3ECRA

Structure of human porphobilinogen deaminase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
339
structure length
318
Chain Sequence
b'MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLECSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural insight into acute intermittent porphyria.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 318
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3ecrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA02
3H06B 3K1NA 5FHNA 5J1DA 1LLSA 3EHSA 4IGRA 2NXOA 3USDA 4XKNA 4F2QA 4F18A 3MP6A 2QSXA 1MS7A 5I57B 4YU0A 3O6IA 2UVGA 1Z7NE 2XX8A 5FHMA 3H6VA 2R6GE 4YKIA 3MQ9A 4ONYA 5DEXB 5DVJA 1PEBA 1B3EA 4OFJA 4FAJA 3RQTA 3FJMA 4YAHX 4F1YA 2CMOA 3LBSA 4IB2A 2AL4A 1HSEA 4PFYA 3K6VA 1B40A 3O28A 3IK6B 4DCYA 3ODBA 1URGA 1JQFA 4C0RA 1OQGA 4RK9A 4DDDA 4QSDA 3SKPA 1AOVA 3CRBA 1SW2A 5EHMA 3SEWA 1MM6A 3D4CA 2YLNA 4HS7A 3MAMA 1N3WA 1MQGA 3RY3A 5EHSA 2Y84A 1US4A 1UTBB 3SERA 3VLWA 3S2VA 3H6UA 4G68C 1NH7A 4I9DA 3CG3A 1JW5A 1AL3A 2GH9A 5CMCA 2GHAA 1BKAA 2E1SA 2F7BA 1H45A 4F1UA 1MPCA 1LFHA 1LBCA 2XD3A 2GHBA 4MF3A 4QSCA 3MVYA 4F29A 1WDNA 4YICA 3EPEA 5HBCA 1EZ9A 3PMVA 1MQDA 1P99A 3M3LA 2DXYA 4O3CA 2VHAA 3FUZA 2F35A 5I2KA 3EF7A 1N76A 3R26A 2AIXA 4JWYA 4FECA 4N6PA 3TTNA 4C1TA 3A3CA 2HZLA 4IO7A 5K2YA 4U1OA 4GL0A 4PFTA 2PX1A 2IEEA 3F11A 3C34A 3HV1A 5AA2D 3VVEA 3VXCA 4FE8A 3VXBA 2OLBA 4ESXA 3LSFB 1B1XA 2X26A 1AMFA 4JSOA 1PBQA 3PPRA 4PFUA 3G3FA 5AE4A 5K2XA 3UK4A 1B3FA 4F1VA 5AA2A 4HW8A 4GVOA 3IJXB 3V89B 1XOCA 2PVUA 5M2VA 2DS9A 1UIUA 1O64A 2H25A 3MZ1A 1J1NA 5I58A 1B6HA 2FYIA 1S9TA 3M8UA 3OO8A 4G8MA 3TTKA 2DWIA 4KYEA 1LAHE 1MH3A 2XXIA 2I49A 4OFLA 4JWOA 4YKJA 3K0VA 3I5OA 1LAXA 2REGA 1BIYA 4OEVA 5H8HA 1OLCA 3OEMA 2QMWA 2XXVA 3C33A 2XD2A 3UGWA 3MZ9A 5CC2A 4F2OA 4OHNA 2FA7A 1AH5A 5DYHA 4Q5TA 4G68A 5I59B 3U1OA 4YKKA 1A99A 3KN7A 4I8CA 1EH3A 3TAJA 2QRYA 3CVGA 2DYXA 1M5FA 5L8DA 4JDFA 3KG2A 2Q9TA 3HHGA 4KD5A 3TKDA 4G2ZA 5TU0A 2DE4A 1BTJA 4OMBA 5H8FA 2Q2AA 3RNNA 2V93A 4TQUQ 3PPQA 1FQEA 2RC9A 1QUKA 1NNKA 4RPOA 4XIGQ 3O29A 1IXHA 3RT8A 3FZVA 3H4ZA 5ISUA 3N6TA 1RYXA 3MUQA 2NVUB 4UA8A 2OJTA 4RJZA 1FTOA 2NWJA 2D3IA 1R1NA 4R6HA 1D3KA 3H03A 1H43A 3PPPA 1FQDA 3TTLA 1IZ1A 3C35A 5L9SA 4R75A 4ZZAA 2ZMBA 3I3VA 4FJPA 2QMXA 3TCGA 2CZLA 4PFWA 1MXZA 2PMSA 4OWDA 4DZ1A 1JETA 2I58A 3Q26A 2A5TA 1O7TA 4H5GA 4X1BA 3QK6A 4QFKA 1WODA 3L6GA 1NH8A 4O3BA 3ECRA 4H0WA 4JSDA 1BLFA 4R9FA 3L6HA 2XXRA 4H5FA 3FV1A 1MY3A 4C1UA 4XTCQ 3QYTA 4KI0E 3G3GA 3IR1A 4R9GA 2O7IA 1LB8A 2DOJA 4F39A 2DE3A 5AA3A 3KEIA 5IKBA 1XHYA 4YMBA 1GV8A 1OVTA 2LAOA 3KN3A 5HM4B 1RKMA 3E9XA 3FXRA 3UORA 4MH5A 4GXAA 1EU8A 1FTMA 1URDA 3SESA 1M5DA 2THIA 1B9JA 4THIA 5L9OA 4FORA 4TLMB 3CR9A 1SW1A 4ZEBA 1M5CA 4DIGA 4LONB 4G8HA 4RYAA 1MY2A 3FGSA 3OSRA 5AA2B 1OQHA 3KBRA 4DXBA 3E3KA 3D4GA 3OMBA 4R72A 3MP1A 1MDP1 3S4UA 3PU5A 4MBPA 4O3AA 3DM0A 2P1SA 1IXIA 3QIMA 1PC3A 2F34A 5CMBA 4ZDMA 2H4IA 3OO7A 3K6WA 1B5IA 5TPAA 4P11A 3C9HA 1P1NA 4GOTA 3TODA 5AA1A 1FQFA 3K1PA 3RTFB 1DOTA 2ZYKA 3K1MA 3K01A 2O51A 2V25A 5DVFA 3PMXA 1ZJLA 2F97A 2XXTA 4RNSA 1D9VA 2OWTA 3VVDA 2PT2A 3TFLA 1N04A 1S50A 2Q88A 4HTGA 5CMMA 3LC8A 5I2NA 4G68B 1GVCA 4G77A 1NNTA 3DLNA 3R7XA 4RA1A 3MPLA 2F6PA 1MPDA 1GTKA 4ZS9A 2Q89A 4EDPA 2DWJA 2Y7KA 2I3VA 1NNPA 2RCBA 2O1MA 2QS2A 2B3BA 1UTHB 1US5A 4BDLA 3IO6A 5H8FB 3CSBA 3PD8A 4KCDA 2RKMA 3O66A 4XXUA 3BFTA 2RF1A 4I62A 3SEUA 2QS1A 2XXWA 1LBBA 3PGFA 3O2AA 3T9UA 4NEDA 1MQHA 3KJ7A 3T9VA 3MC2A 3K02A 4QF9A 4U4SA 3CFXA 4JBZA 1I6QA 4X1DA 4LQ2A 1N7XA 5KDTB 3HCQA 4R73A 4EQBA 2H98A 3FVNA 5H8QA 1MXXA 1ZBMA 4QRZA 1OIBA 3TQWA 4RPNA 4KR5A 1MXVA 2A5TB 3TCFA 4F3SA 1I69A 1JEUA 4QFLA 4KHZE 2Y7WA 4NF8A 4RY1A 2A5SA 3WAFA 2XX7A 1H44A 1QKBA 3BFUA 3TCHA 1IUDA 3OENA 4HCWA 1JW4A 2O68A 1QVSA 3H6WA 1GGGA 1SD3A 3HSTA 2O6AA 4PE5B 4R2FA 4EF1A 5HPQA 3B6TA 3S9MC 3I6VA 1A54A 3IOVA 1SBPA 4NF4A 2H9BA 1MPBA 3RTWB 3RGYA 4NF6A 4IO3A 3G3IA 4WEPA 3PPNA 2AL5A 4MFIA 2DWHA 2Y7IA 2HQ0A 3B6WA 4NMYA 3ILUB 3TDJA 3EHTA 1ZU0A 5I56A 3KOTA 3P7IA 3C32A 1SI1A 1UQWA 2XXYA 2UVIA 2UXAA 4ESWA 2ZNTA 3AXFA 1BP5A 3T9HB 1B5JA 1SW5A 2I0BA 3CG1A 2E0SA 2ZXTA 4ELOA 4QFOA 3B7DA 2VGQA 3PD9A 4BDQA 5TPAB 3SETA 1FTJA 1D4NA 2O1LA 3FV2A 1ZIUA 1VSOA 4R2BA 4IGTA 2V84A 1EZOA 1IXCA 1WVJA 3N5LA 5F1QA 3PUVE 3Q29A 5I2NB 1ZMGA 3PMWA 1HSLA 3KJTA 1B2HA 1B3HA 2HAVA 3O9PA 4UACA 1PB7A 1DTGA 2Z22A 3FXUA 1CB6A 4E0XA 4R6KA 2X7PA 2DE2A 4AB5A 3W9VA 3QXMA 1DMBA 3VVFA 1Y3QA 1Q35A 3B6QA 1JVYA 1QJMA 1EZPA 1A8FA 3SEVA 2NOOA 1QUJA 1P1UA 2QS4A 5A5XA 4ECFA 2UVJA 1IQ7A 4Q8RA 1MM7A 4DCXA 2F8DA 2W7YA 3FJGA 1VFDA 5DT6A 4KYDA 5CI5A 4ZEIA 4FEBA 1A7LA 5JTYA 1S7YA 4U1ZA 2F7CA 3V83A 3T22A 4DXUA 2XXHA 1M5BA 3Q25A 5H8NA 3IOTA 3IAZA 5JK4A 1B1HA 1FQCA 1B58A 3PUXE 4P0IA 1QULA 1OMPA 5H8QB 5F7VA 2WKYA 3ZKKA 2ALUA 5ITPA 4H6DA 1YAEA 5I57A 1AIVA 2UYEA 1SVXB 4ZEKA 1NKXA 1LCFA 3C4MA 1XVYA 1B3GA 3PV0E 2DXRA 4FEDA 5DVIA 1MY4A 1Y3NA 1PDAA 1NMUA 2V3UA 1QKAA 1L5TA 4R6YA 1MDQA 1MQIA 5B7DA 3R6UA 4U23A 2V3TA 2ZNSA 2OCUA 3LR1A 1YCJA 2HZKA 3OSQA 2XXUA 3UN6A 4LA9A 2RC8A 4YZZA 3PPOA 4ZEDA 4XKPA 2AYSA 3TPAA 2P0SA 4LATA 4MLQA 1B7HA 1SDXA 4DE8A 1D9YA 3IX1A 4K3FA 3TTRA 4PQJA 4BLAA 3MW0A 1DSNA 3OXNA 5I2KB 4NF6B 2D21A 3TYHA 3QSLA 3S9EA 1LAGE 2Q2CA 2G93A 5FTIA 1Y1MA 2YPNA 4JB7A 3TZAA 2QJEA 1A8EA 4NF5A 4AB6A 4U4XA 3U93A 5CM6A 2RINA 3CFZA 3KSJA 1ZKBA 3BKIB 3KFMA 1LGBC 2I3WA 5I58B 4NTLA 4H65A 3Q27A 1JW1A 2NUVA 1MH4A 1IITA 1B5HA 4EF2A 1TT1A 4Q0CA 1SYIA 3IO4A 4Z7EA 1UIVA 2UYFA 3PUWE 1B46A 3G7WA 3K00A 3JZJA 1R6ZA 4LQ5A 4NWDA 5H8HB 5ICQA 1IEJA 1VE4A 4GF8A 3G3JA 1B7UA 2ZNUA 1LSTA 3ILTB 5B70A 2VD2A 1N0TA 1MY0A 4P0GA 3G3KA 3KOSA 4OERA 4HCYA 1QW0A 1B0HA 3FASA 5A5XB 4N13A 3EQ1A 1JEVA 1FCKA 3RPWA 4OEUA 3PUZE 5TP9A 2DSFA 1MG1A 1B7ZA 1F9BA 3CIJA 2Y7PA 4XKRA 1LAFE 5EYFA 2B3FA 5I84A 4H8JA 1PBPA 5JTYB 2IA4A 2QS3A 5H8SA 5ELVA 3H6TA 3MBPA 4U2RA 1ANFA 4N07A 4H1XA 3JYRA 1LCTA 3TUSA 4OZ9A 4PP0A 2Y7RA 4QHQA 2H99A 1R9LA 3HO7A 1XS5A 2I4BA 4OYVA 4EXLA 3M3FA 4F31B 4M1VA 2I6EA 3DP4A 1A40A 1POTA 3SEXA 1H76A 3N6UA 3N94A 1P1QA 4LVQA 1MXYA 2ANJA 3T9XB 3GBAA 2KLFA 2Z8FA 3KZGA 2B65A 1Y3PA 3A09A 4IY6A 4EXKA 1B3LA 1M5EA 3TELA 2GFEA 4GFRA 2I4CA 4GLIA 1Y9UA 2RC7A 3FVKA 2XXXA 4YB7A 1FTKA 2VP1A 3MVZA 4L17A 5KCJA 2M8CA 4IO6A 2UVHA 5BUUA 3EN3A 3H3GA 3CI8A 3KGCA 1HSJA 3WAEA 2I0CA 3MWBA 5CBSA 1YPNA 2DQVA 1DPPA 4IO4A 4U21A 3VLUA 3T96B 4NF5B 5DTBA 3KSXA 2X7QA 2ZYNA 5IAIA 4FIMA 4G8NA 4LP2B 1P1OA 4ZEFA 3K6UA 5CMKA 1NL5A 3SDFA 3IL1B 1URSA 2PBWA 1B51A 2PYYA 4Q30B 3FXQA 1VR5A 1FQBA 1N84A 2ZYMA 3OO6A 4YKPA 1ELJA 3C36A 3IOWA 4ZE8A 4KFQA 3LUYA 4WXJA 5ICTA 4OETA 1P1WA 1B05A 3EHUA 1YTVA 4ISUA 2F6GA 4MLVA 1B52A 4TOZA 2OWSA 3LSWA 2XHDA 5JEIA 3S9LC 1SYHA 3U8QA 3HN0A 2QL3A 5FHOA 3FD3A 3FVOA 5ITOA 3U92A 4G4PA 3N26A 2XXPA 2OK2A 4ZZEA 4H8IA 1TFAA 1POY1 2ONSA 3VV5A 4NE4A 3BBRA 1T0KA 2R9JA 1JVXA 4OXVA 2OBGA 3T93B 2O84X 1Z7ME 2HXWA 4GL8A 4F3PA 3GBBA 4GIZA 1DPEA 4ZE9A 4RK2A 4DXCA 4BDRA 5TP9B 4WKMA 1ZTYA 1VFEA 3QUFA 3IJOB 4OVJA 1Y20A 2DVCA 4POWA 5AA4A 4IY5A 4F22A 3THIA 3CSGA 5CRYA 3ONMA 3V5AA 1A55A 1H3DA 4KQPA 4U22A 4Z0IA 3ZKLA 2HEUA 3OO9A 2ZYOA 1IXGA 4ELQA 3UIFA 4EUOA 4F19A 1MXWA 3G3HA 2BJJX 3LSLA 3E4RA 3GXAA 2Q8JA 1GR2A 3U94A 3PUYE 4IO2A 4POXA 1UTHA 3V8XB 2XX9A 4X9TA 4NWCA 1SQYA 1II5A 3K4UA 4KYSA 4F3BA 3A3UA 3DP8A 3SEYA 2FNCA 2O69A 1PB9A 2P2AA 3FATA 5LOMA 4LZ7A 4F3GA 4GXSB 4OFOA 4BDMA 3T66A 4R74A 5DEXA 1Y4CA 4QSEA 4GQOA 1B4ZA 5FTHA 1XC1A 2DP8A 2D5WA 3GLBA 4TLLB 4NF8B 2Z8DA 3ZS6A 3DELB 4JXIA 1CE2A 4YMAA 3W9WA 5KCJB 2OZZA 5KDTA 4GWOA 2RCAA 2Z8EA 1XVXA 3IB1A 3VE1B 4YB6A 3W15C 4EQ9A 1N3XA 3JV9A 4X48A 4OENA 3S9NC 3FVGA 2ONKE 2ONRA 3MP8A 4AQ4A 1LFIA 2Z23A 1I6BA 3O6HA 1UTBA 1N7WA 3UP9A 1JNFA 3C31A 4NF4B 2PT1A 3TTMA 3OOAA 1PB8A 2REJA 4ND9A 2VOZA 2F7AA 2VD3A 5CBRA 3TQLA 3UA8A 2I48A 4LUBA 2G29A 3M3KA 2F5XA 3K2DA 1QUIA 4OTEA 5I56B 3OD7A 5L9MA 3FJ7A 1B4HA 4JWXA 1MRPA 3MJNA 4OESA 1USYH 4PETA 2DWAA 1FW0A 5BWJA 3GZGA 4IO5A 1TWYA 3IB0A 3RUMA 1R9QA 4ELPA 5KZTA 2DVZA 2R71A 2QPQA 1Y1ZA 1FQAA 2O7UA 3E13X 4KPTA 3RN8A 2H5YA 3VDFA 2YJPA 4BDOA 1Y4TA 4ELRA 2GRVA 4WEDA 4E0WA 3MZBA 3MVXA 4GRKA 2ABHA 3MPKA 1MQJA 4BDNA 3TMGA 3OELA 3IORA 1MY1A 4GD5A 1LB9A 1KWHA 4XKQA 1ATGA 4OQOA 3VLVA 1OLAA 1USYE 1NFTA 4QFNA 2V3QA 3O6GA 2F78A 1FTLA 1B32A 1B0LA 3MVWA 3HPIA 1LFGA 1NNFA 3IOUA 3CFLA 1O63A 4RXLA 3QUJA 1IIWA 1ZLQA 2HCAA 4LZ5A 1TXFA 4LZ8A 4KCCA 2HFBA 2HAUA 5AA4B 3DP6A 3QAXA 3HHFA 4H67A 4YB5A 3Q28A 4M4GA 3FIRA 1DTZA 4DLDA 1SW4A 1TFDA 4FATA 3H7MA 4I1DA 3RLFE 1Q1KA 3KN8A 1I6AA 2ESNA 2XXQA 1XT8A 3ZSFA 3IB2A 3TEPA 3VFJA 4EQ7A 3LSXA 3OEKA 3RT6B 1SI0A 5I59A 3O97A 3K6XA 3U72A 1OVBA 4ZECA 2F36A 5H8NB 1MXUA 1RYOA 4QFPA
chains in the Genus database with same CATH superfamily
