZS6A 1BBGA 3PMVA 3MVWA 4ZYHA 2PT1A 4TUIA 2UXAA 5AA4A 2V86A 3THNA 3SEWA 2EOMA 4DMIA 2IA4A 5EHSA 2EOEA 3SEYA 2LUPB 4N07A 4LF9E 2B3TB 3TTMA 1YTVA 1IIWA 1N3GA 2V83A 4QF9A 1EKZA 3LSWA 1X6FA 2XA5A 1NV2A 4F54A 4LQ5A 2PFYA 1MQDA 2F36A 4PAKA 1T39A 1MXXA 1NUZA 1G0IA 5TSEA 4DXBA 1JK2A 2B3BA 4JVIA 4B3RE 4O8MA 2DE4A 2RSIA 1Y3NA 1X5WA 1Y3QA 5AA2A 2GHBA 4I3EA 4RY1A 1X6HA 2V93A 3QMFA 1UILA 2FYIA 1R9QA 3ZSFA 1FQCA 2E0SA 1RC7A 1B1HA 4OOGC 4KCDA 1MM7A 3SKPA 4IO4A 3PV0E 5EQ7A 5IWAE 4F22A 4DXUA 5LL6R 1NV4A 4F39A 5L9SA 3LSFB 3IWCA 4LF8E 2L5VA 4F2JC 1URSA 1PEBA 4OHNA 5I2KB 2X7PA 2XXRA 4DUYE 4UABA 1ZBTA 4LZ7A 2NUEA 4AS4A 2V85A 2EM4A 1N0TA 4JI4E 4NF4B 2EL5A 4MF3A 2MKDA 1K9ZA 1H76A 2QMWA 4MEVA 2ONRA 1A8EA 4JWYA 4BDLA 3MW0A 1ZU1A 3VVEA 4XFEA 3ADIA 4G77A 4TLMB 1SD3A 3PUXE 2YRMA 2N8XA 3ZKLA 4X65E 1AIVA 3KJTA 4LZ5A 3QSLA 1ATGA 1P47A 2YTJA 2FNCA 1N3XA 2CTDA 3MYUA 3K00A 4OVPA 2LE2A 3HPSA 4LA9A 4N6DA 5I58B 2LVHA 5I5PA 1ANFA 2RSMA 1QKBA 4OX9E 2V4CA 2G29A 3R7XA 2OZZA 4GZNC 3FBPA 5CMKA 4GX4A 2LBSB 1JW5A 4MNIA 1T4LB 2QVUA 3U1OA 1YUIA 3K2DA 2UVJA 3TKDA 5H8HA 4XKQA 4P47A 5K2YA 2DXRA 4OZ9A 1B05A 2HZLA 3U65A 1JVXA 4KR5A 5BWJA 1FPKA 1Z7NE 4IY5A 4FEDA 1JW4A 1MDQA 1QGXA 3FXQA 2ONSA 5IKBA 4MJOA 2UVIA 1SBPA 3OEMA 4OWDA 3T9HB 2XXPA 2FVZA 3THOB 3IB2A 3H6TA 1IZ1A 3MP1A 1PJTA 4DR7E 4U1ZA 2DWJA 3MZ1A 1MQJA 2F7BA 1B0HA 1MM6A 5J1DA 3KWRA 1Q9DA 1KZ8A 2XXVA 2EOSA 4ZEIA 4DR2E 1QNTA 1IBLE 1B58A 4IY6A 2EMZA 3LR1A 3KBRA 4FAJA 3B7DA 1US5A 1OLAA 4H67A 5HM4B 1B4ZA 3KBZA 3E78A 3DP4A 4NMYA 2O69A 1O64A 1MQHA 4TLLB 4AB5A 1TF6A 4BDQA 4R6HA 4HXVA 3FGSA 4PFWA 3B50A 4OANA 4B3SE 2F3DA 3FJGA 5AE4A 1NCSA 1B5HA 3TCHA 4ESXA 3CFXA 1LBBA 4O7IA 1NV5A 1MXVA 4WXCA 3O66A 3EPHA 1UTHA 1B1XA 4PETA 4BDOA 5FHOA 2F6PA 4DV1E 1IMEA 2RCAA 2Q8JA 2LT7A 1X48A 1FBFA 2EPKX 2VOZA 3ISPA 4GWUA 1N76A 3PU5A 4KHPE 3FVGA 3TCFA 5I56A 4JI6E 1SQYA 2WEFA 2XWVA 3GXAA 5I59B 3G3IA 5A6JA 3ZOQB 2B7TA 2EWLA 4RH8A 1ZKBA 4ONYA 1O0WA 5I57A 3QK6A 1EU8A 4IO6A 2H99A 4GX6A 3N6UA 3IFCA 1VDWA 2MC5A 1BP5A 2IHR1 2K4VA 2FIXA 2OJTA 2EPLX 1XHYA 4FORA 1KA0A 2JJKA 1MY2A 4KQPA 4F31B 3K6UA 4M9VC 5H8SA 1FTOA 1WRJA 1ZBQA 4MCOA 4R2AA 3RTWB 2WBUA 3CHGA 4NWCA 2UXBE 4MH5A 5JTYA 5KL3A 2V3TA 3IOUA 1N32E 4HCYA 4X48A 2DMYA 2LTSA 2Y84A 2Y7WA 5KDTA 4EF1A 4E0WA 4OQOA 1FTMA 4KYEA 1FPFA 2DWHA 5IGAA 3DP6A 1MQGA 3RUMA 1JETA 5FTHA 4P11A 4QHQA 4U23A 1NH7A 3EHUA 4L5NC 2BJJX 4O3AA 4ZEFA 4DCXA 1SVXB 2YSOA 1RYOA 2Y7KA 3K6XA 4I9DA 2DSFA 1IQSA 3MHSC 2O1MA 4G68B 1B3HA 1X6EA 1EH3A 2XWKA 3AV0A 3E9XA 4YHHE 1SPIA 1FPDA 2OK2A 1A1JA 1FQDA 4N6KA 4QBAA 4U22A 2LV2A 1G0HA 3SESA 3H6UA 4OVQA 4YKJA 4M1VA 4L8NA 3JZJA 2EPXA 3IO6A 4XXUA 4F1VA 1MQIA 1A99A 4O3CA 1HSEA 3UORA 1F9BA 2EN6A 3RN8A 3OSQA 5CBSA 3KG2A 3JU0A 5H8QA 2XX9A 2I13A 4EQBA 4R2PA 1DTGA 2QSXA 3C34A 2VT5A 1IXGA 4H45A 1P99A 3PUVE 3USDA 1PJSA 1LBXA 3OMBA 3VLVA 2ZNTA 1IEJA 2JR1A 1QUJA 2ADRA 4PAIA 2ZYOA 3ILTB 1SW5A 2E5LE 4XIGQ 4GLIA 2K7IA 4B3TE 2GHAA 1LEVA 1P1NA 3PPOA 4YB7A 4BHBA 2LO3A 3QXMA 1AH5A 1N7WA 4N4RB 1SI0A 2GQ1A 1WVJA 2H25A 5ISUA 2X26A 3UGWA 5AC5A 4DR5E 4RJZA 1FPJA 4NF5A 3B6WA 4EXKA 4MNPA 3K4UA 4H0WA 1NKXA 2EPMX 4F2QA 5IT9C 3OEKA 1B52A 1MY4A 3N5LA 3C4TA 2G7HA 1LBCA 4G8HA 3S9EA 2EL4A 3S9MC 2V8QB 3I3VA 2GFEA 4WEPA 3OO6A 4R03A 4LTYA 5ET7A 3IB1A 2LRSA 4K3FA 4HE0A 1VFDA 3KN7A 4J8ZA 3H06B 3LMLA 4DV4E 2LTRA 1YYZA 1A55A 4NF0A 4ZS9A 2FIEA 3RTFB 4NF8A 4Q30B 4Z7EA 2R8TA 1Z7ME 4LFCE 4LF6E 1B9JA 1GTKA 4PF8A 4I3YA 4JSDA 1M5EA 2EMWA 5KL5A 2I3WA 2ODRD 3IX1A 4HTGA 4R6KA 1MXUA 3T9UA 2I4CA 4MIJA 1SW4A 1FTAA 4YMAA 3BIGA 3QG5C 3HPIA 1PC3A 3J7AG 4PFYA 4ZE9A 4PP0A 2YPNA 2F35A 2RTXA 4OVSA 3RT8A 2RKMA 2QFLA 5KL6A 2I3VA 1DBZA 3RNNA 1HSLA 2PCRA 3BBGA 4L17A 2HXRA 2Z22A 4ZYDA 4ELPA 2RCBA 4R2FA 2V3UA 5B70A 4FJPA 4OVJA 1RQ0A 4PGNA 4WFTA 1OVBA 2R6GE 3T66A 4PE3A 3GBAA 3FATA 4ELOA 3FASA 3EPLA 2XXYA 4LFAE 5TPAB 2DWIA 1P1QA 1US4A 4P56A 3LSXA 3KSJA 5ET6A 2Z8DA 2REGA 3DELB 1CE2A 2EQ3A 5A5XA 4BDNA 3L00A 3H03A 4Q28A 5EYFA 3MVYA 2LAOA 4NTLA 2PX1A 1D9VA 4GBWA 2HC5A 1Y4TA 1FTLA 2DS9A 1I6AA 1LLMC 1MPCA 1XMQE 3IWDA 2PRTA 1URDA 1POY1 2CEYA 4DKKA 3MAMA 5LTCA 3D1RA 4PBHA 3TQWA 2EOXA 2YU8A 1IXCA 1UTBB 3C32A 1SI1A 1ZJLA 4OTEA 5LOMA 1ZTYA 3FIRA 3ODBA 4ESWA 4Z0IA 5I7IA 1ZR9A 3OOAA 1S7YA 4DXCA 5F24A 4P8BA 4XKRA 5ITPA 2O1LA 2I9IA 2A5SA 4O43A 2XXQA 2ELZA 1LAHE 3PD8A 4R8OA 4O24A 4I62A 1JK1A 4PQJA 1MPDA 1K9YA 1YFHA 4OENA 4XTCQ 4IGTA 4LF7E 1FJ9A 2WYPA 2WCC3 1XVYA 3HFUA 3HHFA 5TP9A 2YWQA 4G4PA 1LSTA 1NEIA 5IZ3B 2XXIA 2NXOA 3MVZA 1WHNA 3J7Yp 2ZYMA 3K1MA 3G3KA 5F3WA 1RYXA 3KGCA 2B4LA 1BIYA 2HEUA 4NF6B 2Q9TA 1L4SA 1FJGE 4PFBA 4AQ4A 2EMHA 2UUBE 1FQEA 1EH6A 5F1QA 4G8NA 5CMCA 2DXYA 4EQ9A 1EZOA 2I4BA 2NWJA 1WJPA 2H4IA 5B7DA 4NXME 3T93B 4NHRA 1LCTA 3MQ9A 4POXA 2ZYKA 4I8CA 3Q25A 3UK3C 2EZ6A 4XF5A 2LUQA 1R6ZA 3I5OA 2DIXA 3MSWA 3QYTA 4ZDMA 4QFKA 4NF8B 2EMFA 4DZ1A 1LB9A 4DIGA 1D4NA 4KPTA 4TQUQ 2HAUA 3ONMA 1EYIA 2HPGA 4ZE8A 2GH9A 2B9DA 2RC7A 3NOHA 2Q2CA 2YT4A 1T4OA 3H4ZA 3LLHA 2BBGA 1IMFA 4GVOA 5KL7A 4KD5A 2EPCA 4R2QA 1B3FA 3AXFA 4DLDA 5H8FA 3B6QA 2HXWA 3MWBA 4RK9A 5IAIA 3IO4A 4N15A 3MJNA 5DVJA 3C9HA 1T4NA 2Y5KA 4MBPA 1MG1A 3CIJA 1IBME 2THIA 4ZZAA 4F3SA 1OQGA 1TXFA 2CZKA 3SDFA 2YTEA 3Q29A 2CMOA 2DVZA 4JI2E 2XXXA 2VGQA 2CEXA 4F6NA 1S50A 3PGFA 2EPOA 4C0RA 2UXDE 2PVUA 5IZ1A 2A5TA 4PFRA 2EOHA 2AIXA 4QSCA 2VD2A 1B7HA 5FTIA 2JP9A 2WX9A 3FVNA 3FVKA 1Y20A 3BKIB 2EN4A 4LF4E 5DEXB 2E72A 1DCUA 1TWYA 1XOCA 4PGPA 1NV3A 4X04A 4BC9A 4KZSA 2WBDA 4P1LA 5EQ8A 2RINA 4H8JA 2EN7A 1DI2A 4DDDA 2EN1A 5LMUE 2I6EA 3M8UA 4H6DA 3N94A 3PMXA 3EN3A 3Q26A 5ICTA 1B69A 2YTIA 1IUDA 3D4GA 4PF6A 2L2KB 3FXBA 2EN8A 3O9PA 2UVGA 5IZZA 3AUZA 1NNTA 1MY0A 1YZ9A 5KCJA 3T1YE 1XT8A 2EE8A 4BBYA 3KEIA 2EMKA 4IS1C 5TU0A 4RHBB 4GRKA 3IJOB 5ADZA 4OMBA 4ZEKA 4JDFA 4XEQA 1INPA 3LUZA 1B5JA 2P1SA 4P9KA 2ZZVA 1KJKA 3CRBA 3KZZA 3BF2A 2QS1A 4WXJA 3PUZE 2YTQA 4KYDA 1XVXA 2UYFA 3TTKA 3P7IA 3TCGA 3G3GA 4QFOA 4O7MA 4OXVA 1FPBA 3TUSA 2NUVA 5H8NA 4X9JA 4HCWA 5L9MA 3M3FA 3U8QA 2GPIA 4NAPA 2DLKA 3ADGA 3E79A 1NV1A 4N17A 3H6WA 5AA4B 2V84A 4MLQA 3W9VA 2JXPA 3CSGA 1UN6B 2E1SA 5LLQA 2F5XA 2ABHA 2H36X 3C33A 2YTFA 4THIA 4DUZE 1WODA 5T3JA 1SDXA 3H09A 1URGA 4EDPA 1VFEA 3TPAA 2ENCA 3C35A 3FD3A 4YAHX 4G8MA 2KOUA 3CG3A 4OVTA 1YUJA 2UVHA 3OENA 2WKYA 4HEIA 2QL3A 5A69A 5AA2B 4LU9A 1QU6A 2JPAA 3ROJA 2F8BA 3K1NA 3GLBA 3UIFA 1D3KA 4U4XA 4YB5A 5L9OA 4XKPA 1BLFA 2HQ0A 4GQOA 1T38A 1POTA 4RK2A 3OO9A 3MP6A 4MX6A 2KQZA 4DR3E 3RY3A 1BK4A 4P7DA 1P1OA 2N3GA 1FPGA 1B46A 1PBPA 1YYWA 1IITA 1I69A 1G2DC 2OX3A 5IV8B 4R75A 2RS7A 3VHTB 1EZPA 4X8RA 4X1BA 2DSYA 4AS5A 4F29A 1M5FA 1I94E 2A5TB 3MPLA 3EF7A 2Q74A 1YAEA 1F2IG 4R74A 3E4RA 3C6KA 4QFLA 3OELA 4YICA 4IR8A 4WYQB 2HFBA 4TOZA 3GZGA 3TAJA 1X49A 4NGUA 2Q2AA 5AE3A 3U93A 5A6BD 4QSDA 4LN5A 5BR8E 5I2NA 3F6HA 2GHFA 4G2ZA 2B65A 2UYEA 4PFIA 1OQHA 2EOYA 2ZNUA 3G7WA 3HSTA 1EH7A 2YTNA 1ZMGA 3G3HA 5H8HB 2LCEA 2HHHE 3J81C 3K02A 1KYQA 2LJHA 3KJ7A 4PCDA 3VV5A 2AL5A 1OIBA 2D5WA 1Q35A 2JWOA 2Y5LA 2CZIA 1NI9A 4FIMA 1FBHA 3IOVA 2JOXA 3T1BA 3CFLA 2HZKA 3E13X 3QUFA 4QSEA 4POWA 1NUWA 4GWYA 1UHZA 1B6HA 4BC7A 2QRYA 1LAXA 4KWYA 3KOSA 4MNCA 1ZIUA 4ELQA 1FPIA 1Z1BA 3F6GA 2Q8UA 3RPLA 3HO7A 3TQMA 3O29A 2D9HA 4NE4A 1Y3PA 2ONKE 2EOIA 1A1LA 4E0XA 3JYRA 4O5GA 1HR0E 4OFLA 1Q1KA 3C4MA 4DV3E 1FBEA 3E3KA 4GXAA 2Y7RA 4ND9A 4JWOA 4F9CB 3VVFA 4BDRA 2EMIA 2YRHA 5HPQA 3U72A 4JI7E 1A54A 1YZ0A 2L33A 3OSRA 2FV4B 3MHHC 4U21A 1FBCA 1MPBA 3QUJA 4GL0A 4FK5C 1ZU0A 5A6AA 1UTHB 4OESA 2Q89A 3MZBA 1Y1ZA 3B6TA 2DE2A 2V89A 3SETA 1YYKA 4I8OA 4GEQB 1D9QA 3VLUA 2DRPA 4YKKA 4H8IA 1FTJA 3MBPA 1RMDA 1EYKA 2NABA 2ALUA 3CSBA 4F1YA 3TDJA 5FLXC 3SZPA 2L3JA 5I3SA 3TTLA 3SERA 1BBOA 4R73A 1KWHA 5I56B 2EJ4A 2OBGA 4H5GA 5FHNA 2JOBA 1UIVA 2RF1A 1B7ZA 3RYDA 1DK4A 2EP3A 2EPUA 4LATA 2YRKA 1FKAE 5EQAA 4YZZA 1PJQA 1FQFA 3KN3A 4GWOA 3MC2A 4QFNA 2BB8A 1N34E 4RNSA 4U4SA 5I57B 4P3LA 1QVSA 1SW1A 4PBQA 3KSXA 3DM0A 3IL1B 4F3PA 5JK4A 2H5YA 3EHSA 3OO8A 3IK6B 2ENHA 4IO2A 5CFFE 4DR6E 3HXLA 4GXSB 1SYHA 1TN9A 3A29A 1XS5A 4OERA 2VHAA 4F9AB 4IB2A 1KA1A 5JTYB 1FBPA 1P1WA 4R72A 1PKPA 3PPRA 3CVGA 4JSOA 3DF6A 4LUBA 1I6QA 4N8GA 5KDTB 2EMLA 2WBBA 1XC1A 4PAFA 3DJWA 