3ECRA

Structure of human porphobilinogen deaminase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
339
structure length
318
Chain Sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLECSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural insight into acute intermittent porphyria.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 318
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3ecrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ecrA02
1DTZA 1H44A 4QFOA 1UTBA 2P0SA 4WEDA 2V25A 2QPQA 4ZE9A 3SKPA 3C34A 4RPOA 4U2RA 3PUZE 1GGGA 3I5OA 4MH5A 3L6HA 3PMWA 3QAXA 4EF2A 4RNSA 1H76A 3H7MA 1ZU0A 2OZZA 2XX7A 3T22A 5AA4A 2B3BA 3TMGA 3I3VA 2HAUA 4YZZA 4UACA 2DWHA 4YB6A 1I6QA 3G3KA 1XC1A 1Y1MA 2HAVA 2XXIA 3Q28A 4FATA 4F22A 3LSLA 4RPNA 3OMBA 4QHQA 2XHDA 5L9OA 3DP4A 2NWJA 2WKYA 1ZJLA 3QXMA 4HCYA 2Y7WA 3TPAA 1QKAA 3C33A 4RY1A 4LZ8A 4F39A 1IXCA 4QSEA 3U1OA 3UA8A 2X26A 1N0TA 3PV0E 4NF8A 1MPBA 3K2DA 3DP8A 4RK9A 3LSWA 3BFTA 3TTLA 1I6AA 5I58A 2HZKA 2YJPA 1LLSA 3SEVA 3KOSA 1D9YA 4MF3A 1R1NA 1B3LA 3K1MA 3RLFE 4NF5A 3KJTA 2R9JA 3FV1A 4DIGA 4QFPA 4FAJA 4XKPA 5H8HB 2XXVA 2I4BA 1MH4A 2DXRA 4OQOA 4OEVA 5I56A 1B0HA 1R9LA 2Z8DA 4KCDA 4ESXA 2I6EA 4E0XA 2Y7KA 2YLNA 1PB9A 5TU0A 4LQ2A 3KEIA 4TLLB 2W7YA 1PB8A 4H6DA 4DZ1A 4LATA 2UVHA 1SYIA 4U22A 2XXYA 3U92A 3K01A 4KD5A 3KG2A 4OERA 4G2ZA 3HHGA 2F7AA 1SW2A 2E1SA 4C1UA 4H8IA 3B6QA 4F31B 1T0KA 3PMXA 5H8FA 4H8JA 5K2YA 3PPNA 2ESNA 3O6IA 1B51A 1I6BA 3IL1B 2OK2A 5CMMA 5FHOA 1JEUA 2AL4A 2PVUA 4TQUQ 1MXYA 1JQFA 4OESA 4R2BA 4ZEDA 1PB7A 3IAZA 1ZLQA 2ALUA 3K1PA 3FXUA 2ZYMA 3H6UA 4BLAA 4Z0IA 4LA9A 3GBAA 3LR1A 3CRBA 2XX8A 2ANJA 5I2NA 2A5TB 3K1NA 1OVTA 3DLNA 4IO5A 2XXHA 1MY1A 1Y4CA 3QYTA 2QSXA 3SEYA 1USYH 2QS1A 3W9WA 1TXFA 3V5AA 4LZ5A 1BKAA 3OEKA 1B1XA 1USYE 3H03A 3D4CA 3HV1A 3VDFA 3C31A 5TP9A 4F18A 4R9GA 4ESWA 3K6UA 5I59B 1ZMGA 3MQ9A 3LSXA 1L5TA 3PGFA 4ISUA 2DOJA 1MQGA 4EXKA 1WODA 5HBCA 4XIGQ 4F3BA 1SYHA 4EQ7A 3IOUA 1LCTA 1N04A 2QS3A 3QUFA 4JSDA 4E0WA 3O6HA 1P1NA 3S2VA 5AA2B 4GL8A 5ISUA 1B7ZA 4G68B 4POWA 1B32A 4R2FA 1XT8A 2XXXA 1XS5A 1R9QA 3M3FA 4YB5A 4JBZA 2FNCA 1MQDA 1HSEA 1B3GA 2YPNA 3OENA 4ZDMA 3FUZA 4YKKA 3RT6B 1EH3A 3G3IA 3RTFB 3T9UA 3VVDA 1PC3A 1N84A 1FQBA 3PPPA 4G77A 2OWSA 2XXUA 4IO7A 4HCWA 2F7CA 3SETA 1NKXA 2B65A 1Y20A 5A5XA 3OSRA 3R6UA 5DVIA 1WDNA 4F19A 3K6VA 1MM6A 4GFRA 3KSJA 2XD2A 3VVEA 4YMBA 2QJEA 4ZZAA 1IXGA 1R6ZA 4DXUA 4BDLA 4JWYA 3GZGA 1B2HA 3PD9A 2ONSA 1LSTA 3HCQA 2F97A 3K00A 1FTMA 4I1DA 1JETA 1P1WA 3VXCA 4IY6A 4OZ9A 3VLWA 1EU8A 3B6WA 4U4XA 1FQFA 5L9SA 2OLBA 3CFXA 4P11A 2H99A 1B7HA 2XXQA 5I57B 1MQJA 2I3WA 4H0WA 3O29A 3U72A 1B3HA 4KI0E 1N76A 5EHSA 1B3EA 1DPEA 5TPAA 1P1UA 5KDTA 1NNKA 1AMFA 4OTEA 1SW5A 1EZPA 2DE4A 2AL5A 2Z8EA 1UTHB 2F5XA 2OJTA 3TKDA 1OQGA 3LUYA 3G3JA 4JWOA 3FASA 3Q27A 3MVYA 1QUKA 4ZEFA 1SQYA 4EUOA 4FEBA 4DCXA 2RC8A 1Q1KA 5H8NB 4RK2A 5IKBA 4UA8A 4OETA 1B05A 3V89B 1ZBMA 5FTIA 3RGYA 1VR5A 3MVZA 4YKIA 3SESA 4IGRA 2ZXTA 4Q8RA 2DWJA 4PQJA 4PFUA 4N13A 2ONKE 3GLBA 3TDJA 1LBCA 3FV2A 4JSOA 4Q30B 4O3AA 1TT1A 4IO6A 4R6HA 1SD3A 2F6GA 2I4CA 4WXJA 2H9BA 1XHYA 1MY4A 5F7VA 5H8HA 3RTWB 5I84A 1RYXA 3UORA 2PMSA 4AB6A 3O6GA 1NFTA 3TAJA 3QSLA 4DCYA 3TQWA 1POY1 1M5DA 4M4GA 5DVFA 2NOOA 5KCJA 3MC2A 2UYEA 2H25A 4ZE8A 1DTGA 4R9FA 1FTLA 4JXIA 2PT1A 3S9NC 1CB6A 1LAFE 4GRKA 1YTVA 3KZGA 3PUYE 2QRYA 3IR1A 4L17A 3UN6A 3DM0A 1B46A 3O97A 3RY3A 3EF7A 1MXZA 3BBRA 3T9VA 1F9BA 2HXWA 1XVXA 1M5CA 3IB1A 2V93A 1A8FA 1QW0A 5I2KB 4OEUA 2F34A 4GIZA 1LFGA 3KN3A 2UVGA 3CR9A 3EHUA 1LFHA 4GQOA 4YMAA 2ZYOA 3T9XB 5ITOA 1UIVA 4ZEBA 3PD8A 2A5SA 1MRPA 4F1VA 2ZMBA 2B3FA 3C32A 1S50A 5DEXA 1SW1A 4M1VA 2Q88A 3CSGA 5AA1A 2Y7PA 3A09A 2PBWA 3E4RA 4RA1A 1OQHA 1EZ9A 1MS7A 2Y84A 1MPDA 2X7PA 4YICA 3KN8A 3SERA 4WEPA 4PFTA 3UIFA 3H4ZA 3HN0A 2OBGA 2I49A 2HEUA 4H65A 4YKJA 4F1YA 2PT2A 3ZS6A 2AYSA 3MP1A 3MP6A 3Q29A 1B58A 5M2VA 2NUVA 4HTGA 3TTKA 4NF6B 2DWAA 4JWXA 2H98A 3MPLA 5L9MA 2VOZA 4IY5A 1AIVA 4F2OA 3FD3A 3TTRA 5BWJA 3TFLA 2ZNTA 4GD5A 3S9LC 5CBSA 4LP2B 1N3WA 3OELA 4FECA 4X1BA 2DXYA 3CG1A 1XVYA 4OENA 3H6VA 3DP6A 3IJOB 1BLFA 2G29A 5J1DA 3VVFA 1MY3A 3SDFA 1XOCA 3OO6A 1US5A 4H67A 3EHTA 1MXVA 3FIRA 1LB8A 1OMPA 1IEJA 4G68C 2O84X 2D3IA 1UTBB 2PX1A 4EF1A 1LB9A 2V3QA 2DYXA 3N6UA 3SEUA 3OO7A 4KR5A 1VE4A 2HZLA 3PPRA 3R26A 3MVWA 4QRZA 4ELRA 2M8CA 3PPQA 3GBBA 2XXRA 1A7LA 3FJMA 3LC8A 4AQ4A 1P99A 4I62A 3CI8A 1SVXB 1O64A 2FA7A 3RQTA 3TCFA 4R6YA 3C4MA 4NF4A 4R72A 5I57A 4GOTA 3HPIA 1LAGE 4FEDA 2REGA 4TLMB 4XKQA 5CRYA 1DMBA 4FORA 4AB5A 2Q2CA 3S4UA 4U23A 3R7XA 4Q0CA 1B5HA 3THIA 2V3UA 1B52A 1IXIA 3OO9A 4ZZEA 5FHNA 5BUUA 3H3GA 4NTLA 2Q9TA 3WAFA 3ILUB 4NF8B 3IO4A 3FJ7A 3EQ1A 5CC2A 3CFLA 5I58B 3KSXA 4PE5B 4DDDA 1B7UA 1P1QA 3PPOA 3FVOA 1NNTA 3E13X 4NF5B 4R6KA 3W15C 3VFJA 1JW4A 4THIA 4KYDA 4U1ZA 4DLDA 1OIBA 5I56B 4XTCQ 2O68A 2XX9A 3T96B 3TUSA 1DSNA 1UIUA 4X1DA 3T66A 1QUJA 2XXWA 3K6XA 4P0IA 3AXFA 5IAIA 1IITA 5ICTA 1YPNA 3TTMA 5AA3A 5ICQA 1B3FA 3RT8A 4NWCA 4OHNA 4MFIA 1Q35A 3OO8A 1A55A 2OCUA 2XXPA 1N3XA 4G4PA 1BTJA 4ZEKA 3VE1B 1M5BA 2P1SA 4OMBA 2GHAA 3CFZA 5H8FB 4FJPA 2F36A 2I48A 5KZTA 1PBPA 1VFDA 1OVBA 3PUVE 2Q8JA 3VLUA 1SW4A 4ZS9A 3IB2A 4BDNA 4LQ5A 5HPQA 5JTYA 1RKMA 3A3CA 4OFLA 4EDPA 3EHSA 3ZKKA 1GVCA 3Q26A 5B7DA 4LVQA 2Q2AA 1N7XA 5I2NB 2UYFA 3MJNA 1H3DA 1URDA 3N6TA 4R73A 1Z7ME 1B4ZA 3WAEA 4JB7A 1MXWA 3CVGA 1Y1ZA 4ONYA 3M3LA 1AOVA 3S9MC 2X7QA 4POXA 4X48A 3TQLA 4ELOA 1IXHA 3TTNA 3TEPA 3ECRA 1TWYA 1NNFA 4BDMA 1HSLA 1NL5A 1ZKBA 2O1LA 2F35A 4IO4A 3EPEA 5TP9B 4PP0A 4QSCA 2GH9A 3B6TA 4U1OA 1B5IA 4I9DA 5DT6A 2O7IA 3IJXB 2UVIA 1II5A 2I0CA 4R75A 3PUWE 3E9XA 3C36A 1FQEA 1M5EA 3ILTB 2I0BA 4KYSA 3RNNA 1B40A 3S9EA 2O51A 1PEBA 3KBRA 3MUQA 1BP5A 1SBPA 1BIYA 3H6TA 1LCFA 3OXNA 1MDQA 1A8EA 4QSDA 3USDA 4NMYA 4DXCA 2RC9A 4JDFA 3SEXA 3K4UA 1QKBA 4N07A 1MH3A 3VV5A 4IO3A 2BJJX 1QJMA 3RN8A 3V83A 2Q89A 4ELPA 1EZOA 4LZ7A 1HSJA 4HS7A 5A5XB 2ONRA 3MBPA 2THIA 3C35A 2HFBA 1GV8A 2GHBA 3PUXE 4O3BA 5CI5A 1MY2A 4KYEA 1B0LA 3ZSFA 4G8NA 3RUMA 4GF8A 3T9HB 2GFEA 3U94A 1ELJA 4OWDA 4EXLA 1JW5A 2REJA 2O6AA 2Y7RA 3JV9A 1WVJA 4OXVA 4ECFA 3MAMA 3EN3A 4GWOA 4N6PA 1A40A 3RPWA 4RXLA 3PU5A 5TPAB 2RKMA 4QF9A 4ZEIA 2ABHA 5KDTB 2CZLA 1IIWA 1A54A 3PMVA 3MW0A 2RF1A 4G8HA 1VFEA 2RCBA 1MPCA 2A5TA 1LBBA 5HM4B 3HSTA 4TOZA 4LONB 5JEIA 1JNFA 3FXRA 5H8QB 1FTOA 2VHAA 3FJGA 4FE8A 2OWTA 4IGTA 2DQVA 3BFUA 3VLVA 3IO6A 3FVGA 5CMBA 3UP9A 4EQBA 1A99A 1OLAA 3IB0A 3MZ9A 4KHZE 2DVZA 4NE4A 5AA2D 3G7WA 1IQ7A 4PETA 1CE2A 4GL0A 1O63A 1DOTA 3MZ1A 4KCCA 5I59A 3F11A 2UXAA 1I69A 1NH7A 1ATGA 3FZVA 4YB7A 3MP8A 2IEEA 1MQIA 3KFMA 1VSOA 1QVSA 2QMXA 2ZNSA 2D5WA 3IK6B 3IOVA 2RCAA 1M5FA 2QS2A 4F3SA 1ZTYA 1LAHE 2D21A 1FQAA 2P2AA 5CM6A 4LUBA 5AA2A 4G68A 3M8UA 3TELA 1LFIA 4PFYA 3KOTA 1ANFA 4BDQA 1UQWA 4GXAA 4G8MA 5KCJB 4RJZA 2DVCA 4ELQA 3BKIB 2NXOA 4U4SA 1MDP1 3TCHA 4F3GA 3OEMA 4QFKA 4R74A 1Y3NA 2G93A 1OLCA 1H45A 1GR2A 1MXUA 5AE4A 3MVXA 1FCKA 4O3CA 5DVJA 3KJ7A 1FTJA 5ELVA 4K3FA 4EQ9A 4MBPA 3QIMA 1MQHA 3IOWA 1GTKA 1NMUA 1JW1A 4XKRA 2DP8A 5AA4B 3TYHA 3B7DA 1Y9UA 2KLFA 3Q25A 4I8CA 4P0GA 1SI1A 2DE3A 4DXBA 1N7WA 2E0SA 5CMCA 4XKNA 5L8DA 2Z23A 1Y3QA 4F29A 3L6GA 3C9HA 1B5JA 3OD7A 3N94A 2VD3A 5F1QA 5DEXB 3FATA 4H1XA 1IUDA 1P1OA 3E3KA 4GXSB 1S7YA 4Q5TA 3OOAA 1UTHA 5EYFA 4MLQA 1MXXA 2R71A 4NWDA 2HQ0A 3ODBA 4MLVA 2QMWA 3IX1A 4WKMA 2O1MA 1SDXA 4ZECA 1D3KA 3I6VA 4U21A 3OSQA 2I3VA 3JZJA 1QUIA 2UVJA 3H6WA 4H5GA 5H8SA 5K2XA 5H8NA 4QFLA 2I58A 1AL3A 2GRVA 3V8XB 