3H06B 3K1NA 3KBZA 2EN4A 5FHNA 5J1DA 4OX9E 1LLSA 3EHSA 2L3CA 4IGRA 4ZYDA 2NXOA 3USDA 4XKNA 1IBME 4F2QA 4F18A 2FIXA 5F3WA 3MP6A 2JWOA 2YSPA 2QSXA 1MS7A 2GQ1A 1LLMC 5I57B 4YU0A 3KWRA 3O6IA 2YTOA 5A6BA 2CSHA 1FJ9A 2UVGA 1Z7NE 2VPNA 2XX8A 5FHMA 5I5PA 3H6VA 2R6GE 4YKIA 3MQ9A 4ONYA 5DEXB 5DVJA 2K4VA 1PEBA 1B3EA 4OFJA 4DV2E 2LT7A 4FAJA 3RQTA 3FJMA 2VT5A 4YAHX 4F1YA 1SR9A 2CMOA 1JP4A 3LBSA 4IB2A 2AL4A 3EPKA 1Z1BA 1HSEA 4PFYA 3K6VA 1DQ3A 1B40A 3O28A 4LFCE 2EWLA 2YRMA 1KYQA 3IK6B 4DCYA 4PC9A 2GLIA 3ODBA 2EPPA 1URGA 1JQFA 4C0RA 1OQGA 4RK9A 4DDDA 4QSDA 3SKPA 1AOVA 3CRBA 1SW2A 5EHMA 1YYKA 2EM6A 3SEWA 1QU6A 1MM6A 1IMCA 3D4CA 2RS7A 2YLNA 1EH6A 4HS7A 3MAMA 4Q28A 1N3WA 1MQGA 1T4NA 4DMIA 1B69A 4OANA 2NABA 3RY3A 3AUZA 4WSGA 4H46A 5EHSA 4F6MA 2Y84A 1US4A 2EN3A 1UTBB 3SERA 3VLWA 3S2VA 2HXRA 2LUQA 3H6UA 4G68C 1NH7A 4I9DA 3CG3A 1JW5A 1AL3A 2EOQA 2DLKA 4Q35B 2GH9A 5CMCA 2GHAA 2R76A 2YWQA 2ODRC 1BKAA 4WXCA 2E1SA 2F7BA 1H45A 3B8BA 1NUWA 4F1UA 1YYZA 1MPCA 1X6FA 1LFHA 1YZ0A 3EPJA 4NHBA 1LBCA 2XD3A 2GHBA 2ENAA 4MF3A 4QSCA 2FBPA 3MHHC 3MVYA 4I3EA 4F29A 1WDNA 4YICA 3EPEA 4BC7A 5HBCA 1EZ9A 3PMVA 3BIHA 1MQDA 4M2ZA 3C4TA 1P99A 3M3LA 2DXYA 4O3CA 2VHAA 3FUZA 4JI8E 2F35A 2WYKA 5I2KA 3EF7A 4DR7E 1T4OA 1AAYA 1N76A 5ESYA 3R26A 2AIXA 4JWYA 4FECA 2PFYA 4N6PA 4OA4A 5EQAA 3A3CA 3TTNA 4C1TA 5AC4A 2HZLA 4IO7A 4F54A 2CPNA 5K2YA 4U1OA 4M0VA 4GL0A 2LMZA 4PFTA 2PX1A 2IEEA 3F11A 3C34A 3HV1A 4JYAE 3VVEA 5AA2D 4DKKA 3VXCA 4FE8A 1YXIA 3VXBA 2B7VA 2OLBA 3IWDA 4ESXA 3LSFB 1B1XA 2X26A 1BK4A 1AMFA 4JSOA 1PBQA 2N3GA 3OMLA 3PPRA 4PFUA 3G3FA 3ADLA 5AE4A 5K2XA 3UK4A 1L4SA 4GBWA 2QVRA 1B3FA 4F1VA 5AA2A 4HW8A 4BBYA 2JOBA 4GVOA 3IJXB 4H45A 3V89B 1XOCA 2PVUA 4TUIA 5M2VA 2DS9A 1UIUA 4P7DA 1O64A 2H25A 1T38A 3MZ1A 1J1NA 5I58A 4LF8E 1B6HA 2FYIA 1S9TA 3M8UA 3OO8A 4G8MA 2GPIA 3TTKA 2DWIA 4KYEA 2DSYA 1LAHE 1MH3A 2XXIA 2I49A 4OFLA 4ZYGA 4KHPE 2WBUA 4JWOA 5IZ3A 3T1HE 5AASA 1LBXA 2EM4A 4YKJA 2WX9A 4P8BA 5IGAA 1NV0A 3K0VA 3I5OA 3TQMA 1LAXA 2REGA 2EMIA 1BIYA 3J7Yp 4OEVA 4ZYEA 5H8HA 1OLCA 2YTNA 3RMPA 1NCSA 3OEMA 2ODRD 2QMWA 2XXVA 3C33A 2YTQA 4AS4A 2XD2A 4N17A 3UGWA 3MZ9A 3T1BA 5CC2A 2VRDA 4F2OA 4OHNA 2FA7A 1AH5A 5DYHA 1XI6A 4Q5TA 4G68A 2XXKA 5I59B 3U1OA 4YKKA 2L6MA 2ZM6E 4UABA 1A99A 3KN7A 4I8CA 1X6HA 1EH3A 5KL6A 3TAJA 2QRYA 3CVGA 4I3YA 4R2RA 2EM7A 2DYXA 4OVRA 1IQOA 1FPLA 2DIXA 1M5FA 2EN6A 5L8DA 1FBFA 2HHHE 4XEQA 4JI5E 1G0HA 4JDFA 4LF7E 3KG2A 4DI4B 2Q9TA 3HHGA 1WRJA 4GWZA 4KD5A 1XMOE 3TKDA 4G2ZA 5TU0A 2DE4A 1BTJA 4OMBA 5H8FA 2Q2AA 3RNNA 2V93A 3THNA 1KA0A 5AC5A 1FBDA 4TQUQ 3PPQA 1FQEA 2RC9A 1QUKA 1NNKA 4RPOA 4XIGQ 2UXBE 3O29A 1IXHA 4P1LA 2EPAA 3ADIA 3FZVA 3H4ZA 3RT8A 1X5WA 4R2SA 5ISUA 3N6TA 1RYXA 3MUQA 2NVUB 2LVHA 4UA8A 1JK1A 2OJTA 4RJZA 1FTOA 2NWJA 2LBSB 2EP3A 2D3IA 1R1NA 2EMKA 1FBHA 4R6HA 1D3KA 3H03A 1H43A 2UXCE 3PPPA 1FQDA 3TTLA 1IZ1A 4N6KA 3C35A 5L9SA 4R75A 4ZZAA 4IR8A 1NUYA 2Y5LA 2ZMBA 3I3VA 2DLQA 2EMCA 4FJPA 3JTZA 2QMXA 3TCGA 2CZLA 4PFWA 4N4UA 4LTYA 1MXZA 2PMSA 4OWDA 4DZ1A 1JETA 1RMDA 2I58A 3Q26A 2A5TA 1O7TA 5AE3A 4H5GA 4X1BA 3QK6A 2YRKA 4QFKA 4B3TE 4N81A 1WODA 3L6GA 1NH8A 4O3BA 3ECRA 2R1FA 2V85A 4H0WA 4JI6E 4JSDA 3OTOE 1BLFA 2QFLA 2Q8MA 4PF8A 3L6HA 4R9FA 4WPYA 1NV1A 2F8BA 4R2PA 2KHXA 2XXRA 4H5FA 3FV1A 2L92A 1T4LB 4I8OA 1MY3A 5KL5A 4MNPA 4C1UA 1MEYC 4JI2E 1RDXA 4XTCQ 2QVUA 4M9VC 3AV0A 3QYTA 4KI0E 3G3GA 3BBGA 3IR1A 2FVZA 4R9GA 2O7IA 1LB8A 4X9JA 2DOJA 2DE3A 4F39A 3KEIA 5AA3A 5IKBA 4KZSA 2YTIA 1XHYA 4YMBA 1GV8A 1OVTA 2LAOA 3KN3A 4MCOA 1EH8A 5HM4B 1RKMA 3E9XA 3FXRA 3UORA 4MH5A 3BF2A 4GXAA 1EU8A 1FTMA 1URDA 3SESA 1M5DA 4HE1A 2THIA 1B9JA 4THIA 5L9OA 4FORA 2EL6A 4TLMB 2ZZVA 5IXMB 4B3ME 4F9AB 3CR9A 1SW1A 3JAMC 4ZEBA 5AE2A 1M5CA 4DIGA 4LONB 4G8HA 4RYAA 1X47A 1MY2A 5A5LA 3FGSA 3OSRA 5AA2B 1OQHA 4MHFA 1FPGA 3KBRA 4DXBA 3E3KA 1STUA 3D4GA 1JK2A 3OMBA 4R72A 3MP1A 1MDP1 3S4UA 3PU5A 4MBPA 4O3AA 3DM0A 4X8WA 1RDYA 2P1SA 1IXIA 3QIMA 2KONA 1PC3A 2F34A 2JOXA 5CMBA 4ZDMA 2EMHA 2H4IA 2EOZA 2HPGA 3OO7A 3K6WA 1B5IA 2YTEA 5TPAA 3LMLA 2JP9A 3VYXA 4P11A 3C9HA 1P1NA 3KC0A 4BHCA 2EOYA 4GOTA 3TODA 5AA1A 1FQFA 3K1PA 3RTFB 1DOTA 2ZYKA 2XWOA 3K1MA 3K01A 2EZ6A 2O51A 2V25A 5DVFA 3PMXA 1ZJLA 2F97A 2FIEA 2XXTA 1D9VA 2OWTA 4RNSA 5TSEA 3VVDA 2PT2A 3TFLA 5LMUE 4PBHA 1N04A 4WSPA 1S50A 2Q88A 4HTGA 5CMMA 2DMIA 4OVQA 3LC8A 5I2NA 4G68B 4L5NC 1GVCA 4YY3E 4G77A 3ZOQB 1IMBA 4N8GA 1LBWA 4NXNE 1NNTA 2VQFE 3DLNA 4FBPA 3R7XA 4RA1A 3MPLA 2F6PA 1MPDA 1GTKA 3IWBA 4ZS9A 2Q89A 4EDPA 1XNRE 1FBPA 2ZZXA 1PJQA 4O24A 2DWJA 4F9CB 2Y7KA 2I3VA 1NNPA 2RCBA 2O1MA 4LFBE 4MNIA 2EMGA 2EPOA 2QS2A 2G7HA 2B3BA 1UTHB 1US5A 2E1MA 3D1RA 5IM2A 2VPOA 4BDLA 3IO6A 2V8QB 3DF6A 5H8FB 3CSBA 3PD8A 4JV5E 4KCDA 4DI3D 2RKMA 3O66A 5LLQA 4GBVA 4XXUA 3BFTA 2RF1A 1NV5A 1N34E 4I62A 3SEUA 2QS1A 2XXWA 1BBGA 3NOHA 1LBBA 4OOGC 3PGFA 3O2AA 3T9UA 4NEDA 1MQHA 2MC5A 1IMEA 3F6GA 3L00A 3KJ7A 2HJJA 3T9VA 3MC2A 1EYKA 3K02A 4QF9A 4U4SA 3CFXA 4JBZA 1I6QA 2EPUA 2VQEE 4X1DA 4WX9A 2EMZA 2LJHA 4LQ2A 1N7XA 4M30A 2EOEA 2YTGA 2BB8A 5KDTB 3HCQA 4R73A 2NUEA 4EQBA 2H98A 3FVNA 5H8QA 1MXXA 1ZBMA 4QRZA 1OIBA 3IFCA 3TQWA 4RPNA 4KR5A 1MXVA 2A5TB 1I94E 1IMAA 4LU9A 4O7MA 3TCFA 1GZ6A 2DB2A 2YT4A 1FKAE 1I69A 4P3LA 4F3SA 1RC7A 4GZNC 1JEUA 4QFLA 4DR1E 4HE0A 4KHZE 2Y7WA 2LV2A 2I9IA 4NF8A 4RY1A 1UBDC 2EMYA 2A5SA 2EPXA 3WAFA 5EQ7A 3EPLA 5IWAE 2XX7A 1H44A 1QKBA 3BFUA 2EN2A 4R8OA 3TCHA 1IUDA 3OENA 4HCWA 1JW4A 2YTPA 1HNXE 2O68A 5ET8A 2YU5A 4NZVA 2L33A 1QVSA 3H6WA 1GGGA 2JJKA 1SD3A 3J81C 3HSTA 2O6AA 2EN8A 4O8MA 4PE5B 1FRPA 2EOOA 4R2FA 4EF1A 4B3RE 5HPQA 1BB8A 2N8XA 3B6TA 3S9MC 3I6VA 1HR0E 3T1YE 1A54A 3IOVA 1SBPA 1FPIA 4NF4A 2H9BA 1MPBA 1MGTA 3RTWB 3RGYA 4NF6A 4IO3A 3G3IA 4WEPA 3PPNA 2FV4B 4GEQB 2AL5A 4LF6E 1FPJA 4MFIA 2DWHA 1DCUA 2Y7IA 2ELZA 2HQ0A 3B6WA 4NMYA 3ILUB 3TDJA 3EHTA 4MAGA 1ZU0A 4QBAA 2EOSA 5I56A 3KOTA 2A25A 3C32A 3P7IA 1SI1A 1UQWA 2XXYA 3HXLA 2UVIA 1FPKA 2UXAA 4ESWA 4MEVA 2ZNTA 3AXFA 1BP5A 3T9HB 1B5JA 4PDDA 1SW5A 2WBSA 2I0BA 3CG1A 2E0SA 2ZXTA 4ELOA 4QFOA 4IJDA 3BIDA 3B7DA 1A1GA 2VGQA 3PD9A 5FLXC 4DV7E 4BDQA 5TPAB 1YYOA 3IFAA 4R2EA 4DR6E 4LFAE 1X48A 1TF6A 3SETA 1FTJA 1EYJA 2EPRA 1D4NA 1QGXA 4I40A 2O1LA 4PGNA 3FV2A 1ZU1A 1ZIUA 1VSOA 4R2BA 4IGTA 2V84A 1EZOA 1A1IA 1IXCA 1WVJA 3N5LA 5F1QA 3PUVE 3Q29A 5I2NB 1ZMGA 3PMWA 1HSLA 3KJTA 1B2HA 2XA5A 1B3HA 2HAVA 3O9PA 4UACA 1PB7A 1DTGA 2Z22A 3FXUA 4JVCA 1P47A 2ADRA 1CB6A 4LN5A 4E0XA 4R6KA 2X7PA 2MKDA 2DE2A 3RPLA 1NV7A 4AB5A 4O4KA 3W9VA 3QXMA 1DMBA 3VVFA 2F4VE 1Y3QA 2EOIA 1Q35A 3B6QA 1JVYA 4HE2A 1QJMA 1EZPA 4P56A 2L2MA 1A8FA 3SEVA 2NOOA 4MJOA 4P1EA 2OX3A 1QUJA 2LTSA 1P1UA 2QS4A 1G2DC 1CNQA 5A5XA 1QNTA 1NV4A 4ECFA 1NV6A 5LL6R 4HEIA 2UVJA 1IMDA 1IQ7A 1F2IG 2LO3A 4K0KE 1YUJA 4BC9A 4Q8RA 1MM7A 1FSAA 4DCXA 2F8DA 2W7YA 3FJGA 1VFDA 5DT6A 3MYUA 4KYDA 3KC1A 5CI5A 2EN7A 4ZEIA 2ENCA 4TUGA 4FEBA 2M4IA 1A7LA 5JTYA 1S7YA 4U1ZA 2F7CA 2B9DA 2L5VA 3V83A 4X04A 3T22A 1FBEA 4DXUA 1EKZA 2XXHA 2P3VA 1M5BA 4NX1A 3Q25A 5H8NA 1G0IA 5EQ9A 3IOTA 1Q9DA 3IAZA 2EL5A 5JK4A 1B1HA 1FQCA 1B58A 3PUXE 4P0IA 1QULA 2EOXA 2B4LA 5KL3A 2PRTA 1OMPA 5H8QB 5F7VA 2WKYA 3ZKKA 2ALUA 5ITPA 1KA1A 4IS1C 4H6DA 1YAEA 5I57A 1AIVA 4MIJA 4NGUA 4N8YA 2EM8A 2UYEA 1SVXB 2RSIA 4AS5A 4ZEKA 1NKXA 1LCFA 3C4MA 1XVYA 2LCEA 1B3GA 4X62E 3PV0E 2DXRA 4FEDA 5DVIA 1TN9A 1MY4A 5I3SA 1WHNA 1Y3NA 1PDAA 1NMUA 2V3UA 3HTXA 4PAIA 4GWXA 1QKAA 1L5TA 4NF0A 4R6YA 1MDQA 1MQIA 5B7DA 2V86A 1INPA 3R6UA 4U23A 2V3TA 2ZNSA 2FTXB 2OCUA 3LR1A 4KWYA 3C6MA 1YCJA 4GX4A 2HZKA 3OSQA 2XXUA 3UN6A 4O7IA 5IV8B 4X66E 4LA9A 2RC8A 4YZZA 2M7QA 3DJWA 3PPOA 4ZEDA 1X3CA 4XKPA 2ENHA 4NN3A 2EM0A 2AYSA 3TPAA 2YTJA 4GWSA 2L3JA 2P0SA 2OWZA 4LATA 2EOFA 4MLQA 4LF4E 1UILA 1B7HA 1SDXA 4DE8A 4JVIA 1D9YA 3IX1A 1IBKE 5I7IA 4K3FA 3TTRA 2HHMA 4J8ZA 4PQJA 2BBGA 2YRHA 4BLAA 1A1KA 4N91A 3MW0A 1DSNA 3OXNA 5I2KB 4NF6B 2D21A 4GWUA 2L8TA 3QSLA 3TYHA 5LMNE 4DV1E 4LF9E 3S9EA 1LAGE 2RSMA 2Q2CA 3ADJA 2G93A 2WEFA 5FTIA 2QVVA 1Y1MA 2MDRA 2YPNA 4JB7A 3TZAA 2QJEA 1A8EA 4NF5A 1BBOA 1N36E 4AB6A 3H09A 4U4XA 1NUXA 5KL4A 3EKIA 2EPLX 4PE3A 2V89A 3LLHA 3U93A 5CM6A 4N4RB 2RINA 2K7IA 3CFZA 3KSJA 4JI1E 1XNQE 2CT1A 1ZKBA 3BKIB 5CFFE 3KFMA 5F24A 1LGBC 2I3WA 5I58B 4NTLA 1GQEA 2YSOA 1LBYA 3HQ1A 5ET5A 2IHR1 4H65A 3Q27A 1JW1A 2NUVA 1MH4A 5IZ3B 2EM3A 1IITA 1B5HA 4EF2A 1TT1A 4Q0CA 1SYIA 1A1LA 3IO4A 4Z7EA 1UIVA 2UYFA 3PUWE 1B46A 3G7WA 2V88A 3K00A 2DMYA 2CEXA 3JZJA 1R6ZA 4LQ5A 4NWDA 5H8HB 2EE8A 5ICQA 1IEJA 4X65E 1VE4A 5A2QC 2L2NA 4GF8A 2D9HA 3G3JA 2LJUA 1B7UA 2ZNUA 4PTKA 2YU8A 3EPHA 1LSTA 4ZYHA 3RPLB 2EPNA 2DRPA 4OVSA 3ILTB 1YSAC 2NUGA 1NV2A 5B70A 3E78A 2VD2A 1N0TA 2EOHA 1MY0A 4P0GA 3G3KA 3KOSA 4OERA 4HCYA 3IWCA 1QW0A 1G2FC 1ZBQA 1B0HA 3FASA 4DUYE 5ET6A 5A5XB 4N13A 2WCC3 3EQ1A 2MDGA 1JEVA 1FCKA 3RPWA 4OEUA 3B50A 1PJSA 3PUZE 5TP9A 2PCRA 2DSFA 5AE1A 1MG1A 2EMWA 1B7ZA 3HPSA 2JY9A 1F9BA 3E79A 3CIJA 2XWIA 2Y7PA 4XKRA 1LAFE 3A29A 5EYFA 2B3FA 3F6HA 5I84A 4H8JA 1PBPA 5JTYB 2J7JA 1DK4A 4XF5A 2IA4A 2QS3A 1FPEA 1X6EA 5H8SA 2KQZA 5ELVA 3H6TA 2KR0A 1HNZE 3T0JA 2I13A 1O0WA 3MBPA 2EQ0A 2KOUA 4DR4E 4U2RA 1ANFA 5A6BD 4N07A 2EMFA 2F3DA 1FPBA 3RYDA 2JR1A 5KL2A 4H1XA 4HXVA 1FPFA 1LCTA 3JYRA 4OZ9A 3TUSA 4PP0A 1IBLE 2Y7RA 4QHQA 3FBPA 2H99A 2PFZA 1R9LA 2YTDA 1DBZA 3HO7A 1XS5A 2I4BA 4OYVA 2V4CA 3M3FA 4EXLA 4F31B 4WYQB 4M1VA 2I6EA 3DP4A 4O94A 1N33E 1A40A 1POTA 3SEXA 1H76A 3N6UA 3N94A 1P1QA 4LVQA 1MXYA 1UHZA 4PF6A 1FBCA 3ADGA 5EYGA 2ANJA 3T9XB 3GBAA 2KLFA 2Z8FA 3KZGA 4GX6A 5LDZA 4DV4E 1WJPA 1Y3PA 2B65A 3A09A 3HFUA 2B7TA 4IY6A 2UU9E 4EXKA 2VF1A 1B3LA 1M5EA 4O43A 4DR5E 3TELA 2GFEA 4GFRA 2I4CA 4GKJE 4GLIA 1Y9UA 2RC7A 3FVKA 2XXXA 4YB7A 4XFEA 5LTCA 2F3BA 1FTKA 2JVAA 2VP1A 3MVZA 1IQSA 3GYYA 2EQ3A 3C6KA 2NA2A 2CZKA 4L17A 4P78A 5KCJA 1KZ8A 4PFRA 2WBBA 2EPCA 2YTFA 2M8CA 1YZ9A 4IO6A 2EJ4A 2CEYA 2UVHA 5BUUA 3EN3A 2HGHA 3H3GA 3CI8A 2MC6A 3KGCA 1HSJA 3WAEA 1DGCA 2I0CA 2XWKA 3MWBA 5CBSA 1YPNA 2HC5A 2UUAE 4R03A 2DQVA 4MNCA 1YFHA 1DPPA 1LEVA 4IO4A 4U21A 2EQ1A 3PTYA 3VLUA 1HNWE 4BCAA 4GKKE 3T96B 4NF5B 5DTBA 3KSXA 2X7QA 2ZYNA 2DDKA 5IAIA 3JU0A 5KL7A 1A1FA 4FIMA 2LTRA 2EOJA 4GWWA 4G8NA 4LP2B 4NAPA 4PGPA 1P1OA 1RDZA 4ZEFA 1FJ6A 3K6UA 5CMKA 5A6JA 1NL5A 3SDFA 1SFEA 1URSA 3IL1B 2UUBE 1B51A 2PBWA 2PYYA 4FK5C 4Q30B 3FXQA 4NQ8A 1VR5A 4RH8A 1FQBA 1N84A 