1HNWE 1AAYA 5AA2D 4WSGA 1FW0A 4PC9A 4JBZA 5I2KA 4GWXA 5KL4A 1IMBA 4IO5A 2EN3A 4GF8A 4M30A 2EPRA 2EPNA 2VF1A 2XXTA 2YJPA 4NF4A 4R2BA 5ITOA 3K01A 3L6HA 2HHMA 2XXUA 3VE1B 3IAZA 4M2ZA 3MUQA 3LSLA 1USYH 4MLVA 2DYXA 5J16A 5DNYA 1T0KA 2L6MA 5JEIA 2FGGA 3C6MA 4LF5E 2VQFE 4PDHA 1D9YA 4IGRA 2F6GA 4X8WA 4F3GA 4H5FA 3BGHA 5I58A 2OCUA 4BLAA 2OWSA 2EOZA 1A1GA 5AA3A 5H8QB 1MRPA 3A3CA 2B3FA 1FSAA 2BJIA 2VPOA 3VFJA 4C1TA 2UUAE 3K6VA 1IMCA 4N91A 4KHZE 1WXRA 1AL3A 1B5IA 4FE8A 1PDAA 3K6QA 1MXZA 2IEEA 3ADJA 5AE2A 1M5DA 3M3KA 3SEVA 1FPEA 3TELA 2QVVA 2LJUA 3FZVA 3H6VA 4HW8A 4JI0E 4PFTA 1BB8A 5AASA 1LBYA 3EHTA 2DGCA 5ET8A 4FATA 3M3LA 4RPOA 2EQ0A 1DSNA 5BUUA 4DCYA 1MEYC 1YPNA 1IMUA 3IB0A 3S4UA 4R6YA 1FCKA 4I1DA 2FTXB 2V88A 4ZECA 4QRZA 2XXWA 4NF5B 3TMGA 2EN2A 4EXLA 2XXHA 2DLQA 4Q5TA 1QJMA 4LFBE 4Q8RA 2I0CA 3HV1A 2ZNSA 4X1DA 4JXIA 4GKJE 3OMLA 2DB2A 4R2EA 2UXCE 4G68C 1ZLQA 3Q27A 1RDZA 2YU5A 3UK4A 1PB8A 4DV5E 2X7QA 3EPJA 3GBBA 2ZXTA 4OFOA 3TYHA 4HE1A 1EYJA 4JVCA 1NUYA 4OYVA 1NH8A 4R2RA 3IWBA 4IO7A 3Q28A 1FRPA 2L8TA 1TF3A 4FECA 1A1KA 4P0IA 2QJEA 1NV0A 4LP2B 2I49A 5DW8A 4RYAA 3V83A 3EKIA 2MDRA 1O63A 3BIHA 1XMOE 5CI5A 1EZ9A 2CZLA 1MH4A 3IFAA 3T22A 1H44A 1UQWA 3IOWA 4ZEBA 3IOTA 1B40A 3G3JA 1R9LA 2Y7PA 2EM6A 1MXYA 1AWBA 2D21A 3WAEA 2EMBA 5DTBA 2H9BA 2MKNA 3O6GA 4LZ8A 3HTXA 2F7CA 4DV0E 3OD7A 5I59A 4DI3D 1NMUA 1NL5A 3T1HE 4NN3A 2HGHA 1LAGE 4JI3E 2XHDA 2QMXA 2EM2A 5AA1A 1FQAA 2GLIA 3S9NC 4N4UA 4YKIA 2Q8MA 2EL6A 1ZBMA 4O94A 1FQBA 3DP8A 2Y7IA 1H3DA 3R26A 3RMPA 4YU0A 4PFUA 4HE2A 2KLFA 2DE3A 2P3VA 3H7MA 2ZZXA 4R2DA 1STUA 5A5XB 1JVYA 5AE1A 2HJJA 2UU9E 4UACA 2EMXA 3D4CA 3MSTA 1QW0A 2PT2A 1WDNA 2FHYA 3O28A 1WHQA 1FBDA 3SEUA 4DV2E 4BMJA 3FJMA 3VLWA 4DI4B 3T0JA 3TODA 3U92A 2P3NA 1JP4A 1HSJA 1R1NA 4GWWA 2V25A 3RQTA 2EPAA 4BHCA 1XNQE 3MVXA 4XKNA 5EHMA 4YKPA 3TTRA 1B0LA 3QIMA 1FJ6A 2P2AA 2EM3A 2EMAA 2CT1A 1DQ3A 4KI0E 1MY3A 3KC0A 1A1FA 4F9BB 2YTPA 1XNRE 4PTKA 3RT6B 4FEBA 3H3GA 2F97A 3QAXA 4IO3A 2P0SA 4G68A 2G93A 4KXPA 4JV5E 1LLSA 2R9JA 1N04A 2EPZA 3L6GA 1RKMA 3PMWA 2UUCE 5TP9B 4JWXA 5DT6A 4F19A 3IJXB 1OVTA 4ZYEA 2F4VE 1OLCA 1A7LA 1DPEA 4WKMA 3TFLA 1GR2A 4NZVA 3LV0A 5CMMA 4AQYE 3ZKKA 2EOOA 1GV8A 5IXMB 4KFQA 2WBTA 2VD3A 1H43A 1YYOA 2ESNA 2NVUB 4NX1A 2E1MA 4NWDA 1IXHA 1LBVA 3C31A 2XXKA 4KYSA 3ADLA 2XX8A 4WXDA 2MC6A 3FIGA 3LUYA 2R71A 2I48A 2EM8A 2EM9A 2NA2A 2CSHA 1J26A 1CNQA 3TZAA 1S9TA 4AB6A 1QKAA 4MMPA 5ICQA 2M9AA 1NNKA 4JB7A 2OWTA 2JVAA 3W9WA 2VPNA 2YZTA 1J1NA 5CMBA 3T9VA 3FXRA 4JI5E 2EMYA 3V5AA 3JV9A 1Y1MA 1GZ6A 1MGTA 2EORA 5FHMA 3A3UA 3FXUA 1II5A 3RGYA 1OMPA 4GX3A 2W7YA 2ZZWA 1LGBC 5KZTA 3J80C 2H98A 3TQLA 4HS7A 1VR5A 3G3FA 4RXLA 4O3BA 2HAVA 3BFTA 4JYAE 1P1UA 2EM0A 1TFAA 4P1EA 2XD3A 2RQLA 3W15C 1IXIA 4WEDA 3PPQA 4ISUA 2XWIA 3PTYA 1Y4CA 3O6HA 1FBGA 1LBZA 2M7QA 5H8FB 4OVRA 2AL4A 5CM6A 3BIDA 1O7TA 2EMGA 1B7UA 4OFJA 5IM2A 2YLNA 4F6MA 1LAFE 3O6IA 5DVIA 4IJDA 1NV7A 4BCAA 2RPCA 3V89B 2KHXA 2DOJA 1LFHA 1G2FC 5L8DA 4QXDA 1DOTA 2PYYA 4F3BA 1HNZE 2QVRA 3KZYA 1MXWA 2F7AA 1QUIA 4LVQA 1ZAAC 3N6TA 4GWZA 1IQ7A 2DDKA 3MPKA 3N26A 2NUFA 2B4MA 3UA8A 5T6JA 5A6KA 2CPNA 3C4BA 4RA1A 2WBSA 4F2OA 1B51A 1MY1A 2ZYNA 1IMDA 4Q35B 2YSPA 5DVFA 2ENAA 1X3CA 3OXNA 1PB7A 4EUOA 1DPPA 3VK6A 3JTZA 3BBRA 4R2SA 5KCJB 4C1UA 2DMIA 3I6VA 1QUKA 3T9XB 4DV6E 4LONB 2JYAA 4RPNA 1N36E 4MFIA 4GD5A 4NQ8A 2J7JA 3OO7A 1JQFA 4GIZA 4GKKE 5K2XA 5LMNE 4NG7A 3HHGA 5TPAA 3FV1A 1XI6A 1SYIA 2JY9A 4F18A 4B3ME 3TTNA 2NOOA 5CBRA 1Y9UA 5A2QC 1X47A 3O2AA 1PBQA 4OA4A 4JVDA 5H8NB 5I84A 3RPWA 5KL2A 4GFRA 3CG1A 2PBWA 3FVOA 4GL8A 1B4HA 5DYHA 3OTOE 5CRYA 3VYYA 1UTBA 2O84X
chains in the Genus database with same CATH topology
2Z23A 3MZ9A 2O6AA 1AOVA 2DP8A 1CB6A 3K6WA 2Z8FA 2REJA 5F7VA 1LFIA 3DLNA 2F34A 3RLFE 2ANJA 3PPPA 1LCFA 5CC2A 5HBCA 1NNPA 3A09A 2F78A 2OLBA 1MDP1 3HCQA 1MH3A 2QS4A 2I58A 3MP8A 3VXBA 1UIUA 4GOTA 1B2HA 2QPQA 4N13A 4KCCA 4OETA 4NF6A 3KOTA 3R6UA 1JEVA 1VE4A 5M2VA 3T96B 4BDMA 1TT1A 3K1PA 1DMBA 4P0GA 1LFGA 2GRVA 3SEXA 1A40A 1JW1A 3CI8A 4U1OA 1ELJA 1PB9A 3WAFA 1SW2A 3FUZA 1BTJA 5ELVA 3EQ1A 3PPNA 1VSOA 3IORA 2O51A 2VP1A 2AYSA 2QS2A 2O68A 3S9LC 4R9FA 2D3IA 3VDFA 4UA8A 1A8FA 4QFPA 2XX7A 3FV2A 5I2NB 4ZZEA 3LC8A 2O7IA 1B3LA 1N84A 1I6BA 4ELRA 4PE5B 3VVDA 1AMFA 4EF2A 4M4GA 1GVCA 2XD2A 2RC9A 4F1UA 3KZGA 1B32A 1TFDA 4R9GA 3FJ7A 2PMSA 3BFUA 1JNFA 4DE8A 1M5CA 1BKAA 1L5TA 3TEPA 2DVCA 2FA7A 2V3QA 3ILUB 1NFTA 3O97A 1N7XA 5DEXA 3EPEA 2F8DA 3IR1A 4NEDA 3C36A 1JEUA 3LBSA 3CR9A 4U2RA 3F11A 4OEUA 3S2VA 2QS3A 1DTZA 2ZMBA 1B3EA 3KN8A 3HN0A 2DQVA 4ECFA 3KFMA 4YMBA 2DWAA 3VXCA 1N3WA 3UN6A 2Z8EA 4EQ7A 1YCJA 4LQ2A 3V8XB 4H1XA 4Q0CA 1GGGA 3ECRA 1FTKA 3CFZA 2O7UA 2RC8A 1LB8A 2I0BA 4OEVA 3PUYE 1H45A 2M8CA 1QULA 3K0VA 1M5BA 1MS7A 4X9TA 3PUWE 3PD9A 4YB6A 2HCAA 2Q88A 1USYE 4H65A 4N6PA 1NNFA 3U94A 1B3GA 3UP9A 3THIA 4ZEDA 3ZS6A 3PMVA 3MVWA 2PT1A 2UXAA 5AA4A 3SEWA 2IA4A 5EHSA 3SEYA 4N07A 3TTMA 1YTVA 1IIWA 4QF9A 3LSWA 4LQ5A 1MQDA 2F36A 1MXXA 4DXBA 2B3BA 2DE4A 1Y3NA 1Y3QA 5AA2A 2GHBA 4RY1A 2V93A 2FYIA 3ZSFA 1R9QA 1FQCA 2E0SA 1B1HA 4KCDA 1MM7A 3SKPA 4IO4A 3PV0E 4F22A 4DXUA 4F39A 5L9SA 3LSFB 1URSA 1PEBA 4OHNA 5I2KB 2X7PA 2XXRA 4LZ7A 1N0TA 4NF4B 4MF3A 1H76A 2QMWA 2ONRA 1A8EA 4JWYA 4BDLA 3MW0A 3VVEA 4G77A 4TLMB 1SD3A 3PUXE 3ZKLA 1AIVA 3KJTA 4LZ5A 3QSLA 1ATGA 2FNCA 1N3XA 3K00A 4LA9A 5I58B 1ANFA 1QKBA 2G29A 3R7XA 2OZZA 5CMKA 1JW5A 3U1OA 3K2DA 2UVJA 3TKDA 5H8HA 4XKQA 5K2YA 2DXRA 4OZ9A 1B05A 2HZLA 1JVXA 4KR5A 5BWJA 1Z7NE 4IY5A 4FEDA 1JW4A 1MDQA 3FXQA 2ONSA 5IKBA 2UVIA 1SBPA 3OEMA 4OWDA 3T9HB 2XXPA 3IB2A 3MP1A 4U1ZA 3H6TA 1IZ1A 2DWJA 3MZ1A 1MQJA 2F7BA 1B0HA 1MM6A 5J1DA 2XXVA 4ZEIA 1B58A 4IY6A 3LR1A 3KBRA 4FAJA 3B7DA 1US5A 1OLAA 4H67A 5HM4B 1B4ZA 3DP4A 4NMYA 2O69A 1O64A 1MQHA 4TLLB 4AB5A 4BDQA 4R6HA 3FGSA 4PFWA 3FJGA 5AE4A 1B5HA 3TCHA 4ESXA 3CFXA 1LBBA 1MXVA 3O66A 1UTHA 1B1XA 4PETA 4BDOA 5FHOA 2F6PA 2RCAA 2Q8JA 2VOZA 1N76A 3PU5A 3FVGA 3TCFA 5I56A 1SQYA 3GXAA 5I59B 3G3IA 1ZKBA 4ONYA 5I57A 3QK6A 1EU8A 4IO6A 2H99A 3N6UA 1BP5A 2OJTA 1XHYA 4FORA 1MY2A 4KQPA 4F31B 3K6UA 5H8SA 1FTOA 3RTWB 4NWCA 5JTYA 4MH5A 2V3TA 3IOUA 4HCYA 4X48A 2Y84A 2Y7WA 5KDTA 4EF1A 4E0WA 4OQOA 1FTMA 4KYEA 2DWHA 3DP6A 1MQGA 3RUMA 1JETA 5FTHA 4P11A 4QHQA 4U23A 1NH7A 3EHUA 2BJJX 4O3AA 4ZEFA 4DCXA 1SVXB 1RYOA 2Y7KA 3K6XA 4I9DA 2DSFA 2O1MA 4G68B 1B3HA 1EH3A 3E9XA 2OK2A 1FQDA 4U22A 3SESA 3H6UA 4YKJA 4M1VA 3JZJA 3IO6A 4XXUA 4F1VA 1MQIA 1A99A 4O3CA 1HSEA 3UORA 1F9BA 3RN8A 3OSQA 5CBSA 3KG2A 5H8QA 2XX9A 4EQBA 1DTGA 2QSXA 3C34A 1IXGA 1P99A 3PUVE 3USDA 3OMBA 3VLVA 2ZNTA 1IEJA 1QUJA 2ZYOA 3ILTB 1SW5A 4XIGQ 4GLIA 2GHAA 1P1NA 3PPOA 4YB7A 3QXMA 1AH5A 1N7WA 1SI0A 1WVJA 2H25A 5ISUA 2X26A 3UGWA 4RJZA 4NF5A 3B6WA 4EXKA 3K4UA 4H0WA 1NKXA 4F2QA 3OEKA 1B52A 1MY4A 3N5LA 1LBCA 4G8HA 3S9EA 3S9MC 3I3VA 2GFEA 4WEPA 3OO6A 3IB1A 4K3FA 1VFDA 3KN7A 3H06B 1A55A 4ZS9A 3RTFB 4NF8A 4Q30B 4Z7EA 1Z7ME 1B9JA 1GTKA 4JSDA 1M5EA 2I3WA 3IX1A 4HTGA 4R6KA 1MXUA 3T9UA 2I4CA 1SW4A 4YMAA 3HPIA 1PC3A 4PFYA 4ZE9A 4PP0A 2YPNA 2F35A 3RT8A 2RKMA 2I3VA 3RNNA 1HSLA 4L17A 2Z22A 4ELPA 2RCBA 4R2FA 2V3UA 5B70A 4FJPA 4OVJA 1OVBA 2R6GE 3T66A 3GBAA 3FATA 4ELOA 3FASA 2XXYA 5TPAB 2DWIA 1P1QA 1US4A 3LSXA 3KSJA 2Z8DA 2REGA 3DELB 1CE2A 5A5XA 4BDNA 3H03A 5EYFA 3MVYA 2LAOA 4NTLA 2PX1A 1D9VA 1Y4TA 1FTLA 2DS9A 1I6AA 1MPCA 1URDA 1POY1 3MAMA 3TQWA 1IXCA 1UTBB 3C32A 1SI1A 1ZJLA 4OTEA 5LOMA 1ZTYA 3FIRA 3ODBA 4ESWA 4Z0IA 3OOAA 1S7YA 4DXCA 4XKRA 5ITPA 2O1LA 2A5SA 2XXQA 1LAHE 3PD8A 4I62A 4PQJA 1MPDA 4OENA 4XTCQ 4IGTA 1XVYA 3HHFA 5TP9A 4G4PA 1LSTA 2XXIA 2NXOA 3MVZA 2ZYMA 3K1MA 3G3KA 1RYXA 3KGCA 1BIYA 2HEUA 4NF6B 2Q9TA 4AQ4A 1FQEA 5F1QA 4G8NA 5CMCA 2DXYA 4EQ9A 1EZOA 2I4BA 2NWJA 2H4IA 5B7DA 3T93B 1LCTA 3MQ9A 4POXA 2ZYKA 4I8CA 3Q25A 1R6ZA 3I5OA 3QYTA 4ZDMA 4QFKA 4NF8B 4DZ1A 1LB9A 4DIGA 1D4NA 4KPTA 4TQUQ 2HAUA 3ONMA 4ZE8A 2GH9A 2RC7A 2Q2CA 3H4ZA 4GVOA 4KD5A 1B3FA 3AXFA 4DLDA 5H8FA 3B6QA 2HXWA 3MWBA 4RK9A 5IAIA 3IO4A 3MJNA 5DVJA 3C9HA 4MBPA 1MG1A 3CIJA 2THIA 4ZZAA 4F3SA 1OQGA 1TXFA 3SDFA 3Q29A 2CMOA 2DVZA 2XXXA 2VGQA 1S50A 3PGFA 4C0RA 2PVUA 2A5TA 2AIXA 4QSCA 2VD2A 1B7HA 5FTIA 3FVNA 3FVKA 1Y20A 3BKIB 5DEXB 1TWYA 1XOCA 