4F1UA 1POTA 3H06B 2XXTA 1URGA 1Y3PA 1Z7NE 1MG1A 3DELB 4DE8A 1B4HA 2DSFA 5LOMA 3ZKLA 1YCJA 3P7IA 5DTBA 1MM7A 1PBQA 2DWIA 3KGCA 1LGBC 3MZBA 1ZIUA 3HO7A 1LAXA 4NEDA 4IB2A 1FW0A 2F8DA 2IA4A 1B1HA 4YKPA 3U93A 3G3GA 3G3FA 3HHFA 3TZAA 3O66A 3CSBA 4OYVA 3G3HA 4XXUA 2VGQA 4C0RA 1AH5A 4X9TA 3UK4A 3K02A 4HW8A 2VP1A 2ZYNA 1TFAA 1US4A 2F7BA 1Y4TA 4GVOA 3ONMA 2R6GE 2O7UA 2H5YA 4IO2A 2ZYKA 2CMOA 4C1TA 1S9TA 4KFQA 1FQDA 2VD2A 5I2KA 1DPPA 4NF4B 3M3KA 2Y7IA 2HCAA 3QUJA 3LBSA 4OVJA 1B9JA 2F78A 4F2QA 2DE2A 3K6WA 1IZ1A 4ND9A 3SEWA 1NNPA 2QL3A 5DYHA 4GLIA 1FQCA 2XD3A 3T93B 4YU0A 3N5LA 3CG3A 2RC7A 1TFDA 5H8QA 3K0VA 5ITPA 3JYRA 1YAEA 2RINA 5B70A 3UGWA 3D4GA 4KQPA 1KWHA 3FGSA 4OFOA 1D9VA 3CIJA 3A3UA 1J1NA 2DS9A 2QS4A 2PYYA 3TCGA 3KN7A 1H43A 5CMKA 5CBRA 5JK4A 4KPTA 2H4IA 4F3PA 3IOTA 4BDRA 3GXAA 1PDAA 3U8QA 3FVKA 4RYAA 3LSFB 3IORA 2V3TA 5FHMA 2V84A 3W9VA 1QULA 1D4NA 2ZNUA 3O9PA 1URSA 3QK6A 4NF6A 1B6HA 1SI0A 4PFWA 1FTKA 3VXBA 2AIXA 3O28A 2O69A 5FTHA 5EHMA 2F6PA 4FIMA 4QFNA 1JVYA 3MWBA 1O7TA 2FYIA 3N26A 1JVXA 4H5FA 2Z22A 1RYOA 1JEVA 2LAOA 3FXQA 2Z8FA 2NVUB 3MPKA 1NH8A 4Z7EA 5JTYB 3O2AA 3TODA 3FVNA 4OFJA 4BDOA 1MY0A 4YAHX
chains in the Genus database with same CATH superfamily
1DTZA 1H44A 4QFOA 2ZM6E 1LBVA 1UTBA 2P0SA 4WEDA 2V25A 3IWDA 2QPQA 1N32E 4ZE9A 4O8MA 3SKPA 3C34A 4RPOA 4U2RA 2HJJA 2OX3A 1X6EA 3F6HA 2EMWA 4X62E 3PUZE 1GGGA 3I5OA 4GX6A 4MH5A 1FPLA 3L6HA 2WYKA 3PMWA 3QAXA 4EF2A 4RNSA 1H76A 3H7MA 1ZU0A 5IM2A 2OZZA 2XX7A 3T22A 5AA4A 2B3BA 2EOQA 2V83A 2QVRA 3IFCA 3TMGA 3I3VA 2HAUA 2EN3A 4YZZA 5IZ1A 4UACA 2R76A 2VPOA 2DWHA 4PAKA 4DR7E 4YB6A 1I6QA 3G3KA 1XC1A 2B9DA 1Y1MA 2HAVA 2DB2A 2XXIA 3Q28A 4FATA 4F22A 3LSLA 4RPNA 3OMBA 4QHQA 2XHDA 3K6QA 5L9OA 3DP4A 2NWJA 4BCAA 2WKYA 2HHMA 1K9ZA 1ZJLA 4PC9A 2NUGA 3QXMA 4HCYA 4NX1A 2Y7WA 4IS1C 3TPAA 3AV0A 1QKAA 3C6KA 2JR1A 3C33A 4RY1A 4GBVA 4LZ8A 4F39A 1IXCA 4QSEA 3U1OA 3UA8A 1A1FA 2X26A 1FSAA 1N0TA 3PV0E 4PFBA 4NF8A 1MPBA 1WHQA 3K2DA 3DP8A 1MEYC 4RK9A 3LSWA 3BFTA 3TTLA 1I6AA 5I58A 2HZKA 2YJPA 2NUEA 1L4SA 5AE2A 4DV5E 1VDWA 2LT7A 1LLSA 4DMIA 3SEVA 3KOSA 1D9YA 4MF3A 1R1NA 2DIXA 4WXDA 1B3LA 2XWOA 3K1MA 4R2PA 2JY9A 4NF5A 3RLFE 4AS4A 3KJTA 5KL5A 2R9JA 3FV1A 4DIGA 4QFPA 2CSHA 4FAJA 4XKPA 5H8HB 4PFIA 2XXVA 4FK5C 2I4BA 1MH4A 2DXRA 4OQOA 2EM7A 1TF3A 2ENCA 4OEVA 5I56A 3ZOQB 1B0HA 4JVCA 3JU0A 1R9LA 2Z8DA 1YUJA 4KCDA 4ESXA 2I6EA 2FHYA 2EM0A 4GWSA 4E0XA 4X64E 1IQOA 4OVPA 2Y7KA 2EPUA 4O94A 2YLNA 1KZ8A 1PB9A 5TU0A 2BBGA 4LQ2A 2EL6A 3KEIA 4TLLB 2W7YA 1PB8A 4H6DA 3VK6A 3EKIA 4DZ1A 4LATA 2UVHA 1EYKA 1SYIA 4U22A 4X9JA 2XXYA 3U92A 3K01A 4KD5A 3KG2A 4OERA 3HXLA 2B4MA 4G2ZA 4B3RE 3HHGA 2UUBE 2F7AA 1SW2A 2E1SA 4C1UA 4H8IA 3B6QA 4F31B 1T0KA 3PMXA 5H8FA 4H8JA 5K2YA 4UABA 3PPNA 2ESNA 4GKJE 5FLXC 3O6IA 4BHCA 1B51A 1I6BA 3IL1B 3TQMA 5DW8A 2E5LE 2OK2A 5CMMA 3DF6A 4I8OA 4P78A 1G0HA 5FHOA 2KONA 2Q8MA 1JEUA 2AL4A 2PVUA 4TQUQ 1MXYA 2EPLX 1ZBTA 2YZTA 5BR8E 1JQFA 4OESA 4R2BA 3FIGA 4ZEDA 1KA0A 1PB7A 3IAZA 2EN1A 3IWCA 1ZLQA 2ALUA 3K1PA 2BB8A 1CNQA 3FXUA 2GLIA 2DLQA 2ZYMA 2M7QA 1YYWA 3H6UA 4BLAA 4Z0IA 4LA9A 3GBAA 3LR1A 1FPJA 3CRBA 2XX8A 2ANJA 5I2NA 2A5TB 3RMPA 3K1NA 4BHBA 2EPKX 3BGHA 1OVTA 1NUYA 1UILA 2YTEA 3DLNA 1DQ3A 4WSGA 2EQ1A 4IO5A 5LLQA 1X3CA 4FBPA 3THOB 4IR8A 2XXHA 2EOFA 1MY1A 1NEIA 1Y4CA 4GX4A 5F24A 4X65E 2ENHA 3QYTA 2EOMA 2QSXA 3SEYA 1USYH 2QS1A 3W9WA 1TXFA 3V5AA 4LZ5A 1BKAA 2V86A 3OEKA 3LLHA 1B1XA 3P1XA 3DJWA 1USYE 3H03A 3D4CA 3HV1A 3VDFA 4H46A 3C31A 4JVDA 4DR3E 5TP9A 4M9VC 4GEQB 4F18A 4OANA 2EMCA 4R9GA 4PDHA 4ESWA 5ET8A 3K6UA 5I59B 1ZMGA 3MQ9A 3LSXA 1L5TA 3U65A 1HR0E 3PGFA 4ISUA 4NHBA 2DOJA 2WYPA 4JI8E 1MQGA 4EXKA 1WODA 5HBCA 4XIGQ 4F3BA 1YXIA 1SYHA 4EQ7A 1AWBA 3IOUA 1LCTA 1N04A 1K9YA 2DMYA 2LUQA 2L2NA 2QS3A 3QUFA 4JSDA 4R2RA 4E0WA 3O6HA 1P1NA 2ODRD 2EQ3A 4NGUA 3S2VA 2DLKA 5AA2B 2DMIA 4GL8A 2XWIA 4YHHE 5ISUA 2UXCE 1FPKA 1B7ZA 4G68B 1FBHA 4POWA 1B32A 4PBQA 1STUA 4R2FA 1ZU1A 1XT8A 2XXXA 1XS5A 1R9QA 3M3FA 4YB5A 2WCC3 4JBZA 2FNCA 1MQDA 3EPLA 1HSEA 2CTDA 4TUIA 2F8BA 1ZR9A 1B3GA 2JOBA 4JI5E 2VF1A 3RPLA 2YPNA 3OENA 4ZDMA 3FUZA 4YKKA 3RT6B 1EH3A 3G3IA 4KXPA 3RTFB 3T9UA 3VVDA 1PC3A 1N84A 1FQBA 3PPPA 4G77A 2ZZWA 2OWSA 3D1RA 2XXUA 4IO7A 2EMZA 4HCWA 2F7CA 3SETA 5A5LA 1NKXA 2B65A 1BBOA 1Y20A 1RDYA 5A5XA 3OSRA 3R6UA 2L33A 2YTFA 5DVIA 1WDNA 4F19A 4WX9A 3K6VA 1MM6A 4GFRA 1FBCA 3KSJA 5T6JA 2XD2A 3VVEA 4YMBA 1UHZA 4KWYA 2QJEA 4ZZAA 1IXGA 1R6ZA 4PF8A 4DXUA 4BDLA 4JWYA 4PAIA 3GZGA 2DSYA 1B2HA 2MC6A 3PD9A 2ONSA 2WEFA 1LSTA 3HCQA 2YTIA 2F97A 3K00A 1FTMA 4I1DA 3HTXA 1JETA 4NG7A 3C4TA 1P1WA 3VXCA 4DV6E 4IY6A 4X8WA 4X66E 4OZ9A 3VLWA 1NUWA 5KL6A 1EU8A 3B6WA 4U4XA 2LUPB 1FQFA 2RSIA 5L9SA 2OLBA 2EJ4A 3FXBA 3CFXA 4P11A 3VYXA 2H99A 1B7HA 1RDZA 1WJPA 2XXQA 2N3HA 5I57B 1MQJA 2I3WA 3BBGA 5IWAE 4H0WA 3O29A 3U72A 1B3HA 4KI0E 3KC1A 1N76A 5EHSA 1B3EA 1DPEA 5TPAA 1P1UA 2L5VA 5KDTA 1NNKA 1AMFA 5A69A 4OTEA 1SW5A 5EYHA 1EZPA 2DE4A 3VHTB 4AQYE 4B3SE 2AL5A 2Z8EA 1UTHB 4N91A 2F5XA 2OJTA 3TKDA 1OQGA 1SPIA 1DBZA 3LUYA 2EMLA 3G3JA 4JWOA 2CPNA 3FASA 3Q27A 2EM3A 3MVYA 1QUKA 2VPNA 2FV4B 4ZEFA 1SQYA 4EUOA 4GWUA 4FEBA 4DCXA 2RC8A 1Q1KA 5H8NB 4RK2A 5IKBA 4UA8A 5A6AA 4OETA 2EPAA 2Y5KA 1B05A 4F6NA 3V89B 4GBWA 1IMDA 1ZBMA 5FTIA 3RGYA 4PFRA 1VR5A 4JI1E 3MVZA 4YKIA 4HE2A 2RSMA 3SESA 4IGRA 2ZXTA 2EOZA 4Q8RA 4ZYGA 2DWJA 4PQJA 4PFUA 4N13A 1FBDA 2ONKE 3GLBA 3TDJA 5I5PA 1LBCA 1YUIA 3FV2A 1PJSA 4JSOA 4Q30B 4O3AA 1TT1A 4IO6A 4R6HA 2YTDA 1SD3A 4PE3A 2F6GA 1IMAA 2I4CA 1FBFA 4WXJA 4LTYA 2LVHA 2EOIA 2H9BA 1XHYA 1MY4A 2NABA 5F7VA 2F4VE 5H8HA 3RTWB 5I84A 1RYXA 3UORA 2PMSA 5EQAA 5I3SA 4AB6A 2N8XA 1P47A 2P3NA 3O6GA 1NFTA 3TAJA 3J80C 1BB8A 3QSLA 4N81A 1YYOA 4DCYA 3TQWA 1POY1 1BK4A 1M5DA 4M4GA 3BIDA 5DVFA 2NOOA 5KCJA 3MC2A 2UYEA 3LV0A 2V8QB 2H25A 2RS6A 2EMKA 4ZE8A 1DTGA 4R9FA 4LU9A 1FTLA 4JXIA 4PDDA 4R2EA 4BBYA 2PT1A 2UXBE 3T1YE 3S9NC 1CB6A 1LAFE 4GRKA 1YTVA 3KZGA 3PUYE 2ELZA 2QRYA 3IR1A 4L17A 3UN6A 3DM0A 2M9AA 2YTNA 1B46A 3O97A 3RY3A 5EQ7A 3EF7A 4KZSA 4Q35B 4DR4E 2EMBA 1MXZA 3BBRA 5I7IA 3J81C 3T9VA 1F2IG 1F9BA 2HXWA 2YU5A 2K4VA 1J26A 1XVXA 1M5CA 4OVSA 3KZZA 3IB1A 2V93A 2KOUA 1A8FA 1QW0A 2LO3A 5I2KB 1XMQE 4OEUA 1RC7A 4KHPE 2F34A 4GIZA 1LFGA 5A2QC 3KN3A 2OWZA 2UVGA 3CR9A 3EHUA 1LFHA 2UU9E 4GQOA 4YMAA 2ZYOA 3T9XB 2PRTA 5ITOA 3THNA 4DKKA 1UIVA 1HNXE 4ZEBA 3PD8A 4WYQB 4DR5E 3ADJA 2A5SA 1MRPA 4F1VA 2ZMBA 2B3FA 2EN4A 3C32A 2EM2A 2JP9A 5IZ3A 1S50A 4NXNE 5DEXA 3T1BA 1SW1A 1NUXA 4M1VA 4R03A 2Q88A 4ZYEA 2EOSA 2EMIA 2KR0A 3CSGA 5AA1A 2Y7PA 3A09A 2PBWA 3E4RA 4NQ8A 2XXKA 4LF4E 4RA1A 1OQHA 2YT4A 1EZ9A 2EMHA 1MS7A 4HEIA 2Y84A 1MPDA 2EOEA 4X04A 2I9IA 2B7TA 2X7PA 2M1SA 4PF6A 4YICA 3KN8A 3SERA 4WEPA 2YTGA 1I94E 4MAGA 4PFTA 3UIFA 3H4ZA 1T4NA 2OBGA 3HN0A 2I49A 4BC9A 4ZYHA 4LN5A 2I13A 2HEUA 4PGPA 4H65A 4YKJA 4F1YA 2PT2A 3ZS6A 2AYSA 1X48A 3MP1A 3MP6A 3Q29A 1N3GA 1B58A 5M2VA 2L92A 3ADGA 2NUVA 4HTGA 3TTKA 4NF6B 2DWAA 4JWXA 2H98A 3MPLA 5L9MA 2VOZA 4IY5A 1AIVA 4F2OA 5IZZA 3FD3A 3TTRA 5BWJA 1IBKE 4R2SA 3TFLA 2ZNTA 4GD5A 3S9LC 2EPNA 5CBSA 1NV6A 4LP2B 3AUZA 2YRHA 1N3WA 2WBBA 3OELA 4FECA 4X1BA 2DXYA 2EMFA 3KWRA 3CG1A 2EN8A 3M99B 1XVYA 4OENA 1YSAC 3H6VA 3DP6A 3IJOB 1BLFA 2G29A 2JWOA 4MNPA 3VVFA 1MY3A 3SDFA 5J1DA 1XOCA 3OO6A 4LFBE 1US5A 4H67A 3EHTA 2ENAA 1MXVA 4OOGC 1FBEA 1EKZA 3HPZA 2EN2A 3FIRA 1LB8A 4OX9E 1EH7A 1OMPA 1IEJA 2J7JA 2MDGA 4G68C 2O84X 2D3IA 1FPIA 1UTBB 2PX1A 4EF1A 4RHBB 1LB9A 2V3QA 2DYXA 3N6UA 2MDRA 3SEUA 3KZYA 1LLMC 1AAYA 