2ZYMA 3OO6A 4YKPA 1ELJA 2M1SA 4JI7E 3C36A 1LBVA 3IOWA 4ZE8A 4KFQA 2WBTA 3LUYA 5FBPA 4WXJA 2E72A 5ICTA 3C4BA 5IT9C 1P1WA 4N6DA 4OETA 1B05A 3EHUA 1YTVA 4ISUA 2DGCA 2F6GA 4DV6E 2Y5KA 4MLVA 1B52A 4TOZA 1NV3A 2Q8UA 2OWSA 3LSWA 2XHDA 5JEIA 3S9LC 4O5GA 1SYHA 3U8QA 2E5LE 3HN0A 4DUZE 2QL3A 3QMFA 5FHOA 4QXDA 2P3NA 3FD3A 3FVOA 5ITOA 2ZZWA 2N3HA 3U92A 4G4PA 2UXDE 3N26A 1D9QA 2XXPA 2OK2A 4ZZEA 4H8IA 4PDHA 4KXPA 1TFAA 1XMQE 1POY1 2ONSA 3VV5A 4NE4A 3BBRA 1T0KA 4F2JC 2EMAA 4P47A 2R9JA 1JVXA 4OXVA 2OBGA 4DR2E 3T93B 2O84X 1Z7ME 2HXWA 4GL8A 2EPMX 4F3PA 1FBGA 3GBBA 4GIZA 1DPEA 4ZE9A 4RK2A 2Q74A 2R8TA 4DXCA 4BDRA 5TP9B 1SPIA 4OVPA 4WKMA 1ZTYA 3KZZA 2RTXA 1VFEA 4NG7A 3QUFA 2RQLA 3IJOB 4OVJA 2EPKX 1Y20A 2DVCA 4POWA 2ELYA 2CZHA 2LUPB 5AA4A 1IMUA 2RPCA 4IY5A 4DV5E 4F22A 5T6JA 3THIA 4BHBA 3CSGA 5CRYA 3ONMA 3V5AA 4DV0E 1A55A 1H3DA 4KQPA 4U22A 4Z0IA 2L2KB 3ZKLA 2B3TB 2HEUA 1IMFA 3OO9A 2EPZA 2ZYOA 1IXGA 4ELQA 2CZIA 3K6QA 3KZYA 3UIFA 4EUOA 4F19A 3HPZA 1MXWA 3G3HA 4OVTA 3P1XA 2BJJX 4NHRA 3LSLA 3E4RA 3LUZA 3SZPA 2EMBA 2H36X 4JI3E 3GXAA 1T39A 2MKZA 2Q8JA 1GR2A 3U94A 3PUYE 4IO2A 2EM2A 4POXA 1UTHA 3CHGA 4GX3A 3V8XB 2YZTA 1NUZA 2XX9A 4X9TA 4P9KA 4NWCA 2JPAA 1SQYA 4RHBB 1II5A 3K4UA 4KYSA 4F3BA 3A3UA 3DP8A 3SEYA 2FNCA 2O69A 3MHSC 1PB9A 2P2AA 3FATA 5LOMA 4LZ7A 4F3GA 4GXSB 2EMXA 4OFOA 2V87A 4BDMA 4L8NA 3T66A 1LBZA 1AWBA 4R74A 4F9BB 5DEXA 2UUCE 1Y4CA 4QSEA 4GQOA 1B4ZA 4DR3E 1DI2A 5FTHA 1YUIA 4WXDA 4YHHE 1XC1A 2DP8A 3FXBA 1N3GA 2D5WA 3GLBA 4TLLB 4NF8B 2FGGA 2Z8DA 1RQ0A 3ZS6A 4AQYE 3DELB 4BS9A 4PBQA 4JXIA 5EYHA 1CE2A 4YMAA 3W9WA 3UK3C 4LF5E 5KCJB 2OZZA 5KDTA 4GWOA 2RCAA 1J5EE 2Z8EA 1XVXA 5EQ8A 3IB1A 3VE1B 4YB6A 3BGHA 3W15C 4EQ9A 1N3XA 3JV9A 4X48A 4OENA 3S9NC 1EYIA 1FJGE 1FTAA 5ET7A 3FVGA 2ONKE 1K9ZA 2ONRA 3MP8A 4AQ4A 1LFIA 2Z23A 1I6BA 4R2QA 3O6HA 1UTBA 1N7WA 3UP9A 1JNFA 3C31A 2EM9A 4NF4B 2PT1A 2LE2A 3TTMA 3OOAA 1PB8A 2M9AA 2EL4A 2REJA 2BJIA 4ND9A 2EN1A 2VOZA 2F7AA 2VD3A 5A69A 2RS6A 5CBRA 3TQLA 3LV0A 3UA8A 2I48A 4LUBA 4G61A 4PFBA 2VE7C 2G29A 3M3KA 1ZBTA 2V83A 2F5XA 2EOMA 3K2DA 1QUIA 4OTEA 5I56B 4NXME 3OD7A 5L9MA 1NI9A 3FJ7A 5IZ1A 4PCDA 1B4HA 4JWXA 2JYAA 1J26A 1MRPA 3MJNA 4OESA 1USYH 4PETA 2DWAA 1FW0A 3THOB 4MMPA 5BWJA 3GZGA 4IO5A 1TWYA 3IB0A 3ISPA 3RUMA 3QG5C 1R9QA 4ELPA 1TF3A 5KZTA 2DVZA 2R71A 2QPQA 1Y1ZA 1FQAA 4F6NA 2O7UA 2FHYA 3J80C 3E13X 4R2AA 4KPTA 3ROJA 4JVDA 3RN8A 2H5YA 5J16A 3VDFA 1ZR9A 1N32E 2YJPA 5A6KA 4BDOA 1Y4TA 2EM5A 2WZOA 1UN6B 2GRVA 4ELRA 4WEDA 4E0WA 3J7AG 3MSWA 3MZBA 2LRSA 4X64E 4DV3E 3MVXA 1FPDA 4GRKA 2XWVA 4R2DA 2ABHA 3FIGA 1PKPA 3MPKA 1MQJA 4BDNA 3TMGA 3OELA 3IORA 4BMJA 1MY1A 4GD5A 4X8RA 1LB9A 1X49A 1KWHA 4XKQA 1EH7A 1ATGA 4OQOA 3VLVA 1OLAA 5IZZA 1VDWA 3U65A 1USYE 3VYYA 4PFIA 1NFTA 2JXPA 4QFNA 3MSTA 4N15A 2V3QA 3O6GA 3VHTB 5T3JA 2F78A 2NUFA 1FTLA 1B32A 2WBDA 1A1HA 1B0LA 3MVWA 4MX6A 2EMLA 3HPIA 1LFGA 4R2CA 1NNFA 1WXRA 3IOUA 3CFLA 4WFTA 1O63A 4RXLA 3QUJA 1IIWA 1ZLQA 1NEIA 1ZAAC 1A1JA 2HCAA 4LZ5A 4PAFA 1WHQA 1TXFA 4LZ8A 4KCCA 1YYWA 2HFBA 2HAUA 5DW8A 5AA4B 5ADZA 5A6AA 1KJKA 3M99B 2B4MA 3DP6A 5BR8E 3HHFA 3QAXA 4H67A 4YB5A 2WYPA 4GWYA 3Q28A 4M4GA 3FIRA 1DTZA 2MKNA 4DLDA 1SW4A 1TFDA 4FATA 3H7MA 4I1DA 3RLFE 1Q1KA 3KN8A 1I6AA 2ESNA 4JI0E 3VK6A 2XXQA 1XT8A 3ZSFA 3IB2A 3TEPA 4JI4E 2EORA 1K9YA 3VFJA 4EQ7A 3LSXA 3OEKA 3RT6B 1SI0A 5I59A 3O97A 1PJTA 3BIGA 2GHFA 3K6XA 5DNYA 2CTDA 3U72A 1OVBA 4ZECA 2F36A 5H8NB 1MXUA 4B3SE 1RYOA 4PAKA 4QFPA
chains in the Genus database with same CATH topology
3H06B 3K1NA 5FHNA 5J1DA 1LLSA 3EHSA 4IGRA 2NXOA 3USDA 4XKNA 4F2QA 4F18A 3MP6A 2QSXA 1MS7A 5I57B 4YU0A 3O6IA 2UVGA 1Z7NE 2XX8A 5FHMA 3H6VA 2R6GE 4YKIA 3MQ9A 4ONYA 5DEXB 5DVJA 1PEBA 1B3EA 4OFJA 4FAJA 3RQTA 3FJMA 4YAHX 4F1YA 2CMOA 3LBSA 4IB2A 2AL4A 1HSEA 4PFYA 3K6VA 1B40A 3O28A 3IK6B 4DCYA 3ODBA 1URGA 1JQFA 4C0RA 1OQGA 4RK9A 4DDDA 4QSDA 3SKPA 1AOVA 3CRBA 1SW2A 5EHMA 3SEWA 1MM6A 3D4CA 2YLNA 4HS7A 3MAMA 1N3WA 1MQGA 3RY3A 5EHSA 2Y84A 1US4A 1UTBB 3SERA 3VLWA 3S2VA 3H6UA 4G68C 1NH7A 4I9DA 3CG3A 1JW5A 1AL3A 2GH9A 5CMCA 2GHAA 1BKAA 2E1SA 2F7BA 1H45A 4F1UA 1MPCA 1LFHA 1LBCA 2XD3A 2GHBA 4MF3A 4QSCA 3MVYA 4F29A 1WDNA 4YICA 3EPEA 5HBCA 1EZ9A 3PMVA 1MQDA 1P99A 3M3LA 2DXYA 4O3CA 2VHAA 3FUZA 2F35A 5I2KA 3EF7A 1N76A 3R26A 2AIXA 4JWYA 4FECA 4N6PA 3TTNA 4C1TA 3A3CA 2HZLA 4IO7A 5K2YA 4U1OA 4GL0A 4PFTA 2PX1A 2IEEA 3F11A 3C34A 3HV1A 5AA2D 3VVEA 3VXCA 4FE8A 3VXBA 2OLBA 4ESXA 3LSFB 1B1XA 2X26A 1AMFA 4JSOA 1PBQA 3PPRA 4PFUA 3G3FA 5AE4A 5K2XA 3UK4A 1B3FA 4F1VA 5AA2A 4HW8A 4GVOA 3IJXB 3V89B 1XOCA 2PVUA 5M2VA 2DS9A 1UIUA 1O64A 2H25A 3MZ1A 1J1NA 5I58A 1B6HA 2FYIA 1S9TA 3M8UA 3OO8A 4G8MA 3TTKA 2DWIA 4KYEA 1LAHE 1MH3A 2XXIA 2I49A 4OFLA 4JWOA 4YKJA 3K0VA 3I5OA 1LAXA 2REGA 1BIYA 4OEVA 5H8HA 1OLCA 3OEMA 2QMWA 2XXVA 3C33A 2XD2A 3UGWA 3MZ9A 5CC2A 4F2OA 4OHNA 2FA7A 1AH5A 5DYHA 4Q5TA 4G68A 5I59B 3U1OA 4YKKA 1A99A 3KN7A 4I8CA 1EH3A 3TAJA 2QRYA 3CVGA 2DYXA 1M5FA 5L8DA 4JDFA 3KG2A 2Q9TA 3HHGA 4KD5A 3TKDA 4G2ZA 5TU0A 2DE4A 1BTJA 4OMBA 5H8FA 2Q2AA 3RNNA 2V93A 4TQUQ 3PPQA 1FQEA 2RC9A 1QUKA 1NNKA 4RPOA 4XIGQ 3O29A 1IXHA 3RT8A 3FZVA 3H4ZA 5ISUA 3N6TA 1RYXA 3MUQA 2NVUB 4UA8A 2OJTA 4RJZA 1FTOA 2NWJA 2D3IA 1R1NA 4R6HA 1D3KA 3H03A 1H43A 3PPPA 1FQDA 3TTLA 1IZ1A 3C35A 5L9SA 4R75A 4ZZAA 2ZMBA 3I3VA 4FJPA 2QMXA 3TCGA 2CZLA 4PFWA 1MXZA 2PMSA 4OWDA 4DZ1A 1JETA 2I58A 3Q26A 2A5TA 1O7TA 4H5GA 4X1BA 3QK6A 4QFKA 1WODA 3L6GA 1NH8A 4O3BA 3ECRA 4H0WA 4JSDA 1BLFA 4R9FA 3L6HA 2XXRA 4H5FA 3FV1A 1MY3A 4C1UA 4XTCQ 3QYTA 4KI0E 3G3GA 3IR1A 4R9GA 2O7IA 1LB8A 2DOJA 4F39A 2DE3A 5AA3A 3KEIA 5IKBA 1XHYA 4YMBA 1GV8A 1OVTA 2LAOA 3KN3A 5HM4B 1RKMA 3E9XA 3FXRA 3UORA 4MH5A 4GXAA 1EU8A 1FTMA 1URDA 3SESA 1M5DA 2THIA 1B9JA 4THIA 5L9OA 4FORA 4TLMB 3CR9A 1SW1A 4ZEBA 1M5CA 4DIGA 4LONB 4G8HA 4RYAA 1MY2A 3FGSA 3OSRA 5AA2B 1OQHA 3KBRA 4DXBA 3E3KA 3D4GA 3OMBA 4R72A 3MP1A 1MDP1 3S4UA 3PU5A 4MBPA 4O3AA 3DM0A 2P1SA 1IXIA 3QIMA 1PC3A 2F34A 5CMBA 4ZDMA 2H4IA 3OO7A 3K6WA 1B5IA 5TPAA 4P11A 3C9HA 1P1NA 4GOTA 3TODA 5AA1A 1FQFA 3K1PA 3RTFB 1DOTA 2ZYKA 3K1MA 3K01A 2O51A 2V25A 5DVFA 3PMXA 1ZJLA 2F97A 2XXTA 4RNSA 1D9VA 2OWTA 3VVDA 2PT2A 3TFLA 1N04A 1S50A 2Q88A 4HTGA 5CMMA 3LC8A 5I2NA 4G68B 1GVCA 4G77A 1NNTA 3DLNA 3R7XA 4RA1A 3MPLA 2F6PA 1MPDA 1GTKA 4ZS9A 2Q89A 4EDPA 2DWJA 2Y7KA 2I3VA 1NNPA 2RCBA 2O1MA 2QS2A 2B3BA 1UTHB 1US5A 4BDLA 3IO6A 5H8FB 3CSBA 3PD8A 4KCDA 2RKMA 3O66A 4XXUA 3BFTA 2RF1A 4I62A 3SEUA 2QS1A 2XXWA 1LBBA 3PGFA 3O2AA 3T9UA 4NEDA 1MQHA 3KJ7A 3T9VA 3MC2A 3K02A 4QF9A 4U4SA 3CFXA 4JBZA 1I6QA 4X1DA 4LQ2A 1N7XA 5KDTB 3HCQA 4R73A 4EQBA 2H98A 3FVNA 5H8QA 1MXXA 1ZBMA 4QRZA 1OIBA 3TQWA 4RPNA 4KR5A 1MXVA 2A5TB 3TCFA 4F3SA 1I69A 1JEUA 4QFLA 4KHZE 2Y7WA 4NF8A 4RY1A 2A5SA 3WAFA 2XX7A 1H44A 1QKBA 3BFUA 3TCHA 1IUDA 3OENA 4HCWA 1JW4A 2O68A 1QVSA 3H6WA 1GGGA 1SD3A 3HSTA 2O6AA 4PE5B 4R2FA 4EF1A 5HPQA 3B6TA 3S9MC 3I6VA 1A54A 3IOVA 1SBPA 4NF4A 2H9BA 1MPBA 3RTWB 3RGYA 4NF6A 4IO3A 3G3IA 4WEPA 3PPNA 2AL5A 4MFIA 2DWHA 2Y7IA 2HQ0A 3B6WA 4NMYA 3ILUB 3TDJA 3EHTA 1ZU0A 5I56A 3KOTA 3P7IA 3C32A 1SI1A 1UQWA 2XXYA 2UVIA 2UXAA 4ESWA 2ZNTA 3AXFA 1BP5A 3T9HB 1B5JA 1SW5A 2I0BA 3CG1A 2E0SA 2ZXTA 4ELOA 4QFOA 3B7DA 2VGQA 3PD9A 4BDQA 5TPAB 3SETA 1FTJA 1D4NA 2O1LA 3FV2A 1ZIUA 1VSOA 4R2BA 4IGTA 2V84A 1EZOA 1IXCA 1WVJA 3N5LA 5F1QA 3PUVE 3Q29A 5I2NB 1ZMGA 3PMWA 1HSLA 3KJTA 1B2HA 1B3HA 2HAVA 3O9PA 4UACA 1PB7A 1DTGA 2Z22A 3FXUA 1CB6A 4E0XA 4R6KA 2X7PA 2DE2A 4AB5A 3W9VA 3QXMA 1DMBA 3VVFA 1Y3QA 1Q35A 3B6QA 1JVYA 1QJMA 1EZPA 1A8FA 3SEVA 2NOOA 1QUJA 1P1UA 2QS4A 5A5XA 4ECFA 2UVJA 1IQ7A 4Q8RA 1MM7A 4DCXA 2F8DA 2W7YA 3FJGA 1VFDA 5DT6A 4KYDA 5CI5A 4ZEIA 4FEBA 1A7LA 5JTYA 1S7YA 4U1ZA 2F7CA 3V83A 3T22A 4DXUA 2XXHA 1M5BA 3Q25A 5H8NA 3IOTA 3IAZA 5JK4A 1B1HA 1FQCA 1B58A 3PUXE 4P0IA 1QULA 1OMPA 5H8QB 5F7VA 2WKYA 3ZKKA 2ALUA 5ITPA 4H6DA 1YAEA 5I57A 1AIVA 2UYEA 1SVXB 4ZEKA 1NKXA 1LCFA 3C4MA 1XVYA 1B3GA 3PV0E 2DXRA 4FEDA 5DVIA 1MY4A 1Y3NA 1PDAA 1NMUA 2V3UA 1QKAA 1L5TA 4R6YA 1MDQA 1MQIA 5B7DA 3R6UA 4U23A 2V3TA 2ZNSA 2OCUA 3LR1A 1YCJA 2HZKA 3OSQA 2XXUA 3UN6A 4LA9A 2RC8A 4YZZA 3PPOA 4ZEDA 4XKPA 2AYSA 3TPAA 2P0SA 4LATA 4MLQA 1B7HA 1SDXA 4DE8A 1D9YA 3IX1A 4K3FA 3TTRA 4PQJA 4BLAA 3MW0A 1DSNA 3OXNA 5I2KB 4NF6B 2D21A 3TYHA 3QSLA 3S9EA 1LAGE 2Q2CA 2G93A 5FTIA 1Y1MA 2YPNA 4JB7A 3TZAA 2QJEA 1A8EA 4NF5A 4AB6A 4U4XA 3U93A 5CM6A 2RINA 3CFZA 3KSJA 1ZKBA 3BKIB 3KFMA 1LGBC 2I3WA 5I58B 4NTLA 4H65A 3Q27A 1JW1A 2NUVA 1MH4A 1IITA 1B5HA 4EF2A 1TT1A 4Q0CA 1SYIA 3IO4A 4Z7EA 1UIVA 2UYFA 3PUWE 1B46A 3G7WA 3K00A 3JZJA 1R6ZA 4LQ5A 4NWDA 5H8HB 5ICQA 1IEJA 1VE4A 4GF8A 3G3JA 1B7UA 2ZNUA 1LSTA 3ILTB 5B70A 2VD2A 1N0TA 1MY0A 4P0GA 3G3KA 3KOSA 4OERA 4HCYA 1QW0A 1B0HA 3FASA 5A5XB 4N13A 3EQ1A 1JEVA 1FCKA 3RPWA 4OEUA 3PUZE 5TP9A 2DSFA 1MG1A 1B7ZA 1F9BA 3CIJA 2Y7PA 4XKRA 1LAFE 5EYFA 2B3FA 5I84A 4H8JA 1PBPA 5JTYB 2IA4A 2QS3A 5H8SA 5ELVA 3H6TA 3MBPA 4U2RA 1ANFA 4N07A 4H1XA 3JYRA 1LCTA 3TUSA 4OZ9A 4PP0A 2Y7RA 4QHQA 2H99A 1R9LA 3HO7A 1XS5A 2I4BA 4OYVA 4EXLA 3M3FA 4F31B 4M1VA 2I6EA 3DP4A 1A40A 1POTA 3SEXA 1H76A 3N6UA 3N94A 1P1QA 4LVQA 1MXYA 2ANJA 3T9XB 3GBAA 2KLFA 2Z8FA 3KZGA 2B65A 1Y3PA 3A09A 4IY6A 4EXKA 1B3LA 1M5EA 3TELA 2GFEA 4GFRA 2I4CA 4GLIA 1Y9UA 2RC7A 3FVKA 2XXXA 4YB7A 1FTKA 2VP1A 3MVZA 4L17A 5KCJA 2M8CA 4IO6A 2UVHA 5BUUA 3EN3A 3H3GA 3CI8A 3KGCA 1HSJA 3WAEA 2I0CA 3MWBA 5CBSA 1YPNA 2DQVA 1DPPA 4IO4A 4U21A 3VLUA 3T96B 4NF5B 5DTBA 3KSXA 2X7QA 2ZYNA 5IAIA 4FIMA 4G8NA 4LP2B 1P1OA 4ZEFA 3K6UA 5CMKA 1NL5A 3SDFA 3IL1B 1URSA 