2RINA 4H8JA 4DDDA 2I6EA 3M8UA 4H6DA 3N94A 3PMXA 3EN3A 3Q26A 5ICTA 1IUDA 3D4GA 3O9PA 2UVGA 1NNTA 1MY0A 5KCJA 1XT8A 3KEIA 5TU0A 4GRKA 3IJOB 4OMBA 4ZEKA 4JDFA 1B5JA 2P1SA 3CRBA 2QS1A 4WXJA 3PUZE 4KYDA 1XVXA 2UYFA 3TTKA 3P7IA 3TCGA 3G3GA 4QFOA 4OXVA 3TUSA 2NUVA 5H8NA 4HCWA 5L9MA 3M3FA 3U8QA 3H6WA 5AA4B 2V84A 4MLQA 3W9VA 3CSGA 2E1SA 2F5XA 2ABHA 3C33A 4THIA 1WODA 1SDXA 1URGA 4EDPA 1VFEA 3TPAA 3C35A 3FD3A 4YAHX 4G8MA 3CG3A 2UVHA 3OENA 2WKYA 2QL3A 5AA2B 3K1NA 3GLBA 3UIFA 1D3KA 4U4XA 4YB5A 5L9OA 4XKPA 1BLFA 2HQ0A 4GQOA 1POTA 4RK2A 3OO9A 3MP6A 3RY3A 1P1OA 1B46A 1PBPA 1IITA 1I69A 4R75A 1EZPA 4X1BA 4F29A 1M5FA 2A5TB 3MPLA 3EF7A 1YAEA 4R74A 3E4RA 4QFLA 3OELA 4YICA 2HFBA 4TOZA 3GZGA 3TAJA 2Q2AA 3U93A 4QSDA 5I2NA 4G2ZA 2B65A 2UYEA 1OQHA 2ZNUA 3G7WA 3HSTA 1ZMGA 3G3HA 5H8HB 3K02A 3KJ7A 3VV5A 2AL5A 1OIBA 2D5WA 1Q35A 4FIMA 3IOVA 3CFLA 2HZKA 3E13X 3QUFA 4QSEA 4POWA 1B6HA 2QRYA 1LAXA 3KOSA 1ZIUA 4ELQA 3HO7A 3O29A 4NE4A 1Y3PA 2ONKE 4E0XA 3JYRA 4OFLA 1Q1KA 3C4MA 4GXAA 3E3KA 2Y7RA 4ND9A 4JWOA 3VVFA 4BDRA 5HPQA 3U72A 1A54A 3OSRA 4U21A 1MPBA 3QUJA 4GL0A 1ZU0A 1UTHB 4OESA 2Q89A 3MZBA 1Y1ZA 3B6TA 2DE2A 3SETA 3VLUA 4YKKA 4H8IA 1FTJA 3MBPA 4F1YA 2ALUA 3CSBA 3TDJA 3TTLA 3SERA 4R73A 1KWHA 5I56B 2OBGA 4H5GA 5FHNA 1UIVA 2RF1A 1B7ZA 4LATA 4YZZA 1FQFA 3KN3A 4GWOA 3MC2A 4QFNA 4RNSA 4U4SA 5I57B 1QVSA 1SW1A 3KSXA 3DM0A 3IL1B 4F3PA 5JK4A 2H5YA 3EHSA 3OO8A 3IK6B 4IO2A 4GXSB 1SYHA 4OERA 1XS5A 2VHAA 4IB2A 5JTYB 1P1WA 4R72A 3PPRA 3CVGA 4JSOA 4LUBA 1I6QA 5KDTB 1XC1A 5AA2D 1FW0A 4JBZA 5I2KA 4IO5A 4GF8A 2XXTA 2YJPA 4NF4A 4R2BA 5ITOA 3K01A 3L6HA 2XXUA 3VE1B 3IAZA 3MUQA 3LSLA 1USYH 4MLVA 2DYXA 1T0KA 5JEIA 1D9YA 4IGRA 2F6GA 4F3GA 4H5FA 5I58A 2OCUA 4BLAA 2OWSA 5AA3A 5H8QB 1MRPA 3A3CA 2B3FA 3VFJA 4C1TA 3K6VA 4KHZE 1AL3A 1B5IA 4FE8A 1PDAA 1MXZA 2IEEA 1M5DA 3M3KA 3SEVA 3TELA 3FZVA 3H6VA 4HW8A 4PFTA 3EHTA 4FATA 3M3LA 4RPOA 1DSNA 5BUUA 4DCYA 1YPNA 3IB0A 3S4UA 4R6YA 1FCKA 4I1DA 4ZECA 4QRZA 2XXWA 4NF5B 3TMGA 4EXLA 2XXHA 4Q5TA 1QJMA 4Q8RA 2I0CA 3HV1A 2ZNSA 4X1DA 4JXIA 4G68C 1ZLQA 3Q27A 3UK4A 1PB8A 2X7QA 3GBBA 2ZXTA 4OFOA 3TYHA 4OYVA 1NH8A 4IO7A 3Q28A 4FECA 4P0IA 2QJEA 4LP2B 2I49A 4RYAA 3V83A 1O63A 5CI5A 1EZ9A 2CZLA 1MH4A 3T22A 1H44A 1UQWA 3IOWA 4ZEBA 3IOTA 1B40A 3G3JA 1R9LA 2Y7PA 1MXYA 2D21A 3WAEA 5DTBA 2H9BA 3O6GA 4LZ8A 2F7CA 3OD7A 5I59A 1NMUA 1NL5A 1LAGE 2XHDA 2QMXA 5AA1A 1FQAA 3S9NC 4YKIA 1ZBMA 1FQBA 3DP8A 2Y7IA 1H3DA 3R26A 4YU0A 4PFUA 2KLFA 2DE3A 3H7MA 5A5XB 1JVYA 4UACA 3D4CA 1QW0A 2PT2A 1WDNA 3O28A 3SEUA 3FJMA 3VLWA 3TODA 3U92A 1HSJA 1R1NA 2V25A 3RQTA 3MVXA 4XKNA 5EHMA 4YKPA 3TTRA 1B0LA 3QIMA 2P2AA 4KI0E 1MY3A 3RT6B 4FEBA 3H3GA 2F97A 3QAXA 4IO3A 2P0SA 4G68A 2G93A 1LLSA 2R9JA 1N04A 3L6GA 1RKMA 3PMWA 5TP9B 4JWXA 5DT6A 4F19A 3IJXB 1OVTA 1OLCA 4WKMA 1A7LA 1DPEA 3TFLA 1GR2A 5CMMA 3ZKKA 1GV8A 4KFQA 2VD3A 1H43A 2ESNA 2NVUB 4NWDA 1IXHA 3C31A 4KYSA 2XX8A 3LUYA 2R71A 2I48A 3TZAA 1S9TA 4AB6A 1QKAA 5ICQA 1NNKA 4JB7A 2OWTA 3W9WA 1J1NA 5CMBA 3T9VA 3FXRA 3V5AA 3JV9A 1Y1MA 5FHMA 3A3UA 3FXUA 1II5A 3RGYA 1OMPA 2W7YA 1LGBC 5KZTA 2H98A 3TQLA 4HS7A 1VR5A 3G3FA 4RXLA 4O3BA 2HAVA 3BFTA 1P1UA 1TFAA 2XD3A 3W15C 1IXIA 4WEDA 3PPQA 4ISUA 1Y4CA 3O6HA 5H8FB 2AL4A 5CM6A 1O7TA 4OFJA 1B7UA 2YLNA 1LAFE 3O6IA 5DVIA 3V89B 2DOJA 1LFHA 5L8DA 1DOTA 2PYYA 4F3BA 1MXWA 2F7AA 1QUIA 4LVQA 3N6TA 1IQ7A 3MPKA 3N26A 3UA8A 4RA1A 4F2OA 1B51A 1MY1A 2ZYNA 5DVFA 3OXNA 1PB7A 4EUOA 1DPPA 3BBRA 5KCJB 4C1UA 3I6VA 1QUKA 3T9XB 4LONB 4RPNA 4MFIA 4GD5A 4GIZA 3OO7A 1JQFA 5K2XA 3HHGA 5TPAA 3FV1A 1SYIA 4F18A 3TTNA 2NOOA 5CBRA 1Y9UA 3O2AA 1PBQA 5H8NB 5I84A 3RPWA 4GFRA 3CG1A 2PBWA 3FVOA 4GL8A 1B4HA 5DYHA 5CRYA 1UTBA 2O84X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z23 A;  3MZ9 A;  2O6A A;  1AOV A;  2DP8 A;  1CB6 A;  3K6W A;  2Z8F A;  2REJ A;  5F7V A;  1LFI A;  3DLN A;  2F34 A;  3RLF E;  2ANJ A;  3PPP A;  1LCF A;  5CC2 A;  5HBC A;  1NNP A;  3A09 A;  2F78 A;  2OLB A;  1MDP 1;  3HCQ A;  1MH3 A;  2QS4 A;  2I58 A;  3MP8 A;  3VXB A;  1UIU A;  4GOT A;  1B2H A;  2QPQ A;  4N13 A;  4KCC A;  4OET A;  4NF6 A;  3KOT A;  3R6U A;  1JEV A;  1VE4 A;  5M2V A;  3T96 B;  4BDM A;  1TT1 A;  3K1P A;  1DMB A;  4P0G A;  1LFG A;  2GRV A;  3SEX A;  1A40 A;  1JW1 A;  3CI8 A;  4U1O A;  1ELJ A;  1PB9 A;  3WAF A;  1SW2 A;  3FUZ A;  1BTJ A;  5ELV A;  3EQ1 A;  3PPN A;  1VSO A;  3IOR A;  2O51 A;  2VP1 A;  2AYS A;  2QS2 A;  2O68 A;  3S9L C;  4R9F A;  2D3I A;  3VDF A;  4UA8 A;  1A8F A;  4QFP A;  2XX7 A;  3FV2 A;  5I2N B;  4ZZE A;  3LC8 A;  2O7I A;  1B3L A;  1N84 A;  1I6B A;  4ELR A;  4PE5 B;  3VVD A;  1AMF A;  4EF2 A;  4M4G A;  1GVC A;  2XD2 A;  2RC9 A;  4F1U A;  3KZG A;  1B32 A;  1TFD A;  4R9G A;  3FJ7 A;  2PMS A;  3BFU A;  1JNF A;  4DE8 A;  1M5C A;  1BKA A;  1L5T A;  3TEP A;  2DVC A;  2FA7 A;  2V3Q A;  3ILU B;  1NFT A;  3O97 A;  1N7X A;  5DEX A;  3EPE A;  2F8D A;  3IR1 A;  4NED A;  3C36 A;  1JEU A;  3LBS A;  3CR9 A;  4U2R A;  3F11 A;  4OEU A;  3S2V A;  2QS3 A;  1DTZ A;  2ZMB A;  1B3E A;  3KN8 A;  3HN0 A;  2DQV A;  4ECF A;  3KFM A;  4YMB A;  2DWA A;  3VXC A;  1N3W A;  3UN6 A;  2Z8E A;  4EQ7 A;  1YCJ A;  4LQ2 A;  3V8X B;  4H1X A;  4Q0C A;  1GGG A;  3ECR A;  1FTK A;  3CFZ A;  2O7U A;  2RC8 A;  1LB8 A;  2I0B A;  4OEV A;  3PUY E;  1H45 A;  2M8C A;  1QUL A;  3K0V A;  1M5B A;  1MS7 A;  4X9T A;  3PUW E;  3PD9 A;  4YB6 A;  2HCA A;  2Q88 A;  1USY E;  4H65 A;  4N6P A;  1NNF A;  3U94 A;  1B3G A;  3UP9 A;  3THI A;  4ZED A;  3ZS6 A;  3PMV A;  3MVW A;  2PT1 A;  2UXA A;  5AA4 A;  3SEW A;  2IA4 A;  5EHS A;  3SEY A;  4N07 A;  3TTM A;  1YTV A;  1IIW A;  4QF9 A;  3LSW A;  4LQ5 A;  1MQD A;  2F36 A;  1MXX A;  4DXB A;  2B3B A;  2DE4 A;  1Y3N A;  1Y3Q A;  5AA2 A;  2GHB A;  4RY1 A;  2V93 A;  2FYI A;  3ZSF A;  1R9Q A;  1FQC A;  2E0S A;  1B1H A;  4KCD A;  1MM7 A;  3SKP A;  4IO4 A;  3PV0 E;  4F22 A;  4DXU A;  4F39 A;  5L9S A;  3LSF B;  1URS A;  1PEB A;  4OHN A;  5I2K B;  2X7P A;  2XXR A;  4LZ7 A;  1N0T A;  4NF4 B;  4MF3 A;  1H76 A;  2QMW A;  2ONR A;  1A8E A;  4JWY A;  4BDL A;  3MW0 A;  3VVE A;  4G77 A;  4TLM B;  1SD3 A;  3PUX E;  3ZKL A;  1AIV A;  3KJT A;  4LZ5 A;  3QSL A;  1ATG A;  2FNC A;  1N3X A;  3K00 A;  4LA9 A;  5I58 B;  1ANF A;  1QKB A;  2G29 A;  3R7X A;  2OZZ A;  5CMK A;  1JW5 A;  3U1O A;  3K2D A;  2UVJ A;  3TKD A;  5H8H A;  4XKQ A;  5K2Y A;  2DXR A;  4OZ9 A;  1B05 A;  2HZL A;  1JVX A;  4KR5 A;  5BWJ A;  1Z7N E;  4IY5 A;  4FED A;  1JW4 A;  1MDQ A;  3FXQ A;  2ONS A;  5IKB A;  2UVI A;  1SBP A;  3OEM A;  4OWD A;  3T9H B;  2XXP A;  3IB2 A;  3MP1 A;  4U1Z A;  3H6T A;  1IZ1 A;  2DWJ A;  3MZ1 A;  1MQJ A;  2F7B A;  1B0H A;  1MM6 A;  5J1D A;  2XXV A;  4ZEI A;  1B58 A;  4IY6 A;  3LR1 A;  3KBR A;  4FAJ A;  3B7D A;  1US5 A;  1OLA A;  4H67 A;  5HM4 B;  1B4Z A;  3DP4 A;  4NMY A;  2O69 A;  1O64 A;  1MQH A;  4TLL B;  4AB5 A;  4BDQ A;  4R6H A;  3FGS A;  4PFW A;  3FJG A;  5AE4 A;  1B5H A;  3TCH A;  4ESX A;  3CFX A;  1LBB A;  1MXV A;  3O66 A;  1UTH A;  1B1X A;  4PET A;  4BDO A;  5FHO A;  2F6P A;  2RCA A;  2Q8J A;  2VOZ A;  1N76 A;  3PU5 A;  3FVG A;  3TCF A;  5I56 A;  1SQY A;  3GXA A;  5I59 B;  3G3I A;  1ZKB A;  4ONY A;  5I57 A;  3QK6 A;  1EU8 A;  4IO6 A;  2H99 A;  3N6U A;  1BP5 A;  2OJT A;  1XHY A;  4FOR A;  1MY2 A;  4KQP A;  4F31 B;  3K6U A;  5H8S A;  1FTO A;  3RTW B;  4NWC A;  5JTY A;  4MH5 A;  2V3T A;  3IOU A;  4HCY A;  4X48 A;  2Y84 A;  2Y7W A;  5KDT A;  4EF1 A;  4E0W A;  4OQO A;  1FTM A;  4KYE A;  2DWH A;  3DP6 A;  1MQG A;  3RUM A;  1JET A;  5FTH A;  4P11 A;  4QHQ A;  4U23 A;  1NH7 A;  3EHU A;  2BJJ X;  4O3A A;  4ZEF A;  4DCX A;  1SVX B;  1RYO A;  2Y7K A;  3K6X A;  4I9D A;  2DSF A;  2O1M A;  4G68 B;  1B3H A;  1EH3 A;  3E9X A;  2OK2 A;  1FQD A;  4U22 A;  3SES A;  3H6U A;  4YKJ A;  4M1V A;  3JZJ A;  3IO6 A;  4XXU A;  4F1V A;  1MQI A;  1A99 A;  4O3C A;  1HSE A;  3UOR A;  1F9B A;  3RN8 A;  3OSQ A;  5CBS A;  3KG2 A;  5H8Q A;  2XX9 A;  4EQB A;  1DTG A;  2QSX A;  3C34 A;  1IXG A;  1P99 A;  3PUV E;  3USD A;  3OMB A;  3VLV A;  2ZNT A;  1IEJ A;  1QUJ A;  2ZYO A;  3ILT B;  1SW5 A;  4XIG Q;  4GLI A;  2GHA A;  1P1N A;  3PPO A;  4YB7 A;  