3FBPA 4R2DA 3OO7A 1A1HA 4O43A 5LDZA 4KR5A 1SR9A 4R2AA 2ELYA 1VE4A 3ROJA 2HZLA 3PPRA 1QU6A 3R26A 2NUFA 3MVWA 4QRZA 4ELRA 2Q8UA 2M8CA 3PPQA 3GBBA 2GHFA 1WXRA 2XXRA 4B3ME 4N8GA 2EM6A 4R8OA 1A7LA 3FJMA 3LC8A 4AQ4A 4NAPA 1P99A 4I62A 3CI8A 4F9BB 1SVXB 1O64A 2FA7A 3RQTA 3UK3C 4GKKE 3TCFA 4R6YA 2EM8A 5CFFE 3C4MA 3HQ1A 2UUCE 4NF4A 4R72A 5I57A 4L8NA 3HPIA 4GOTA 1LAGE 2EN7A 4FEDA 2REGA 2YTJA 4TLMB 4XKQA 5CRYA 4N17A 1DMBA 4FORA 4AB5A 2Q2CA 4Q28A 1ZBQA 4QBAA 3S4UA 1LBWA 4U23A 3R7XA 4Q0CA 1B5HA 4MIJA 1KJKA 1XI6A 5F3WA 3THIA 2V3UA 1WHNA 3MHHC 1B52A 1IXIA 3OO9A 1EYJA 4ZZEA 5A6BD 5FHNA 5BUUA 3H3GA 4PAFA 4LFAE 2XA5A 2DRPA 4OA4A 2WZOA 1KA1A 4NTLA 2Q9TA 3WAFA 3BIGA 3ILUB 4NF8B 2CZHA 3IO4A 3FJ7A 1EH6A 2L2MA 3EQ1A 2DGCA 5CC2A 3CFLA 4I3EA 5I58B 4GWYA 3KSXA 4PE5B 4DDDA 1B7UA 1P1QA 3PPOA 2DDKA 3T1HE 3FVOA 1NNTA 3E13X 4NF5B 4R6KA 3W15C 2D9HA 3VFJA 1JW4A 4LFCE 4THIA 3ADIA 4KYDA 3IWBA 4WPYA 4U1ZA 5ET6A 1YYZA 4DR1E 4DLDA 1FJ9A 1OIBA 2CZKA 5I56B 4XTCQ 5A6BA 1DI2A 2O68A 2XX9A 3T96B 3TUSA 5T3JA 1DSNA 1UIUA 4X1DA 3T66A 1QUJA 2EORA 2XXWA 3K6XA 4P0IA 4DI3D 2GPIA 1IMFA 3AXFA 5LMUE 2EL4A 2L6MA 2F3BA 2MC5A 5IAIA 1IITA 5ICTA 1YPNA 3TTMA 5AA3A 2NA2A 4OVRA 5ICQA 1B3FA 3RT8A 1ZAAC 4NWCA 4O5GA 4OHNA 4IJDA 3KBZA 2F3DA 4MFIA 1Q35A 3OO8A 2Y5LA 1A55A 2OCUA 2XXPA 1N3XA 4G4PA 1BTJA 4ZEKA 3VE1B 1M5BA 2P1SA 2EWLA 4OMBA 2GHAA 3CFZA 5H8FB 2L3JA 4FJPA 5AC5A 1LEVA 2F36A 2MKZA 2I48A 4P56A 5KZTA 1PBPA 2V87A 2V89A 4F9AB 1PJTA 1VFDA 1OVBA 3PUVE 5KL4A 2Q8JA 3VLUA 2B7VA 2UXDE 3BF2A 1SW4A 4BS9A 4ZS9A 2YU8A 1SFEA 2EQ0A 3IB2A 4BDNA 1XMOE 4LQ5A 5HPQA 5JTYA 1RKMA 2YTPA 1HNZE 1G0IA 3A3CA 5AE3A 4OFLA 4EDPA 3EHSA 3ZKKA 1HNWE 2MKDA 3QG5C 1GVCA 5AE1A 3Q26A 2WX9A 5B7DA 4LVQA 2E72A 2CT1A 2FTXB 2Q2AA 1N7XA 5KL3A 1FPEA 1LBZA 5I2NB 1QNTA 2UYFA 3MJNA 1O0WA 5ET7A 5J16A 1H3DA 1T4LB 1URDA 3N6TA 4R73A 1Z7ME 2B4LA 4MEVA 1B4ZA 2EP3A 3WAEA 4JB7A 1MXWA 3CVGA 2N3GA 1Y1ZA 4ONYA 3QMFA 3M3LA 2P3VA 4MCOA 1AOVA 3S9MC 4BMJA 4DUYE 2X7QA 4POXA 4X48A 3TQLA 4JI4E 4ELOA 1IXHA 3TTNA 3TEPA 3ECRA 1TWYA 1NNFA 4BDMA 1HSLA 1NL5A 1ZKBA 2O1LA 3HFUA 2F35A 4IO4A 3EPEA 1IBLE 5TP9B 4PP0A 4QSCA 2GH9A 3B6TA 1IQSA 4U1OA 1B5IA 4I9DA 2YSOA 5DT6A 2O7IA 1YYKA 3IJXB 2UVIA 2Q74A 1II5A 2I0CA 5IV8B 1T39A 4R75A 1NI9A 3PUWE 2JVAA 3E9XA 3C36A 1YZ0A 2V4CA 1FQEA 1M5EA 4NZVA 2UUAE 3ILTB 2I0BA 2RS7A 4KYSA 2H36X 3RNNA 1B40A 3S9EA 2EOJA 4DV1E 1PEBA 2O51A 3KBRA 3MUQA 4QXDA 1FBPA 1BP5A 1SBPA 1BIYA 3H6TA 1LCFA 2EM4A 2JXPA 3OXNA 1MDQA 3J7AG 1A8EA 4QSDA 3USDA 4N6DA 4XFEA 5DNYA 4NMYA 4DXCA 2RC9A 4JDFA 3SEXA 1X6FA 4P1LA 5A6KA 3K4UA 2EOYA 1QKBA 3RPLB 4N07A 1MH3A 4ZYDA 1FPBA 4IO3A 3E78A 3VV5A 2BJJX 1QJMA 3RN8A 3NOHA 3VYYA 3E79A 5ET5A 3V83A 2Q89A 2LRSA 1A1KA 4ELPA 4MNCA 1EZOA 4LZ7A 1TN9A 1HSJA 4GWZA 4HS7A 2EPXA 5A5XB 2ONRA 2FGGA 3MBPA 2THIA 3C35A 4M0VA 2HFBA 1NV2A 4GX3A 1GV8A 2GHBA 3PUXE 4O3BA 5CI5A 1MY2A 2LMZA 4KYEA 1B0LA 3ZSFA 4G8NA 3RUMA 2YRMA 1KYQA 4GF8A 3T9HB 2GFEA 5EYGA 3U94A 1ELJA 2JYAA 2A25A 5IGAA 2HC5A 3HPSA 1N36E 4OWDA 4EXLA 1JW5A 4GWXA 2REJA 1RMDA 2O6AA 2Y7RA 3JV9A 1WVJA 4OXVA 1BBGA 2KHXA 4ECFA 3MAMA 3EN3A 2JJKA 4GWOA 4N6PA 1A40A 1DK4A 1T38A 3RPWA 4RXLA 3PU5A 2LCEA 4MHFA 4P1EA 5TPAB 2RKMA 4QF9A 4JI6E 4ZEIA 2ABHA 4DV3E 5KDTB 3H09A 2CZLA 1IIWA 4LF7E 1A54A 2FIXA 3PMVA 3MW0A 2VRDA 5AC4A 2RF1A 1GQEA 1JK1A 4G8HA 1VFEA 2RCBA 1MPCA 1X47A 2A5TA 1DCUA 1LBBA 5HM4B 4BC7A 3HSTA 4TOZA 4LONB 5JEIA 4P3LA 2JPAA 2QVVA 5IT9C 1JNFA 3FXRA 2HXRA 5H8QB 1FTOA 2VHAA 1UN6B 3FJGA 2EL5A 4P9KA 4JYAE 1T4OA 4FE8A 2OWTA 4IGTA 2DQVA 3BFUA 1G2FC 3VLVA 1DGCA 2GQ1A 3IO6A 4O4KA 3FVGA 3EPHA 5CMBA 4JI2E 3MSWA 2EPMX 5ESYA 3UP9A 4EQBA 1N34E 1A99A 1OLAA 3IB0A 3MZ9A 4KHZE 2DVZA 4NE4A 4O7MA 5AA2D 3G7WA 2KQZA 4RH8A 1IQ7A 3MHSC 4PETA 1CE2A 4GL0A 1O63A 1IMBA 1DOTA 3MZ1A 4KCCA 5I59A 5KL2A 4PGNA 4LF8E 3F11A 2UXAA 1I69A 1NH7A 1ATGA 3FZVA 4YB7A 3MP8A 2IEEA 4N4RB 4N8YA 1MQIA 2RPCA 4L5NC 1FJGE 3SZPA 3KFMA 1VSOA 2G7HA 1QVSA 3BIHA 2QMXA 2ZNSA 1RQ0A 3F6GA 2D5WA 4LF9E 3IK6B 3IOVA 2RCAA 4M2ZA 1M5FA 2HPGA 2QS2A 4F3SA 1ZTYA 1XNRE 3EPKA 4NN3A 1FPFA 5ADZA 3RYDA 2YSPA 1LAHE 4GZNC 1FQAA 2D21A 2L3CA 4P47A 2P2AA 4HE1A 5CM6A 4LUBA 5AA2A 2EM5A 3EPJA 1NCSA 2XWVA 4G68A 3M8UA 2L2KB 3TELA 1LFIA 1FRPA 4PFYA 4NF0A 2EPPA 4MJOA 2EPZA 3KOTA 4XEQA 1ANFA 2CEXA 4BDQA 2L8TA 1UQWA 4GXAA 4G8MA 5KCJB 4RJZA 2DVCA 4ELQA 3BKIB 4WFTA 2NXOA 5EQ9A 4DV4E 4U4SA 1MDP1 3TCHA 2FBPA 4JVIA 1G2DC 4OVQA 4F3GA 4DV2E 3OEMA 4QFKA 4R74A 1Y3NA 2G93A 1OLCA 1H45A 4MMPA 3L00A 4B3TE 1GR2A 3A29A 3OTOE 1MXUA 3CHGA 5AE4A 3MVXA 1FCKA 4O3CA 3B8BA 5DVJA 3KJ7A 1EH8A 1FTJA 5ELVA 5KL7A 4K3FA 2CEYA 4EQ9A 4MBPA 2YWQA 2HHHE 4PBHA 3QIMA 4PTKA 1MQHA 3IOWA 1GTKA 1NMUA 1JW1A 4XKRA 5A6JA 2LTRA 2DP8A 1FBGA 5AA4B 2EOXA 4O24A 3TYHA 3B7DA 4WXCA 1Y9UA 2KLFA 2YTOA 3Q25A 4I8CA 4M30A 2LJUA 4P0GA 1B69A 3IFAA 1FPDA 1SI1A 2DE3A 2EM9A 4DXBA 4DI4B 1N7WA 2E0SA 2JOXA 1IMCA 5CMCA 2YTQA 4H45A 4XKNA 4LF5E 5L8DA 2Z23A 4DUZE 1Y3QA 4F29A 5IXMB 3L6GA 4F54A 3C9HA 2VQEE 1B5JA 3OD7A 3ISPA 3N94A 1WRJA 2VD3A 4N4UA 5F1QA 5IZ3B 1NV4A 5DEXB 2EOHA 1N33E 3FATA 1X49A 4H1XA 1IUDA 1P1OA 3E3KA 2QVUA 1S7YA 4GXSB 4Q5TA 5EQ8A 3OOAA 4MNIA 4R2CA 1UTHA 3B50A 4TUGA 1NV1A 2RTXA 1EYIA 5EYFA 2EN6A 4MLQA 1MXXA 4GWWA 2R71A 4NWDA 2RQLA 2HQ0A 3ODBA 4MLVA 3LMLA 2QMWA 3IX1A 2VT5A 4WKMA 3JAMC 2MKNA 2O1MA 2LBSB 1SDXA 4ZECA 1IBME 1D3KA 3I6VA 2EMGA 4U21A 3OSQA 2I3VA 3JZJA 1QUIA 2UVJA 3H6WA 4H5GA 1PKPA 5H8SA 1INPA 4HXVA 5K2XA 1NV3A 5H8NA 4QFLA 2I58A 4K0KE 1AL3A 2GRVA 1MGTA 3V8XB 3ADLA 4PCDA 4JI3E 4JV5E 2XWKA 5LL6R 4F1UA 1POTA 3H06B 2WBSA 2EPRA 2WBUA 2V85A 4JI0E 2XXTA 4JI7E 1URGA 1Y3PA 3MSTA 1Z7NE 1MG1A 2EOOA 3DELB 4DE8A 1X5WA 4N15A 2LE2A 1B4HA 2DSFA 5LOMA 3ZKLA 1YCJA 3P7IA 5DTBA 1MM7A 1PBQA 2DWIA 1Z1BA 3KGCA 1LGBC 2EE8A 3MZBA 4I3YA 2IHR1 1ZIUA 2HGHA 3HO7A 1LAXA 4NEDA 4IB2A 1FW0A 2F8DA 1FPGA 2IA4A 4HE0A 1B1HA 4YKPA 3LUZA 3U93A 4AS5A 3G3GA 1LBXA 3G3FA 1GZ6A 3HHFA 2LTSA 3TZAA 3O66A 4F9CB 3CSBA 4OYVA 3G3HA 4I40A 4XXUA 2VGQA 2R1FA 5FBPA 5LTCA 4C0RA 2V88A 4MX6A 1AH5A 4X9TA 3JTZA 3UK4A 3K02A 4HW8A 2VP1A 2R8TA 2LV2A 1LBYA 2ZYNA 2EPOA 1TFAA 1US4A 2F7BA 1Y4TA 2FIEA 4GVOA 3ONMA 3KC0A 2R6GE 2O7UA 2EPCA 2H5YA 2EZ6A 4IO2A 2ODRC 2BJIA 1FTAA 2ZZVA 2ZYKA 2VQFE 2CMOA 4DV7E 4C1TA 3C4BA 1S9TA 4P7DA 1NV7A 4XF5A 4KFQA 1FQDA 1QGXA 2ZZXA 4J8ZA 2VD2A 5I2KA 1DPPA 2YRKA 4NF4B 2EMYA 3M3KA 1NUZA 2Y7IA 4NHRA 2HCAA 3QUJA 1NV0A 3LBSA 4OVJA 1B9JA 2F78A 4F2QA 4NXME 4X8RA 1A1LA 2DE2A 1Q9DA 3T0JA 4DV0E 4F6MA 3K6WA 1IZ1A 4ND9A 3MYUA 1NNPA 3SEWA 2QL3A 5DYHA 2EMAA 4GLIA 1FQCA 2XD3A 3T93B 1JK2A 4YU0A 3N5LA 3CG3A 1RDXA 2CZIA 2RC7A 1TFDA 5H8QA 3K0VA 5ITPA 2QFLA 3JYRA 1YAEA 2RINA 1YFHA 5B70A 1XNQE 3UGWA 2E1MA 3D4GA 4KQPA 2LJHA 1KWHA 3FGSA 2PFYA 4OFOA 1TF6A 1D9VA 3CIJA 1JP4A 3OMLA 3A3UA 4LF6E 1J1NA 4DR2E 2DS9A 2QS4A 2PYYA 3TCGA 3KN7A 1H43A 5CMKA 1YZ9A 5CBRA 5JK4A 2M4IA 4KPTA 2H4IA 4F3PA 1NV5A 2EMXA 3IOTA 1IMUA 4BDRA 3GXAA 1PDAA 3U8QA 5TSEA 3FVKA 4RYAA 3LSFB 3IORA 2V3TA 5FHMA 2V84A 3W9VA 2B3TB 1QULA 1D4NA 2PFZA 2ZNUA 3O9PA 1URSA 3QK6A 1A1JA 4NF6A 2WBTA 1B6HA 5LMNE 1J5EE 1SI0A 4PFWA 3PTYA 1FTKA 2PCRA 3VXBA 2AIXA 3O28A 1X6HA 1UBDC 2O69A 3GYYA 1A1IA 5AASA 4YY3E 5FTHA 5EHMA 2K7IA 2F6PA 4FIMA 3C6MA 4QFNA 1JVYA 4P8BA 3MWBA 1O7TA 2FYIA 3N26A 1JVXA 4H5FA 2Z22A 1RYOA 1JEVA 1PJQA 2ADRA 4WSPA 2LAOA 1D9QA 2VE7C 3FXQA 2Z8FA 2NVUB 3MPKA 1NH8A 4R2QA 2FVZA 4Z7EA 4OVTA 4DR6E 5JTYB 3O2AA 2WBDA 3TODA 3FVNA 4OFJA 4O7IA 1FJ6A 4BDOA 4F2JC 1A1GA 4G61A 1IMEA 1MY0A 4N6KA 4YAHX 1FKAE 3J7Yp