2PBWA 1B51A 2PYYA 4Q30B 3FXQA 1VR5A 1FQBA 1N84A 2ZYMA 3OO6A 4YKPA 1ELJA 3C36A 3IOWA 4ZE8A 4KFQA 3LUYA 4WXJA 5ICTA 4OETA 1P1WA 1B05A 3EHUA 1YTVA 4ISUA 2F6GA 4MLVA 1B52A 4TOZA 2OWSA 3LSWA 2XHDA 5JEIA 3S9LC 1SYHA 3U8QA 3HN0A 2QL3A 5FHOA 3FD3A 3FVOA 5ITOA 3U92A 4G4PA 3N26A 2XXPA 2OK2A 4ZZEA 4H8IA 1TFAA 1POY1 2ONSA 3VV5A 4NE4A 3BBRA 1T0KA 2R9JA 1JVXA 4OXVA 2OBGA 3T93B 2O84X 1Z7ME 2HXWA 4GL8A 4F3PA 3GBBA 4GIZA 1DPEA 4ZE9A 4RK2A 4DXCA 4BDRA 5TP9B 4WKMA 1ZTYA 1VFEA 3QUFA 3IJOB 4OVJA 1Y20A 2DVCA 4POWA 5AA4A 4IY5A 4F22A 3THIA 3CSGA 5CRYA 3ONMA 3V5AA 1A55A 1H3DA 4KQPA 4U22A 4Z0IA 3ZKLA 2HEUA 3OO9A 2ZYOA 1IXGA 4ELQA 3UIFA 4EUOA 4F19A 1MXWA 3G3HA 2BJJX 3LSLA 3E4RA 3GXAA 2Q8JA 1GR2A 3U94A 3PUYE 4IO2A 4POXA 1UTHA 3V8XB 2XX9A 4X9TA 4NWCA 1SQYA 1II5A 3K4UA 4KYSA 4F3BA 3A3UA 3DP8A 3SEYA 2FNCA 2O69A 1PB9A 2P2AA 3FATA 5LOMA 4LZ7A 4F3GA 4GXSB 4OFOA 4BDMA 3T66A 4R74A 5DEXA 1Y4CA 4QSEA 4GQOA 1B4ZA 5FTHA 1XC1A 2DP8A 2D5WA 3GLBA 4TLLB 4NF8B 2Z8DA 3ZS6A 3DELB 4JXIA 1CE2A 4YMAA 3W9WA 5KCJB 2OZZA 5KDTA 4GWOA 2RCAA 2Z8EA 1XVXA 3IB1A 3VE1B 4YB6A 3W15C 4EQ9A 1N3XA 3JV9A 4X48A 4OENA 3S9NC 3FVGA 2ONKE 2ONRA 3MP8A 4AQ4A 1LFIA 2Z23A 1I6BA 3O6HA 1UTBA 1N7WA 3UP9A 1JNFA 3C31A 4NF4B 2PT1A 3TTMA 3OOAA 1PB8A 2REJA 4ND9A 2VOZA 2F7AA 2VD3A 5CBRA 3TQLA 3UA8A 2I48A 4LUBA 2G29A 3M3KA 2F5XA 3K2DA 1QUIA 4OTEA 5I56B 3OD7A 5L9MA 3FJ7A 1B4HA 4JWXA 1MRPA 3MJNA 4OESA 1USYH 4PETA 2DWAA 1FW0A 5BWJA 3GZGA 4IO5A 1TWYA 3IB0A 3RUMA 1R9QA 4ELPA 5KZTA 2DVZA 2R71A 2QPQA 1Y1ZA 1FQAA 2O7UA 3E13X 4KPTA 3RN8A 2H5YA 3VDFA 2YJPA 4BDOA 1Y4TA 4ELRA 2GRVA 4WEDA 4E0WA 3MZBA 3MVXA 4GRKA 2ABHA 3MPKA 1MQJA 4BDNA 3TMGA 3OELA 3IORA 1MY1A 4GD5A 1LB9A 1KWHA 4XKQA 1ATGA 4OQOA 3VLVA 1OLAA 1USYE 1NFTA 4QFNA 2V3QA 3O6GA 2F78A 1FTLA 1B32A 1B0LA 3MVWA 3HPIA 1LFGA 1NNFA 3IOUA 3CFLA 1O63A 4RXLA 3QUJA 1IIWA 1ZLQA 2HCAA 4LZ5A 1TXFA 4LZ8A 4KCCA 2HFBA 2HAUA 5AA4B 3DP6A 3QAXA 3HHFA 4H67A 4YB5A 3Q28A 4M4GA 3FIRA 1DTZA 4DLDA 1SW4A 1TFDA 4FATA 3H7MA 4I1DA 3RLFE 1Q1KA 3KN8A 1I6AA 2ESNA 2XXQA 1XT8A 3ZSFA 3IB2A 3TEPA 3VFJA 4EQ7A 3LSXA 3OEKA 3RT6B 1SI0A 5I59A 3O97A 3K6XA 3U72A 1OVBA 4ZECA 2F36A 5H8NB 1MXUA 1RYOA 4QFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H06 B;  3K1N A;  5FHN A;  5J1D A;  1LLS A;  3EHS A;  4IGR A;  2NXO A;  3USD A;  4XKN A;  4F2Q A;  4F18 A;  3MP6 A;  2QSX A;  1MS7 A;  5I57 B;  4YU0 A;  3O6I A;  2UVG A;  1Z7N E;  2XX8 A;  5FHM A;  3H6V A;  2R6G E;  4YKI A;  3MQ9 A;  4ONY A;  5DEX B;  5DVJ A;  1PEB A;  1B3E A;  4OFJ A;  4FAJ A;  3RQT A;  3FJM A;  4YAH X;  4F1Y A;  2CMO A;  3LBS A;  4IB2 A;  2AL4 A;  1HSE A;  4PFY A;  3K6V A;  1B40 A;  3O28 A;  3IK6 B;  4DCY A;  3ODB A;  1URG A;  1JQF A;  4C0R A;  1OQG A;  4RK9 A;  4DDD A;  4QSD A;  3SKP A;  1AOV A;  3CRB A;  1SW2 A;  5EHM A;  3SEW A;  1MM6 A;  3D4C A;  2YLN A;  4HS7 A;  3MAM A;  1N3W A;  1MQG A;  3RY3 A;  5EHS A;  2Y84 A;  1US4 A;  1UTB B;  3SER A;  3VLW A;  3S2V A;  3H6U A;  4G68 C;  1NH7 A;  4I9D A;  3CG3 A;  1JW5 A;  1AL3 A;  2GH9 A;  5CMC A;  2GHA A;  1BKA A;  2E1S A;  2F7B A;  1H45 A;  4F1U A;  1MPC A;  1LFH A;  1LBC A;  2XD3 A;  2GHB A;  4MF3 A;  4QSC A;  3MVY A;  4F29 A;  1WDN A;  4YIC A;  3EPE A;  5HBC A;  1EZ9 A;  3PMV A;  1MQD A;  1P99 A;  3M3L A;  2DXY A;  4O3C A;  2VHA A;  3FUZ A;  2F35 A;  5I2K A;  3EF7 A;  1N76 A;  3R26 A;  2AIX A;  4JWY A;  4FEC A;  4N6P A;  3TTN A;  4C1T A;  3A3C A;  2HZL A;  4IO7 A;  5K2Y A;  4U1O A;  4GL0 A;  4PFT A;  2PX1 A;  2IEE A;  3F11 A;  3C34 A;  3HV1 A;  5AA2 D;  3VVE A;  3VXC A;  4FE8 A;  3VXB A;  2OLB A;  4ESX A;  3LSF B;  1B1X A;  2X26 A;  1AMF A;  4JSO A;  1PBQ A;  3PPR A;  4PFU A;  3G3F A;  5AE4 A;  5K2X A;  3UK4 A;  1B3F A;  4F1V A;  5AA2 A;  4HW8 A;  4GVO A;  3IJX B;  3V89 B;  1XOC A;  2PVU A;  5M2V A;  2DS9 A;  1UIU A;  1O64 A;  2H25 A;  3MZ1 A;  1J1N A;  5I58 A;  1B6H A;  2FYI A;  1S9T A;  3M8U A;  3OO8 A;  4G8M A;  3TTK A;  2DWI A;  4KYE A;  1LAH E;  1MH3 A;  2XXI A;  2I49 A;  4OFL A;  4JWO A;  4YKJ A;  3K0V A;  3I5O A;  1LAX A;  2REG A;  1BIY A;  4OEV A;  5H8H A;  1OLC A;  3OEM A;  2QMW A;  2XXV A;  3C33 A;  2XD2 A;  3UGW A;  3MZ9 A;  5CC2 A;  4F2O A;  4OHN A;  2FA7 A;  1AH5 A;  5DYH A;  4Q5T A;  4G68 A;  5I59 B;  3U1O A;  4YKK A;  1A99 A;  3KN7 A;  4I8C A;  1EH3 A;  3TAJ A;  2QRY A;  3CVG A;  2DYX A;  1M5F A;  5L8D A;  4JDF A;  3KG2 A;  2Q9T A;  3HHG A;  4KD5 A;  3TKD A;  4G2Z A;  5TU0 A;  2DE4 A;  1BTJ A;  4OMB A;  5H8F A;  2Q2A A;  3RNN A;  2V93 A;  4TQU Q;  3PPQ A;  1FQE A;  2RC9 A;  1QUK A;  1NNK A;  4RPO A;  4XIG Q;  3O29 A;  1IXH A;  3RT8 A;  3FZV A;  3H4Z A;  5ISU A;  3N6T A;  1RYX A;  3MUQ A;  2NVU B;  4UA8 A;  2OJT A;  4RJZ A;  1FTO A;  2NWJ A;  2D3I A;  1R1N A;  4R6H A;  1D3K A;  3H03 A;  1H43 A;  3PPP A;  1FQD A;  3TTL A;  1IZ1 A;  3C35 A;  5L9S A;  4R75 A;  4ZZA A;  2ZMB A;  3I3V A;  4FJP A;  2QMX A;  3TCG A;  2CZL A;  4PFW A;  1MXZ A;  2PMS A;  4OWD A;  4DZ1 A;  1JET A;  2I58 A;  3Q26 A;  2A5T A;  1O7T A;  4H5G A;  4X1B A;  3QK6 A;  4QFK A;  1WOD A;  3L6G A;  1NH8 A;  4O3B A;  3ECR A;  4H0W A;  4JSD A;  1BLF A;  4R9F A;  3L6H A;  2XXR A;  4H5F A;  3FV1 A;  1MY3 A;  4C1U A;  4XTC Q;  3QYT A;  4KI0 E;  3G3G A;  3IR1 A;  4R9G A;  2O7I A;  1LB8 A;  2DOJ A;  4F39 A;  2DE3 A;  5AA3 A;  3KEI A;  5IKB A;  1XHY A;  4YMB A;  1GV8 A;  1OVT A;  2LAO A;  3KN3 A;  5HM4 B;  1RKM A;  3E9X A;  3FXR A;  3UOR A;  4MH5 A;  4GXA A;  1EU8 A;  1FTM A;  1URD A;  3SES A;  1M5D A;  2THI A;  1B9J A;  4THI A;  5L9O A;  4FOR A;  4TLM B;  3CR9 A;  1SW1 A;  4ZEB A;  1M5C A;  4DIG A;  4LON B;  4G8H A;  4RYA A;  1MY2 A;  3FGS A;  3OSR A;  5AA2 B;  1OQH A;  3KBR A;  4DXB A;  3E3K A;  3D4G A;  3OMB A;  4R72 A;  3MP1 A;  1MDP 1;  3S4U A;  3PU5 A;  4MBP A;  4O3A A;  3DM0 A;  2P1S A;  1IXI A;  3QIM A;  1PC3 A;  2F34 A;  5CMB A;  4ZDM A;  2H4I A;  3OO7 A;  3K6W A;  1B5I A;  5TPA A;  4P11 A;  3C9H A;  1P1N A;  4GOT A;  3TOD A;  5AA1 A;  1FQF A;  3K1P A;  3RTF B;  1DOT A;  2ZYK A;  3K1M A;  3K01 A;  2O51 A;  2V25 A;  5DVF A;  3PMX A;  1ZJL A;  2F97 A;  2XXT A;  4RNS A;  1D9V A;  2OWT A;  3VVD A;  2PT2 A;  3TFL A;  1N04 A;  1S50 A;  2Q88 A;  4HTG A;  5CMM A;  3LC8 A;  5I2N A;  4G68 B;  1GVC A;  4G77 A;  1NNT A;  3DLN A;  3R7X A;  4RA1 A;  3MPL A;  2F6P A;  1MPD A;  1GTK A;  4ZS9 A;  2Q89 A;  4EDP A;  2DWJ A;  2Y7K A;  2I3V A;  1NNP A;  2RCB A;  2O1M A;  2QS2 A;  2B3B A;  1UTH B;  1US5 A;  4BDL A;  3IO6 A;  5H8F B;  3CSB A;  3PD8 A;  4KCD A;  2RKM A;  3O66 A;  4XXU A;  3BFT A;  2RF1 A;  4I62 A;  3SEU A;  2QS1 A;  2XXW A;  1LBB A;  3PGF A;  3O2A A;  3T9U A;  4NED A;  1MQH A;  3KJ7 A;  3T9V A;  3MC2 A;  3K02 A;  4QF9 A;  4U4S A;  3CFX A;  4JBZ A;  1I6Q A;  4X1D A;  4LQ2 A;  1N7X A;  5KDT B;  3HCQ A;  4R73 A;  4EQB A;  2H98 A;  3FVN A;  5H8Q A;  1MXX A;  1ZBM A;  4QRZ A;  1OIB A;  3TQW A;  4RPN A;  4KR5 A;  1MXV A;  2A5T B;  3TCF A;  4F3S A;  1I69 A;  1JEU A;  4QFL A;  4KHZ E;  2Y7W A;  4NF8 A;  4RY1 A;  2A5S A;  3WAF A;  2XX7 A;  1H44 A;  1QKB A;  3BFU A;  3TCH A;  1IUD A;  3OEN A;  4HCW A;  1JW4 A;  2O68 A;  1QVS A;  3H6W A;  1GGG A;  1SD3 A;  3HST A;  2O6A A;  4PE5 B;  4R2F A;  4EF1 A;  5HPQ A;  3B6T A;  3S9M C;  3I6V A;  1A54 A;  3IOV A;  1SBP A;  4NF4 A;  2H9B A;  1MPB A;  3RTW B;  3RGY A;  4NF6 A;  4IO3 A;  3G3I A;  4WEP A;  3PPN A;  2AL5 A;  4MFI A;  2DWH A;  2Y7I A;  2HQ0 A;  3B6W A;  4NMY A;  3ILU B;  3TDJ A;  3EHT A;  1ZU0 A;  5I56 A;  3KOT A;  3P7I A;  3C32 A;  1SI1 A;  1UQW A;  2XXY A;  2UVI A;  2UXA A;  4ESW A;  2ZNT A;  3AXF A;  1BP5 A;  3T9H B;  1B5J A;  1SW5 A;  2I0B A;  3CG1 A;  2E0S A;  2ZXT A;  4ELO A;  4QFO A;  3B7D A;  2VGQ A;  3PD9 A;  4BDQ A;  5TPA B;  3SET A;  1FTJ A;  1D4N A;  2O1L A;  3FV2 A;  1ZIU A;  1VSO A;  4R2B A;  4IGT A;  2V84 A;  1EZO A;  1IXC A;  1WVJ A;  3N5L A;  5F1Q A;  3PUV E;  3Q29 A;  5I2N B;  1ZMG A;  3PMW A;  1HSL A;  3KJT A;  1B2H A;  1B3H A;  2HAV A;  3O9P A;  4UAC A;  1PB7 A;  1DTG A;  2Z22 A;  3FXU A;  1CB6 A;  4E0X A;  4R6K A;  2X7P A;  2DE2 A;  4AB5 A;  3W9V A;  3QXM A;  1DMB A;  3VVF A;  1Y3Q A;  1Q35 A;  3B6Q A;  1JVY A;  1QJM A;  1EZP A;  1A8F A;  3SEV A;  2NOO A;  1QUJ A;  1P1U A;  2QS4 A;  5A5X A;  4ECF A;  2UVJ A;  1IQ7 A;  4Q8R A;  1MM7 A;  4DCX A;  2F8D A;  2W7Y A;  3FJG A;  1VFD A;  5DT6 A;  4KYD A;  5CI5 A;  4ZEI A;  4FEB A;  1A7L A;  5JTY A;  1S7Y A;  4U1Z A;  2F7C A;  3V83 A;  3T22 A;  4DXU A;  2XXH A;  1M5B A;  3Q25 A;  5H8N A;  3IOT A;  3IAZ A;  5JK4 A;  1B1H A;  1FQC A;  1B58 A;  3PUX E;  4P0I A;  1QUL A;  1OMP A;  5H8Q B;  5F7V A;  2WKY A;  3ZKK A;  2ALU A;  5ITP A;  4H6D A;  1YAE A;  5I57 A;  1AIV A;  2UYE A;  1SVX B;  4ZEK A;  1NKX A;  1LCF A;  3C4M A;  1XVY A;  1B3G A;  3PV0 E;  2DXR A;  4FED A;  5DVI A;  1MY4 A;  1Y3N A;  1PDA A;  1NMU A;  2V3U A;  1QKA A;  1L5T A;  4R6Y A;  1MDQ A;  1MQI A;  5B7D A;  3R6U A;  4U23 A;  2V3T A;  2ZNS A;  2OCU A;  3LR1 A;  1YCJ A;  2HZK A;  3OSQ A;  2XXU A;  3UN6 A;  4LA9 A;  2RC8 A;  4YZZ A;  3PPO A;  4ZED A;  4XKP A;  2AYS A;  3TPA A;  2P0S A;  4LAT A;  4MLQ A;  1B7H A;  1SDX A;  4DE8 A;  1D9Y A;  3IX1 A;  4K3F A;  3TTR A;  4PQJ A;  4BLA A;  3MW0 A;  1DSN A;  3OXN A;  5I2K B;  4NF6 B;  2D21 A;  3TYH A;  3QSL A;  3S9E A;  1LAG E;  2Q2C A;  2G93 A;  5FTI A;  1Y1M A;  2YPN A;  4JB7 A;  3TZA A;  2QJE A;  1A8E A;  4NF5 A;  4AB6 A;  4U4X A;  3U93 A;  5CM6 A;  2RIN A;  3CFZ A;  