3QXM A;  1AH5 A;  1N7W A;  1SI0 A;  1WVJ A;  2H25 A;  5ISU A;  2X26 A;  3UGW A;  4RJZ A;  4NF5 A;  3B6W A;  4EXK A;  3K4U A;  4H0W A;  1NKX A;  4F2Q A;  3OEK A;  1B52 A;  1MY4 A;  3N5L A;  1LBC A;  4G8H A;  3S9E A;  3S9M C;  3I3V A;  2GFE A;  4WEP A;  3OO6 A;  3IB1 A;  4K3F A;  1VFD A;  3KN7 A;  3H06 B;  1A55 A;  4ZS9 A;  3RTF B;  4NF8 A;  4Q30 B;  4Z7E A;  1Z7M E;  1B9J A;  1GTK A;  4JSD A;  1M5E A;  2I3W A;  3IX1 A;  4HTG A;  4R6K A;  1MXU A;  3T9U A;  2I4C A;  1SW4 A;  4YMA A;  3HPI A;  1PC3 A;  4PFY A;  4ZE9 A;  4PP0 A;  2YPN A;  2F35 A;  3RT8 A;  2RKM A;  2I3V A;  3RNN A;  1HSL A;  4L17 A;  2Z22 A;  4ELP A;  2RCB A;  4R2F A;  2V3U A;  5B70 A;  4FJP A;  4OVJ A;  1OVB A;  2R6G E;  3T66 A;  3GBA A;  3FAT A;  4ELO A;  3FAS A;  2XXY A;  5TPA B;  2DWI A;  1P1Q A;  1US4 A;  3LSX A;  3KSJ A;  2Z8D A;  2REG A;  3DEL B;  1CE2 A;  5A5X A;  4BDN A;  3H03 A;  5EYF A;  3MVY A;  2LAO A;  4NTL A;  2PX1 A;  1D9V A;  1Y4T A;  1FTL A;  2DS9 A;  1I6A A;  1MPC A;  1URD A;  1POY 1;  3MAM A;  3TQW A;  1IXC A;  1UTB B;  3C32 A;  1SI1 A;  1ZJL A;  4OTE A;  5LOM A;  1ZTY A;  3FIR A;  3ODB A;  4ESW A;  4Z0I A;  3OOA A;  1S7Y A;  4DXC A;  4XKR A;  5ITP A;  2O1L A;  2A5S A;  2XXQ A;  1LAH E;  3PD8 A;  4I62 A;  4PQJ A;  1MPD A;  4OEN A;  4XTC Q;  4IGT A;  1XVY A;  3HHF A;  5TP9 A;  4G4P A;  1LST A;  2XXI A;  2NXO A;  3MVZ A;  2ZYM A;  3K1M A;  3G3K A;  1RYX A;  3KGC A;  1BIY A;  2HEU A;  4NF6 B;  2Q9T A;  4AQ4 A;  1FQE A;  5F1Q A;  4G8N A;  5CMC A;  2DXY A;  4EQ9 A;  1EZO A;  2I4B A;  2NWJ A;  2H4I A;  5B7D A;  3T93 B;  1LCT A;  3MQ9 A;  4POX A;  2ZYK A;  4I8C A;  3Q25 A;  1R6Z A;  3I5O A;  3QYT A;  4ZDM A;  4QFK A;  4NF8 B;  4DZ1 A;  1LB9 A;  4DIG A;  1D4N A;  4KPT A;  4TQU Q;  2HAU A;  3ONM A;  4ZE8 A;  2GH9 A;  2RC7 A;  2Q2C A;  3H4Z A;  4GVO A;  4KD5 A;  1B3F A;  3AXF A;  4DLD A;  5H8F A;  3B6Q A;  2HXW A;  3MWB A;  4RK9 A;  5IAI A;  3IO4 A;  3MJN A;  5DVJ A;  3C9H A;  4MBP A;  1MG1 A;  3CIJ A;  2THI A;  4ZZA A;  4F3S A;  1OQG A;  1TXF A;  3SDF A;  3Q29 A;  2CMO A;  2DVZ A;  2XXX A;  2VGQ A;  1S50 A;  3PGF A;  4C0R A;  2PVU A;  2A5T A;  2AIX A;  4QSC A;  2VD2 A;  1B7H A;  5FTI A;  3FVN A;  3FVK A;  1Y20 A;  3BKI B;  5DEX B;  1TWY A;  1XOC A;  2RIN A;  4H8J A;  4DDD A;  2I6E A;  3M8U A;  4H6D A;  3N94 A;  3PMX A;  3EN3 A;  3Q26 A;  5ICT A;  1IUD A;  3D4G A;  3O9P A;  2UVG A;  1NNT A;  1MY0 A;  5KCJ A;  1XT8 A;  3KEI A;  5TU0 A;  4GRK A;  3IJO B;  4OMB A;  4ZEK A;  4JDF A;  1B5J A;  2P1S A;  3CRB A;  2QS1 A;  4WXJ A;  3PUZ E;  4KYD A;  1XVX A;  2UYF A;  3TTK A;  3P7I A;  3TCG A;  3G3G A;  4QFO A;  4OXV A;  3TUS A;  2NUV A;  5H8N A;  4HCW A;  5L9M A;  3M3F A;  3U8Q A;  3H6W A;  5AA4 B;  2V84 A;  4MLQ A;  3W9V A;  3CSG A;  2E1S A;  2F5X A;  2ABH A;  3C33 A;  4THI A;  1WOD A;  1SDX A;  1URG A;  4EDP A;  1VFE A;  3TPA A;  3C35 A;  3FD3 A;  4YAH X;  4G8M A;  3CG3 A;  2UVH A;  3OEN A;  2WKY A;  2QL3 A;  5AA2 B;  3K1N A;  3GLB A;  3UIF A;  1D3K A;  4U4X A;  4YB5 A;  5L9O A;  4XKP A;  1BLF A;  2HQ0 A;  4GQO A;  1POT A;  4RK2 A;  3OO9 A;  3MP6 A;  3RY3 A;  1P1O A;  1B46 A;  1PBP A;  1IIT A;  1I69 A;  4R75 A;  1EZP A;  4X1B A;  4F29 A;  1M5F A;  2A5T B;  3MPL A;  3EF7 A;  1YAE A;  4R74 A;  3E4R A;  4QFL A;  3OEL A;  4YIC A;  2HFB A;  4TOZ A;  3GZG A;  3TAJ A;  2Q2A A;  3U93 A;  4QSD A;  5I2N A;  4G2Z A;  2B65 A;  2UYE A;  1OQH A;  2ZNU A;  3G7W A;  3HST A;  1ZMG A;  3G3H A;  5H8H B;  3K02 A;  3KJ7 A;  3VV5 A;  2AL5 A;  1OIB A;  2D5W A;  1Q35 A;  4FIM A;  3IOV A;  3CFL A;  2HZK A;  3E13 X;  3QUF A;  4QSE A;  4POW A;  1B6H A;  2QRY A;  1LAX A;  3KOS A;  1ZIU A;  4ELQ A;  3HO7 A;  3O29 A;  4NE4 A;  1Y3P A;  2ONK E;  4E0X A;  3JYR A;  4OFL A;  1Q1K A;  3C4M A;  4GXA A;  3E3K A;  2Y7R A;  4ND9 A;  4JWO A;  3VVF A;  4BDR A;  5HPQ A;  3U72 A;  1A54 A;  3OSR A;  4U21 A;  1MPB A;  3QUJ A;  4GL0 A;  1ZU0 A;  1UTH B;  4OES A;  2Q89 A;  3MZB A;  1Y1Z A;  3B6T A;  2DE2 A;  3SET A;  3VLU A;  4YKK A;  4H8I A;  1FTJ A;  3MBP A;  4F1Y A;  2ALU A;  3CSB A;  3TDJ A;  3TTL A;  3SER A;  4R73 A;  1KWH A;  5I56 B;  2OBG A;  4H5G A;  5FHN A;  1UIV A;  2RF1 A;  1B7Z A;  4LAT A;  4YZZ A;  1FQF A;  3KN3 A;  4GWO A;  3MC2 A;  4QFN A;  4RNS A;  4U4S A;  5I57 B;  1QVS A;  1SW1 A;  3KSX A;  3DM0 A;  3IL1 B;  4F3P A;  5JK4 A;  2H5Y A;  3EHS A;  3OO8 A;  3IK6 B;  4IO2 A;  4GXS B;  1SYH A;  4OER A;  1XS5 A;  2VHA A;  4IB2 A;  5JTY B;  1P1W A;  4R72 A;  3PPR A;  3CVG A;  4JSO A;  4LUB A;  1I6Q A;  5KDT B;  1XC1 A;  5AA2 D;  1FW0 A;  4JBZ A;  5I2K A;  4IO5 A;  4GF8 A;  2XXT A;  2YJP A;  4NF4 A;  4R2B A;  5ITO A;  3K01 A;  3L6H A;  2XXU A;  3VE1 B;  3IAZ A;  3MUQ A;  3LSL A;  1USY H;  4MLV A;  2DYX A;  1T0K A;  5JEI A;  1D9Y A;  4IGR A;  2F6G A;  4F3G A;  4H5F A;  5I58 A;  2OCU A;  4BLA A;  2OWS A;  5AA3 A;  5H8Q B;  1MRP A;  3A3C A;  2B3F A;  3VFJ A;  4C1T A;  3K6V A;  4KHZ E;  1AL3 A;  1B5I A;  4FE8 A;  1PDA A;  1MXZ A;  2IEE A;  1M5D A;  3M3K A;  3SEV A;  3TEL A;  3FZV A;  3H6V A;  4HW8 A;  4PFT A;  3EHT A;  4FAT A;  3M3L A;  4RPO A;  1DSN A;  5BUU A;  4DCY A;  1YPN A;  3IB0 A;  3S4U A;  4R6Y A;  1FCK A;  4I1D A;  4ZEC A;  4QRZ A;  2XXW A;  4NF5 B;  3TMG A;  4EXL A;  2XXH A;  4Q5T A;  1QJM A;  4Q8R A;  2I0C A;  3HV1 A;  2ZNS A;  4X1D A;  4JXI A;  4G68 C;  1ZLQ A;  3Q27 A;  3UK4 A;  1PB8 A;  2X7Q A;  3GBB A;  2ZXT A;  4OFO A;  3TYH A;  4OYV A;  1NH8 A;  4IO7 A;  3Q28 A;  4FEC A;  4P0I A;  2QJE A;  4LP2 B;  2I49 A;  4RYA A;  3V83 A;  1O63 A;  5CI5 A;  1EZ9 A;  2CZL A;  1MH4 A;  3T22 A;  1H44 A;  1UQW A;  3IOW A;  4ZEB A;  3IOT A;  1B40 A;  3G3J A;  1R9L A;  2Y7P A;  1MXY A;  2D21 A;  3WAE A;  5DTB A;  2H9B A;  3O6G A;  4LZ8 A;  2F7C A;  3OD7 A;  5I59 A;  1NMU A;  1NL5 A;  1LAG E;  2XHD A;  2QMX A;  5AA1 A;  1FQA A;  3S9N C;  4YKI A;  1ZBM A;  1FQB A;  3DP8 A;  2Y7I A;  1H3D A;  3R26 A;  4YU0 A;  4PFU A;  2KLF A;  2DE3 A;  3H7M A;  5A5X B;  1JVY A;  4UAC A;  3D4C A;  1QW0 A;  2PT2 A;  1WDN A;  3O28 A;  3SEU A;  3FJM A;  3VLW A;  3TOD A;  3U92 A;  1HSJ A;  1R1N A;  2V25 A;  3RQT A;  3MVX A;  4XKN A;  5EHM A;  4YKP A;  3TTR A;  1B0L A;  3QIM A;  2P2A A;  4KI0 E;  1MY3 A;  3RT6 B;  4FEB A;  3H3G A;  2F97 A;  3QAX A;  4IO3 A;  2P0S A;  4G68 A;  2G93 A;  1LLS A;  2R9J A;  1N04 A;  3L6G A;  1RKM A;  3PMW A;  5TP9 B;  4JWX A;  5DT6 A;  4F19 A;  3IJX B;  1OVT A;  1OLC A;  4WKM A;  1A7L A;  1DPE A;  3TFL A;  1GR2 A;  5CMM A;  3ZKK A;  1GV8 A;  4KFQ A;  2VD3 A;  1H43 A;  2ESN A;  2NVU B;  4NWD A;  1IXH A;  3C31 A;  4KYS A;  2XX8 A;  3LUY A;  2R71 A;  2I48 A;  3TZA A;  1S9T A;  4AB6 A;  1QKA A;  5ICQ A;  1NNK A;  4JB7 A;  2OWT A;  3W9W A;  1J1N A;  5CMB A;  3T9V A;  3FXR A;  3V5A A;  3JV9 A;  1Y1M A;  5FHM A;  3A3U A;  3FXU A;  1II5 A;  3RGY A;  1OMP A;  2W7Y A;  1LGB C;  5KZT A;  2H98 A;  3TQL A;  4HS7 A;  1VR5 A;  3G3F A;  4RXL A;  4O3B A;  2HAV A;  3BFT A;  1P1U A;  1TFA A;  2XD3 A;  3W15 C;  1IXI A;  4WED A;  3PPQ A;  4ISU A;  1Y4C A;  3O6H A;  5H8F B;  2AL4 A;  5CM6 A;  1O7T A;  4OFJ A;  1B7U A;  2YLN A;  1LAF E;  3O6I A;  5DVI A;  3V89 B;  2DOJ A;  1LFH A;  5L8D A;  1DOT A;  2PYY A;  4F3B A;  1MXW A;  2F7A A;  1QUI A;  4LVQ A;  3N6T A;  1IQ7 A;  3MPK A;  3N26 A;  3UA8 A;  4RA1 A;  4F2O A;  1B51 A;  1MY1 A;  2ZYN A;  5DVF A;  3OXN A;  1PB7 A;  4EUO A;  1DPP A;  3BBR A;  5KCJ B;  4C1U A;  3I6V A;  1QUK A;  3T9X B;  4LON B;  4RPN A;  4MFI A;  4GD5 A;  4GIZ A;  3OO7 A;  1JQF A;  5K2X A;  3HHG A;  5TPA A;  3FV1 A;  1SYI A;  4F18 A;  3TTN A;  2NOO A;  5CBR A;  1Y9U A;  3O2A A;  1PBQ A;  5H8N B;  5I84 A;  3RPW A;  4GFR A;  3CG1 A;  2PBW A;  3FVO A;  4GL8 A;  1B4H A;  5DYH A;  5CRY A;  1UTB A;  2O84 X; 
#chains in the Genus database with same CATH topology