chains in the Genus database with same CATH topology
1DTZA 1H44A 4QFOA 1UTBA 2P0SA 4WEDA 2V25A 2QPQA 4ZE9A 3SKPA 3C34A 4RPOA 4U2RA 3PUZE 1GGGA 3I5OA 4MH5A 3L6HA 3PMWA 3QAXA 4EF2A 4RNSA 1H76A 3H7MA 1ZU0A 2OZZA 2XX7A 3T22A 5AA4A 2B3BA 3TMGA 3I3VA 2HAUA 4YZZA 4UACA 2DWHA 4YB6A 1I6QA 3G3KA 1XC1A 1Y1MA 2HAVA 2XXIA 3Q28A 4FATA 4F22A 3LSLA 4RPNA 3OMBA 4QHQA 2XHDA 5L9OA 3DP4A 2NWJA 2WKYA 1ZJLA 3QXMA 4HCYA 2Y7WA 3TPAA 1QKAA 3C33A 4RY1A 4LZ8A 4F39A 1IXCA 4QSEA 3U1OA 3UA8A 2X26A 1N0TA 3PV0E 4NF8A 1MPBA 3K2DA 3DP8A 4RK9A 3LSWA 3BFTA 3TTLA 1I6AA 5I58A 2HZKA 2YJPA 1LLSA 3SEVA 3KOSA 1D9YA 4MF3A 1R1NA 1B3LA 3K1MA 3RLFE 4NF5A 3KJTA 2R9JA 3FV1A 4DIGA 4QFPA 4FAJA 4XKPA 5H8HB 2XXVA 2I4BA 1MH4A 2DXRA 4OQOA 4OEVA 5I56A 1B0HA 1R9LA 2Z8DA 4KCDA 4ESXA 2I6EA 4E0XA 2Y7KA 2YLNA 1PB9A 5TU0A 4LQ2A 3KEIA 4TLLB 2W7YA 1PB8A 4H6DA 4DZ1A 4LATA 2UVHA 1SYIA 4U22A 2XXYA 3U92A 3K01A 4KD5A 3KG2A 4OERA 4G2ZA 3HHGA 2F7AA 1SW2A 2E1SA 4C1UA 4H8IA 3B6QA 4F31B 1T0KA 3PMXA 5H8FA 4H8JA 5K2YA 3PPNA 2ESNA 3O6IA 1B51A 1I6BA 3IL1B 2OK2A 5CMMA 5FHOA 1JEUA 2AL4A 2PVUA 4TQUQ 1MXYA 1JQFA 4OESA 4R2BA 4ZEDA 1PB7A 3IAZA 1ZLQA 2ALUA 3K1PA 3FXUA 2ZYMA 3H6UA 4BLAA 4Z0IA 4LA9A 3GBAA 3LR1A 3CRBA 2XX8A 2ANJA 5I2NA 2A5TB 3K1NA 1OVTA 3DLNA 4IO5A 2XXHA 1MY1A 1Y4CA 3QYTA 2QSXA 3SEYA 1USYH 2QS1A 3W9WA 1TXFA 3V5AA 4LZ5A 1BKAA 3OEKA 1B1XA 1USYE 3H03A 3D4CA 3HV1A 3VDFA 3C31A 5TP9A 4F18A 4R9GA 4ESWA 3K6UA 5I59B 1ZMGA 3MQ9A 3LSXA 1L5TA 3PGFA 4ISUA 2DOJA 1MQGA 4EXKA 1WODA 5HBCA 4XIGQ 4F3BA 1SYHA 4EQ7A 3IOUA 1LCTA 1N04A 2QS3A 3QUFA 4JSDA 4E0WA 3O6HA 1P1NA 3S2VA 5AA2B 4GL8A 5ISUA 1B7ZA 4G68B 4POWA 1B32A 4R2FA 1XT8A 2XXXA 1XS5A 1R9QA 3M3FA 4YB5A 4JBZA 2FNCA 1MQDA 1HSEA 1B3GA 2YPNA 3OENA 4ZDMA 3FUZA 4YKKA 3RT6B 1EH3A 3G3IA 3RTFB 3T9UA 3VVDA 1PC3A 1N84A 1FQBA 3PPPA 4G77A 2OWSA 2XXUA 4IO7A 4HCWA 2F7CA 3SETA 1NKXA 2B65A 1Y20A 5A5XA 3OSRA 3R6UA 5DVIA 1WDNA 4F19A 3K6VA 1MM6A 4GFRA 3KSJA 2XD2A 3VVEA 4YMBA 2QJEA 4ZZAA 1IXGA 1R6ZA 4DXUA 4BDLA 4JWYA 3GZGA 1B2HA 3PD9A 2ONSA 1LSTA 3HCQA 2F97A 3K00A 1FTMA 4I1DA 1JETA 1P1WA 3VXCA 4IY6A 4OZ9A 3VLWA 1EU8A 3B6WA 4U4XA 1FQFA 5L9SA 2OLBA 3CFXA 4P11A 2H99A 1B7HA 2XXQA 5I57B 1MQJA 2I3WA 4H0WA 3O29A 3U72A 1B3HA 4KI0E 1N76A 5EHSA 1B3EA 1DPEA 5TPAA 1P1UA 5KDTA 1NNKA 1AMFA 4OTEA 1SW5A 1EZPA 2DE4A 2AL5A 2Z8EA 1UTHB 2F5XA 2OJTA 3TKDA 1OQGA 3LUYA 3G3JA 4JWOA 3FASA 3Q27A 3MVYA 1QUKA 4ZEFA 1SQYA 4EUOA 4FEBA 4DCXA 2RC8A 1Q1KA 5H8NB 4RK2A 5IKBA 4UA8A 4OETA 1B05A 3V89B 1ZBMA 5FTIA 3RGYA 1VR5A 3MVZA 4YKIA 3SESA 4IGRA 2ZXTA 4Q8RA 2DWJA 4PQJA 4PFUA 4N13A 2ONKE 3GLBA 3TDJA 1LBCA 3FV2A 4JSOA 4Q30B 4O3AA 1TT1A 4IO6A 4R6HA 1SD3A 2F6GA 2I4CA 4WXJA 2H9BA 1XHYA 1MY4A 5F7VA 5H8HA 3RTWB 5I84A 1RYXA 3UORA 2PMSA 4AB6A 3O6GA 1NFTA 3TAJA 3QSLA 4DCYA 3TQWA 1POY1 1M5DA 4M4GA 5DVFA 2NOOA 5KCJA 3MC2A 2UYEA 2H25A 4ZE8A 1DTGA 4R9FA 1FTLA 4JXIA 2PT1A 3S9NC 1CB6A 1LAFE 4GRKA 1YTVA 3KZGA 3PUYE 2QRYA 3IR1A 4L17A 3UN6A 3DM0A 1B46A 3O97A 3RY3A 3EF7A 1MXZA 3BBRA 3T9VA 1F9BA 2HXWA 1XVXA 1M5CA 3IB1A 2V93A 1A8FA 1QW0A 5I2KB 4OEUA 2F34A 4GIZA 1LFGA 3KN3A 2UVGA 3CR9A 3EHUA 1LFHA 4GQOA 4YMAA 2ZYOA 3T9XB 5ITOA 1UIVA 4ZEBA 3PD8A 2A5SA 1MRPA 4F1VA 2ZMBA 2B3FA 3C32A 1S50A 5DEXA 1SW1A 4M1VA 2Q88A 3CSGA 5AA1A 2Y7PA 3A09A 2PBWA 3E4RA 4RA1A 1OQHA 1EZ9A 1MS7A 2Y84A 1MPDA 2X7PA 4YICA 3KN8A 3SERA 4WEPA 4PFTA 3UIFA 3H4ZA 3HN0A 2OBGA 2I49A 2HEUA 4H65A 4YKJA 4F1YA 2PT2A 3ZS6A 2AYSA 3MP1A 3MP6A 3Q29A 1B58A 5M2VA 2NUVA 4HTGA 3TTKA 4NF6B 2DWAA 4JWXA 2H98A 3MPLA 5L9MA 2VOZA 4IY5A 1AIVA 4F2OA 3FD3A 3TTRA 5BWJA 3TFLA 2ZNTA 4GD5A 3S9LC 5CBSA 4LP2B 1N3WA 3OELA 4FECA 4X1BA 2DXYA 3CG1A 1XVYA 4OENA 3H6VA 3DP6A 3IJOB 1BLFA 2G29A 5J1DA 3VVFA 1MY3A 3SDFA 1XOCA 3OO6A 1US5A 4H67A 3EHTA 1MXVA 3FIRA 1LB8A 1OMPA 1IEJA 4G68C 2O84X 2D3IA 1UTBB 2PX1A 4EF1A 1LB9A 2V3QA 2DYXA 3N6UA 3SEUA 3OO7A 4KR5A 1VE4A 2HZLA 3PPRA 3R26A 3MVWA 4QRZA 4ELRA 2M8CA 3PPQA 3GBBA 2XXRA 1A7LA 3FJMA 3LC8A 4AQ4A 1P99A 4I62A 3CI8A 1SVXB 1O64A 2FA7A 3RQTA 3TCFA 4R6YA 3C4MA 4NF4A 4R72A 5I57A 4GOTA 3HPIA 1LAGE 4FEDA 2REGA 4TLMB 4XKQA 5CRYA 1DMBA 4FORA 4AB5A 2Q2CA 3S4UA 4U23A 3R7XA 4Q0CA 1B5HA 3THIA 2V3UA 1B52A 1IXIA 3OO9A 4ZZEA 5FHNA 5BUUA 3H3GA 4NTLA 2Q9TA 3WAFA 3ILUB 4NF8B 3IO4A 3FJ7A 3EQ1A 5CC2A 3CFLA 5I58B 3KSXA 4PE5B 4DDDA 1B7UA 1P1QA 3PPOA 3FVOA 1NNTA 3E13X 4NF5B 4R6KA 3W15C 3VFJA 1JW4A 4THIA 4KYDA 4U1ZA 4DLDA 1OIBA 5I56B 4XTCQ 2O68A 2XX9A 3T96B 3TUSA 1DSNA 1UIUA 4X1DA 3T66A 1QUJA 2XXWA 3K6XA 4P0IA 3AXFA 5IAIA 1IITA 5ICTA 1YPNA 3TTMA 5AA3A 5ICQA 1B3FA 3RT8A 4NWCA 4OHNA 4MFIA 1Q35A 3OO8A 1A55A 2OCUA 2XXPA 1N3XA 4G4PA 1BTJA 4ZEKA 3VE1B 1M5BA 2P1SA 4OMBA 2GHAA 3CFZA 5H8FB 4FJPA 2F36A 2I48A 5KZTA 1PBPA 1VFDA 1OVBA 3PUVE 2Q8JA 3VLUA 1SW4A 4ZS9A 3IB2A 4BDNA 4LQ5A 5HPQA 5JTYA 1RKMA 3A3CA 4OFLA 4EDPA 3EHSA 3ZKKA 1GVCA 3Q26A 5B7DA 4LVQA 2Q2AA 1N7XA 5I2NB 2UYFA 3MJNA 1H3DA 1URDA 3N6TA 4R73A 1Z7ME 1B4ZA 3WAEA 4JB7A 1MXWA 3CVGA 1Y1ZA 4ONYA 3M3LA 1AOVA 3S9MC 2X7QA 4POXA 4X48A 3TQLA 4ELOA 1IXHA 3TTNA 3TEPA 3ECRA 1TWYA 1NNFA 4BDMA 1HSLA 1NL5A 1ZKBA 2O1LA 2F35A 4IO4A 3EPEA 5TP9B 4PP0A 4QSCA 2GH9A 3B6TA 4U1OA 1B5IA 4I9DA 5DT6A 2O7IA 3IJXB 2UVIA 1II5A 2I0CA 4R75A 3PUWE 3E9XA 3C36A 1FQEA 1M5EA 3ILTB 2I0BA 4KYSA 3RNNA 1B40A 3S9EA 2O51A 1PEBA 3KBRA 3MUQA 1BP5A 1SBPA 1BIYA 3H6TA 1LCFA 3OXNA 1MDQA 1A8EA 4QSDA 3USDA 4NMYA 4DXCA 2RC9A 4JDFA 3SEXA 3K4UA 1QKBA 4N07A 1MH3A 3VV5A 4IO3A 2BJJX 1QJMA 3RN8A 3V83A 2Q89A 4ELPA 1EZOA 4LZ7A 1HSJA 4HS7A 5A5XB 2ONRA 3MBPA 2THIA 3C35A 2HFBA 1GV8A 2GHBA 3PUXE 4O3BA 5CI5A 1MY2A 4KYEA 1B0LA 3ZSFA 4G8NA 3RUMA 4GF8A 3T9HB 2GFEA 3U94A 1ELJA 4OWDA 4EXLA 1JW5A 2REJA 2O6AA 2Y7RA 3JV9A 1WVJA 4OXVA 4ECFA 3MAMA 3EN3A 4GWOA 4N6PA 1A40A 3RPWA 4RXLA 3PU5A 5TPAB 2RKMA 4QF9A 4ZEIA 2ABHA 5KDTB 2CZLA 1IIWA 1A54A 3PMVA 3MW0A 2RF1A 4G8HA 1VFEA 2RCBA 1MPCA 2A5TA 1LBBA 5HM4B 3HSTA 4TOZA 4LONB 5JEIA 1JNFA 3FXRA 5H8QB 1FTOA 2VHAA 3FJGA 4FE8A 2OWTA 4IGTA 2DQVA 3BFUA 3VLVA 3IO6A 3FVGA 5CMBA 3UP9A 4EQBA 1A99A 1OLAA 3IB0A 3MZ9A 4KHZE 2DVZA 4NE4A 5AA2D 3G7WA 1IQ7A 4PETA 1CE2A 4GL0A 1O63A 1DOTA 3MZ1A 4KCCA 5I59A 3F11A 2UXAA 1I69A 1NH7A 1ATGA 3FZVA 4YB7A 3MP8A 2IEEA 1MQIA 3KFMA 1VSOA 1QVSA 2QMXA 2ZNSA 2D5WA 3IK6B 3IOVA 2RCAA 1M5FA 2QS2A 4F3SA 1ZTYA 1LAHE 2D21A 1FQAA 2P2AA 5CM6A 4LUBA 5AA2A 4G68A 3M8UA 3TELA 1LFIA 4PFYA 3KOTA 1ANFA 4BDQA 1UQWA 4GXAA 4G8MA 5KCJB 4RJZA 2DVCA 4ELQA 3BKIB 2NXOA 4U4SA 1MDP1 3TCHA 4F3GA 3OEMA 4QFKA 4R74A 1Y3NA 2G93A 1OLCA 1H45A 1GR2A 1MXUA 5AE4A 3MVXA 1FCKA 4O3CA 5DVJA 3KJ7A 1FTJA 5ELVA 4K3FA 4EQ9A 4MBPA 3QIMA 1MQHA 3IOWA 1GTKA 1NMUA 1JW1A 4XKRA 2DP8A 5AA4B 3TYHA 3B7DA 1Y9UA 2KLFA 3Q25A 4I8CA 4P0GA 1SI1A 2DE3A 4DXBA 1N7WA 2E0SA 5CMCA 4XKNA 5L8DA 2Z23A 1Y3QA 4F29A 3L6GA 3C9HA 1B5JA 3OD7A 3N94A 2VD3A 5F1QA 5DEXB 3FATA 4H1XA 1IUDA 1P1OA 3E3KA 4GXSB 1S7YA 4Q5TA 3OOAA 1UTHA 5EYFA 4MLQA 1MXXA 2R71A 4NWDA 2HQ0A 3ODBA 4MLVA 2QMWA 3IX1A 4WKMA 2O1MA 1SDXA 4ZECA 1D3KA 3I6VA 4U21A 3OSQA 2I3VA 3JZJA 1QUIA 2UVJA 3H6WA 4H5GA 5H8SA 5K2XA 5H8NA 4QFLA 2I58A 1AL3A 2GRVA 3V8XB 4F1UA 1POTA 3H06B 2XXTA 1URGA 1Y3PA 1Z7NE 1MG1A 3DELB 4DE8A 1B4HA 2DSFA 5LOMA 3ZKLA 1YCJA 3P7IA 5DTBA 1MM7A 1PBQA 2DWIA 3KGCA 1LGBC 3MZBA 1ZIUA 3HO7A 1LAXA 4NEDA 4IB2A 1FW0A 2F8DA 2IA4A 1B1HA 4YKPA 3U93A 3G3GA 3G3FA 3HHFA 3TZAA 3O66A 3CSBA 4OYVA 3G3HA 4XXUA 2VGQA 4C0RA 1AH5A 4X9TA 3UK4A 3K02A 4HW8A 2VP1A 2ZYNA 1TFAA 1US4A 2F7BA 1Y4TA 4GVOA 3ONMA 2R6GE 2O7UA 2H5YA 4IO2A 2ZYKA 2CMOA 4C1TA 1S9TA 4KFQA 1FQDA 2VD2A 