3KSJ A;  1ZKB A;  3BKI B;  3KFM A;  1LGB C;  2I3W A;  5I58 B;  4NTL A;  4H65 A;  3Q27 A;  1JW1 A;  2NUV A;  1MH4 A;  1IIT A;  1B5H A;  4EF2 A;  1TT1 A;  4Q0C A;  1SYI A;  3IO4 A;  4Z7E A;  1UIV A;  2UYF A;  3PUW E;  1B46 A;  3G7W A;  3K00 A;  3JZJ A;  1R6Z A;  4LQ5 A;  4NWD A;  5H8H B;  5ICQ A;  1IEJ A;  1VE4 A;  4GF8 A;  3G3J A;  1B7U A;  2ZNU A;  1LST A;  3ILT B;  5B70 A;  2VD2 A;  1N0T A;  1MY0 A;  4P0G A;  3G3K A;  3KOS A;  4OER A;  4HCY A;  1QW0 A;  1B0H A;  3FAS A;  5A5X B;  4N13 A;  3EQ1 A;  1JEV A;  1FCK A;  3RPW A;  4OEU A;  3PUZ E;  5TP9 A;  2DSF A;  1MG1 A;  1B7Z A;  1F9B A;  3CIJ A;  2Y7P A;  4XKR A;  1LAF E;  5EYF A;  2B3F A;  5I84 A;  4H8J A;  1PBP A;  5JTY B;  2IA4 A;  2QS3 A;  5H8S A;  5ELV A;  3H6T A;  3MBP A;  4U2R A;  1ANF A;  4N07 A;  4H1X A;  3JYR A;  1LCT A;  3TUS A;  4OZ9 A;  4PP0 A;  2Y7R A;  4QHQ A;  2H99 A;  1R9L A;  3HO7 A;  1XS5 A;  2I4B A;  4OYV A;  4EXL A;  3M3F A;  4F31 B;  4M1V A;  2I6E A;  3DP4 A;  1A40 A;  1POT A;  3SEX A;  1H76 A;  3N6U A;  3N94 A;  1P1Q A;  4LVQ A;  1MXY A;  2ANJ A;  3T9X B;  3GBA A;  2KLF A;  2Z8F A;  3KZG A;  2B65 A;  1Y3P A;  3A09 A;  4IY6 A;  4EXK A;  1B3L A;  1M5E A;  3TEL A;  2GFE A;  4GFR A;  2I4C A;  4GLI A;  1Y9U A;  2RC7 A;  3FVK A;  2XXX A;  4YB7 A;  1FTK A;  2VP1 A;  3MVZ A;  4L17 A;  5KCJ A;  2M8C A;  4IO6 A;  2UVH A;  5BUU A;  3EN3 A;  3H3G A;  3CI8 A;  3KGC A;  1HSJ A;  3WAE A;  2I0C A;  3MWB A;  5CBS A;  1YPN A;  2DQV A;  1DPP A;  4IO4 A;  4U21 A;  3VLU A;  3T96 B;  4NF5 B;  5DTB A;  3KSX A;  2X7Q A;  2ZYN A;  5IAI A;  4FIM A;  4G8N A;  4LP2 B;  1P1O A;  4ZEF A;  3K6U A;  5CMK A;  1NL5 A;  3SDF A;  3IL1 B;  1URS A;  2PBW A;  1B51 A;  2PYY A;  4Q30 B;  3FXQ A;  1VR5 A;  1FQB A;  1N84 A;  2ZYM A;  3OO6 A;  4YKP A;  1ELJ A;  3C36 A;  3IOW A;  4ZE8 A;  4KFQ A;  3LUY A;  4WXJ A;  5ICT A;  4OET A;  1P1W A;  1B05 A;  3EHU A;  1YTV A;  4ISU A;  2F6G A;  4MLV A;  1B52 A;  4TOZ A;  2OWS A;  3LSW A;  2XHD A;  5JEI A;  3S9L C;  1SYH A;  3U8Q A;  3HN0 A;  2QL3 A;  5FHO A;  3FD3 A;  3FVO A;  5ITO A;  3U92 A;  4G4P A;  3N26 A;  2XXP A;  2OK2 A;  4ZZE A;  4H8I A;  1TFA A;  1POY 1;  2ONS A;  3VV5 A;  4NE4 A;  3BBR A;  1T0K A;  2R9J A;  1JVX A;  4OXV A;  2OBG A;  3T93 B;  2O84 X;  1Z7M E;  2HXW A;  4GL8 A;  4F3P A;  3GBB A;  4GIZ A;  1DPE A;  4ZE9 A;  4RK2 A;  4DXC A;  4BDR A;  5TP9 B;  4WKM A;  1ZTY A;  1VFE A;  3QUF A;  3IJO B;  4OVJ A;  1Y20 A;  2DVC A;  4POW A;  5AA4 A;  4IY5 A;  4F22 A;  3THI A;  3CSG A;  5CRY A;  3ONM A;  3V5A A;  1A55 A;  1H3D A;  4KQP A;  4U22 A;  4Z0I A;  3ZKL A;  2HEU A;  3OO9 A;  2ZYO A;  1IXG A;  4ELQ A;  3UIF A;  4EUO A;  4F19 A;  1MXW A;  3G3H A;  2BJJ X;  3LSL A;  3E4R A;  3GXA A;  2Q8J A;  1GR2 A;  3U94 A;  3PUY E;  4IO2 A;  4POX A;  1UTH A;  3V8X B;  2XX9 A;  4X9T A;  4NWC A;  1SQY A;  1II5 A;  3K4U A;  4KYS A;  4F3B A;  3A3U A;  3DP8 A;  3SEY A;  2FNC A;  2O69 A;  1PB9 A;  2P2A A;  3FAT A;  5LOM A;  4LZ7 A;  4F3G A;  4GXS B;  4OFO A;  4BDM A;  3T66 A;  4R74 A;  5DEX A;  1Y4C A;  4QSE A;  4GQO A;  1B4Z A;  5FTH A;  1XC1 A;  2DP8 A;  2D5W A;  3GLB A;  4TLL B;  4NF8 B;  2Z8D A;  3ZS6 A;  3DEL B;  4JXI A;  1CE2 A;  4YMA A;  3W9W A;  5KCJ B;  2OZZ A;  5KDT A;  4GWO A;  2RCA A;  2Z8E A;  1XVX A;  3IB1 A;  3VE1 B;  4YB6 A;  3W15 C;  4EQ9 A;  1N3X A;  3JV9 A;  4X48 A;  4OEN A;  3S9N C;  3FVG A;  2ONK E;  2ONR A;  3MP8 A;  4AQ4 A;  1LFI A;  2Z23 A;  1I6B A;  3O6H A;  1UTB A;  1N7W A;  3UP9 A;  1JNF A;  3C31 A;  4NF4 B;  2PT1 A;  3TTM A;  3OOA A;  1PB8 A;  2REJ A;  4ND9 A;  2VOZ A;  2F7A A;  2VD3 A;  5CBR A;  3TQL A;  3UA8 A;  2I48 A;  4LUB A;  2G29 A;  3M3K A;  2F5X A;  3K2D A;  1QUI A;  4OTE A;  5I56 B;  3OD7 A;  5L9M A;  3FJ7 A;  1B4H A;  4JWX A;  1MRP A;  3MJN A;  4OES A;  1USY H;  4PET A;  2DWA A;  1FW0 A;  5BWJ A;  3GZG A;  4IO5 A;  1TWY A;  3IB0 A;  3RUM A;  1R9Q A;  4ELP A;  5KZT A;  2DVZ A;  2R71 A;  2QPQ A;  1Y1Z A;  1FQA A;  2O7U A;  3E13 X;  4KPT A;  3RN8 A;  2H5Y A;  3VDF A;  2YJP A;  4BDO A;  1Y4T A;  4ELR A;  2GRV A;  4WED A;  4E0W A;  3MZB A;  3MVX A;  4GRK A;  2ABH A;  3MPK A;  1MQJ A;  4BDN A;  3TMG A;  3OEL A;  3IOR A;  1MY1 A;  4GD5 A;  1LB9 A;  1KWH A;  4XKQ A;  1ATG A;  4OQO A;  3VLV A;  1OLA A;  1USY E;  1NFT A;  4QFN A;  2V3Q A;  3O6G A;  2F78 A;  1FTL A;  1B32 A;  1B0L A;  3MVW A;  3HPI A;  1LFG A;  1NNF A;  3IOU A;  3CFL A;  1O63 A;  4RXL A;  3QUJ A;  1IIW A;  1ZLQ A;  2HCA A;  4LZ5 A;  1TXF A;  4LZ8 A;  4KCC A;  2HFB A;  2HAU A;  5AA4 B;  3DP6 A;  3QAX A;  3HHF A;  4H67 A;  4YB5 A;  3Q28 A;  4M4G A;  3FIR A;  1DTZ A;  4DLD A;  1SW4 A;  1TFD A;  4FAT A;  3H7M A;  4I1D A;  3RLF E;  1Q1K A;  3KN8 A;  1I6A A;  2ESN A;  2XXQ A;  1XT8 A;  3ZSF A;  3IB2 A;  3TEP A;  3VFJ A;  4EQ7 A;  3LSX A;  3OEK A;  3RT6 B;  1SI0 A;  5I59 A;  3O97 A;  3K6X A;  3U72 A;  1OVB A;  4ZEC A;  2F36 A;  5H8N B;  1MXU A;  1RYO A;  4QFP A; 
#chains in the Genus database with same CATH topology
 3H06 B;  3K1N A;  3KBZ A;  2EN4 A;  5FHN A;  5J1D A;  4OX9 E;  1LLS A;  3EHS A;  2L3C A;  4IGR A;  4ZYD A;  2NXO A;  3USD A;  4XKN A;  1IBM E;  4F2Q A;  4F18 A;  2FIX A;  5F3W A;  3MP6 A;  2JWO A;  2YSP A;  2QSX A;  1MS7 A;  2GQ1 A;  1LLM C;  5I57 B;  4YU0 A;  3KWR A;  3O6I A;  2YTO A;  5A6B A;  2CSH A;  1FJ9 A;  2UVG A;  1Z7N E;  2VPN A;  2XX8 A;  5FHM A;  5I5P A;  3H6V A;  2R6G E;  4YKI A;  3MQ9 A;  4ONY A;  5DEX B;  5DVJ A;  2K4V A;  1PEB A;  1B3E A;  4OFJ A;  4DV2 E;  2LT7 A;  4FAJ A;  3RQT A;  3FJM A;  2VT5 A;  4YAH X;  4F1Y A;  1SR9 A;  2CMO A;  1JP4 A;  3LBS A;  4IB2 A;  2AL4 A;  3EPK A;  1Z1B A;  1HSE A;  4PFY A;  3K6V A;  1DQ3 A;  1B40 A;  3O28 A;  4LFC E;  2EWL A;  2YRM A;  1KYQ A;  3IK6 B;  4DCY A;  4PC9 A;  2GLI A;  3ODB A;  2EPP A;  1URG A;  1JQF A;  4C0R A;  1OQG A;  4RK9 A;  4DDD A;  4QSD A;  3SKP A;  1AOV A;  3CRB A;  1SW2 A;  5EHM A;  1YYK A;  2EM6 A;  3SEW A;  1QU6 A;  1MM6 A;  1IMC A;  3D4C A;  2RS7 A;  2YLN A;  1EH6 A;  4HS7 A;  3MAM A;  4Q28 A;  1N3W A;  1MQG A;  1T4N A;  4DMI A;  1B69 A;  4OAN A;  2NAB A;  3RY3 A;  3AUZ A;  4WSG A;  4H46 A;  5EHS A;  4F6M A;  2Y84 A;  1US4 A;  2EN3 A;  1UTB B;  3SER A;  3VLW A;  3S2V A;  2HXR A;  2LUQ A;  3H6U A;  4G68 C;  1NH7 A;  4I9D A;  3CG3 A;  1JW5 A;  1AL3 A;  2EOQ A;  2DLK A;  4Q35 B;  2GH9 A;  5CMC A;  2GHA A;  2R76 A;  2YWQ A;  2ODR C;  1BKA A;  4WXC A;  2E1S A;  2F7B A;  1H45 A;  3B8B A;  1NUW A;  4F1U A;  1YYZ A;  1MPC A;  1X6F A;  1LFH A;  1YZ0 A;  3EPJ A;  4NHB A;  1LBC A;  2XD3 A;  2GHB A;  2ENA A;  4MF3 A;  4QSC A;  2FBP A;  3MHH C;  3MVY A;  4I3E A;  4F29 A;  1WDN A;  4YIC A;  3EPE A;  4BC7 A;  5HBC A;  1EZ9 A;  3PMV A;  3BIH A;  1MQD A;  4M2Z A;  3C4T A;  1P99 A;  3M3L A;  2DXY A;  4O3C A;  2VHA A;  3FUZ A;  4JI8 E;  2F35 A;  2WYK A;  5I2K A;  3EF7 A;  4DR7 E;  1T4O A;  1AAY A;  1N76 A;  5ESY A;  3R26 A;  2AIX A;  4JWY A;  4FEC A;  2PFY A;  4N6P A;  4OA4 A;  5EQA A;  3A3C A;  3TTN A;  4C1T A;  5AC4 A;  2HZL A;  4IO7 A;  4F54 A;  2CPN A;  5K2Y A;  4U1O A;  4M0V A;  4GL0 A;  2LMZ A;  4PFT A;  2PX1 A;  2IEE A;  3F11 A;  3C34 A;  3HV1 A;  4JYA E;  3VVE A;  5AA2 D;  4DKK A;  3VXC A;  4FE8 A;  1YXI A;  3VXB A;  2B7V A;  2OLB A;  3IWD A;  4ESX A;  3LSF B;  1B1X A;  2X26 A;  1BK4 A;  1AMF A;  4JSO A;  1PBQ A;  2N3G A;  3OML A;  3PPR A;  4PFU A;  3G3F A;  3ADL A;  5AE4 A;  5K2X A;  3UK4 A;  1L4S A;  4GBW A;  2QVR A;  1B3F A;  4F1V A;  5AA2 A;  4HW8 A;  4BBY A;  2JOB A;  4GVO A;  3IJX B;  4H45 A;  3V89 B;  1XOC A;  2PVU A;  4TUI A;  5M2V A;  2DS9 A;  1UIU A;  4P7D A;  1O64 A;  2H25 A;  1T38 A;  3MZ1 A;  1J1N A;  5I58 A;  4LF8 E;  1B6H A;  2FYI A;  1S9T A;  3M8U A;  3OO8 A;  4G8M A;  2GPI A;  3TTK A;  2DWI A;  4KYE A;  2DSY A;  1LAH E;  1MH3 A;  2XXI A;  2I49 A;  4OFL A;  4ZYG A;  4KHP E;  2WBU A;  4JWO A;  5IZ3 A;  3T1H E;  5AAS A;  1LBX A;  2EM4 A;  4YKJ A;  2WX9 A;  4P8B A;  5IGA A;  1NV0 A;  3K0V A;  3I5O A;  3TQM A;  1LAX A;  2REG A;  2EMI A;  1BIY A;  3J7Y p;  4OEV A;  4ZYE A;  5H8H A;  1OLC A;  2YTN A;  3RMP A;  1NCS A;  3OEM A;  2ODR D;  2QMW A;  2XXV A;  3C33 A;  2YTQ A;  4AS4 A;  2XD2 A;  4N17 A;  3UGW A;  3MZ9 A;  3T1B A;  5CC2 A;  2VRD A;  4F2O A;  4OHN A;  2FA7 A;  1AH5 A;  5DYH A;  1XI6 A;  4Q5T A;  4G68 A;  2XXK A;  5I59 B;  3U1O A;  4YKK A;  2L6M A;  2ZM6 E;  4UAB A;  1A99 A;  3KN7 A;  4I8C A;  1X6H A;  1EH3 A;  5KL6 A;  3TAJ A;  2QRY A;  3CVG A;  4I3Y A;  4R2R A;  2EM7 A;  2DYX A;  4OVR A;  1IQO A;  1FPL A;  2DIX A;  1M5F A;  2EN6 A;  5L8D A;  1FBF A;  2HHH E;  4XEQ A;  4JI5 E;  1G0H A;  4JDF A;  4LF7 E;  3KG2 A;  4DI4 B;  2Q9T A;  3HHG A;  1WRJ A;  4GWZ A;  4KD5 A;  1XMO E;  3TKD A;  4G2Z A;  5TU0 A;  2DE4 A;  1BTJ A;  4OMB A;  5H8F A;  2Q2A A;  3RNN A;  2V93 A;  3THN A;  1KA0 A;  5AC5 A;  1FBD A;  4TQU Q;  3PPQ A;  1FQE A;  2RC9 A;  1QUK A;  1NNK A;  4RPO A;  4XIG Q;  2UXB E;  3O29 A;  1IXH A;  4P1L A;  2EPA A;  3ADI A;  3FZV A;  3H4Z A;  3RT8 A;  1X5W A;  4R2S A;  5ISU A;  3N6T A;  1RYX A;  3MUQ A;  2NVU B;  2LVH A;  4UA8 A;  1JK1 A;  2OJT A;  4RJZ A;  1FTO A;  2NWJ A;  2LBS B;  2EP3 A;  2D3I A;  1R1N A;  2EMK A;  1FBH A;  4R6H A;  1D3K A;  3H03 A;  1H43 A;  2UXC E;  3PPP A;  1FQD A;  3TTL A;  1IZ1 A;  4N6K A;  3C35 A;  5L9S A;  4R75 A;  4ZZA A;  4IR8 A;  1NUY A;  2Y5L A;  2ZMB A;  3I3V A;  2DLQ A;  2EMC A;  4FJP A;  3JTZ A;  2QMX A;  