 4M0V A;  2Z23 A;  3MZ9 A;  2O6A A;  1AOV A;  2DP8 A;  1CB6 A;  3M99 B;  3K6W A;  4P78 A;  2Z8F A;  2EQ1 A;  2REJ A;  5F7V A;  1LFI A;  3DLN A;  2F34 A;  3RLF E;  2EPP A;  2ANJ A;  3PPP A;  1LCF A;  2VE7 C;  5CC2 A;  5HBC A;  1NNP A;  2VQE E;  3A09 A;  2F78 A;  1HNX E;  2MKZ A;  1SR9 A;  3P1X A;  2OLB A;  1SFE A;  1MDP 1;  3HCQ A;  1MH3 A;  2QS4 A;  2I58 A;  3MP8 A;  3VXB A;  1UIU A;  4GOT A;  1B2H A;  2QPQ A;  4NXN E;  5FBP A;  4G61 A;  2KR0 A;  2YTO A;  4N13 A;  5IZ3 A;  4KCC A;  2EOQ A;  4WX9 A;  5A5L A;  1NV6 A;  4OET A;  4GBV A;  4N8Y A;  4NF6 A;  2L2N A;  3KOT A;  4DR4 E;  3R6U A;  1JEV A;  1VE4 A;  5M2V A;  2PFZ A;  3T96 B;  4BDM A;  1YXI A;  4R2C A;  4H46 A;  1TT1 A;  4FBP A;  3HQ1 A;  3GYY A;  3K1P A;  2M4I A;  1DMB A;  4P0G A;  1LFG A;  2GRV A;  1IMA A;  3SEX A;  5AC4 A;  1A40 A;  1JW1 A;  3CI8 A;  4U1O A;  1ELJ A;  4PDD A;  1PB9 A;  3WAF A;  1SW2 A;  2EOJ A;  3FUZ A;  2EM5 A;  4K0K E;  1BTJ A;  5ELV A;  2CZH A;  4NHB A;  3EQ1 A;  5LDZ A;  3PPN A;  1VSO A;  2OWZ A;  3IOR A;  1RDY A;  2O51 A;  5EYH A;  2VP1 A;  2ODR C;  2R76 A;  3JAM C;  5A6B A;  4GWS A;  2AYS A;  2QS2 A;  4WPY A;  2O68 A;  3S9L C;  4JI8 E;  4R9F A;  1YSA C;  2D3I A;  2L2M A;  2A25 A;  2ZM6 E;  5EYG A;  3VDF A;  4UA8 A;  2N3H A;  1IQO A;  1A8F A;  4ZYG A;  4MAG A;  2M1S A;  4QFP A;  2XX7 A;  3FV2 A;  2NUG A;  2EOF A;  4WSP A;  5I2N B;  1N33 E;  4BS9 A;  2MDG A;  4ZZE A;  3LC8 A;  2O7I A;  2RS6 A;  3VYX A;  2YTD A;  1B3L A;  2XWO A;  1A1I A;  2R1F A;  2L92 A;  1N84 A;  1I6B A;  4ELR A;  4PE5 B;  3VVD A;  4I40 A;  4MHF A;  1AMF A;  4EF2 A;  1FPL A;  4M4G A;  1GVC A;  2XD2 A;  2RC9 A;  5EQ9 A;  4F1U A;  3KZG A;  1B32 A;  1TFD A;  4X64 E;  4R9G A;  3FJ7 A;  2PMS A;  3BFU A;  1JNF A;  4TUG A;  4DE8 A;  2V87 A;  4YY3 E;  1M5C A;  1J5E E;  1BKA A;  1L5T A;  2WYK A;  3TEP A;  2DVC A;  2FA7 A;  2V3Q A;  3ILU B;  4N81 A;  2B7V A;  1NFT A;  2LMZ A;  3B8B A;  2ELY A;  3O97 A;  1N7X A;  5DEX A;  3EPE A;  2F8D A;  3IR1 A;  4NED A;  3C36 A;  2WZO A;  1JEU A;  3LBS A;  3CR9 A;  3RPL B;  4U2R A;  3F11 A;  4OEU A;  3S2V A;  2EMC A;  3EPK A;  2QS3 A;  1DTZ A;  2ZMB A;  1B3E A;  1DGC A;  5ET5 A;  2YTG A;  2EM7 A;  3KN8 A;  3HN0 A;  1LBW A;  2DQV A;  4O4K A;  4ECF A;  3KFM A;  4YMB A;  2DWA A;  1GQE A;  3VXC A;  4X66 E;  1N3W A;  1NUX A;  3UN6 A;  2Z8E A;  2KON A;  3HPZ A;  4EQ7 A;  3KC1 A;  5ESY A;  1YCJ A;  2VRD A;  1A1H A;  4LQ2 A;  3V8X B;  4H1X A;  1RDX A;  4Q0C A;  1UBD C;  1GGG A;  4DR1 E;  3ECR A;  1FTK A;  3CFZ A;  4X62 E;  2O7U A;  2RC8 A;  4JI1 E;  1LB8 A;  2L3C A;  1IBK E;  2I0B A;  4OEV A;  3PUY E;  1H45 A;  1EH8 A;  2M8C A;  1QUL A;  3K0V A;  1M5B A;  1MS7 A;  2F3B A;  4X9T A;  3PUW E;  3PD9 A;  4YB6 A;  2HCA A;  2Q88 A;  4DV7 E;  1USY E;  4H65 A;  4N6P A;  1NNF A;  3U94 A;  1B3G A;  3UP9 A;  3THI A;  2FBP A;  4ZED A;  3ZS6 A;  1BBG A;  3PMV A;  3MVW A;  4ZYH A;  2PT1 A;  4TUI A;  2UXA A;  5AA4 A;  2V86 A;  3THN A;  3SEW A;  2EOM A;  4DMI A;  2IA4 A;  5EHS A;  2EOE A;  3SEY A;  2LUP B;  4N07 A;  4LF9 E;  2B3T B;  3TTM A;  1YTV A;  1IIW A;  1N3G A;  2V83 A;  4QF9 A;  1EKZ A;  3LSW A;  1X6F A;  2XA5 A;  1NV2 A;  4F54 A;  4LQ5 A;  2PFY A;  1MQD A;  2F36 A;  4PAK A;  1T39 A;  1MXX A;  1NUZ A;  1G0I A;  5TSE A;  4DXB A;  1JK2 A;  2B3B A;  4JVI A;  4B3R E;  4O8M A;  2DE4 A;  2RSI A;  1Y3N A;  1X5W A;  1Y3Q A;  5AA2 A;  2GHB A;  4I3E A;  4RY1 A;  1X6H A;  2V93 A;  3QMF A;  1UIL A;  2FYI A;  1R9Q A;  3ZSF A;  1FQC A;  2E0S A;  1RC7 A;  1B1H A;  4OOG C;  4KCD A;  1MM7 A;  3SKP A;  4IO4 A;  3PV0 E;  5EQ7 A;  5IWA E;  4F22 A;  4DXU A;  5LL6 R;  1NV4 A;  4F39 A;  5L9S A;  3LSF B;  3IWC A;  4LF8 E;  2L5V A;  4F2J C;  1URS A;  1PEB A;  4OHN A;  5I2K B;  2X7P A;  2XXR A;  4DUY E;  4UAB A;  1ZBT A;  4LZ7 A;  2NUE A;  4AS4 A;  2V85 A;  2EM4 A;  1N0T A;  4JI4 E;  4NF4 B;  2EL5 A;  4MF3 A;  2MKD A;  1K9Z A;  1H76 A;  2QMW A;  4MEV A;  2ONR A;  1A8E A;  4JWY A;  4BDL A;  3MW0 A;  1ZU1 A;  3VVE A;  4XFE A;  3ADI A;  4G77 A;  4TLM B;  1SD3 A;  3PUX E;  2YRM A;  2N8X A;  3ZKL A;  4X65 E;  1AIV A;  3KJT A;  4LZ5 A;  3QSL A;  1ATG A;  1P47 A;  2YTJ A;  2FNC A;  1N3X A;  2CTD A;  3MYU A;  3K00 A;  4OVP A;  2LE2 A;  3HPS A;  4LA9 A;  4N6D A;  5I58 B;  2LVH A;  5I5P A;  1ANF A;  2RSM A;  1QKB A;  4OX9 E;  2V4C A;  2G29 A;  3R7X A;  2OZZ A;  4GZN C;  3FBP A;  5CMK A;  4GX4 A;  2LBS B;  1JW5 A;  4MNI A;  1T4L B;  2QVU A;  3U1O A;  1YUI A;  3K2D A;  2UVJ A;  3TKD A;  5H8H A;  4XKQ A;  4P47 A;  5K2Y A;  2DXR A;  4OZ9 A;  1B05 A;  2HZL A;  3U65 A;  1JVX A;  4KR5 A;  5BWJ A;  1FPK A;  1Z7N E;  4IY5 A;  4FED A;  1JW4 A;  1MDQ A;  1QGX A;  3FXQ A;  2ONS A;  5IKB A;  4MJO A;  2UVI A;  1SBP A;  3OEM A;  4OWD A;  3T9H B;  2XXP A;  2FVZ A;  3THO B;  3IB2 A;  3H6T A;  1IZ1 A;  3MP1 A;  1PJT A;  4DR7 E;  4U1Z A;  2DWJ A;  3MZ1 A;  1MQJ A;  2F7B A;  1B0H A;  1MM6 A;  5J1D A;  3KWR A;  1Q9D A;  1KZ8 A;  2XXV A;  2EOS A;  4ZEI A;  4DR2 E;  1QNT A;  1IBL E;  1B58 A;  4IY6 A;  2EMZ A;  3LR1 A;  3KBR A;  4FAJ A;  3B7D A;  1US5 A;  1OLA A;  4H67 A;  5HM4 B;  1B4Z A;  3KBZ A;  3E78 A;  3DP4 A;  4NMY A;  2O69 A;  1O64 A;  1MQH A;  4TLL B;  4AB5 A;  1TF6 A;  4BDQ A;  4R6H A;  4HXV A;  3FGS A;  4PFW A;  3B50 A;  4OAN A;  4B3S E;  2F3D A;  3FJG A;  5AE4 A;  1NCS A;  1B5H A;  3TCH A;  4ESX A;  3CFX A;  1LBB A;  4O7I A;  1NV5 A;  1MXV A;  4WXC A;  3O66 A;  3EPH A;  1UTH A;  1B1X A;  4PET A;  4BDO A;  5FHO A;  2F6P A;  4DV1 E;  1IME A;  2RCA A;  2Q8J A;  2LT7 A;  1X48 A;  1FBF A;  2EPK X;  2VOZ A;  3ISP A;  4GWU A;  1N76 A;  3PU5 A;  4KHP E;  3FVG A;  3TCF A;  5I56 A;  4JI6 E;  1SQY A;  2WEF A;  2XWV A;  3GXA A;  5I59 B;  3G3I A;  5A6J A;  3ZOQ B;  2B7T A;  2EWL A;  4RH8 A;  1ZKB A;  4ONY A;  1O0W A;  5I57 A;  3QK6 A;  1EU8 A;  4IO6 A;  2H99 A;  4GX6 A;  3N6U A;  3IFC A;  1VDW A;  2MC5 A;  1BP5 A;  2IHR 1;  2K4V A;  2FIX A;  2OJT A;  2EPL X;  1XHY A;  4FOR A;  1KA0 A;  2JJK A;  1MY2 A;  4KQP A;  4F31 B;  3K6U A;  4M9V C;  5H8S A;  1FTO A;  1WRJ A;  1ZBQ A;  4MCO A;  4R2A A;  3RTW B;  2WBU A;  3CHG A;  4NWC A;  2UXB E;  4MH5 A;  5JTY A;  5KL3 A;  2V3T A;  3IOU A;  1N32 E;  4HCY A;  4X48 A;  2DMY A;  2LTS A;  2Y84 A;  2Y7W A;  5KDT A;  4EF1 A;  4E0W A;  4OQO A;  1FTM A;  4KYE A;  1FPF A;  2DWH A;  5IGA A;  3DP6 A;  1MQG A;  3RUM A;  1JET A;  5FTH A;  4P11 A;  4QHQ A;  4U23 A;  1NH7 A;  3EHU A;  4L5N C;  2BJJ X;  4O3A A;  4ZEF A;  4DCX A;  1SVX B;  2YSO A;  1RYO A;  2Y7K A;  3K6X A;  4I9D A;  2DSF A;  1IQS A;  3MHS C;  2O1M A;  4G68 B;  1B3H A;  1X6E A;  1EH3 A;  2XWK A;  3AV0 A;  3E9X A;  4YHH E;  1SPI A;  1FPD A;  2OK2 A;  1A1J A;  1FQD A;  4N6K A;  4QBA A;  4U22 A;  2LV2 A;  1G0H A;  3SES A;  3H6U A;  4OVQ A;  4YKJ A;  4M1V A;  4L8N A;  3JZJ A;  2EPX A;  3IO6 A;  4XXU A;  4F1V A;  1MQI A;  1A99 A;  4O3C A;  1HSE A;  3UOR A;  1F9B A;  2EN6 A;  3RN8 A;  3OSQ A;  5CBS A;  3KG2 A;  3JU0 A;  5H8Q A;  2XX9 A;  2I13 A;  4EQB A;  4R2P A;  1DTG A;  2QSX A;  3C34 A;  2VT5 A;  1IXG A;  4H45 A;  1P99 A;  3PUV E;  3USD A;  1PJS A;  1LBX A;  3OMB A;  3VLV A;  2ZNT A;  1IEJ A;  2JR1 A;  1QUJ A;  2ADR A;  4PAI A;  2ZYO A;  3ILT B;  1SW5 A;  2E5L E;  4XIG Q;  4GLI A;  2K7I A;  4B3T E;  2GHA A;  1LEV A;  1P1N A;  3PPO A;  4YB7 A;  4BHB A;  2LO3 A;  3QXM A;  1AH5 A;  1N7W A;  4N4R B;  1SI0 A;  2GQ1 A;  1WVJ A;  2H25 A;  5ISU A;  2X26 A;  3UGW A;  5AC5 A;  4DR5 E;  4RJZ A;  1FPJ A;  4NF5 A;  3B6W A;  4EXK A;  4MNP A;  3K4U A;  4H0W A;  1NKX A;  2EPM X;  4F2Q A;  5IT9 C;  3OEK A;  1B52 A;  1MY4 A;  3N5L A;  3C4T A;  2G7H A;  1LBC A;  4G8H A;  3S9E A;  2EL4 A;  3S9M C;  2V8Q B;  3I3V A;  2GFE A;  4WEP A;  3OO6 A;  4R03 A;  4LTY A;  5ET7 A;  3IB1 A;  2LRS A;  4K3F A;  4HE0 A;  1VFD A;  3KN7 A;  4J8Z A;  3H06 B;  3LML A;  4DV4 E;  2LTR A;  1YYZ A;  1A55 A;  4NF0 A;  4ZS9 A;  2FIE A;  3RTF B;  4NF8 A;  4Q30 B;  4Z7E A;  2R8T A;  1Z7M E;  4LFC E;  4LF6 E;  1B9J A;  1GTK A;  4PF8 A;  4I3Y A;  4JSD A;  1M5E A;  2EMW A;  5KL5 A;  2I3W A;  2ODR D;  3IX1 A;  4HTG A;  4R6K A;  1MXU A;  3T9U A;  2I4C A;  4MIJ A;  1SW4 A;  1FTA A;  4YMA A;  3BIG A;  3QG5 C;  3HPI A;  1PC3 A;  3J7A G;  4PFY A;  4ZE9 A;  4PP0 A;  2YPN A;  2F35 A;  2RTX A;  4OVS A;  3RT8 A;  2RKM A;  2QFL A;  5KL6 A;  2I3V A;  1DBZ A;  3RNN A;  1HSL A;  2PCR A;  3BBG A;  