5I2KA 1DPPA 4NF4B 3M3KA 2Y7IA 2HCAA 3QUJA 3LBSA 4OVJA 1B9JA 2F78A 4F2QA 2DE2A 3K6WA 1IZ1A 4ND9A 3SEWA 1NNPA 2QL3A 5DYHA 4GLIA 1FQCA 2XD3A 3T93B 4YU0A 3N5LA 3CG3A 2RC7A 1TFDA 5H8QA 3K0VA 5ITPA 3JYRA 1YAEA 2RINA 5B70A 3UGWA 3D4GA 4KQPA 1KWHA 3FGSA 4OFOA 1D9VA 3CIJA 3A3UA 1J1NA 2DS9A 2QS4A 2PYYA 3TCGA 3KN7A 1H43A 5CMKA 5CBRA 5JK4A 4KPTA 2H4IA 4F3PA 3IOTA 4BDRA 3GXAA 1PDAA 3U8QA 3FVKA 4RYAA 3LSFB 3IORA 2V3TA 5FHMA 2V84A 3W9VA 1QULA 1D4NA 2ZNUA 3O9PA 1URSA 3QK6A 4NF6A 1B6HA 1SI0A 4PFWA 1FTKA 3VXBA 2AIXA 3O28A 2O69A 5FTHA 5EHMA 2F6PA 4FIMA 4QFNA 1JVYA 3MWBA 1O7TA 2FYIA 3N26A 1JVXA 4H5FA 2Z22A 1RYOA 1JEVA 2LAOA 3FXQA 2Z8FA 2NVUB 3MPKA 1NH8A 4Z7EA 5JTYB 3O2AA 3TODA 3FVNA 4OFJA 4BDOA 1MY0A 4YAHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTZ A;  1H44 A;  4QFO A;  1UTB A;  2P0S A;  4WED A;  2V25 A;  2QPQ A;  4ZE9 A;  3SKP A;  3C34 A;  4RPO A;  4U2R A;  3PUZ E;  1GGG A;  3I5O A;  4MH5 A;  3L6H A;  3PMW A;  3QAX A;  4EF2 A;  4RNS A;  1H76 A;  3H7M A;  1ZU0 A;  2OZZ A;  2XX7 A;  3T22 A;  5AA4 A;  2B3B A;  3TMG A;  3I3V A;  2HAU A;  4YZZ A;  4UAC A;  2DWH A;  4YB6 A;  1I6Q A;  3G3K A;  1XC1 A;  1Y1M A;  2HAV A;  2XXI A;  3Q28 A;  4FAT A;  4F22 A;  3LSL A;  4RPN A;  3OMB A;  4QHQ A;  2XHD A;  5L9O A;  3DP4 A;  2NWJ A;  2WKY A;  1ZJL A;  3QXM A;  4HCY A;  2Y7W A;  3TPA A;  1QKA A;  3C33 A;  4RY1 A;  4LZ8 A;  4F39 A;  1IXC A;  4QSE A;  3U1O A;  3UA8 A;  2X26 A;  1N0T A;  3PV0 E;  4NF8 A;  1MPB A;  3K2D A;  3DP8 A;  4RK9 A;  3LSW A;  3BFT A;  3TTL A;  1I6A A;  5I58 A;  2HZK A;  2YJP A;  1LLS A;  3SEV A;  3KOS A;  1D9Y A;  4MF3 A;  1R1N A;  1B3L A;  3K1M A;  3RLF E;  4NF5 A;  3KJT A;  2R9J A;  3FV1 A;  4DIG A;  4QFP A;  4FAJ A;  4XKP A;  5H8H B;  2XXV A;  2I4B A;  1MH4 A;  2DXR A;  4OQO A;  4OEV A;  5I56 A;  1B0H A;  1R9L A;  2Z8D A;  4KCD A;  4ESX A;  2I6E A;  4E0X A;  2Y7K A;  2YLN A;  1PB9 A;  5TU0 A;  4LQ2 A;  3KEI A;  4TLL B;  2W7Y A;  1PB8 A;  4H6D A;  4DZ1 A;  4LAT A;  2UVH A;  1SYI A;  4U22 A;  2XXY A;  3U92 A;  3K01 A;  4KD5 A;  3KG2 A;  4OER A;  4G2Z A;  3HHG A;  2F7A A;  1SW2 A;  2E1S A;  4C1U A;  4H8I A;  3B6Q A;  4F31 B;  1T0K A;  3PMX A;  5H8F A;  4H8J A;  5K2Y A;  3PPN A;  2ESN A;  3O6I A;  1B51 A;  1I6B A;  3IL1 B;  2OK2 A;  5CMM A;  5FHO A;  1JEU A;  2AL4 A;  2PVU A;  4TQU Q;  1MXY A;  1JQF A;  4OES A;  4R2B A;  4ZED A;  1PB7 A;  3IAZ A;  1ZLQ A;  2ALU A;  3K1P A;  3FXU A;  2ZYM A;  3H6U A;  4BLA A;  4Z0I A;  4LA9 A;  3GBA A;  3LR1 A;  3CRB A;  2XX8 A;  2ANJ A;  5I2N A;  2A5T B;  3K1N A;  1OVT A;  3DLN A;  4IO5 A;  2XXH A;  1MY1 A;  1Y4C A;  3QYT A;  2QSX A;  3SEY A;  1USY H;  2QS1 A;  3W9W A;  1TXF A;  3V5A A;  4LZ5 A;  1BKA A;  3OEK A;  1B1X A;  1USY E;  3H03 A;  3D4C A;  3HV1 A;  3VDF A;  3C31 A;  5TP9 A;  4F18 A;  4R9G A;  4ESW A;  3K6U A;  5I59 B;  1ZMG A;  3MQ9 A;  3LSX A;  1L5T A;  3PGF A;  4ISU A;  2DOJ A;  1MQG A;  4EXK A;  1WOD A;  5HBC A;  4XIG Q;  4F3B A;  1SYH A;  4EQ7 A;  3IOU A;  1LCT A;  1N04 A;  2QS3 A;  3QUF A;  4JSD A;  4E0W A;  3O6H A;  1P1N A;  3S2V A;  5AA2 B;  4GL8 A;  5ISU A;  1B7Z A;  4G68 B;  4POW A;  1B32 A;  4R2F A;  1XT8 A;  2XXX A;  1XS5 A;  1R9Q A;  3M3F A;  4YB5 A;  4JBZ A;  2FNC A;  1MQD A;  1HSE A;  1B3G A;  2YPN A;  3OEN A;  4ZDM A;  3FUZ A;  4YKK A;  3RT6 B;  1EH3 A;  3G3I A;  3RTF B;  3T9U A;  3VVD A;  1PC3 A;  1N84 A;  1FQB A;  3PPP A;  4G77 A;  2OWS A;  2XXU A;  4IO7 A;  4HCW A;  2F7C A;  3SET A;  1NKX A;  2B65 A;  1Y20 A;  5A5X A;  3OSR A;  3R6U A;  5DVI A;  1WDN A;  4F19 A;  3K6V A;  1MM6 A;  4GFR A;  3KSJ A;  2XD2 A;  3VVE A;  4YMB A;  2QJE A;  4ZZA A;  1IXG A;  1R6Z A;  4DXU A;  4BDL A;  4JWY A;  3GZG A;  1B2H A;  3PD9 A;  2ONS A;  1LST A;  3HCQ A;  2F97 A;  3K00 A;  1FTM A;  4I1D A;  1JET A;  1P1W A;  3VXC A;  4IY6 A;  4OZ9 A;  3VLW A;  1EU8 A;  3B6W A;  4U4X A;  1FQF A;  5L9S A;  2OLB A;  3CFX A;  4P11 A;  2H99 A;  1B7H A;  2XXQ A;  5I57 B;  1MQJ A;  2I3W A;  4H0W A;  3O29 A;  3U72 A;  1B3H A;  4KI0 E;  1N76 A;  5EHS A;  1B3E A;  1DPE A;  5TPA A;  1P1U A;  5KDT A;  1NNK A;  1AMF A;  4OTE A;  1SW5 A;  1EZP A;  2DE4 A;  2AL5 A;  2Z8E A;  1UTH B;  2F5X A;  2OJT A;  3TKD A;  1OQG A;  3LUY A;  3G3J A;  4JWO A;  3FAS A;  3Q27 A;  3MVY A;  1QUK A;  4ZEF A;  1SQY A;  4EUO A;  4FEB A;  4DCX A;  2RC8 A;  1Q1K A;  5H8N B;  4RK2 A;  5IKB A;  4UA8 A;  4OET A;  1B05 A;  3V89 B;  1ZBM A;  5FTI A;  3RGY A;  1VR5 A;  3MVZ A;  4YKI A;  3SES A;  4IGR A;  2ZXT A;  4Q8R A;  2DWJ A;  4PQJ A;  4PFU A;  4N13 A;  2ONK E;  3GLB A;  3TDJ A;  1LBC A;  3FV2 A;  4JSO A;  4Q30 B;  4O3A A;  1TT1 A;  4IO6 A;  4R6H A;  1SD3 A;  2F6G A;  2I4C A;  4WXJ A;  2H9B A;  1XHY A;  1MY4 A;  5F7V A;  5H8H A;  3RTW B;  5I84 A;  1RYX A;  3UOR A;  2PMS A;  4AB6 A;  3O6G A;  1NFT A;  3TAJ A;  3QSL A;  4DCY A;  3TQW A;  1POY 1;  1M5D A;  4M4G A;  5DVF A;  2NOO A;  5KCJ A;  3MC2 A;  2UYE A;  2H25 A;  4ZE8 A;  1DTG A;  4R9F A;  1FTL A;  4JXI A;  2PT1 A;  3S9N C;  1CB6 A;  1LAF E;  4GRK A;  1YTV A;  3KZG A;  3PUY E;  2QRY A;  3IR1 A;  4L17 A;  3UN6 A;  3DM0 A;  1B46 A;  3O97 A;  3RY3 A;  3EF7 A;  1MXZ A;  3BBR A;  3T9V A;  1F9B A;  2HXW A;  1XVX A;  1M5C A;  3IB1 A;  2V93 A;  1A8F A;  1QW0 A;  5I2K B;  4OEU A;  2F34 A;  4GIZ A;  1LFG A;  3KN3 A;  2UVG A;  3CR9 A;  3EHU A;  1LFH A;  4GQO A;  4YMA A;  2ZYO A;  3T9X B;  5ITO A;  1UIV A;  4ZEB A;  3PD8 A;  2A5S A;  1MRP A;  4F1V A;  2ZMB A;  2B3F A;  3C32 A;  1S50 A;  5DEX A;  1SW1 A;  4M1V A;  2Q88 A;  3CSG A;  5AA1 A;  2Y7P A;  3A09 A;  2PBW A;  3E4R A;  4RA1 A;  1OQH A;  1EZ9 A;  1MS7 A;  2Y84 A;  1MPD A;  2X7P A;  4YIC A;  3KN8 A;  3SER A;  4WEP A;  4PFT A;  3UIF A;  3H4Z A;  3HN0 A;  2OBG A;  2I49 A;  2HEU A;  4H65 A;  4YKJ A;  4F1Y A;  2PT2 A;  3ZS6 A;  2AYS A;  3MP1 A;  3MP6 A;  3Q29 A;  1B58 A;  5M2V A;  2NUV A;  4HTG A;  3TTK A;  4NF6 B;  2DWA A;  4JWX A;  2H98 A;  3MPL A;  5L9M A;  2VOZ A;  4IY5 A;  1AIV A;  4F2O A;  3FD3 A;  3TTR A;  5BWJ A;  3TFL A;  2ZNT A;  4GD5 A;  3S9L C;  5CBS A;  4LP2 B;  1N3W A;  3OEL A;  4FEC A;  4X1B A;  2DXY A;  3CG1 A;  1XVY A;  4OEN A;  3H6V A;  3DP6 A;  3IJO B;  1BLF A;  2G29 A;  5J1D A;  3VVF A;  1MY3 A;  3SDF A;  1XOC A;  3OO6 A;  1US5 A;  4H67 A;  3EHT A;  1MXV A;  3FIR A;  1LB8 A;  1OMP A;  1IEJ A;  4G68 C;  2O84 X;  2D3I A;  1UTB B;  2PX1 A;  4EF1 A;  1LB9 A;  2V3Q A;  2DYX A;  3N6U A;  3SEU A;  3OO7 A;  4KR5 A;  1VE4 A;  2HZL A;  3PPR A;  3R26 A;  3MVW A;  4QRZ A;  4ELR A;  2M8C A;  3PPQ A;  3GBB A;  2XXR A;  1A7L A;  3FJM A;  3LC8 A;  4AQ4 A;  1P99 A;  4I62 A;  3CI8 A;  1SVX B;  1O64 A;  2FA7 A;  3RQT A;  3TCF A;  4R6Y A;  3C4M A;  4NF4 A;  4R72 A;  5I57 A;  4GOT A;  3HPI A;  1LAG E;  4FED A;  2REG A;  4TLM B;  4XKQ A;  5CRY A;  1DMB A;  4FOR A;  4AB5 A;  2Q2C A;  3S4U A;  4U23 A;  3R7X A;  4Q0C A;  1B5H A;  3THI A;  2V3U A;  1B52 A;  1IXI A;  3OO9 A;  4ZZE A;  5FHN A;  5BUU A;  3H3G A;  4NTL A;  2Q9T A;  3WAF A;  3ILU B;  4NF8 B;  3IO4 A;  3FJ7 A;  3EQ1 A;  5CC2 A;  3CFL A;  5I58 B;  3KSX A;  4PE5 B;  4DDD A;  1B7U A;  1P1Q A;  3PPO A;  3FVO A;  1NNT A;  3E13 X;  4NF5 B;  4R6K A;  3W15 C;  3VFJ A;  1JW4 A;  4THI A;  4KYD A;  4U1Z A;  4DLD A;  1OIB A;  5I56 B;  4XTC Q;  2O68 A;  2XX9 A;  3T96 B;  3TUS A;  1DSN A;  1UIU A;  4X1D A;  3T66 A;  1QUJ A;  2XXW A;  3K6X A;  4P0I A;  3AXF A;  5IAI A;  1IIT A;  5ICT A;  1YPN A;  3TTM A;  