3TCG A;  2CZL A;  4PFW A;  4N4U A;  4LTY A;  1MXZ A;  2PMS A;  4OWD A;  4DZ1 A;  1JET A;  1RMD A;  2I58 A;  3Q26 A;  2A5T A;  1O7T A;  5AE3 A;  4H5G A;  4X1B A;  3QK6 A;  2YRK A;  4QFK A;  4B3T E;  4N81 A;  1WOD A;  3L6G A;  1NH8 A;  4O3B A;  3ECR A;  2R1F A;  2V85 A;  4H0W A;  4JI6 E;  4JSD A;  3OTO E;  1BLF A;  2QFL A;  2Q8M A;  4PF8 A;  3L6H A;  4R9F A;  4WPY A;  1NV1 A;  2F8B A;  4R2P A;  2KHX A;  2XXR A;  4H5F A;  3FV1 A;  2L92 A;  1T4L B;  4I8O A;  1MY3 A;  5KL5 A;  4MNP A;  4C1U A;  1MEY C;  4JI2 E;  1RDX A;  4XTC Q;  2QVU A;  4M9V C;  3AV0 A;  3QYT A;  4KI0 E;  3G3G A;  3BBG A;  3IR1 A;  2FVZ A;  4R9G A;  2O7I A;  1LB8 A;  4X9J A;  2DOJ A;  2DE3 A;  4F39 A;  3KEI A;  5AA3 A;  5IKB A;  4KZS A;  2YTI A;  1XHY A;  4YMB A;  1GV8 A;  1OVT A;  2LAO A;  3KN3 A;  4MCO A;  1EH8 A;  5HM4 B;  1RKM A;  3E9X A;  3FXR A;  3UOR A;  4MH5 A;  3BF2 A;  4GXA A;  1EU8 A;  1FTM A;  1URD A;  3SES A;  1M5D A;  4HE1 A;  2THI A;  1B9J A;  4THI A;  5L9O A;  4FOR A;  2EL6 A;  4TLM B;  2ZZV A;  5IXM B;  4B3M E;  4F9A B;  3CR9 A;  1SW1 A;  3JAM C;  4ZEB A;  5AE2 A;  1M5C A;  4DIG A;  4LON B;  4G8H A;  4RYA A;  1X47 A;  1MY2 A;  5A5L A;  3FGS A;  3OSR A;  5AA2 B;  1OQH A;  4MHF A;  1FPG A;  3KBR A;  4DXB A;  3E3K A;  1STU A;  3D4G A;  1JK2 A;  3OMB A;  4R72 A;  3MP1 A;  1MDP 1;  3S4U A;  3PU5 A;  4MBP A;  4O3A A;  3DM0 A;  4X8W A;  1RDY A;  2P1S A;  1IXI A;  3QIM A;  2KON A;  1PC3 A;  2F34 A;  2JOX A;  5CMB A;  4ZDM A;  2EMH A;  2H4I A;  2EOZ A;  2HPG A;  3OO7 A;  3K6W A;  1B5I A;  2YTE A;  5TPA A;  3LML A;  2JP9 A;  3VYX A;  4P11 A;  3C9H A;  1P1N A;  3KC0 A;  4BHC A;  2EOY A;  4GOT A;  3TOD A;  5AA1 A;  1FQF A;  3K1P A;  3RTF B;  1DOT A;  2ZYK A;  2XWO A;  3K1M A;  3K01 A;  2EZ6 A;  2O51 A;  2V25 A;  5DVF A;  3PMX A;  1ZJL A;  2F97 A;  2FIE A;  2XXT A;  1D9V A;  2OWT A;  4RNS A;  5TSE A;  3VVD A;  2PT2 A;  3TFL A;  5LMU E;  4PBH A;  1N04 A;  4WSP A;  1S50 A;  2Q88 A;  4HTG A;  5CMM A;  2DMI A;  4OVQ A;  3LC8 A;  5I2N A;  4G68 B;  4L5N C;  1GVC A;  4YY3 E;  4G77 A;  3ZOQ B;  1IMB A;  4N8G A;  1LBW A;  4NXN E;  1NNT A;  2VQF E;  3DLN A;  4FBP A;  3R7X A;  4RA1 A;  3MPL A;  2F6P A;  1MPD A;  1GTK A;  3IWB A;  4ZS9 A;  2Q89 A;  4EDP A;  1XNR E;  1FBP A;  2ZZX A;  1PJQ A;  4O24 A;  2DWJ A;  4F9C B;  2Y7K A;  2I3V A;  1NNP A;  2RCB A;  2O1M A;  4LFB E;  4MNI A;  2EMG A;  2EPO A;  2QS2 A;  2G7H A;  2B3B A;  1UTH B;  1US5 A;  2E1M A;  3D1R A;  5IM2 A;  2VPO A;  4BDL A;  3IO6 A;  2V8Q B;  3DF6 A;  5H8F B;  3CSB A;  3PD8 A;  4JV5 E;  4KCD A;  4DI3 D;  2RKM A;  3O66 A;  5LLQ A;  4GBV A;  4XXU A;  3BFT A;  2RF1 A;  1NV5 A;  1N34 E;  4I62 A;  3SEU A;  2QS1 A;  2XXW A;  1BBG A;  3NOH A;  1LBB A;  4OOG C;  3PGF A;  3O2A A;  3T9U A;  4NED A;  1MQH A;  2MC5 A;  1IME A;  3F6G A;  3L00 A;  3KJ7 A;  2HJJ A;  3T9V A;  3MC2 A;  1EYK A;  3K02 A;  4QF9 A;  4U4S A;  3CFX A;  4JBZ A;  1I6Q A;  2EPU A;  2VQE E;  4X1D A;  4WX9 A;  2EMZ A;  2LJH A;  4LQ2 A;  1N7X A;  4M30 A;  2EOE A;  2YTG A;  2BB8 A;  5KDT B;  3HCQ A;  4R73 A;  2NUE A;  4EQB A;  2H98 A;  3FVN A;  5H8Q A;  1MXX A;  1ZBM A;  4QRZ A;  1OIB A;  3IFC A;  3TQW A;  4RPN A;  4KR5 A;  1MXV A;  2A5T B;  1I94 E;  1IMA A;  4LU9 A;  4O7M A;  3TCF A;  1GZ6 A;  2DB2 A;  2YT4 A;  1FKA E;  1I69 A;  4P3L A;  4F3S A;  1RC7 A;  4GZN C;  1JEU A;  4QFL A;  4DR1 E;  4HE0 A;  4KHZ E;  2Y7W A;  2LV2 A;  2I9I A;  4NF8 A;  4RY1 A;  1UBD C;  2EMY A;  2A5S A;  2EPX A;  3WAF A;  5EQ7 A;  3EPL A;  5IWA E;  2XX7 A;  1H44 A;  1QKB A;  3BFU A;  2EN2 A;  4R8O A;  3TCH A;  1IUD A;  3OEN A;  4HCW A;  1JW4 A;  2YTP A;  1HNX E;  2O68 A;  5ET8 A;  2YU5 A;  4NZV A;  2L33 A;  1QVS A;  3H6W A;  1GGG A;  2JJK A;  1SD3 A;  3J81 C;  3HST A;  2O6A A;  2EN8 A;  4O8M A;  4PE5 B;  1FRP A;  2EOO A;  4R2F A;  4EF1 A;  4B3R E;  5HPQ A;  1BB8 A;  2N8X A;  3B6T A;  3S9M C;  3I6V A;  1HR0 E;  3T1Y E;  1A54 A;  3IOV A;  1SBP A;  1FPI A;  4NF4 A;  2H9B A;  1MPB A;  1MGT A;  3RTW B;  3RGY A;  4NF6 A;  4IO3 A;  3G3I A;  4WEP A;  3PPN A;  2FV4 B;  4GEQ B;  2AL5 A;  4LF6 E;  1FPJ A;  4MFI A;  2DWH A;  1DCU A;  2Y7I A;  2ELZ A;  2HQ0 A;  3B6W A;  4NMY A;  3ILU B;  3TDJ A;  3EHT A;  4MAG A;  1ZU0 A;  4QBA A;  2EOS A;  5I56 A;  3KOT A;  2A25 A;  3C32 A;  3P7I A;  1SI1 A;  1UQW A;  2XXY A;  3HXL A;  2UVI A;  1FPK A;  2UXA A;  4ESW A;  4MEV A;  2ZNT A;  3AXF A;  1BP5 A;  3T9H B;  1B5J A;  4PDD A;  1SW5 A;  2WBS A;  2I0B A;  3CG1 A;  2E0S A;  2ZXT A;  4ELO A;  4QFO A;  4IJD A;  3BID A;  3B7D A;  1A1G A;  2VGQ A;  3PD9 A;  5FLX C;  4DV7 E;  4BDQ A;  5TPA B;  1YYO A;  3IFA A;  4R2E A;  4DR6 E;  4LFA E;  1X48 A;  1TF6 A;  3SET A;  1FTJ A;  1EYJ A;  2EPR A;  1D4N A;  1QGX A;  4I40 A;  2O1L A;  4PGN A;  3FV2 A;  1ZU1 A;  1ZIU A;  1VSO A;  4R2B A;  4IGT A;  2V84 A;  1EZO A;  1A1I A;  1IXC A;  1WVJ A;  3N5L A;  5F1Q A;  3PUV E;  3Q29 A;  5I2N B;  1ZMG A;  3PMW A;  1HSL A;  3KJT A;  1B2H A;  2XA5 A;  1B3H A;  2HAV A;  3O9P A;  4UAC A;  1PB7 A;  1DTG A;  2Z22 A;  3FXU A;  4JVC A;  1P47 A;  2ADR A;  1CB6 A;  4LN5 A;  4E0X A;  4R6K A;  2X7P A;  2MKD A;  2DE2 A;  3RPL A;  1NV7 A;  4AB5 A;  4O4K A;  3W9V A;  3QXM A;  1DMB A;  3VVF A;  2F4V E;  1Y3Q A;  2EOI A;  1Q35 A;  3B6Q A;  1JVY A;  4HE2 A;  1QJM A;  1EZP A;  4P56 A;  2L2M A;  1A8F A;  3SEV A;  2NOO A;  4MJO A;  4P1E A;  2OX3 A;  1QUJ A;  2LTS A;  1P1U A;  2QS4 A;  1G2D C;  1CNQ A;  5A5X A;  1QNT A;  1NV4 A;  4ECF A;  1NV6 A;  5LL6 R;  4HEI A;  2UVJ A;  1IMD A;  1IQ7 A;  1F2I G;  2LO3 A;  4K0K E;  1YUJ A;  4BC9 A;  4Q8R A;  1MM7 A;  1FSA A;  4DCX A;  2F8D A;  2W7Y A;  3FJG A;  1VFD A;  5DT6 A;  3MYU A;  4KYD A;  3KC1 A;  5CI5 A;  2EN7 A;  4ZEI A;  2ENC A;  4TUG A;  4FEB A;  2M4I A;  1A7L A;  5JTY A;  1S7Y A;  4U1Z A;  2F7C A;  2B9D A;  2L5V A;  3V83 A;  4X04 A;  3T22 A;  1FBE A;  4DXU A;  1EKZ A;  2XXH A;  2P3V A;  1M5B A;  4NX1 A;  3Q25 A;  5H8N A;  1G0I A;  5EQ9 A;  3IOT A;  1Q9D A;  3IAZ A;  2EL5 A;  5JK4 A;  1B1H A;  1FQC A;  1B58 A;  3PUX E;  4P0I A;  1QUL A;  2EOX A;  2B4L A;  5KL3 A;  2PRT A;  1OMP A;  5H8Q B;  5F7V A;  2WKY A;  3ZKK A;  2ALU A;  5ITP A;  1KA1 A;  4IS1 C;  4H6D A;  1YAE A;  5I57 A;  1AIV A;  4MIJ A;  4NGU A;  4N8Y A;  2EM8 A;  2UYE A;  1SVX B;  2RSI A;  4AS5 A;  4ZEK A;  1NKX A;  1LCF A;  3C4M A;  1XVY A;  2LCE A;  1B3G A;  4X62 E;  3PV0 E;  2DXR A;  4FED A;  5DVI A;  1TN9 A;  1MY4 A;  5I3S A;  1WHN A;  1Y3N A;  1PDA A;  1NMU A;  2V3U A;  3HTX A;  4PAI A;  4GWX A;  1QKA A;  1L5T A;  4NF0 A;  4R6Y A;  1MDQ A;  1MQI A;  5B7D A;  2V86 A;  1INP A;  3R6U A;  4U23 A;  2V3T A;  2ZNS A;  2FTX B;  2OCU A;  3LR1 A;  4KWY A;  3C6M A;  1YCJ A;  4GX4 A;  2HZK A;  3OSQ A;  2XXU A;  3UN6 A;  4O7I A;  5IV8 B;  4X66 E;  4LA9 A;  2RC8 A;  4YZZ A;  2M7Q A;  3DJW A;  3PPO A;  4ZED A;  1X3C A;  4XKP A;  2ENH A;  4NN3 A;  2EM0 A;  2AYS A;  3TPA A;  2YTJ A;  4GWS A;  2L3J A;  2P0S A;  2OWZ A;  4LAT A;  2EOF A;  4MLQ A;  4LF4 E;  1UIL A;  1B7H A;  1SDX A;  4DE8 A;  4JVI A;  1D9Y A;  3IX1 A;  1IBK E;  5I7I A;  4K3F A;  3TTR A;  2HHM A;  4J8Z A;  4PQJ A;  2BBG A;  2YRH A;  4BLA A;  1A1K A;  4N91 A;  3MW0 A;  1DSN A;  3OXN A;  5I2K B;  4NF6 B;  2D21 A;  4GWU A;  2L8T A;  3QSL A;  3TYH A;  5LMN E;  4DV1 E;  4LF9 E;  3S9E A;  1LAG E;  2RSM A;  2Q2C A;  3ADJ A;  2G93 A;  2WEF A;  5FTI A;  2QVV A;  1Y1M A;  2MDR A;  2YPN A;  4JB7 A;  3TZA A;  2QJE A;  1A8E A;  4NF5 A;  1BBO A;  1N36 E;  4AB6 A;  3H09 A;  4U4X A;  1NUX A;  5KL4 A;  3EKI A;  2EPL X;  4PE3 A;  2V89 A;  3LLH A;  3U93 A;  5CM6 A;  4N4R B;  2RIN A;  2K7I A;  3CFZ A;  3KSJ A;  4JI1 E;  1XNQ E;  2CT1 A;  1ZKB A;  3BKI B;  5CFF E;  3KFM A;  5F24 A;  1LGB C;  2I3W A;  5I58 B;  4NTL A;  1GQE A;  2YSO A;  1LBY A;  3HQ1 A;  5ET5 A;  2IHR 1;  4H65 A;  3Q27 A;  1JW1 A;  2NUV A;  1MH4 A;  5IZ3 B;  2EM3 A;  1IIT A;  1B5H A;  4EF2 A;  1TT1 A;  4Q0C A;  1SYI A;  1A1L A;  3IO4 A;  4Z7E A;  1UIV A;  2UYF A;  3PUW E;  1B46 A;  3G7W A;  2V88 A;  3K00 A;  2DMY A;  2CEX A;  3JZJ A;  1R6Z A;  4LQ5 A;  4NWD A;  5H8H B;  2EE8 A;  5ICQ A;  1IEJ A;  4X65 E;  1VE4 A;  5A2Q C;  2L2N A;  4GF8 A;  2D9H A;  3G3J A;  2LJU A;  1B7U A;  2ZNU A;  4PTK A;  2YU8 A;  3EPH A;  1LST A;  4ZYH A;  3RPL B;  2EPN A;  2DRP A;  4OVS A;  3ILT B;  1YSA C;  2NUG A;  1NV2 A;  5B70 A;  3E78 A;  2VD2 A;  1N0T A;  2EOH A;  1MY0 A;  4P0G A;  3G3K A;  3KOS A;  4OER A;  4HCY A;  3IWC A;  1QW0 A;  1G2F C;  1ZBQ A;  1B0H A;  3FAS A;  4DUY E;  5ET6 A;  5A5X B;  4N13 A;  2WCC 3;  3EQ1 A;  2MDG A;  1JEV A;  1FCK A;  3RPW A;  4OEU A;  3B50 A;  1PJS A;  3PUZ E;  5TP9 A;  2PCR A;  2DSF A;  5AE1 A;  1MG1 A;  2EMW A;  1B7Z A;  3HPS A;  2JY9 A;  1F9B A;  3E79 A;  3CIJ A;  2XWI A;  2Y7P A;  4XKR A;  1LAF E;  3A29 A;  5EYF A;  2B3F A;  3F6H A;  5I84 A;  4H8J A;  1PBP A;  5JTY B;  2J7J A;  1DK4 A;  4XF5 A;  2IA4 A;  2QS3 A;  1FPE A;  1X6E A;  5H8S A;  2KQZ A;  5ELV A;  3H6T A;  2KR0 A;  1HNZ E;  3T0J A;  2I13 A;  1O0W A;  3MBP A;  2EQ0 A;  2KOU A;  4DR4 E;  4U2R A;  1ANF A;  5A6B D;  4N07 A;  2EMF A;  2F3D A;  1FPB A;  3RYD A;  2JR1 A;  5KL2 A;  4H1X A;  4HXV A;  1FPF A;  1LCT A;  3JYR A;  4OZ9 A;  3TUS A;  4PP0 A;  1IBL E;  2Y7R A;  4QHQ A;  3FBP A;  2H99 A;  2PFZ A;  1R9L A;  2YTD A;  1DBZ A;  3HO7 A;  1XS5 A;  2I4B A;  4OYV A;  2V4C A;  3M3F A;  4EXL A;  4F31 B;  4WYQ B;  4M1V A;  2I6E A;  3DP4 