4L17 A;  2HXR A;  2Z22 A;  4ZYD A;  4ELP A;  2RCB A;  4R2F A;  2V3U A;  5B70 A;  4FJP A;  4OVJ A;  1RQ0 A;  4PGN A;  4WFT A;  1OVB A;  2R6G E;  3T66 A;  4PE3 A;  3GBA A;  3FAT A;  4ELO A;  3FAS A;  3EPL A;  2XXY A;  4LFA E;  5TPA B;  2DWI A;  1P1Q A;  1US4 A;  4P56 A;  3LSX A;  3KSJ A;  5ET6 A;  2Z8D A;  2REG A;  3DEL B;  1CE2 A;  2EQ3 A;  5A5X A;  4BDN A;  3L00 A;  3H03 A;  4Q28 A;  5EYF A;  3MVY A;  2LAO A;  4NTL A;  2PX1 A;  1D9V A;  4GBW A;  2HC5 A;  1Y4T A;  1FTL A;  2DS9 A;  1I6A A;  1LLM C;  1MPC A;  1XMQ E;  3IWD A;  2PRT A;  1URD A;  1POY 1;  2CEY A;  4DKK A;  3MAM A;  5LTC A;  3D1R A;  4PBH A;  3TQW A;  2EOX A;  2YU8 A;  1IXC A;  1UTB B;  3C32 A;  1SI1 A;  1ZJL A;  4OTE A;  5LOM A;  1ZTY A;  3FIR A;  3ODB A;  4ESW A;  4Z0I A;  5I7I A;  1ZR9 A;  3OOA A;  1S7Y A;  4DXC A;  5F24 A;  4P8B A;  4XKR A;  5ITP A;  2O1L A;  2I9I A;  2A5S A;  4O43 A;  2XXQ A;  2ELZ A;  1LAH E;  3PD8 A;  4R8O A;  4O24 A;  4I62 A;  1JK1 A;  4PQJ A;  1MPD A;  1K9Y A;  1YFH A;  4OEN A;  4XTC Q;  4IGT A;  4LF7 E;  1FJ9 A;  2WYP A;  2WCC 3;  1XVY A;  3HFU A;  3HHF A;  5TP9 A;  2YWQ A;  4G4P A;  1LST A;  1NEI A;  5IZ3 B;  2XXI A;  2NXO A;  3MVZ A;  1WHN A;  3J7Y p;  2ZYM A;  3K1M A;  3G3K A;  5F3W A;  1RYX A;  3KGC A;  2B4L A;  1BIY A;  2HEU A;  4NF6 B;  2Q9T A;  1L4S A;  1FJG E;  4PFB A;  4AQ4 A;  2EMH A;  2UUB E;  1FQE A;  1EH6 A;  5F1Q A;  4G8N A;  5CMC A;  2DXY A;  4EQ9 A;  1EZO A;  2I4B A;  2NWJ A;  1WJP A;  2H4I A;  5B7D A;  4NXM E;  3T93 B;  4NHR A;  1LCT A;  3MQ9 A;  4POX A;  2ZYK A;  4I8C A;  3Q25 A;  3UK3 C;  2EZ6 A;  4XF5 A;  2LUQ A;  1R6Z A;  3I5O A;  2DIX A;  3MSW A;  3QYT A;  4ZDM A;  4QFK A;  4NF8 B;  2EMF A;  4DZ1 A;  1LB9 A;  4DIG A;  1D4N A;  4KPT A;  4TQU Q;  2HAU A;  3ONM A;  1EYI A;  2HPG A;  4ZE8 A;  2GH9 A;  2B9D A;  2RC7 A;  3NOH A;  2Q2C A;  2YT4 A;  1T4O A;  3H4Z A;  3LLH A;  2BBG A;  1IMF A;  4GVO A;  5KL7 A;  4KD5 A;  2EPC A;  4R2Q A;  1B3F A;  3AXF A;  4DLD A;  5H8F A;  3B6Q A;  2HXW A;  3MWB A;  4RK9 A;  5IAI A;  3IO4 A;  4N15 A;  3MJN A;  5DVJ A;  3C9H A;  1T4N A;  2Y5K A;  4MBP A;  1MG1 A;  3CIJ A;  1IBM E;  2THI A;  4ZZA A;  4F3S A;  1OQG A;  1TXF A;  2CZK A;  3SDF A;  2YTE A;  3Q29 A;  2CMO A;  2DVZ A;  4JI2 E;  2XXX A;  2VGQ A;  2CEX A;  4F6N A;  1S50 A;  3PGF A;  2EPO A;  4C0R A;  2UXD E;  2PVU A;  5IZ1 A;  2A5T A;  4PFR A;  2EOH A;  2AIX A;  4QSC A;  2VD2 A;  1B7H A;  5FTI A;  2JP9 A;  2WX9 A;  3FVN A;  3FVK A;  1Y20 A;  3BKI B;  2EN4 A;  4LF4 E;  5DEX B;  2E72 A;  1DCU A;  1TWY A;  1XOC A;  4PGP A;  1NV3 A;  4X04 A;  4BC9 A;  4KZS A;  2WBD A;  4P1L A;  5EQ8 A;  2RIN A;  4H8J A;  2EN7 A;  1DI2 A;  4DDD A;  2EN1 A;  5LMU E;  2I6E A;  3M8U A;  4H6D A;  3N94 A;  3PMX A;  3EN3 A;  3Q26 A;  5ICT A;  1B69 A;  2YTI A;  1IUD A;  3D4G A;  4PF6 A;  2L2K B;  3FXB A;  2EN8 A;  3O9P A;  2UVG A;  5IZZ A;  3AUZ A;  1NNT A;  1MY0 A;  1YZ9 A;  5KCJ A;  3T1Y E;  1XT8 A;  2EE8 A;  4BBY A;  3KEI A;  2EMK A;  4IS1 C;  5TU0 A;  4RHB B;  4GRK A;  3IJO B;  5ADZ A;  4OMB A;  4ZEK A;  4JDF A;  4XEQ A;  1INP A;  3LUZ A;  1B5J A;  2P1S A;  4P9K A;  2ZZV A;  1KJK A;  3CRB A;  3KZZ A;  3BF2 A;  2QS1 A;  4WXJ A;  3PUZ E;  2YTQ A;  4KYD A;  1XVX A;  2UYF A;  3TTK A;  3P7I A;  3TCG A;  3G3G A;  4QFO A;  4O7M A;  4OXV A;  1FPB A;  3TUS A;  2NUV A;  5H8N A;  4X9J A;  4HCW A;  5L9M A;  3M3F A;  3U8Q A;  2GPI A;  4NAP A;  2DLK A;  3ADG A;  3E79 A;  1NV1 A;  4N17 A;  3H6W A;  5AA4 B;  2V84 A;  4MLQ A;  3W9V A;  2JXP A;  3CSG A;  1UN6 B;  2E1S A;  5LLQ A;  2F5X A;  2ABH A;  2H36 X;  3C33 A;  2YTF A;  4THI A;  4DUZ E;  1WOD A;  5T3J A;  1SDX A;  3H09 A;  1URG A;  4EDP A;  1VFE A;  3TPA A;  2ENC A;  3C35 A;  3FD3 A;  4YAH X;  4G8M A;  2KOU A;  3CG3 A;  4OVT A;  1YUJ A;  2UVH A;  3OEN A;  2WKY A;  4HEI A;  2QL3 A;  5A69 A;  5AA2 B;  4LU9 A;  1QU6 A;  2JPA A;  3ROJ A;  2F8B A;  3K1N A;  3GLB A;  3UIF A;  1D3K A;  4U4X A;  4YB5 A;  5L9O A;  4XKP A;  1BLF A;  2HQ0 A;  4GQO A;  1T38 A;  1POT A;  4RK2 A;  3OO9 A;  3MP6 A;  4MX6 A;  2KQZ A;  4DR3 E;  3RY3 A;  1BK4 A;  4P7D A;  1P1O A;  2N3G A;  1FPG A;  1B46 A;  1PBP A;  1YYW A;  1IIT A;  1I69 A;  1G2D C;  2OX3 A;  5IV8 B;  4R75 A;  2RS7 A;  3VHT B;  1EZP A;  4X8R A;  4X1B A;  2DSY A;  4AS5 A;  4F29 A;  1M5F A;  1I94 E;  2A5T B;  3MPL A;  3EF7 A;  2Q74 A;  1YAE A;  1F2I G;  4R74 A;  3E4R A;  3C6K A;  4QFL A;  3OEL A;  4YIC A;  4IR8 A;  4WYQ B;  2HFB A;  4TOZ A;  3GZG A;  3TAJ A;  1X49 A;  4NGU A;  2Q2A A;  5AE3 A;  3U93 A;  5A6B D;  4QSD A;  4LN5 A;  5BR8 E;  5I2N A;  3F6H A;  2GHF A;  4G2Z A;  2B65 A;  2UYE A;  4PFI A;  1OQH A;  2EOY A;  2ZNU A;  3G7W A;  3HST A;  1EH7 A;  2YTN A;  1ZMG A;  3G3H A;  5H8H B;  2LCE A;  2HHH E;  3J81 C;  3K02 A;  1KYQ A;  2LJH A;  3KJ7 A;  4PCD A;  3VV5 A;  2AL5 A;  1OIB A;  2D5W A;  1Q35 A;  2JWO A;  2Y5L A;  2CZI A;  1NI9 A;  4FIM A;  1FBH A;  3IOV A;  2JOX A;  3T1B A;  3CFL A;  2HZK A;  3E13 X;  3QUF A;  4QSE A;  4POW A;  1NUW A;  4GWY A;  1UHZ A;  1B6H A;  4BC7 A;  2QRY A;  1LAX A;  4KWY A;  3KOS A;  4MNC A;  1ZIU A;  4ELQ A;  1FPI A;  1Z1B A;  3F6G A;  2Q8U A;  3RPL A;  3HO7 A;  3TQM A;  3O29 A;  2D9H A;  4NE4 A;  1Y3P A;  2ONK E;  2EOI A;  1A1L A;  4E0X A;  3JYR A;  4O5G A;  1HR0 E;  4OFL A;  1Q1K A;  3C4M A;  4DV3 E;  1FBE A;  3E3K A;  4GXA A;  2Y7R A;  4ND9 A;  4JWO A;  4F9C B;  3VVF A;  4BDR A;  2EMI A;  2YRH A;  5HPQ A;  3U72 A;  4JI7 E;  1A54 A;  1YZ0 A;  2L33 A;  3OSR A;  2FV4 B;  3MHH C;  4U21 A;  1FBC A;  1MPB A;  3QUJ A;  4GL0 A;  4FK5 C;  1ZU0 A;  5A6A A;  1UTH B;  4OES A;  2Q89 A;  3MZB A;  1Y1Z A;  3B6T A;  2DE2 A;  2V89 A;  3SET A;  1YYK A;  4I8O A;  4GEQ B;  1D9Q A;  3VLU A;  2DRP A;  4YKK A;  4H8I A;  1FTJ A;  3MBP A;  1RMD A;  1EYK A;  2NAB A;  2ALU A;  3CSB A;  4F1Y A;  3TDJ A;  5FLX C;  3SZP A;  2L3J A;  5I3S A;  3TTL A;  3SER A;  1BBO A;  4R73 A;  1KWH A;  5I56 B;  2EJ4 A;  2OBG A;  4H5G A;  5FHN A;  2JOB A;  1UIV A;  2RF1 A;  1B7Z A;  3RYD A;  1DK4 A;  2EP3 A;  2EPU A;  4LAT A;  2YRK A;  1FKA E;  5EQA A;  4YZZ A;  1PJQ A;  1FQF A;  3KN3 A;  4GWO A;  3MC2 A;  4QFN A;  2BB8 A;  1N34 E;  4RNS A;  4U4S A;  5I57 B;  4P3L A;  1QVS A;  1SW1 A;  4PBQ A;  3KSX A;  3DM0 A;  3IL1 B;  4F3P A;  5JK4 A;  2H5Y A;  3EHS A;  3OO8 A;  3IK6 B;  2ENH A;  4IO2 A;  5CFF E;  4DR6 E;  3HXL A;  4GXS B;  1SYH A;  1TN9 A;  3A29 A;  1XS5 A;  4OER A;  2VHA A;  4F9A B;  4IB2 A;  1KA1 A;  5JTY B;  1FBP A;  1P1W A;  4R72 A;  1PKP A;  3PPR A;  3CVG A;  4JSO A;  3DF6 A;  4LUB A;  1I6Q A;  4N8G A;  5KDT B;  2EML A;  2WBB A;  1XC1 A;  4PAF A;  3DJW A;  1HNW E;  1AAY A;  5AA2 D;  4WSG A;  1FW0 A;  4PC9 A;  4JBZ A;  5I2K A;  4GWX A;  5KL4 A;  1IMB A;  4IO5 A;  2EN3 A;  4GF8 A;  4M30 A;  2EPR A;  2EPN A;  2VF1 A;  2XXT A;  2YJP A;  4NF4 A;  4R2B A;  5ITO A;  3K01 A;  3L6H A;  2HHM A;  2XXU A;  3VE1 B;  3IAZ A;  4M2Z A;  3MUQ A;  3LSL A;  1USY H;  4MLV A;  2DYX A;  5J16 A;  5DNY A;  1T0K A;  2L6M A;  5JEI A;  2FGG A;  3C6M A;  4LF5 E;  2VQF E;  4PDH A;  1D9Y A;  4IGR A;  2F6G A;  4X8W A;  4F3G A;  4H5F A;  3BGH A;  5I58 A;  2OCU A;  4BLA A;  2OWS A;  2EOZ A;  1A1G A;  5AA3 A;  5H8Q B;  1MRP A;  3A3C A;  2B3F A;  1FSA A;  2BJI A;  2VPO A;  3VFJ A;  4C1T A;  2UUA E;  3K6V A;  1IMC A;  4N91 A;  4KHZ E;  1WXR A;  1AL3 A;  1B5I A;  4FE8 A;  1PDA A;  3K6Q A;  1MXZ A;  2IEE A;  3ADJ A;  5AE2 A;  1M5D A;  3M3K A;  3SEV A;  1FPE A;  3TEL A;  2QVV A;  2LJU A;  3FZV A;  3H6V A;  4HW8 A;  4JI0 E;  4PFT A;  1BB8 A;  5AAS A;  1LBY A;  3EHT A;  2DGC A;  5ET8 A;  4FAT A;  3M3L A;  4RPO A;  2EQ0 A;  1DSN A;  5BUU A;  4DCY A;  1MEY C;  1YPN A;  1IMU A;  3IB0 A;  3S4U A;  4R6Y A;  1FCK A;  4I1D A;  2FTX B;  2V88 A;  4ZEC A;  4QRZ A;  2XXW A;  4NF5 B;  3TMG A;  2EN2 A;  4EXL A;  2XXH A;  2DLQ A;  4Q5T A;  1QJM A;  4LFB E;  4Q8R A;  2I0C A;  3HV1 A;  2ZNS A;  4X1D A;  4JXI A;  4GKJ E;  3OML A;  2DB2 A;  4R2E A;  2UXC E;  4G68 C;  1ZLQ A;  3Q27 A;  1RDZ A;  2YU5 A;  3UK4 A;  1PB8 A;  4DV5 E;  2X7Q A;  3EPJ A;  3GBB A;  2ZXT A;  4OFO