5AA3 A;  5ICQ A;  1B3F A;  3RT8 A;  4NWC A;  4OHN A;  4MFI A;  1Q35 A;  3OO8 A;  1A55 A;  2OCU A;  2XXP A;  1N3X A;  4G4P A;  1BTJ A;  4ZEK A;  3VE1 B;  1M5B A;  2P1S A;  4OMB A;  2GHA A;  3CFZ A;  5H8F B;  4FJP A;  2F36 A;  2I48 A;  5KZT A;  1PBP A;  1VFD A;  1OVB A;  3PUV E;  2Q8J A;  3VLU A;  1SW4 A;  4ZS9 A;  3IB2 A;  4BDN A;  4LQ5 A;  5HPQ A;  5JTY A;  1RKM A;  3A3C A;  4OFL A;  4EDP A;  3EHS A;  3ZKK A;  1GVC A;  3Q26 A;  5B7D A;  4LVQ A;  2Q2A A;  1N7X A;  5I2N B;  2UYF A;  3MJN A;  1H3D A;  1URD A;  3N6T A;  4R73 A;  1Z7M E;  1B4Z A;  3WAE A;  4JB7 A;  1MXW A;  3CVG A;  1Y1Z A;  4ONY A;  3M3L A;  1AOV A;  3S9M C;  2X7Q A;  4POX A;  4X48 A;  3TQL A;  4ELO A;  1IXH A;  3TTN A;  3TEP A;  3ECR A;  1TWY A;  1NNF A;  4BDM A;  1HSL A;  1NL5 A;  1ZKB A;  2O1L A;  2F35 A;  4IO4 A;  3EPE A;  5TP9 B;  4PP0 A;  4QSC A;  2GH9 A;  3B6T A;  4U1O A;  1B5I A;  4I9D A;  5DT6 A;  2O7I A;  3IJX B;  2UVI A;  1II5 A;  2I0C A;  4R75 A;  3PUW E;  3E9X A;  3C36 A;  1FQE A;  1M5E A;  3ILT B;  2I0B A;  4KYS A;  3RNN A;  1B40 A;  3S9E A;  2O51 A;  1PEB A;  3KBR A;  3MUQ A;  1BP5 A;  1SBP A;  1BIY A;  3H6T A;  1LCF A;  3OXN A;  1MDQ A;  1A8E A;  4QSD A;  3USD A;  4NMY A;  4DXC A;  2RC9 A;  4JDF A;  3SEX A;  3K4U A;  1QKB A;  4N07 A;  1MH3 A;  3VV5 A;  4IO3 A;  2BJJ X;  1QJM A;  3RN8 A;  3V83 A;  2Q89 A;  4ELP A;  1EZO A;  4LZ7 A;  1HSJ A;  4HS7 A;  5A5X B;  2ONR A;  3MBP A;  2THI A;  3C35 A;  2HFB A;  1GV8 A;  2GHB A;  3PUX E;  4O3B A;  5CI5 A;  1MY2 A;  4KYE A;  1B0L A;  3ZSF A;  4G8N A;  3RUM A;  4GF8 A;  3T9H B;  2GFE A;  3U94 A;  1ELJ A;  4OWD A;  4EXL A;  1JW5 A;  2REJ A;  2O6A A;  2Y7R A;  3JV9 A;  1WVJ A;  4OXV A;  4ECF A;  3MAM A;  3EN3 A;  4GWO A;  4N6P A;  1A40 A;  3RPW A;  4RXL A;  3PU5 A;  5TPA B;  2RKM A;  4QF9 A;  4ZEI A;  2ABH A;  5KDT B;  2CZL A;  1IIW A;  1A54 A;  3PMV A;  3MW0 A;  2RF1 A;  4G8H A;  1VFE A;  2RCB A;  1MPC A;  2A5T A;  1LBB A;  5HM4 B;  3HST A;  4TOZ A;  4LON B;  5JEI A;  1JNF A;  3FXR A;  5H8Q B;  1FTO A;  2VHA A;  3FJG A;  4FE8 A;  2OWT A;  4IGT A;  2DQV A;  3BFU A;  3VLV A;  3IO6 A;  3FVG A;  5CMB A;  3UP9 A;  4EQB A;  1A99 A;  1OLA A;  3IB0 A;  3MZ9 A;  4KHZ E;  2DVZ A;  4NE4 A;  5AA2 D;  3G7W A;  1IQ7 A;  4PET A;  1CE2 A;  4GL0 A;  1O63 A;  1DOT A;  3MZ1 A;  4KCC A;  5I59 A;  3F11 A;  2UXA A;  1I69 A;  1NH7 A;  1ATG A;  3FZV A;  4YB7 A;  3MP8 A;  2IEE A;  1MQI A;  3KFM A;  1VSO A;  1QVS A;  2QMX A;  2ZNS A;  2D5W A;  3IK6 B;  3IOV A;  2RCA A;  1M5F A;  2QS2 A;  4F3S A;  1ZTY A;  1LAH E;  2D21 A;  1FQA A;  2P2A A;  5CM6 A;  4LUB A;  5AA2 A;  4G68 A;  3M8U A;  3TEL A;  1LFI A;  4PFY A;  3KOT A;  1ANF A;  4BDQ A;  1UQW A;  4GXA A;  4G8M A;  5KCJ B;  4RJZ A;  2DVC A;  4ELQ A;  3BKI B;  2NXO A;  4U4S A;  1MDP 1;  3TCH A;  4F3G A;  3OEM A;  4QFK A;  4R74 A;  1Y3N A;  2G93 A;  1OLC A;  1H45 A;  1GR2 A;  1MXU A;  5AE4 A;  3MVX A;  1FCK A;  4O3C A;  5DVJ A;  3KJ7 A;  1FTJ A;  5ELV A;  4K3F A;  4EQ9 A;  4MBP A;  3QIM A;  1MQH A;  3IOW A;  1GTK A;  1NMU A;  1JW1 A;  4XKR A;  2DP8 A;  5AA4 B;  3TYH A;  3B7D A;  1Y9U A;  2KLF A;  3Q25 A;  4I8C A;  4P0G A;  1SI1 A;  2DE3 A;  4DXB A;  1N7W A;  2E0S A;  5CMC A;  4XKN A;  5L8D A;  2Z23 A;  1Y3Q A;  4F29 A;  3L6G A;  3C9H A;  1B5J A;  3OD7 A;  3N94 A;  2VD3 A;  5F1Q A;  5DEX B;  3FAT A;  4H1X A;  1IUD A;  1P1O A;  3E3K A;  4GXS B;  1S7Y A;  4Q5T A;  3OOA A;  1UTH A;  5EYF A;  4MLQ A;  1MXX A;  2R71 A;  4NWD A;  2HQ0 A;  3ODB A;  4MLV A;  2QMW A;  3IX1 A;  4WKM A;  2O1M A;  1SDX A;  4ZEC A;  1D3K A;  3I6V A;  4U21 A;  3OSQ A;  2I3V A;  3JZJ A;  1QUI A;  2UVJ A;  3H6W A;  4H5G A;  5H8S A;  5K2X A;  5H8N A;  4QFL A;  2I58 A;  1AL3 A;  2GRV A;  3V8X B;  4F1U A;  1POT A;  3H06 B;  2XXT A;  1URG A;  1Y3P A;  1Z7N E;  1MG1 A;  3DEL B;  4DE8 A;  1B4H A;  2DSF A;  5LOM A;  3ZKL A;  1YCJ A;  3P7I A;  5DTB A;  1MM7 A;  1PBQ A;  2DWI A;  3KGC A;  1LGB C;  3MZB A;  1ZIU A;  3HO7 A;  1LAX A;  4NED A;  4IB2 A;  1FW0 A;  2F8D A;  2IA4 A;  1B1H A;  4YKP A;  3U93 A;  3G3G A;  3G3F A;  3HHF A;  3TZA A;  3O66 A;  3CSB A;  4OYV A;  3G3H A;  4XXU A;  2VGQ A;  4C0R A;  1AH5 A;  4X9T A;  3UK4 A;  3K02 A;  4HW8 A;  2VP1 A;  2ZYN A;  1TFA A;  1US4 A;  2F7B A;  1Y4T A;  4GVO A;  3ONM A;  2R6G E;  2O7U A;  2H5Y A;  4IO2 A;  2ZYK A;  2CMO A;  4C1T A;  1S9T A;  4KFQ A;  1FQD A;  2VD2 A;  5I2K A;  1DPP A;  4NF4 B;  3M3K A;  2Y7I A;  2HCA A;  3QUJ A;  3LBS A;  4OVJ A;  1B9J A;  2F78 A;  4F2Q A;  2DE2 A;  3K6W A;  1IZ1 A;  4ND9 A;  3SEW A;  1NNP A;  2QL3 A;  5DYH A;  4GLI A;  1FQC A;  2XD3 A;  3T93 B;  4YU0 A;  3N5L A;  3CG3 A;  2RC7 A;  1TFD A;  5H8Q A;  3K0V A;  5ITP A;  3JYR A;  1YAE A;  2RIN A;  5B70 A;  3UGW A;  3D4G A;  4KQP A;  1KWH A;  3FGS A;  4OFO A;  1D9V A;  3CIJ A;  3A3U A;  1J1N A;  2DS9 A;  2QS4 A;  2PYY A;  3TCG A;  3KN7 A;  1H43 A;  5CMK A;  5CBR A;  5JK4 A;  4KPT A;  2H4I A;  4F3P A;  3IOT A;  4BDR A;  3GXA A;  1PDA A;  3U8Q A;  3FVK A;  4RYA A;  3LSF B;  3IOR A;  2V3T A;  5FHM A;  2V84 A;  3W9V A;  1QUL A;  1D4N A;  2ZNU A;  3O9P A;  1URS A;  3QK6 A;  4NF6 A;  1B6H A;  1SI0 A;  4PFW A;  1FTK A;  3VXB A;  2AIX A;  3O28 A;  2O69 A;  5FTH A;  5EHM A;  2F6P A;  4FIM A;  4QFN A;  1JVY A;  3MWB A;  1O7T A;  2FYI A;  3N26 A;  1JVX A;  4H5F A;  2Z22 A;  1RYO A;  1JEV A;  2LAO A;  3FXQ A;  2Z8F A;  2NVU B;  3MPK A;  1NH8 A;  4Z7E A;  5JTY B;  3O2A A;  3TOD A;  3FVN A;  4OFJ A;  4BDO A;  1MY0 A;  4YAH X; 
#chains in the Genus database with same CATH topology
 1DTZ A;  1H44 A;  4QFO A;  2ZM6 E;  1LBV A;  1UTB A;  2P0S A;  4WED A;  2V25 A;  3IWD A;  2QPQ A;  1N32 E;  4ZE9 A;  4O8M A;  3SKP A;  3C34 A;  4RPO A;  4U2R A;  2HJJ A;  2OX3 A;  1X6E A;  3F6H A;  2EMW A;  4X62 E;  3PUZ E;  1GGG A;  3I5O A;  4GX6 A;  4MH5 A;  1FPL A;  3L6H A;  2WYK A;  3PMW A;  3QAX A;  4EF2 A;  4RNS A;  1H76 A;  3H7M A;  1ZU0 A;  5IM2 A;  2OZZ A;  2XX7 A;  3T22 A;  5AA4 A;  2B3B A;  2EOQ A;  2V83 A;  2QVR A;  3IFC A;  3TMG A;  3I3V A;  2HAU A;  2EN3 A;  4YZZ A;  5IZ1 A;  4UAC A;  2R76 A;  2VPO A;  2DWH A;  4PAK A;  4DR7 E;  4YB6 A;  1I6Q A;  3G3K A;  1XC1 A;  2B9D A;  1Y1M A;  2HAV A;  2DB2 A;  2XXI A;  3Q28 A;  4FAT A;  4F22 A;  3LSL A;  4RPN A;  3OMB A;  4QHQ A;  2XHD A;  3K6Q A;  5L9O A;  3DP4 A;  2NWJ A;  4BCA A;  2WKY A;  2HHM A;  1K9Z A;  1ZJL A;  4PC9 A;  2NUG A;  3QXM A;  4HCY A;  4NX1 A;  2Y7W A;  4IS1 C;  3TPA A;  3AV0 A;  1QKA A;  3C6K A;  2JR1 A;  3C33 A;  4RY1 A;  4GBV A;  4LZ8 A;  4F39 A;  1IXC A;  4QSE A;  3U1O A;  3UA8 A;  1A1F A;  2X26 A;  1FSA A;  1N0T A;  3PV0 E;  4PFB A;  4NF8 A;  1MPB A;  1WHQ A;  3K2D A;  3DP8 A;  1MEY C;  4RK9 A;  3LSW A;  3BFT A;  3TTL A;  1I6A A;  5I58 A;  2HZK A;  2YJP A;  2NUE A;  1L4S A;  5AE2 A;  4DV5 E;  1VDW A;  2LT7 A;  1LLS A;  4DMI A;  3SEV A;  3KOS A;  1D9Y A;  4MF3 A;  1R1N A;  2DIX A;  4WXD A;  1B3L A;  2XWO A;  3K1M A;  4R2P A;  2JY9 A;  4NF5 A;  3RLF E;  4AS4 A;  3KJT A;  5KL5 A;  2R9J A;  3FV1 A;  4DIG A;  4QFP A;  2CSH A;  4FAJ A;  4XKP A;  5H8H B;  4PFI A;  2XXV A;  4FK5 C;  2I4B A;  1MH4 A;  2DXR A;  4OQO A;  2EM7 A;  1TF3 A;  2ENC A;  4OEV A;  5I56 A;  3ZOQ B;  1B0H A;  4JVC A;  3JU0 A;  1R9L A;  2Z8D A;  1YUJ A;  4KCD A;  4ESX A;  2I6E A;  2FHY A;  2EM0 A;  4GWS A;  4E0X A;  4X64 E;  1IQO A;  4OVP A;  2Y7K A;  2EPU A;  4O94 A;  2YLN A;  1KZ8 A;  1PB9 A;  