A;  4O94 A;  1N33 E;  1A40 A;  1POT A;  3SEX A;  1H76 A;  3N6U A;  3N94 A;  1P1Q A;  4LVQ A;  1MXY A;  1UHZ A;  4PF6 A;  1FBC A;  3ADG A;  5EYG A;  2ANJ A;  3T9X B;  3GBA A;  2KLF A;  2Z8F A;  3KZG A;  4GX6 A;  5LDZ A;  4DV4 E;  1WJP A;  1Y3P A;  2B65 A;  3A09 A;  3HFU A;  2B7T A;  4IY6 A;  2UU9 E;  4EXK A;  2VF1 A;  1B3L A;  1M5E A;  4O43 A;  4DR5 E;  3TEL A;  2GFE A;  4GFR A;  2I4C A;  4GKJ E;  4GLI A;  1Y9U A;  2RC7 A;  3FVK A;  2XXX A;  4YB7 A;  4XFE A;  5LTC A;  2F3B A;  1FTK A;  2JVA A;  2VP1 A;  3MVZ A;  1IQS A;  3GYY A;  2EQ3 A;  3C6K A;  2NA2 A;  2CZK A;  4L17 A;  4P78 A;  5KCJ A;  1KZ8 A;  4PFR A;  2WBB A;  2EPC A;  2YTF A;  2M8C A;  1YZ9 A;  4IO6 A;  2EJ4 A;  2CEY A;  2UVH A;  5BUU A;  3EN3 A;  2HGH A;  3H3G A;  3CI8 A;  2MC6 A;  3KGC A;  1HSJ A;  3WAE A;  1DGC A;  2I0C A;  2XWK A;  3MWB A;  5CBS A;  1YPN A;  2HC5 A;  2UUA E;  4R03 A;  2DQV A;  4MNC A;  1YFH A;  1DPP A;  1LEV A;  4IO4 A;  4U21 A;  2EQ1 A;  3PTY A;  3VLU A;  1HNW E;  4BCA A;  4GKK E;  3T96 B;  4NF5 B;  5DTB A;  3KSX A;  2X7Q A;  2ZYN A;  2DDK A;  5IAI A;  3JU0 A;  5KL7 A;  1A1F A;  4FIM A;  2LTR A;  2EOJ A;  4GWW A;  4G8N A;  4LP2 B;  4NAP A;  4PGP A;  1P1O A;  1RDZ A;  4ZEF A;  1FJ6 A;  3K6U A;  5CMK A;  5A6J A;  1NL5 A;  3SDF A;  1SFE A;  1URS A;  3IL1 B;  2UUB E;  1B51 A;  2PBW A;  2PYY A;  4FK5 C;  4Q30 B;  3FXQ A;  4NQ8 A;  1VR5 A;  4RH8 A;  1FQB A;  1N84 A;  2ZYM A;  3OO6 A;  4YKP A;  1ELJ A;  2M1S A;  4JI7 E;  3C36 A;  1LBV A;  3IOW A;  4ZE8 A;  4KFQ A;  2WBT A;  3LUY A;  5FBP A;  4WXJ A;  2E72 A;  5ICT A;  3C4B A;  5IT9 C;  1P1W A;  4N6D A;  4OET A;  1B05 A;  3EHU A;  1YTV A;  4ISU A;  2DGC A;  2F6G A;  4DV6 E;  2Y5K A;  4MLV A;  1B52 A;  4TOZ A;  1NV3 A;  2Q8U A;  2OWS A;  3LSW A;  2XHD A;  5JEI A;  3S9L C;  4O5G A;  1SYH A;  3U8Q A;  2E5L E;  3HN0 A;  4DUZ E;  2QL3 A;  3QMF A;  5FHO A;  4QXD A;  2P3N A;  3FD3 A;  3FVO A;  5ITO A;  2ZZW A;  2N3H A;  3U92 A;  4G4P A;  2UXD E;  3N26 A;  1D9Q A;  2XXP A;  2OK2 A;  4ZZE A;  4H8I A;  4PDH A;  4KXP A;  1TFA A;  1XMQ E;  1POY 1;  2ONS A;  3VV5 A;  4NE4 A;  3BBR A;  1T0K A;  4F2J C;  2EMA A;  4P47 A;  2R9J A;  1JVX A;  4OXV A;  2OBG A;  4DR2 E;  3T93 B;  2O84 X;  1Z7M E;  2HXW A;  4GL8 A;  2EPM X;  4F3P A;  1FBG A;  3GBB A;  4GIZ A;  1DPE A;  4ZE9 A;  4RK2 A;  2Q74 A;  2R8T A;  4DXC A;  4BDR A;  5TP9 B;  1SPI A;  4OVP A;  4WKM A;  1ZTY A;  3KZZ A;  2RTX A;  1VFE A;  4NG7 A;  3QUF A;  2RQL A;  3IJO B;  4OVJ A;  2EPK X;  1Y20 A;  2DVC A;  4POW A;  2ELY A;  2CZH A;  2LUP B;  5AA4 A;  1IMU A;  2RPC A;  4IY5 A;  4DV5 E;  4F22 A;  5T6J A;  3THI A;  4BHB A;  3CSG A;  5CRY A;  3ONM A;  3V5A A;  4DV0 E;  1A55 A;  1H3D A;  4KQP A;  4U22 A;  4Z0I A;  2L2K B;  3ZKL A;  2B3T B;  2HEU A;  1IMF A;  3OO9 A;  2EPZ A;  2ZYO A;  1IXG A;  4ELQ A;  2CZI A;  3K6Q A;  3KZY A;  3UIF A;  4EUO A;  4F19 A;  3HPZ A;  1MXW A;  3G3H A;  4OVT A;  3P1X A;  2BJJ X;  4NHR A;  3LSL A;  3E4R A;  3LUZ A;  3SZP A;  2EMB A;  2H36 X;  4JI3 E;  3GXA A;  1T39 A;  2MKZ A;  2Q8J A;  1GR2 A;  3U94 A;  3PUY E;  4IO2 A;  2EM2 A;  4POX A;  1UTH A;  3CHG A;  4GX3 A;  3V8X B;  2YZT A;  1NUZ A;  2XX9 A;  4X9T A;  4P9K A;  4NWC A;  2JPA A;  1SQY A;  4RHB B;  1II5 A;  3K4U A;  4KYS A;  4F3B A;  3A3U A;  3DP8 A;  3SEY A;  2FNC A;  2O69 A;  3MHS C;  1PB9 A;  2P2A A;  3FAT A;  5LOM A;  4LZ7 A;  4F3G A;  4GXS B;  2EMX A;  4OFO A;  2V87 A;  4BDM A;  4L8N A;  3T66 A;  1LBZ A;  1AWB A;  4R74 A;  4F9B B;  5DEX A;  2UUC E;  1Y4C A;  4QSE A;  4GQO A;  1B4Z A;  4DR3 E;  1DI2 A;  5FTH A;  1YUI A;  4WXD A;  4YHH E;  1XC1 A;  2DP8 A;  3FXB A;  1N3G A;  2D5W A;  3GLB A;  4TLL B;  4NF8 B;  2FGG A;  2Z8D A;  1RQ0 A;  3ZS6 A;  4AQY E;  3DEL B;  4BS9 A;  4PBQ A;  4JXI A;  5EYH A;  1CE2 A;  4YMA A;  3W9W A;  3UK3 C;  4LF5 E;  5KCJ B;  2OZZ A;  5KDT A;  4GWO A;  2RCA A;  1J5E E;  2Z8E A;  1XVX A;  5EQ8 A;  3IB1 A;  3VE1 B;  4YB6 A;  3BGH A;  3W15 C;  4EQ9 A;  1N3X A;  3JV9 A;  4X48 A;  4OEN A;  3S9N C;  1EYI A;  1FJG E;  1FTA A;  5ET7 A;  3FVG A;  2ONK E;  1K9Z A;  2ONR A;  3MP8 A;  4AQ4 A;  1LFI A;  2Z23 A;  1I6B A;  4R2Q A;  3O6H A;  1UTB A;  1N7W A;  3UP9 A;  1JNF A;  3C31 A;  2EM9 A;  4NF4 B;  2PT1 A;  2LE2 A;  3TTM A;  3OOA A;  1PB8 A;  2M9A A;  2EL4 A;  2REJ A;  2BJI A;  4ND9 A;  2EN1 A;  2VOZ A;  2F7A A;  2VD3 A;  5A69 A;  2RS6 A;  5CBR A;  3TQL A;  3LV0 A;  3UA8 A;  2I48 A;  4LUB A;  4G61 A;  4PFB A;  2VE7 C;  2G29 A;  3M3K A;  1ZBT A;  2V83 A;  2F5X A;  2EOM A;  3K2D A;  1QUI A;  4OTE A;  5I56 B;  4NXM E;  3OD7 A;  5L9M A;  1NI9 A;  3FJ7 A;  5IZ1 A;  4PCD A;  1B4H A;  4JWX A;  2JYA A;  1J26 A;  1MRP A;  3MJN A;  4OES A;  1USY H;  4PET A;  2DWA A;  1FW0 A;  3THO B;  4MMP A;  5BWJ A;  3GZG A;  4IO5 A;  1TWY A;  3IB0 A;  3ISP A;  3RUM A;  3QG5 C;  1R9Q A;  4ELP A;  1TF3 A;  5KZT A;  2DVZ A;  2R71 A;  2QPQ A;  1Y1Z A;  1FQA A;  4F6N A;  2O7U A;  2FHY A;  3J80 C;  3E13 X;  4R2A A;  4KPT A;  3ROJ A;  4JVD A;  3RN8 A;  2H5Y A;  5J16 A;  3VDF A;  1ZR9 A;  1N32 E;  2YJP A;  5A6K A;  4BDO A;  1Y4T A;  2EM5 A;  2WZO A;  1UN6 B;  2GRV A;  4ELR A;  4WED A;  4E0W A;  3J7A G;  3MSW A;  3MZB A;  2LRS A;  4X64 E;  4DV3 E;  3MVX A;  1FPD A;  4GRK A;  2XWV A;  4R2D A;  2ABH A;  3FIG A;  1PKP A;  3MPK A;  1MQJ A;  4BDN A;  3TMG A;  3OEL A;  3IOR A;  4BMJ A;  1MY1 A;  4GD5 A;  4X8R A;  1LB9 A;  1X49 A;  1KWH A;  4XKQ A;  1EH7 A;  1ATG A;  4OQO A;  3VLV A;  1OLA A;  5IZZ A;  1VDW A;  3U65 A;  1USY E;  3VYY A;  4PFI A;  1NFT A;  2JXP A;  4QFN A;  3MST A;  4N15 A;  2V3Q A;  3O6G A;  3VHT B;  5T3J A;  2F78 A;  2NUF A;  1FTL A;  1B32 A;  2WBD A;  1A1H A;  1B0L A;  3MVW A;  4MX6 A;  2EML A;  3HPI A;  1LFG A;  4R2C A;  1NNF A;  1WXR A;  3IOU A;  3CFL A;  4WFT A;  1O63 A;  4RXL A;  3QUJ A;  1IIW A;  1ZLQ A;  1NEI A;  1ZAA C;  1A1J A;  2HCA A;  4LZ5 A;  4PAF A;  1WHQ A;  1TXF A;  4LZ8 A;  4KCC A;  1YYW A;  2HFB A;  2HAU A;  5DW8 A;  5AA4 B;  5ADZ A;  5A6A A;  1KJK A;  3M99 B;  2B4M A;  3DP6 A;  5BR8 E;  3HHF A;  3QAX A;  4H67 A;  4YB5 A;  2WYP A;  4GWY A;  3Q28 A;  4M4G A;  3FIR A;  1DTZ A;  2MKN A;  4DLD A;  1SW4 A;  1TFD A;  4FAT A;  3H7M A;  4I1D A;  3RLF E;  1Q1K A;  3KN8 A;  1I6A A;  2ESN A;  4JI0 E;  3VK6 A;  2XXQ A;  1XT8 A;  3ZSF A;  3IB2 A;  3TEP A;  4JI4 E;  2EOR A;  1K9Y A;  3VFJ A;  4EQ7 A;  3LSX A;  3OEK A;  3RT6 B;  1SI0 A;  5I59 A;  3O97 A;  1PJT A;  3BIG A;  2GHF A;  3K6X A;  5DNY A;  2CTD A;  3U72 A;  1OVB A;  4ZEC A;  2F36 A;  5H8N B;  1MXU A;  4B3S E;  1RYO A;  4PAK A;  4QFP A; 
#chains in the Genus database with same CATH homology
 3H06 B;  3K1N A;  5FHN A;  5J1D A;  1LLS A;  3EHS A;  4IGR A;  2NXO A;  3USD A;  4XKN A;  4F2Q A;  4F18 A;  3MP6 A;  2QSX A;  1MS7 A;  5I57 B;  4YU0 A;  3O6I A;  2UVG A;  1Z7N E;  2XX8 A;  5FHM A;  3H6V A;  2R6G E;  4YKI A;  3MQ9 A;  4ONY A;  5DEX B;  5DVJ A;  1PEB A;  1B3E A;  4OFJ A;  4FAJ A;  3RQT A;  3FJM A;  4YAH X;  4F1Y A;  2CMO A;  3LBS A;  4IB2 A;  2AL4 A;  1HSE A;  4PFY A;  3K6V A;  1B40 A;  3O28 A;  3IK6 B;  4DCY A;  3ODB A;  1URG A;  1JQF A;  4C0R A;  1OQG A;  4RK9 A;  4DDD A;  4QSD A;  3SKP A;  1AOV A;  3CRB A;  1SW2 A;  5EHM A;  3SEW A;  1MM6 A;  3D4C A;  2YLN A;  4HS7 A;  3MAM A;  1N3W A;  1MQG A;  3RY3 A;  5EHS A;  2Y84 A;  1US4 A;  1UTB B;  3SER A;  3VLW A;  3S2V A;  3H6U A;  4G68 C;  1NH7 A;  4I9D A;  3CG3 A;  1JW5 A;  1AL3 A;  2GH9 A;  5CMC A;  2GHA A;  1BKA A;  2E1S A;  2F7B A;  1H45 A;  4F1U A;  1MPC A;  1LFH A;  1LBC A;  2XD3 A;  2GHB A;  4MF3 A;  4QSC A;  3MVY A;  4F29 A;  1WDN A;  4YIC A;  3EPE A;  5HBC A;  1EZ9 A;  3PMV A;  1MQD A;  1P99 A;  3M3L A;  2DXY A;  4O3C A;  2VHA A;  3FUZ A;  2F35 A;  5I2K A;  3EF7 A;  1N76 A;  3R26 A;  2AIX A;  4JWY A;  4FEC A;  4N6P A;  3TTN A;  4C1T A;  3A3C A;  2HZL A;  4IO7 A;  5K2Y A;  4U1O A;  4GL0 A;  4PFT A;  2PX1 A;  2IEE A;  3F11 A;  3C34 A;  3HV1 A;  5AA2 D;  3VVE A;  3VXC A;  4FE8 A;  3VXB A;  2OLB A;  4ESX A;  3LSF B;  1B1X A;  2X26 A;  1AMF A;  4JSO A;  1PBQ A;  3PPR A;  4PFU A;  3G3F A;  5AE4 A;  5K2X A;  3UK4 A;  1B3F A;  4F1V A;  5AA2 A;  4HW8 A;  4GVO A;  3IJX B;  3V89 B;  1XOC A;  2PVU A;  5M2V A;  2DS9 A;  1UIU A;  1O64 A;  2H25 A;  3MZ1 A;  1J1N A;  5I58 A;  1B6H A;  2FYI A;  1S9T A;  3M8U A;  3OO8 A;  4G8M A;  3TTK A;  2DWI A;  4KYE A;  1LAH E;  1MH3 A;  2XXI A;  2I49 A;  4OFL A;  4JWO A;  4YKJ A;  3K0V A;  3I5O A;  1LAX A;  2REG A;  1BIY A;  4OEV A;  5H8H A;  1OLC A;  3OEM A;  2QMW A;  2XXV A;  3C33 A;  2XD2 A;  3UGW A;  3MZ9 A;  5CC2 A;  4F2O A;  4OHN A;  2FA7 A;  1AH5 A;  5DYH A;  4Q5T A;  4G68 A;  5I59 B;  3U1O A;  4YKK A;  1A99 A;  3KN7 A;  4I8C A;  1EH3 A;  3TAJ A;  2QRY A;  3CVG A;  2DYX A;  1M5F A;  5L8D A;  4JDF A;  3KG2 A;  2Q9T A;  3HHG A;  4KD5 A;  3TKD A;  4G2Z A;  5TU0 A;  2DE4 A;  1BTJ A;  4OMB A;  5H8F A;  2Q2A A;  3RNN A;  2V93 A;  4TQU Q;  3PPQ A;  1FQE A;  2RC9 A;  1QUK A;  1NNK A;  4RPO A;  4XIG Q;  3O29 A;  1IXH A;  3RT8 A;  3FZV A;  3H4Z A;  5ISU A;  3N6T A;  1RYX A;  3MUQ A;  2NVU B;  4UA8 A;  2OJT A;  4RJZ A;  1FTO A;  2NWJ A;  2D3I A;  1R1N A;  4R6H A;  1D3K A;  3H03 A;  1H43 A;  3PPP A;  1FQD A;  3TTL A;  1IZ1 A;  3C35 A;  5L9S A;  4R75 A;  4ZZA A;  2ZMB A;  3I3V A;  4FJP A;  2QMX A;  3TCG A;  2CZL A;  4PFW A;  1MXZ A;  2PMS A;  4OWD A;  4DZ1 A;  1JET A;  2I58 A;  3Q26 A;  2A5T A;  1O7T A;  4H5G