A;  3TYH A;  4HE1 A;  1EYJ A;  4JVC A;  1NUY A;  4OYV A;  1NH8 A;  4R2R A;  3IWB A;  4IO7 A;  3Q28 A;  1FRP A;  2L8T A;  1TF3 A;  4FEC A;  1A1K A;  4P0I A;  2QJE A;  1NV0 A;  4LP2 B;  2I49 A;  5DW8 A;  4RYA A;  3V83 A;  3EKI A;  2MDR A;  1O63 A;  3BIH A;  1XMO E;  5CI5 A;  1EZ9 A;  2CZL A;  1MH4 A;  3IFA A;  3T22 A;  1H44 A;  1UQW A;  3IOW A;  4ZEB A;  3IOT A;  1B40 A;  3G3J A;  1R9L A;  2Y7P A;  2EM6 A;  1MXY A;  1AWB A;  2D21 A;  3WAE A;  2EMB A;  5DTB A;  2H9B A;  2MKN A;  3O6G A;  4LZ8 A;  3HTX A;  2F7C A;  4DV0 E;  3OD7 A;  5I59 A;  4DI3 D;  1NMU A;  1NL5 A;  3T1H E;  4NN3 A;  2HGH A;  1LAG E;  4JI3 E;  2XHD A;  2QMX A;  2EM2 A;  5AA1 A;  1FQA A;  2GLI A;  3S9N C;  4N4U A;  4YKI A;  2Q8M A;  2EL6 A;  1ZBM A;  4O94 A;  1FQB A;  3DP8 A;  2Y7I A;  1H3D A;  3R26 A;  3RMP A;  4YU0 A;  4PFU A;  4HE2 A;  2KLF A;  2DE3 A;  2P3V A;  3H7M A;  2ZZX A;  4R2D A;  1STU A;  5A5X B;  1JVY A;  5AE1 A;  2HJJ A;  2UU9 E;  4UAC A;  2EMX A;  3D4C A;  3MST A;  1QW0 A;  2PT2 A;  1WDN A;  2FHY A;  3O28 A;  1WHQ A;  1FBD A;  3SEU A;  4DV2 E;  4BMJ A;  3FJM A;  3VLW A;  4DI4 B;  3T0J A;  3TOD A;  3U92 A;  2P3N A;  1JP4 A;  1HSJ A;  1R1N A;  4GWW A;  2V25 A;  3RQT A;  2EPA A;  4BHC A;  1XNQ E;  3MVX A;  4XKN A;  5EHM A;  4YKP A;  3TTR A;  1B0L A;  3QIM A;  1FJ6 A;  2P2A A;  2EM3 A;  2EMA A;  2CT1 A;  1DQ3 A;  4KI0 E;  1MY3 A;  3KC0 A;  1A1F A;  4F9B B;  2YTP A;  1XNR E;  4PTK A;  3RT6 B;  4FEB A;  3H3G A;  2F97 A;  3QAX A;  4IO3 A;  2P0S A;  4G68 A;  2G93 A;  4KXP A;  4JV5 E;  1LLS A;  2R9J A;  1N04 A;  2EPZ A;  3L6G A;  1RKM A;  3PMW A;  2UUC E;  5TP9 B;  4JWX A;  5DT6 A;  4F19 A;  3IJX B;  1OVT A;  4ZYE A;  2F4V E;  1OLC A;  1A7L A;  1DPE A;  4WKM A;  3TFL A;  1GR2 A;  4NZV A;  3LV0 A;  5CMM A;  4AQY E;  3ZKK A;  2EOO A;  1GV8 A;  5IXM B;  4KFQ A;  2WBT A;  2VD3 A;  1H43 A;  1YYO A;  2ESN A;  2NVU B;  4NX1 A;  2E1M A;  4NWD A;  1IXH A;  1LBV A;  3C31 A;  2XXK A;  4KYS A;  3ADL A;  2XX8 A;  4WXD A;  2MC6 A;  3FIG A;  3LUY A;  2R71 A;  2I48 A;  2EM8 A;  2EM9 A;  2NA2 A;  2CSH A;  1J26 A;  1CNQ A;  3TZA A;  1S9T A;  4AB6 A;  1QKA A;  4MMP A;  5ICQ A;  2M9A A;  1NNK A;  4JB7 A;  2OWT A;  2JVA A;  3W9W A;  2VPN A;  2YZT A;  1J1N A;  5CMB A;  3T9V A;  3FXR A;  4JI5 E;  2EMY A;  3V5A A;  3JV9 A;  1Y1M A;  1GZ6 A;  1MGT A;  2EOR A;  5FHM A;  3A3U A;  3FXU A;  1II5 A;  3RGY A;  1OMP A;  4GX3 A;  2W7Y A;  2ZZW A;  1LGB C;  5KZT A;  3J80 C;  2H98 A;  3TQL A;  4HS7 A;  1VR5 A;  3G3F A;  4RXL A;  4O3B A;  2HAV A;  3BFT A;  4JYA E;  1P1U A;  2EM0 A;  1TFA A;  4P1E A;  2XD3 A;  2RQL A;  3W15 C;  1IXI A;  4WED A;  3PPQ A;  4ISU A;  2XWI A;  3PTY A;  1Y4C A;  3O6H A;  1FBG A;  1LBZ A;  2M7Q A;  5H8F B;  4OVR A;  2AL4 A;  5CM6 A;  3BID A;  1O7T A;  2EMG A;  1B7U A;  4OFJ A;  5IM2 A;  2YLN A;  4F6M A;  1LAF E;  3O6I A;  5DVI A;  4IJD A;  1NV7 A;  4BCA A;  2RPC A;  3V89 B;  2KHX A;  2DOJ A;  1LFH A;  1G2F C;  5L8D A;  4QXD A;  1DOT A;  2PYY A;  4F3B A;  1HNZ E;  2QVR A;  3KZY A;  1MXW A;  2F7A A;  1QUI A;  4LVQ A;  1ZAA C;  3N6T A;  4GWZ A;  1IQ7 A;  2DDK A;  3MPK A;  3N26 A;  2NUF A;  2B4M A;  3UA8 A;  5T6J A;  5A6K A;  2CPN A;  3C4B A;  4RA1 A;  2WBS A;  4F2O A;  1B51 A;  1MY1 A;  2ZYN A;  1IMD A;  4Q35 B;  2YSP A;  5DVF A;  2ENA A;  1X3C A;  3OXN A;  1PB7 A;  4EUO A;  1DPP A;  3VK6 A;  3JTZ A;  3BBR A;  4R2S A;  5KCJ B;  4C1U A;  2DMI A;  3I6V A;  1QUK A;  3T9X B;  4DV6 E;  4LON B;  2JYA A;  4RPN A;  1N36 E;  4MFI A;  4GD5 A;  4NQ8 A;  2J7J A;  3OO7 A;  1JQF A;  4GIZ A;  4GKK E;  5K2X A;  5LMN E;  4NG7 A;  3HHG A;  5TPA A;  3FV1 A;  1XI6 A;  1SYI A;  2JY9 A;  4F18 A;  4B3M E;  3TTN A;  2NOO A;  5CBR A;  1Y9U A;  5A2Q C;  1X47 A;  3O2A A;  1PBQ A;  4OA4 A;  4JVD A;  5H8N B;  5I84 A;  3RPW A;  5KL2 A;  4GFR A;  3CG1 A;  2PBW A;  3FVO A;  4GL8 A;  1B4H A;  5DYH A;  3OTO E;  5CRY A;  3VYY A;  1UTB A;  2O84 X; 
#chains in the Genus database with same CATH homology
 2Z23 A;  3MZ9 A;  2O6A A;  1AOV A;  2DP8 A;  1CB6 A;  3K6W A;  2Z8F A;  2REJ A;  5F7V A;  1LFI A;  3DLN A;  2F34 A;  3RLF E;  2ANJ A;  3PPP A;  1LCF A;  5CC2 A;  5HBC A;  1NNP A;  3A09 A;  2F78 A;  2OLB A;  1MDP 1;  3HCQ A;  1MH3 A;  2QS4 A;  2I58 A;  3MP8 A;  3VXB A;  1UIU A;  4GOT A;  1B2H A;  2QPQ A;  4N13 A;  4KCC A;  4OET A;  4NF6 A;  3KOT A;  3R6U A;  1JEV A;  1VE4 A;  5M2V A;  3T96 B;  4BDM A;  1TT1 A;  3K1P A;  1DMB A;  4P0G A;  1LFG A;  2GRV A;  3SEX A;  1A40 A;  1JW1 A;  3CI8 A;  4U1O A;  1ELJ A;  1PB9 A;  3WAF A;  1SW2 A;  3FUZ A;  1BTJ A;  5ELV A;  3EQ1 A;  3PPN A;  1VSO A;  3IOR A;  2O51 A;  2VP1 A;  2AYS A;  2QS2 A;  2O68 A;  3S9L C;  4R9F A;  2D3I A;  3VDF A;  4UA8 A;  1A8F A;  4QFP A;  2XX7 A;  3FV2 A;  5I2N B;  4ZZE A;  3LC8 A;  2O7I A;  1B3L A;  1N84 A;  1I6B A;  4ELR A;  4PE5 B;  3VVD A;  1AMF A;  4EF2 A;  4M4G A;  1GVC A;  2XD2 A;  2RC9 A;  4F1U A;  3KZG A;  1B32 A;  1TFD A;  4R9G A;  3FJ7 A;  2PMS A;  3BFU A;  1JNF A;  4DE8 A;  1M5C A;  1BKA A;  1L5T A;  3TEP A;  2DVC A;  2FA7 A;  2V3Q A;  3ILU B;  1NFT A;  3O97 A;  1N7X A;  5DEX A;  3EPE A;  2F8D A;  3IR1 A;  4NED A;  3C36 A;  1JEU A;  3LBS A;  3CR9 A;  4U2R A;  3F11 A;  4OEU A;  3S2V A;  2QS3 A;  1DTZ A;  2ZMB A;  1B3E A;  3KN8 A;  3HN0 A;  2DQV A;  4ECF A;  3KFM A;  4YMB A;  2DWA A;  3VXC A;  1N3W A;  3UN6 A;  2Z8E A;  4EQ7 A;  1YCJ A;  4LQ2 A;  3V8X B;  4H1X A;  4Q0C A;  1GGG A;  3ECR A;  1FTK A;  3CFZ A;  2O7U A;  2RC8 A;  1LB8 A;  2I0B A;  4OEV A;  3PUY E;  1H45 A;  2M8C A;  1QUL A;  3K0V A;  1M5B A;  1MS7 A;  4X9T A;  3PUW E;  3PD9 A;  4YB6 A;  2HCA A;  2Q88 A;  1USY E;  4H65 A;  4N6P A;  1NNF A;  3U94 A;  1B3G A;  3UP9 A;  3THI A;  4ZED A;  3ZS6 A;  3PMV A;  3MVW A;  2PT1 A;  2UXA A;  5AA4 A;  3SEW A;  2IA4 A;  5EHS A;  3SEY A;  4N07 A;  3TTM A;  1YTV A;  1IIW A;  4QF9 A;  3LSW A;  4LQ5 A;  1MQD A;  2F36 A;  1MXX A;  4DXB A;  2B3B A;  2DE4 A;  1Y3N A;  1Y3Q A;  5AA2 A;  2GHB A;  4RY1 A;  2V93 A;  2FYI A;  3ZSF A;  1R9Q A;  1FQC A;  2E0S A;  1B1H A;  4KCD A;  1MM7 A;  3SKP A;  4IO4 A;  3PV0 E;  4F22 A;  4DXU A;  4F39 A;  5L9S A;  3LSF B;  1URS A;  1PEB A;  4OHN A;  5I2K B;  2X7P A;  2XXR A;  4LZ7 A;  1N0T A;  4NF4 B;  4MF3 A;  1H76 A;  2QMW A;  2ONR A;  1A8E A;  4JWY A;  4BDL A;  3MW0 A;  3VVE A;  4G77 A;  4TLM B;  1SD3 A;  3PUX E;  3ZKL A;  1AIV A;  3KJT A;  4LZ5 A;  3QSL A;  1ATG A;  2FNC A;  1N3X A;  3K00 A;  4LA9 A;  5I58 B;  1ANF A;  1QKB A;  2G29 A;  3R7X A;  2OZZ A;  5CMK A;  1JW5 A;  3U1O A;  3K2D A;  2UVJ A;  3TKD A;  5H8H A;  4XKQ A;  5K2Y A;  2DXR A;  4OZ9 A;  1B05 A;  2HZL A;  1JVX A;  4KR5 A;  5BWJ A;  1Z7N E;  4IY5 A;  4FED A;  1JW4 A;  1MDQ A;  3FXQ A;  2ONS A;  5IKB A;  2UVI A;  1SBP A;  3OEM A;  4OWD A;  3T9H B;  2XXP A;  3IB2 A;  3MP1 A;  4U1Z A;  3H6T A;  1IZ1 A;  2DWJ A;  3MZ1 A;  1MQJ A;  2F7B A;  1B0H A;  1MM6 A;  5J1D A;  2XXV A;  4ZEI A;  1B58 A;  4IY6 A;  3LR1 A;  3KBR A;  4FAJ A;  3B7D A;  1US5 A;  1OLA A;  4H67 A;  5HM4 B;  1B4Z A;  3DP4 A;  4NMY A;  2O69 A;  1O64 A;  1MQH A;  4TLL B;  4AB5 A;  4BDQ A;  4R6H A;  3FGS A;  4PFW A;  3FJG A;  5AE4 A;  1B5H A;  3TCH A;  4ESX A;  3CFX A;  1LBB A;  1MXV A;  3O66 A;  1UTH A;  1B1X A;  4PET A;  4BDO A;  5FHO A;  2F6P A;  2RCA A;  2Q8J A;  2VOZ A;  1N76 A;  3PU5 A;  3FVG A;  3TCF A;  5I56 A;  1SQY A;  3GXA A;  5I59 B;  3G3I A;  1ZKB A;  4ONY A;  5I57 A;  3QK6 A;  1EU8 A;  4IO6 A;  2H99 A;  3N6U A;  1BP5 A;  2OJT A;  1XHY A;  4FOR A;  1MY2 A;  4KQP A;  4F31 B;  3K6U A;  5H8S A;  1FTO A;  3RTW B;  4NWC A;  5JTY A;  4MH5 A;  2V3T A;  3IOU A;  4HCY A;  4X48 A;  2Y84 A;  2Y7W A;  5KDT A;  4EF1 A;  4E0W A;  4OQO A;  1FTM A;  4KYE A;  2DWH A;  3DP6 A;  1MQG A;  3RUM A;  1JET A;  5FTH A;  4P11 A;  4QHQ A;  4U23 A;  1NH7 A;  3EHU A;  2BJJ X;  4O3A A;  4ZEF A;  4DCX A;  1SVX B;  1RYO A;  2Y7K A;  3K6X A;  4I9D A;  2DSF A;  2O1M A;  4G68 B;  1B3H A;  1EH3 A;  3E9X A;  2OK2 A;  1FQD A;  4U22 A;  3SES A;  3H6U A;  4YKJ A;  4M1V A;  3JZJ A;  3IO6 A;  4XXU A;  4F1V A;  1MQI A;  1A99 A;  4O3C A;  