5TU0 A;  2BBG A;  4LQ2 A;  2EL6 A;  3KEI A;  4TLL B;  2W7Y A;  1PB8 A;  4H6D A;  3VK6 A;  3EKI A;  4DZ1 A;  4LAT A;  2UVH A;  1EYK A;  1SYI A;  4U22 A;  4X9J A;  2XXY A;  3U92 A;  3K01 A;  4KD5 A;  3KG2 A;  4OER A;  3HXL A;  2B4M A;  4G2Z A;  4B3R E;  3HHG A;  2UUB E;  2F7A A;  1SW2 A;  2E1S A;  4C1U A;  4H8I A;  3B6Q A;  4F31 B;  1T0K A;  3PMX A;  5H8F A;  4H8J A;  5K2Y A;  4UAB A;  3PPN A;  2ESN A;  4GKJ E;  5FLX C;  3O6I A;  4BHC A;  1B51 A;  1I6B A;  3IL1 B;  3TQM A;  5DW8 A;  2E5L E;  2OK2 A;  5CMM A;  3DF6 A;  4I8O A;  4P78 A;  1G0H A;  5FHO A;  2KON A;  2Q8M A;  1JEU A;  2AL4 A;  2PVU A;  4TQU Q;  1MXY A;  2EPL X;  1ZBT A;  2YZT A;  5BR8 E;  1JQF A;  4OES A;  4R2B A;  3FIG A;  4ZED A;  1KA0 A;  1PB7 A;  3IAZ A;  2EN1 A;  3IWC A;  1ZLQ A;  2ALU A;  3K1P A;  2BB8 A;  1CNQ A;  3FXU A;  2GLI A;  2DLQ A;  2ZYM A;  2M7Q A;  1YYW A;  3H6U A;  4BLA A;  4Z0I A;  4LA9 A;  3GBA A;  3LR1 A;  1FPJ A;  3CRB A;  2XX8 A;  2ANJ A;  5I2N A;  2A5T B;  3RMP A;  3K1N A;  4BHB A;  2EPK X;  3BGH A;  1OVT A;  1NUY A;  1UIL A;  2YTE A;  3DLN A;  1DQ3 A;  4WSG A;  2EQ1 A;  4IO5 A;  5LLQ A;  1X3C A;  4FBP A;  3THO B;  4IR8 A;  2XXH A;  2EOF A;  1MY1 A;  1NEI A;  1Y4C A;  4GX4 A;  5F24 A;  4X65 E;  2ENH A;  3QYT A;  2EOM A;  2QSX A;  3SEY A;  1USY H;  2QS1 A;  3W9W A;  1TXF A;  3V5A A;  4LZ5 A;  1BKA A;  2V86 A;  3OEK A;  3LLH A;  1B1X A;  3P1X A;  3DJW A;  1USY E;  3H03 A;  3D4C A;  3HV1 A;  3VDF A;  4H46 A;  3C31 A;  4JVD A;  4DR3 E;  5TP9 A;  4M9V C;  4GEQ B;  4F18 A;  4OAN A;  2EMC A;  4R9G A;  4PDH A;  4ESW A;  5ET8 A;  3K6U A;  5I59 B;  1ZMG A;  3MQ9 A;  3LSX A;  1L5T A;  3U65 A;  1HR0 E;  3PGF A;  4ISU A;  4NHB A;  2DOJ A;  2WYP A;  4JI8 E;  1MQG A;  4EXK A;  1WOD A;  5HBC A;  4XIG Q;  4F3B A;  1YXI A;  1SYH A;  4EQ7 A;  1AWB A;  3IOU A;  1LCT A;  1N04 A;  1K9Y A;  2DMY A;  2LUQ A;  2L2N A;  2QS3 A;  3QUF A;  4JSD A;  4R2R A;  4E0W A;  3O6H A;  1P1N A;  2ODR D;  2EQ3 A;  4NGU A;  3S2V A;  2DLK A;  5AA2 B;  2DMI A;  4GL8 A;  2XWI A;  4YHH E;  5ISU A;  2UXC E;  1FPK A;  1B7Z A;  4G68 B;  1FBH A;  4POW A;  1B32 A;  4PBQ A;  1STU A;  4R2F A;  1ZU1 A;  1XT8 A;  2XXX A;  1XS5 A;  1R9Q A;  3M3F A;  4YB5 A;  2WCC 3;  4JBZ A;  2FNC A;  1MQD A;  3EPL A;  1HSE A;  2CTD A;  4TUI A;  2F8B A;  1ZR9 A;  1B3G A;  2JOB A;  4JI5 E;  2VF1 A;  3RPL A;  2YPN A;  3OEN A;  4ZDM A;  3FUZ A;  4YKK A;  3RT6 B;  1EH3 A;  3G3I A;  4KXP A;  3RTF B;  3T9U A;  3VVD A;  1PC3 A;  1N84 A;  1FQB A;  3PPP A;  4G77 A;  2ZZW A;  2OWS A;  3D1R A;  2XXU A;  4IO7 A;  2EMZ A;  4HCW A;  2F7C A;  3SET A;  5A5L A;  1NKX A;  2B65 A;  1BBO A;  1Y20 A;  1RDY A;  5A5X A;  3OSR A;  3R6U A;  2L33 A;  2YTF A;  5DVI A;  1WDN A;  4F19 A;  4WX9 A;  3K6V A;  1MM6 A;  4GFR A;  1FBC A;  3KSJ A;  5T6J A;  2XD2 A;  3VVE A;  4YMB A;  1UHZ A;  4KWY A;  2QJE A;  4ZZA A;  1IXG A;  1R6Z A;  4PF8 A;  4DXU A;  4BDL A;  4JWY A;  4PAI A;  3GZG A;  2DSY A;  1B2H A;  2MC6 A;  3PD9 A;  2ONS A;  2WEF A;  1LST A;  3HCQ A;  2YTI A;  2F97 A;  3K00 A;  1FTM A;  4I1D A;  3HTX A;  1JET A;  4NG7 A;  3C4T A;  1P1W A;  3VXC A;  4DV6 E;  4IY6 A;  4X8W A;  4X66 E;  4OZ9 A;  3VLW A;  1NUW A;  5KL6 A;  1EU8 A;  3B6W A;  4U4X A;  2LUP B;  1FQF A;  2RSI A;  5L9S A;  2OLB A;  2EJ4 A;  3FXB A;  3CFX A;  4P11 A;  3VYX A;  2H99 A;  1B7H A;  1RDZ A;  1WJP A;  2XXQ A;  2N3H A;  5I57 B;  1MQJ A;  2I3W A;  3BBG A;  5IWA E;  4H0W A;  3O29 A;  3U72 A;  1B3H A;  4KI0 E;  3KC1 A;  1N76 A;  5EHS A;  1B3E A;  1DPE A;  5TPA A;  1P1U A;  2L5V A;  5KDT A;  1NNK A;  1AMF A;  5A69 A;  4OTE A;  1SW5 A;  5EYH A;  1EZP A;  2DE4 A;  3VHT B;  4AQY E;  4B3S E;  2AL5 A;  2Z8E A;  1UTH B;  4N91 A;  2F5X A;  2OJT A;  3TKD A;  1OQG A;  1SPI A;  1DBZ A;  3LUY A;  2EML A;  3G3J A;  4JWO A;  2CPN A;  3FAS A;  3Q27 A;  2EM3 A;  3MVY A;  1QUK A;  2VPN A;  2FV4 B;  4ZEF A;  1SQY A;  4EUO A;  4GWU A;  4FEB A;  4DCX A;  2RC8 A;  1Q1K A;  5H8N B;  4RK2 A;  5IKB A;  4UA8 A;  5A6A A;  4OET A;  2EPA A;  2Y5K A;  1B05 A;  4F6N A;  3V89 B;  4GBW A;  1IMD A;  1ZBM A;  5FTI A;  3RGY A;  4PFR A;  1VR5 A;  4JI1 E;  3MVZ A;  4YKI A;  4HE2 A;  2RSM A;  3SES A;  4IGR A;  2ZXT A;  2EOZ A;  4Q8R A;  4ZYG A;  2DWJ A;  4PQJ A;  4PFU A;  4N13 A;  1FBD A;  2ONK E;  3GLB A;  3TDJ A;  5I5P A;  1LBC A;  1YUI A;  3FV2 A;  1PJS A;  4JSO A;  4Q30 B;  4O3A A;  1TT1 A;  4IO6 A;  4R6H A;  2YTD A;  1SD3 A;  4PE3 A;  2F6G A;  1IMA A;  2I4C A;  1FBF A;  4WXJ A;  4LTY A;  2LVH A;  2EOI A;  2H9B A;  1XHY A;  1MY4 A;  2NAB A;  5F7V A;  2F4V E;  5H8H A;  3RTW B;  5I84 A;  1RYX A;  3UOR A;  2PMS A;  5EQA A;  5I3S A;  4AB6 A;  2N8X A;  1P47 A;  2P3N A;  3O6G A;  1NFT A;  3TAJ A;  3J80 C;  1BB8 A;  3QSL A;  4N81 A;  1YYO A;  4DCY A;  3TQW A;  1POY 1;  1BK4 A;  1M5D A;  4M4G A;  3BID A;  5DVF A;  2NOO A;  5KCJ A;  3MC2 A;  2UYE A;  3LV0 A;  2V8Q B;  2H25 A;  2RS6 A;  2EMK A;  4ZE8 A;  1DTG A;  4R9F A;  4LU9 A;  1FTL A;  4JXI A;  4PDD A;  4R2E A;  4BBY A;  2PT1 A;  2UXB E;  3T1Y E;  3S9N C;  1CB6 A;  1LAF E;  4GRK A;  1YTV A;  3KZG A;  3PUY E;  2ELZ A;  2QRY A;  3IR1 A;  4L17 A;  3UN6 A;  3DM0 A;  2M9A A;  2YTN A;  1B46 A;  3O97 A;  3RY3 A;  5EQ7 A;  3EF7 A;  4KZS A;  4Q35 B;  4DR4 E;  2EMB A;  1MXZ A;  3BBR A;  5I7I A;  3J81 C;  3T9V A;  1F2I G;  1F9B A;  2HXW A;  2YU5 A;  2K4V A;  1J26 A;  1XVX A;  1M5C A;  4OVS A;  3KZZ A;  3IB1 A;  2V93 A;  2KOU A;  1A8F A;  1QW0 A;  2LO3 A;  5I2K B;  1XMQ E;  4OEU A;  1RC7 A;  4KHP E;  2F34 A;  4GIZ A;  1LFG A;  5A2Q C;  3KN3 A;  2OWZ A;  2UVG A;  3CR9 A;  3EHU A;  1LFH A;  2UU9 E;  4GQO A;  4YMA A;  2ZYO A;  3T9X B;  2PRT A;  5ITO A;  3THN A;  4DKK A;  1UIV A;  1HNX E;  4ZEB A;  3PD8 A;  4WYQ B;  4DR5 E;  3ADJ A;  2A5S A;  1MRP A;  4F1V A;  2ZMB A;  2B3F A;  2EN4 A;  3C32 A;  2EM2 A;  2JP9 A;  5IZ3 A;  1S50 A;  4NXN E;  5DEX A;  3T1B A;  1SW1 A;  1NUX A;  4M1V A;  4R03 A;  2Q88 A;  4ZYE A;  2EOS A;  2EMI A;  2KR0 A;  3CSG A;  5AA1 A;  2Y7P A;  3A09 A;  2PBW A;  3E4R A;  4NQ8 A;  2XXK A;  4LF4 E;  4RA1 A;  1OQH A;  2YT4 A;  1EZ9 A;  2EMH A;  1MS7 A;  4HEI A;  2Y84 A;  1MPD A;  2EOE A;  4X04 A;  2I9I A;  2B7T A;  2X7P A;  2M1S A;  4PF6 A;  4YIC A;  3KN8 A;  3SER A;  4WEP A;  2YTG A;  1I94 E;  4MAG A;  4PFT A;  3UIF A;  3H4Z A;  1T4N A;  2OBG A;  3HN0 A;  2I49 A;  4BC9 A;  4ZYH A;  4LN5 A;  2I13 A;  2HEU A;  4PGP A;  4H65 A;  4YKJ A;  4F1Y A;  2PT2 A;  3ZS6 A;  2AYS A;  1X48 A;  3MP1 A;  3MP6 A;  3Q29 A;  1N3G A;  1B58 A;  5M2V A;  2L92 A;  3ADG A;  2NUV A;  4HTG A;  3TTK A;  4NF6 B;  2DWA A;  4JWX A;  2H98 A;  3MPL A;  5L9M A;  2VOZ A;  4IY5 A;  1AIV A;  4F2O A;  5IZZ A;  3FD3 A;  3TTR A;  5BWJ A;  1IBK E;  4R2S A;  3TFL A;  2ZNT A;  4GD5 A;  3S9L C;  2EPN A;  5CBS A;  1NV6 A;  4LP2 B;  3AUZ A;  2YRH A;  1N3W A;  2WBB A;  3OEL A;  4FEC A;  4X1B A;  2DXY A;  2EMF A;  3KWR A;  3CG1 A;  2EN8 A;  3M99 B;  1XVY A;  4OEN A;  1YSA C;  3H6V A;  3DP6 A;  3IJO B;  1BLF A;  2G29 A;  2JWO A;  4MNP A;  3VVF A;  1MY3 A;  3SDF A;  5J1D A;  1XOC A;  3OO6 A;  4LFB E;  1US5 A;  4H67 A;  3EHT A;  2ENA A;  1MXV A;  4OOG C;  1FBE A;  1EKZ A;  3HPZ A;  2EN2 A;  3FIR A;  1LB8 A;  4OX9 E;  1EH7 A;  1OMP A;  1IEJ A;  2J7J A;  2MDG A;  4G68 C;  2O84 X;  2D3I A;  1FPI A;  1UTB B;  2PX1 A;  4EF1 A;  4RHB B;  1LB9 A;  2V3Q A;  2DYX A;  3N6U A;  2MDR A;  3SEU A;  3KZY A;  1LLM C;  