A;  4X1B A;  3QK6 A;  4QFK A;  1WOD A;  3L6G A;  1NH8 A;  4O3B A;  3ECR A;  4H0W A;  4JSD A;  1BLF A;  4R9F A;  3L6H A;  2XXR A;  4H5F A;  3FV1 A;  1MY3 A;  4C1U A;  4XTC Q;  3QYT A;  4KI0 E;  3G3G A;  3IR1 A;  4R9G A;  2O7I A;  1LB8 A;  2DOJ A;  4F39 A;  2DE3 A;  5AA3 A;  3KEI A;  5IKB A;  1XHY A;  4YMB A;  1GV8 A;  1OVT A;  2LAO A;  3KN3 A;  5HM4 B;  1RKM A;  3E9X A;  3FXR A;  3UOR A;  4MH5 A;  4GXA A;  1EU8 A;  1FTM A;  1URD A;  3SES A;  1M5D A;  2THI A;  1B9J A;  4THI A;  5L9O A;  4FOR A;  4TLM B;  3CR9 A;  1SW1 A;  4ZEB A;  1M5C A;  4DIG A;  4LON B;  4G8H A;  4RYA A;  1MY2 A;  3FGS A;  3OSR A;  5AA2 B;  1OQH A;  3KBR A;  4DXB A;  3E3K A;  3D4G A;  3OMB A;  4R72 A;  3MP1 A;  1MDP 1;  3S4U A;  3PU5 A;  4MBP A;  4O3A A;  3DM0 A;  2P1S A;  1IXI A;  3QIM A;  1PC3 A;  2F34 A;  5CMB A;  4ZDM A;  2H4I A;  3OO7 A;  3K6W A;  1B5I A;  5TPA A;  4P11 A;  3C9H A;  1P1N A;  4GOT A;  3TOD A;  5AA1 A;  1FQF A;  3K1P A;  3RTF B;  1DOT A;  2ZYK A;  3K1M A;  3K01 A;  2O51 A;  2V25 A;  5DVF A;  3PMX A;  1ZJL A;  2F97 A;  2XXT A;  4RNS A;  1D9V A;  2OWT A;  3VVD A;  2PT2 A;  3TFL A;  1N04 A;  1S50 A;  2Q88 A;  4HTG A;  5CMM A;  3LC8 A;  5I2N A;  4G68 B;  1GVC A;  4G77 A;  1NNT A;  3DLN A;  3R7X A;  4RA1 A;  3MPL A;  2F6P A;  1MPD A;  1GTK A;  4ZS9 A;  2Q89 A;  4EDP A;  2DWJ A;  2Y7K A;  2I3V A;  1NNP A;  2RCB A;  2O1M A;  2QS2 A;  2B3B A;  1UTH B;  1US5 A;  4BDL A;  3IO6 A;  5H8F B;  3CSB A;  3PD8 A;  4KCD A;  2RKM A;  3O66 A;  4XXU A;  3BFT A;  2RF1 A;  4I62 A;  3SEU A;  2QS1 A;  2XXW A;  1LBB A;  3PGF A;  3O2A A;  3T9U A;  4NED A;  1MQH A;  3KJ7 A;  3T9V A;  3MC2 A;  3K02 A;  4QF9 A;  4U4S A;  3CFX A;  4JBZ A;  1I6Q A;  4X1D A;  4LQ2 A;  1N7X A;  5KDT B;  3HCQ A;  4R73 A;  4EQB A;  2H98 A;  3FVN A;  5H8Q A;  1MXX A;  1ZBM A;  4QRZ A;  1OIB A;  3TQW A;  4RPN A;  4KR5 A;  1MXV A;  2A5T B;  3TCF A;  4F3S A;  1I69 A;  1JEU A;  4QFL A;  4KHZ E;  2Y7W A;  4NF8 A;  4RY1 A;  2A5S A;  3WAF A;  2XX7 A;  1H44 A;  1QKB A;  3BFU A;  3TCH A;  1IUD A;  3OEN A;  4HCW A;  1JW4 A;  2O68 A;  1QVS A;  3H6W A;  1GGG A;  1SD3 A;  3HST A;  2O6A A;  4PE5 B;  4R2F A;  4EF1 A;  5HPQ A;  3B6T A;  3S9M C;  3I6V A;  1A54 A;  3IOV A;  1SBP A;  4NF4 A;  2H9B A;  1MPB A;  3RTW B;  3RGY A;  4NF6 A;  4IO3 A;  3G3I A;  4WEP A;  3PPN A;  2AL5 A;  4MFI A;  2DWH A;  2Y7I A;  2HQ0 A;  3B6W A;  4NMY A;  3ILU B;  3TDJ A;  3EHT A;  1ZU0 A;  5I56 A;  3KOT A;  3P7I A;  3C32 A;  1SI1 A;  1UQW A;  2XXY A;  2UVI A;  2UXA A;  4ESW A;  2ZNT A;  3AXF A;  1BP5 A;  3T9H B;  1B5J A;  1SW5 A;  2I0B A;  3CG1 A;  2E0S A;  2ZXT A;  4ELO A;  4QFO A;  3B7D A;  2VGQ A;  3PD9 A;  4BDQ A;  5TPA B;  3SET A;  1FTJ A;  1D4N A;  2O1L A;  3FV2 A;  1ZIU A;  1VSO A;  4R2B A;  4IGT A;  2V84 A;  1EZO A;  1IXC A;  1WVJ A;  3N5L A;  5F1Q A;  3PUV E;  3Q29 A;  5I2N B;  1ZMG A;  3PMW A;  1HSL A;  3KJT A;  1B2H A;  1B3H A;  2HAV A;  3O9P A;  4UAC A;  1PB7 A;  1DTG A;  2Z22 A;  3FXU A;  1CB6 A;  4E0X A;  4R6K A;  2X7P A;  2DE2 A;  4AB5 A;  3W9V A;  3QXM A;  1DMB A;  3VVF A;  1Y3Q A;  1Q35 A;  3B6Q A;  1JVY A;  1QJM A;  1EZP A;  1A8F A;  3SEV A;  2NOO A;  1QUJ A;  1P1U A;  2QS4 A;  5A5X A;  4ECF A;  2UVJ A;  1IQ7 A;  4Q8R A;  1MM7 A;  4DCX A;  2F8D A;  2W7Y A;  3FJG A;  1VFD A;  5DT6 A;  4KYD A;  5CI5 A;  4ZEI A;  4FEB A;  1A7L A;  5JTY A;  1S7Y A;  4U1Z A;  2F7C A;  3V83 A;  3T22 A;  4DXU A;  2XXH A;  1M5B A;  3Q25 A;  5H8N A;  3IOT A;  3IAZ A;  5JK4 A;  1B1H A;  1FQC A;  1B58 A;  3PUX E;  4P0I A;  1QUL A;  1OMP A;  5H8Q B;  5F7V A;  2WKY A;  3ZKK A;  2ALU A;  5ITP A;  4H6D A;  1YAE A;  5I57 A;  1AIV A;  2UYE A;  1SVX B;  4ZEK A;  1NKX A;  1LCF A;  3C4M A;  1XVY A;  1B3G A;  3PV0 E;  2DXR A;  4FED A;  5DVI A;  1MY4 A;  1Y3N A;  1PDA A;  1NMU A;  2V3U A;  1QKA A;  1L5T A;  4R6Y A;  1MDQ A;  1MQI A;  5B7D A;  3R6U A;  4U23 A;  2V3T A;  2ZNS A;  2OCU A;  3LR1 A;  1YCJ A;  2HZK A;  3OSQ A;  2XXU A;  3UN6 A;  4LA9 A;  2RC8 A;  4YZZ A;  3PPO A;  4ZED A;  4XKP A;  2AYS A;  3TPA A;  2P0S A;  4LAT A;  4MLQ A;  1B7H A;  1SDX A;  4DE8 A;  1D9Y A;  3IX1 A;  4K3F A;  3TTR A;  4PQJ A;  4BLA A;  3MW0 A;  1DSN A;  3OXN A;  5I2K B;  4NF6 B;  2D21 A;  3TYH A;  3QSL A;  3S9E A;  1LAG E;  2Q2C A;  2G93 A;  5FTI A;  1Y1M A;  2YPN A;  4JB7 A;  3TZA A;  2QJE A;  1A8E A;  4NF5 A;  4AB6 A;  4U4X A;  3U93 A;  5CM6 A;  2RIN A;  3CFZ A;  3KSJ A;  1ZKB A;  3BKI B;  3KFM A;  1LGB C;  2I3W A;  5I58 B;  4NTL A;  4H65 A;  3Q27 A;  1JW1 A;  2NUV A;  1MH4 A;  1IIT A;  1B5H A;  4EF2 A;  1TT1 A;  4Q0C A;  1SYI A;  3IO4 A;  4Z7E A;  1UIV A;  2UYF A;  3PUW E;  1B46 A;  3G7W A;  3K00 A;  3JZJ A;  1R6Z A;  4LQ5 A;  4NWD A;  5H8H B;  5ICQ A;  1IEJ A;  1VE4 A;  4GF8 A;  3G3J A;  1B7U A;  2ZNU A;  1LST A;  3ILT B;  5B70 A;  2VD2 A;  1N0T A;  1MY0 A;  4P0G A;  3G3K A;  3KOS A;  4OER A;  4HCY A;  1QW0 A;  1B0H A;  3FAS A;  5A5X B;  4N13 A;  3EQ1 A;  1JEV A;  1FCK A;  3RPW A;  4OEU A;  3PUZ E;  5TP9 A;  2DSF A;  1MG1 A;  1B7Z A;  1F9B A;  3CIJ A;  2Y7P A;  4XKR A;  1LAF E;  5EYF A;  2B3F A;  5I84 A;  4H8J A;  1PBP A;  5JTY B;  2IA4 A;  2QS3 A;  5H8S A;  5ELV A;  3H6T A;  3MBP A;  4U2R A;  1ANF A;  4N07 A;  4H1X A;  3JYR A;  1LCT A;  3TUS A;  4OZ9 A;  4PP0 A;  2Y7R A;  4QHQ A;  2H99 A;  1R9L A;  3HO7 A;  1XS5 A;  2I4B A;  4OYV A;  4EXL A;  3M3F A;  4F31 B;  4M1V A;  2I6E A;  3DP4 A;  1A40 A;  1POT A;  3SEX A;  1H76 A;  3N6U A;  3N94 A;  1P1Q A;  4LVQ A;  1MXY A;  2ANJ A;  3T9X B;  3GBA A;  2KLF A;  2Z8F A;  3KZG A;  2B65 A;  1Y3P A;  3A09 A;  4IY6 A;  4EXK A;  1B3L A;  1M5E A;  3TEL A;  2GFE A;  4GFR A;  2I4C A;  4GLI A;  1Y9U A;  2RC7 A;  3FVK A;  2XXX A;  4YB7 A;  1FTK A;  2VP1 A;  3MVZ A;  4L17 A;  5KCJ A;  2M8C A;  4IO6 A;  2UVH A;  5BUU A;  3EN3 A;  3H3G A;  3CI8 A;  3KGC A;  1HSJ A;  3WAE A;  2I0C A;  3MWB A;  5CBS A;  1YPN A;  2DQV A;  1DPP A;  4IO4 A;  4U21 A;  3VLU A;  3T96 B;  4NF5 B;  5DTB A;  3KSX A;  2X7Q A;  2ZYN A;  5IAI A;  4FIM A;  4G8N A;  4LP2 B;  1P1O A;  4ZEF A;  3K6U A;  5CMK A;  1NL5 A;  3SDF A;  3IL1 B;  1URS A;  2PBW A;  1B51 A;  2PYY A;  4Q30 B;  3FXQ A;  1VR5 A;  1FQB A;  1N84 A;  2ZYM A;  3OO6 A;  4YKP A;  1ELJ A;  3C36 A;  3IOW A;  4ZE8 A;  4KFQ A;  3LUY A;  4WXJ A;  5ICT A;  4OET A;  1P1W A;  1B05 A;  3EHU A;  1YTV A;  4ISU A;  2F6G A;  4MLV A;  1B52 A;  4TOZ A;  2OWS A;  3LSW A;  2XHD A;  5JEI A;  3S9L C;  1SYH A;  3U8Q A;  3HN0 A;  2QL3 A;  5FHO A;  3FD3 A;  3FVO A;  5ITO A;  3U92 A;  4G4P A;  3N26 A;  2XXP A;  2OK2 A;  4ZZE A;  4H8I A;  1TFA A;  1POY 1;  2ONS A;  3VV5 A;  4NE4 A;  3BBR A;  1T0K A;  2R9J A;  1JVX A;  4OXV A;  2OBG A;  3T93 B;  2O84 X;  1Z7M E;  2HXW A;  4GL8 A;  4F3P A;  3GBB A;  4GIZ A;  1DPE A;  4ZE9 A;  4RK2 A;  4DXC A;  4BDR A;  5TP9 B;  4WKM A;  1ZTY A;  1VFE A;  3QUF A;  3IJO B;  4OVJ A;  1Y20 A;  2DVC A;  4POW A;  5AA4 A;  4IY5 A;  4F22 A;  3THI A;  3CSG A;  5CRY A;  3ONM A;  3V5A A;  1A55 A;  1H3D A;  4KQP A;  4U22 A;  4Z0I A;  3ZKL A;  2HEU A;  3OO9 A;  2ZYO A;  1IXG A;  4ELQ A;  3UIF A;  4EUO A;  4F19 A;  1MXW A;  3G3H A;  2BJJ X;  3LSL A;  3E4R A;  3GXA A;  2Q8J A;  1GR2 A;  3U94 A;  3PUY E;  4IO2 A;  4POX A;  1UTH A;  3V8X B;  2XX9 A;  4X9T A;  4NWC A;  1SQY A;  1II5 A;  3K4U A;  4KYS A;  4F3B A;  3A3U A;  3DP8 A;  3SEY A;  2FNC A;  2O69 A;  1PB9 A;  2P2A A;  3FAT A;  5LOM A;  4LZ7 A;  4F3G A;  4GXS B;  4OFO A;  4BDM A;  3T66 A;  4R74 A;  5DEX A;  1Y4C A;  4QSE A;  4GQO A;  1B4Z A;  5FTH A;  1XC1 A;  2DP8 A;  2D5W A;  3GLB A;  4TLL B;  4NF8 B;  2Z8D A;  3ZS6 A;  3DEL B;  4JXI A;  1CE2 A;  4YMA A;  3W9W A;  5KCJ B;  2OZZ A;  5KDT A;  4GWO A;  2RCA A;  2Z8E A;  1XVX A;  3IB1 A;  3VE1 B;  4YB6 A;  3W15 C;  4EQ9 A;  1N3X A;  3JV9 A;  4X48 A;  4OEN A;  3S9N C;  3FVG A;  2ONK E;  2ONR A;  3MP8 A;  4AQ4 A;  1LFI A;  2Z23 A;  1I6B A;  3O6H A;  1UTB A;  1N7W A;  3UP9 A;  1JNF A;  3C31 A;  4NF4 B;  2PT1 A;  3TTM A;  3OOA A;  1PB8 A;  2REJ A;  4ND9 A;  2VOZ A;  2F7A A;  2VD3 A;  5CBR A;  3TQL A;  3UA8 A;  2I48 A;  4LUB A;  2G29 A;  3M3K A;  2F5X A;  3K2D A;  1QUI A;  4OTE A;  5I56 B;  3OD7 A;  5L9M A;  3FJ7 A;  1B4H A;  4JWX A;  1MRP A;  3MJN A;  4OES A;  1USY H;  4PET A;  2DWA A;  1FW0 A;  5BWJ A;  3GZG A;  4IO5 A;  1TWY A;  3IB0 A;  3RUM A;  1R9Q A;  4ELP A;  5KZT A;  2DVZ A;  2R71 A;  2QPQ A;  1Y1Z A;  1FQA A;  2O7U A;  3E13 X;  4KPT A;  3RN8 A;  2H5Y A;  3VDF A;  2YJP A;  4BDO A;  1Y4T A;  4ELR A;  2GRV A;  4WED A;  4E0W A;  3MZB A;  3MVX A;  4GRK A;  2ABH A;  3MPK A;  1MQJ A;  4BDN A;  3TMG A;  3OEL A;  3IOR A;  1MY1 A;  4GD5 A;  1LB9 A;  1KWH A;  4XKQ A;  1ATG A;  4OQO A;  3VLV A;  1OLA A;  1USY E;  1NFT A;  4QFN A;  2V3Q A;  3O6G A;  2F78 A;  1FTL A;  1B32 A;  1B0L A;  3MVW A;  3HPI A;  1LFG A;  1NNF A;  3IOU A;  3CFL A;  1O63 A;  4RXL A;  3QUJ A;  1IIW A;  1ZLQ A;  2HCA A;  4LZ5 A;  1TXF A;  4LZ8 A;  4KCC A;  2HFB A;  2HAU A;  5AA4 B;  3DP6 A;  3QAX A;  3HHF A;  4H67 A;  4YB5 A;  3Q28 A;  4M4G A;  3FIR A;  1DTZ A;  4DLD A;  1SW4 A;  1TFD A;  4FAT A;  3H7M A;  4I1D A;  3RLF E;  1Q1K A;  3KN8 A;  1I6A A;  2ESN A;  2XXQ A;  1XT8 A;  3ZSF A;  3IB2 A;  3TEP A;  3VFJ A;  4EQ7 A;  3LSX A;  3OEK A;  3RT6 B;  1SI0 A;  5I59 A;  3O97 A;  3K6X A;  3U72 A;  1OVB A;  4ZEC A;  2F36 A;  5H8N B;  1MXU A;  1RYO A;  4QFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...