1HSE A;  3UOR A;  1F9B A;  3RN8 A;  3OSQ A;  5CBS A;  3KG2 A;  5H8Q A;  2XX9 A;  4EQB A;  1DTG A;  2QSX A;  3C34 A;  1IXG A;  1P99 A;  3PUV E;  3USD A;  3OMB A;  3VLV A;  2ZNT A;  1IEJ A;  1QUJ A;  2ZYO A;  3ILT B;  1SW5 A;  4XIG Q;  4GLI A;  2GHA A;  1P1N A;  3PPO A;  4YB7 A;  3QXM A;  1AH5 A;  1N7W A;  1SI0 A;  1WVJ A;  2H25 A;  5ISU A;  2X26 A;  3UGW A;  4RJZ A;  4NF5 A;  3B6W A;  4EXK A;  3K4U A;  4H0W A;  1NKX A;  4F2Q A;  3OEK A;  1B52 A;  1MY4 A;  3N5L A;  1LBC A;  4G8H A;  3S9E A;  3S9M C;  3I3V A;  2GFE A;  4WEP A;  3OO6 A;  3IB1 A;  4K3F A;  1VFD A;  3KN7 A;  3H06 B;  1A55 A;  4ZS9 A;  3RTF B;  4NF8 A;  4Q30 B;  4Z7E A;  1Z7M E;  1B9J A;  1GTK A;  4JSD A;  1M5E A;  2I3W A;  3IX1 A;  4HTG A;  4R6K A;  1MXU A;  3T9U A;  2I4C A;  1SW4 A;  4YMA A;  3HPI A;  1PC3 A;  4PFY A;  4ZE9 A;  4PP0 A;  2YPN A;  2F35 A;  3RT8 A;  2RKM A;  2I3V A;  3RNN A;  1HSL A;  4L17 A;  2Z22 A;  4ELP A;  2RCB A;  4R2F A;  2V3U A;  5B70 A;  4FJP A;  4OVJ A;  1OVB A;  2R6G E;  3T66 A;  3GBA A;  3FAT A;  4ELO A;  3FAS A;  2XXY A;  5TPA B;  2DWI A;  1P1Q A;  1US4 A;  3LSX A;  3KSJ A;  2Z8D A;  2REG A;  3DEL B;  1CE2 A;  5A5X A;  4BDN A;  3H03 A;  5EYF A;  3MVY A;  2LAO A;  4NTL A;  2PX1 A;  1D9V A;  1Y4T A;  1FTL A;  2DS9 A;  1I6A A;  1MPC A;  1URD A;  1POY 1;  3MAM A;  3TQW A;  1IXC A;  1UTB B;  3C32 A;  1SI1 A;  1ZJL A;  4OTE A;  5LOM A;  1ZTY A;  3FIR A;  3ODB A;  4ESW A;  4Z0I A;  3OOA A;  1S7Y A;  4DXC A;  4XKR A;  5ITP A;  2O1L A;  2A5S A;  2XXQ A;  1LAH E;  3PD8 A;  4I62 A;  4PQJ A;  1MPD A;  4OEN A;  4XTC Q;  4IGT A;  1XVY A;  3HHF A;  5TP9 A;  4G4P A;  1LST A;  2XXI A;  2NXO A;  3MVZ A;  2ZYM A;  3K1M A;  3G3K A;  1RYX A;  3KGC A;  1BIY A;  2HEU A;  4NF6 B;  2Q9T A;  4AQ4 A;  1FQE A;  5F1Q A;  4G8N A;  5CMC A;  2DXY A;  4EQ9 A;  1EZO A;  2I4B A;  2NWJ A;  2H4I A;  5B7D A;  3T93 B;  1LCT A;  3MQ9 A;  4POX A;  2ZYK A;  4I8C A;  3Q25 A;  1R6Z A;  3I5O A;  3QYT A;  4ZDM A;  4QFK A;  4NF8 B;  4DZ1 A;  1LB9 A;  4DIG A;  1D4N A;  4KPT A;  4TQU Q;  2HAU A;  3ONM A;  4ZE8 A;  2GH9 A;  2RC7 A;  2Q2C A;  3H4Z A;  4GVO A;  4KD5 A;  1B3F A;  3AXF A;  4DLD A;  5H8F A;  3B6Q A;  2HXW A;  3MWB A;  4RK9 A;  5IAI A;  3IO4 A;  3MJN A;  5DVJ A;  3C9H A;  4MBP A;  1MG1 A;  3CIJ A;  2THI A;  4ZZA A;  4F3S A;  1OQG A;  1TXF A;  3SDF A;  3Q29 A;  2CMO A;  2DVZ A;  2XXX A;  2VGQ A;  1S50 A;  3PGF A;  4C0R A;  2PVU A;  2A5T A;  2AIX A;  4QSC A;  2VD2 A;  1B7H A;  5FTI A;  3FVN A;  3FVK A;  1Y20 A;  3BKI B;  5DEX B;  1TWY A;  1XOC A;  2RIN A;  4H8J A;  4DDD A;  2I6E A;  3M8U A;  4H6D A;  3N94 A;  3PMX A;  3EN3 A;  3Q26 A;  5ICT A;  1IUD A;  3D4G A;  3O9P A;  2UVG A;  1NNT A;  1MY0 A;  5KCJ A;  1XT8 A;  3KEI A;  5TU0 A;  4GRK A;  3IJO B;  4OMB A;  4ZEK A;  4JDF A;  1B5J A;  2P1S A;  3CRB A;  2QS1 A;  4WXJ A;  3PUZ E;  4KYD A;  1XVX A;  2UYF A;  3TTK A;  3P7I A;  3TCG A;  3G3G A;  4QFO A;  4OXV A;  3TUS A;  2NUV A;  5H8N A;  4HCW A;  5L9M A;  3M3F A;  3U8Q A;  3H6W A;  5AA4 B;  2V84 A;  4MLQ A;  3W9V A;  3CSG A;  2E1S A;  2F5X A;  2ABH A;  3C33 A;  4THI A;  1WOD A;  1SDX A;  1URG A;  4EDP A;  1VFE A;  3TPA A;  3C35 A;  3FD3 A;  4YAH X;  4G8M A;  3CG3 A;  2UVH A;  3OEN A;  2WKY A;  2QL3 A;  5AA2 B;  3K1N A;  3GLB A;  3UIF A;  1D3K A;  4U4X A;  4YB5 A;  5L9O A;  4XKP A;  1BLF A;  2HQ0 A;  4GQO A;  1POT A;  4RK2 A;  3OO9 A;  3MP6 A;  3RY3 A;  1P1O A;  1B46 A;  1PBP A;  1IIT A;  1I69 A;  4R75 A;  1EZP A;  4X1B A;  4F29 A;  1M5F A;  2A5T B;  3MPL A;  3EF7 A;  1YAE A;  4R74 A;  3E4R A;  4QFL A;  3OEL A;  4YIC A;  2HFB A;  4TOZ A;  3GZG A;  3TAJ A;  2Q2A A;  3U93 A;  4QSD A;  5I2N A;  4G2Z A;  2B65 A;  2UYE A;  1OQH A;  2ZNU A;  3G7W A;  3HST A;  1ZMG A;  3G3H A;  5H8H B;  3K02 A;  3KJ7 A;  3VV5 A;  2AL5 A;  1OIB A;  2D5W A;  1Q35 A;  4FIM A;  3IOV A;  3CFL A;  2HZK A;  3E13 X;  3QUF A;  4QSE A;  4POW A;  1B6H A;  2QRY A;  1LAX A;  3KOS A;  1ZIU A;  4ELQ A;  3HO7 A;  3O29 A;  4NE4 A;  1Y3P A;  2ONK E;  4E0X A;  3JYR A;  4OFL A;  1Q1K A;  3C4M A;  4GXA A;  3E3K A;  2Y7R A;  4ND9 A;  4JWO A;  3VVF A;  4BDR A;  5HPQ A;  3U72 A;  1A54 A;  3OSR A;  4U21 A;  1MPB A;  3QUJ A;  4GL0 A;  1ZU0 A;  1UTH B;  4OES A;  2Q89 A;  3MZB A;  1Y1Z A;  3B6T A;  2DE2 A;  3SET A;  3VLU A;  4YKK A;  4H8I A;  1FTJ A;  3MBP A;  4F1Y A;  2ALU A;  3CSB A;  3TDJ A;  3TTL A;  3SER A;  4R73 A;  1KWH A;  5I56 B;  2OBG A;  4H5G A;  5FHN A;  1UIV A;  2RF1 A;  1B7Z A;  4LAT A;  4YZZ A;  1FQF A;  3KN3 A;  4GWO A;  3MC2 A;  4QFN A;  4RNS A;  4U4S A;  5I57 B;  1QVS A;  1SW1 A;  3KSX A;  3DM0 A;  3IL1 B;  4F3P A;  5JK4 A;  2H5Y A;  3EHS A;  3OO8 A;  3IK6 B;  4IO2 A;  4GXS B;  1SYH A;  4OER A;  1XS5 A;  2VHA A;  4IB2 A;  5JTY B;  1P1W A;  4R72 A;  3PPR A;  3CVG A;  4JSO A;  4LUB A;  1I6Q A;  5KDT B;  1XC1 A;  5AA2 D;  1FW0 A;  4JBZ A;  5I2K A;  4IO5 A;  4GF8 A;  2XXT A;  2YJP A;  4NF4 A;  4R2B A;  5ITO A;  3K01 A;  3L6H A;  2XXU A;  3VE1 B;  3IAZ A;  3MUQ A;  3LSL A;  1USY H;  4MLV A;  2DYX A;  1T0K A;  5JEI A;  1D9Y A;  4IGR A;  2F6G A;  4F3G A;  4H5F A;  5I58 A;  2OCU A;  4BLA A;  2OWS A;  5AA3 A;  5H8Q B;  1MRP A;  3A3C A;  2B3F A;  3VFJ A;  4C1T A;  3K6V A;  4KHZ E;  1AL3 A;  1B5I A;  4FE8 A;  1PDA A;  1MXZ A;  2IEE A;  1M5D A;  3M3K A;  3SEV A;  3TEL A;  3FZV A;  3H6V A;  4HW8 A;  4PFT A;  3EHT A;  4FAT A;  3M3L A;  4RPO A;  1DSN A;  5BUU A;  4DCY A;  1YPN A;  3IB0 A;  3S4U A;  4R6Y A;  1FCK A;  4I1D A;  4ZEC A;  4QRZ A;  2XXW A;  4NF5 B;  3TMG A;  4EXL A;  2XXH A;  4Q5T A;  1QJM A;  4Q8R A;  2I0C A;  3HV1 A;  2ZNS A;  4X1D A;  4JXI A;  4G68 C;  1ZLQ A;  3Q27 A;  3UK4 A;  1PB8 A;  2X7Q A;  3GBB A;  2ZXT A;  4OFO A;  3TYH A;  4OYV A;  1NH8 A;  4IO7 A;  3Q28 A;  4FEC A;  4P0I A;  2QJE A;  4LP2 B;  2I49 A;  4RYA A;  3V83 A;  1O63 A;  5CI5 A;  1EZ9 A;  2CZL A;  1MH4 A;  3T22 A;  1H44 A;  1UQW A;  3IOW A;  4ZEB A;  3IOT A;  1B40 A;  3G3J A;  1R9L A;  2Y7P A;  1MXY A;  2D21 A;  3WAE A;  5DTB A;  2H9B A;  3O6G A;  4LZ8 A;  2F7C A;  3OD7 A;  5I59 A;  1NMU A;  1NL5 A;  1LAG E;  2XHD A;  2QMX A;  5AA1 A;  1FQA A;  3S9N C;  4YKI A;  1ZBM A;  1FQB A;  3DP8 A;  2Y7I A;  1H3D A;  3R26 A;  4YU0 A;  4PFU A;  2KLF A;  2DE3 A;  3H7M A;  5A5X B;  1JVY A;  4UAC A;  3D4C A;  1QW0 A;  2PT2 A;  1WDN A;  3O28 A;  3SEU A;  3FJM A;  3VLW A;  3TOD A;  3U92 A;  1HSJ A;  1R1N A;  2V25 A;  3RQT A;  3MVX A;  4XKN A;  5EHM A;  4YKP A;  3TTR A;  1B0L A;  3QIM A;  2P2A A;  4KI0 E;  1MY3 A;  3RT6 B;  4FEB A;  3H3G A;  2F97 A;  3QAX A;  4IO3 A;  2P0S A;  4G68 A;  2G93 A;  1LLS A;  2R9J A;  1N04 A;  3L6G A;  1RKM A;  3PMW A;  5TP9 B;  4JWX A;  5DT6 A;  4F19 A;  3IJX B;  1OVT A;  1OLC A;  4WKM A;  1A7L A;  1DPE A;  3TFL A;  1GR2 A;  5CMM A;  3ZKK A;  1GV8 A;  4KFQ A;  2VD3 A;  1H43 A;  2ESN A;  2NVU B;  4NWD A;  1IXH A;  3C31 A;  4KYS A;  2XX8 A;  3LUY A;  2R71 A;  2I48 A;  3TZA A;  1S9T A;  4AB6 A;  1QKA A;  5ICQ A;  1NNK A;  4JB7 A;  2OWT A;  3W9W A;  1J1N A;  5CMB A;  3T9V A;  3FXR A;  3V5A A;  3JV9 A;  1Y1M A;  5FHM A;  3A3U A;  3FXU A;  1II5 A;  3RGY A;  1OMP A;  2W7Y A;  1LGB C;  5KZT A;  2H98 A;  3TQL A;  4HS7 A;  1VR5 A;  3G3F A;  4RXL A;  4O3B A;  2HAV A;  3BFT A;  1P1U A;  1TFA A;  2XD3 A;  3W15 C;  1IXI A;  4WED A;  3PPQ A;  4ISU A;  1Y4C A;  3O6H A;  5H8F B;  2AL4 A;  5CM6 A;  1O7T A;  4OFJ A;  1B7U A;  2YLN A;  1LAF E;  3O6I A;  5DVI A;  3V89 B;  2DOJ A;  1LFH A;  5L8D A;  1DOT A;  2PYY A;  4F3B A;  1MXW A;  2F7A A;  1QUI A;  4LVQ A;  3N6T A;  1IQ7 A;  3MPK A;  3N26 A;  3UA8 A;  4RA1 A;  4F2O A;  1B51 A;  1MY1 A;  2ZYN A;  5DVF A;  3OXN A;  1PB7 A;  4EUO A;  1DPP A;  3BBR A;  5KCJ B;  4C1U A;  3I6V A;  1QUK A;  3T9X B;  4LON B;  4RPN A;  4MFI A;  4GD5 A;  4GIZ A;  3OO7 A;  1JQF A;  5K2X A;  3HHG A;  5TPA A;  3FV1 A;  1SYI A;  4F18 A;  3TTN A;  2NOO A;  5CBR A;  1Y9U A;  3O2A A;  1PBQ A;  5H8N B;  5I84 A;  3RPW A;  4GFR A;  3CG1 A;  2PBW A;  3FVO A;  4GL8 A;  1B4H A;  5DYH A;  5CRY A;  1UTB A;  2O84 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...