1AAY A;  3FBP A;  4R2D A;  3OO7 A;  1A1H A;  4O43 A;  5LDZ A;  4KR5 A;  1SR9 A;  4R2A A;  2ELY A;  1VE4 A;  3ROJ A;  2HZL A;  3PPR A;  1QU6 A;  3R26 A;  2NUF A;  3MVW A;  4QRZ A;  4ELR A;  2Q8U A;  2M8C A;  3PPQ A;  3GBB A;  2GHF A;  1WXR A;  2XXR A;  4B3M E;  4N8G A;  2EM6 A;  4R8O A;  1A7L A;  3FJM A;  3LC8 A;  4AQ4 A;  4NAP A;  1P99 A;  4I62 A;  3CI8 A;  4F9B B;  1SVX B;  1O64 A;  2FA7 A;  3RQT A;  3UK3 C;  4GKK E;  3TCF A;  4R6Y A;  2EM8 A;  5CFF E;  3C4M A;  3HQ1 A;  2UUC E;  4NF4 A;  4R72 A;  5I57 A;  4L8N A;  3HPI A;  4GOT A;  1LAG E;  2EN7 A;  4FED A;  2REG A;  2YTJ A;  4TLM B;  4XKQ A;  5CRY A;  4N17 A;  1DMB A;  4FOR A;  4AB5 A;  2Q2C A;  4Q28 A;  1ZBQ A;  4QBA A;  3S4U A;  1LBW A;  4U23 A;  3R7X A;  4Q0C A;  1B5H A;  4MIJ A;  1KJK A;  1XI6 A;  5F3W A;  3THI A;  2V3U A;  1WHN A;  3MHH C;  1B52 A;  1IXI A;  3OO9 A;  1EYJ A;  4ZZE A;  5A6B D;  5FHN A;  5BUU A;  3H3G A;  4PAF A;  4LFA E;  2XA5 A;  2DRP A;  4OA4 A;  2WZO A;  1KA1 A;  4NTL A;  2Q9T A;  3WAF A;  3BIG A;  3ILU B;  4NF8 B;  2CZH A;  3IO4 A;  3FJ7 A;  1EH6 A;  2L2M A;  3EQ1 A;  2DGC A;  5CC2 A;  3CFL A;  4I3E A;  5I58 B;  4GWY A;  3KSX A;  4PE5 B;  4DDD A;  1B7U A;  1P1Q A;  3PPO A;  2DDK A;  3T1H E;  3FVO A;  1NNT A;  3E13 X;  4NF5 B;  4R6K A;  3W15 C;  2D9H A;  3VFJ A;  1JW4 A;  4LFC E;  4THI A;  3ADI A;  4KYD A;  3IWB A;  4WPY A;  4U1Z A;  5ET6 A;  1YYZ A;  4DR1 E;  4DLD A;  1FJ9 A;  1OIB A;  2CZK A;  5I56 B;  4XTC Q;  5A6B A;  1DI2 A;  2O68 A;  2XX9 A;  3T96 B;  3TUS A;  5T3J A;  1DSN A;  1UIU A;  4X1D A;  3T66 A;  1QUJ A;  2EOR A;  2XXW A;  3K6X A;  4P0I A;  4DI3 D;  2GPI A;  1IMF A;  3AXF A;  5LMU E;  2EL4 A;  2L6M A;  2F3B A;  2MC5 A;  5IAI A;  1IIT A;  5ICT A;  1YPN A;  3TTM A;  5AA3 A;  2NA2 A;  4OVR A;  5ICQ A;  1B3F A;  3RT8 A;  1ZAA C;  4NWC A;  4O5G A;  4OHN A;  4IJD A;  3KBZ A;  2F3D A;  4MFI A;  1Q35 A;  3OO8 A;  2Y5L A;  1A55 A;  2OCU A;  2XXP A;  1N3X A;  4G4P A;  1BTJ A;  4ZEK A;  3VE1 B;  1M5B A;  2P1S A;  2EWL A;  4OMB A;  2GHA A;  3CFZ A;  5H8F B;  2L3J A;  4FJP A;  5AC5 A;  1LEV A;  2F36 A;  2MKZ A;  2I48 A;  4P56 A;  5KZT A;  1PBP A;  2V87 A;  2V89 A;  4F9A B;  1PJT A;  1VFD A;  1OVB A;  3PUV E;  5KL4 A;  2Q8J A;  3VLU A;  2B7V A;  2UXD E;  3BF2 A;  1SW4 A;  4BS9 A;  4ZS9 A;  2YU8 A;  1SFE A;  2EQ0 A;  3IB2 A;  4BDN A;  1XMO E;  4LQ5 A;  5HPQ A;  5JTY A;  1RKM A;  2YTP A;  1HNZ E;  1G0I A;  3A3C A;  5AE3 A;  4OFL A;  4EDP A;  3EHS A;  3ZKK A;  1HNW E;  2MKD A;  3QG5 C;  1GVC A;  5AE1 A;  3Q26 A;  2WX9 A;  5B7D A;  4LVQ A;  2E72 A;  2CT1 A;  2FTX B;  2Q2A A;  1N7X A;  5KL3 A;  1FPE A;  1LBZ A;  5I2N B;  1QNT A;  2UYF A;  3MJN A;  1O0W A;  5ET7 A;  5J16 A;  1H3D A;  1T4L B;  1URD A;  3N6T A;  4R73 A;  1Z7M E;  2B4L A;  4MEV A;  1B4Z A;  2EP3 A;  3WAE A;  4JB7 A;  1MXW A;  3CVG A;  2N3G A;  1Y1Z A;  4ONY A;  3QMF A;  3M3L A;  2P3V A;  4MCO A;  1AOV A;  3S9M C;  4BMJ A;  4DUY E;  2X7Q A;  4POX A;  4X48 A;  3TQL A;  4JI4 E;  4ELO A;  1IXH A;  3TTN A;  3TEP A;  3ECR A;  1TWY A;  1NNF A;  4BDM A;  1HSL A;  1NL5 A;  1ZKB A;  2O1L A;  3HFU A;  2F35 A;  4IO4 A;  3EPE A;  1IBL E;  5TP9 B;  4PP0 A;  4QSC A;  2GH9 A;  3B6T A;  1IQS A;  4U1O A;  1B5I A;  4I9D A;  2YSO A;  5DT6 A;  2O7I A;  1YYK A;  3IJX B;  2UVI A;  2Q74 A;  1II5 A;  2I0C A;  5IV8 B;  1T39 A;  4R75 A;  1NI9 A;  3PUW E;  2JVA A;  3E9X A;  3C36 A;  1YZ0 A;  2V4C A;  1FQE A;  1M5E A;  4NZV A;  2UUA E;  3ILT B;  2I0B A;  2RS7 A;  4KYS A;  2H36 X;  3RNN A;  1B40 A;  3S9E A;  2EOJ A;  4DV1 E;  1PEB A;  2O51 A;  3KBR A;  3MUQ A;  4QXD A;  1FBP A;  1BP5 A;  1SBP A;  1BIY A;  3H6T A;  1LCF A;  2EM4 A;  2JXP A;  3OXN A;  1MDQ A;  3J7A G;  1A8E A;  4QSD A;  3USD A;  4N6D A;  4XFE A;  5DNY A;  4NMY A;  4DXC A;  2RC9 A;  4JDF A;  3SEX A;  1X6F A;  4P1L A;  5A6K A;  3K4U A;  2EOY A;  1QKB A;  3RPL B;  4N07 A;  1MH3 A;  4ZYD A;  1FPB A;  4IO3 A;  3E78 A;  3VV5 A;  2BJJ X;  1QJM A;  3RN8 A;  3NOH A;  3VYY A;  3E79 A;  5ET5 A;  3V83 A;  2Q89 A;  2LRS A;  1A1K A;  4ELP A;  4MNC A;  1EZO A;  4LZ7 A;  1TN9 A;  1HSJ A;  4GWZ A;  4HS7 A;  2EPX A;  5A5X B;  2ONR A;  2FGG A;  3MBP A;  2THI A;  3C35 A;  4M0V A;  2HFB A;  1NV2 A;  4GX3 A;  1GV8 A;  2GHB A;  3PUX E;  4O3B A;  5CI5 A;  1MY2 A;  2LMZ A;  4KYE A;  1B0L A;  3ZSF A;  4G8N A;  3RUM A;  2YRM A;  1KYQ A;  4GF8 A;  3T9H B;  2GFE A;  5EYG A;  3U94 A;  1ELJ A;  2JYA A;  2A25 A;  5IGA A;  2HC5 A;  3HPS A;  1N36 E;  4OWD A;  4EXL A;  1JW5 A;  4GWX A;  2REJ A;  1RMD A;  2O6A A;  2Y7R A;  3JV9 A;  1WVJ A;  4OXV A;  1BBG A;  2KHX A;  4ECF A;  3MAM A;  3EN3 A;  2JJK A;  4GWO A;  4N6P A;  1A40 A;  1DK4 A;  1T38 A;  3RPW A;  4RXL A;  3PU5 A;  2LCE A;  4MHF A;  4P1E A;  5TPA B;  2RKM A;  4QF9 A;  4JI6 E;  4ZEI A;  2ABH A;  4DV3 E;  5KDT B;  3H09 A;  2CZL A;  1IIW A;  4LF7 E;  1A54 A;  2FIX A;  3PMV A;  3MW0 A;  2VRD A;  5AC4 A;  2RF1 A;  1GQE A;  1JK1 A;  4G8H A;  1VFE A;  2RCB A;  1MPC A;  1X47 A;  2A5T A;  1DCU A;  1LBB A;  5HM4 B;  4BC7 A;  3HST A;  4TOZ A;  4LON B;  5JEI A;  4P3L A;  2JPA A;  2QVV A;  5IT9 C;  1JNF A;  3FXR A;  2HXR A;  5H8Q B;  1FTO A;  2VHA A;  1UN6 B;  3FJG A;  2EL5 A;  4P9K A;  4JYA E;  1T4O A;  4FE8 A;  2OWT A;  4IGT A;  2DQV A;  3BFU A;  1G2F C;  3VLV A;  1DGC A;  2GQ1 A;  3IO6 A;  4O4K A;  3FVG A;  3EPH A;  5CMB A;  4JI2 E;  3MSW A;  2EPM X;  5ESY A;  3UP9 A;  4EQB A;  1N34 E;  1A99 A;  1OLA A;  3IB0 A;  3MZ9 A;  4KHZ E;  2DVZ A;  4NE4 A;  4O7M A;  5AA2 D;  3G7W A;  2KQZ A;  4RH8 A;  1IQ7 A;  3MHS C;  4PET A;  1CE2 A;  4GL0 A;  1O63 A;  1IMB A;  1DOT A;  3MZ1 A;  4KCC A;  5I59 A;  5KL2 A;  4PGN A;  4LF8 E;  3F11 A;  2UXA A;  1I69 A;  1NH7 A;  1ATG A;  3FZV A;  4YB7 A;  3MP8 A;  2IEE A;  4N4R B;  4N8Y A;  1MQI A;  2RPC A;  4L5N C;  1FJG E;  3SZP A;  3KFM A;  1VSO A;  2G7H A;  1QVS A;  3BIH A;  2QMX A;  2ZNS A;  1RQ0 A;  3F6G A;  2D5W A;  4LF9 E;  3IK6 B;  3IOV A;  2RCA A;  4M2Z A;  1M5F A;  2HPG A;  2QS2 A;  4F3S A;  1ZTY A;  1XNR E;  3EPK A;  4NN3 A;  1FPF A;  5ADZ A;  3RYD A;  2YSP A;  1LAH E;  4GZN C;  1FQA A;  2D21 A;  2L3C A;  4P47 A;  2P2A A;  4HE1 A;  5CM6 A;  4LUB A;  5AA2 A;  2EM5 A;  3EPJ A;  1NCS A;  2XWV A;  4G68 A;  3M8U A;  2L2K B;  3TEL A;  1LFI A;  1FRP A;  4PFY A;  4NF0 A;  2EPP A;  4MJO A;  2EPZ A;  3KOT A;  4XEQ A;  1ANF A;  2CEX A;  4BDQ A;  2L8T A;  1UQW A;  4GXA A;  4G8M A;  5KCJ B;  4RJZ A;  2DVC A;  4ELQ A;  3BKI B;  4WFT A;  2NXO A;  5EQ9 A;  4DV4 E;  4U4S A;  1MDP 1;  3TCH A;  2FBP A;  4JVI A;  1G2D C;  4OVQ A;  4F3G A;  4DV2 E;  3OEM A;  4QFK A;  4R74 A;  1Y3N A;  2G93 A;  1OLC A;  1H45 A;  4MMP A;  3L00 A;  4B3T E;  1GR2 A;  3A29 A;  3OTO E;  1MXU A;  3CHG A;  5AE4 A;  3MVX A;  1FCK A;  4O3C A;  3B8B A;  5DVJ A;  3KJ7 A;  1EH8 A;  1FTJ A;  5ELV A;  5KL7 A;  4K3F A;  2CEY A;  4EQ9 A;  4MBP A;  2YWQ A;  2HHH E;  4PBH A;  3QIM A;  4PTK A;  1MQH A;  3IOW A;  1GTK A;  1NMU A;  1JW1 A;  4XKR A;  5A6J A;  2LTR A;  2DP8 A;  1FBG A;  5AA4 B;  2EOX A;  4O24 A;  3TYH A;  3B7D A;  4WXC A;  1Y9U A;  2KLF A;  2YTO A;  3Q25 A;  4I8C A;  4M30 A;  2LJU A;  4P0G A;  1B69 A;  3IFA A;  1FPD A;  1SI1 A;  2DE3 A;  2EM9 A;  4DXB A;  4DI4 B;  1N7W A;  2E0S A;  2JOX A;  1IMC A;  5CMC A;  2YTQ A;  4H45 A;  4XKN A;  4LF5 E;  5L8D A;  2Z23 A;  4DUZ E;  1Y3Q A;  4F29 A;  5IXM B;  3L6G A;  4F54 A;  3C9H A;  2VQE E;  1B5J A;  3OD7 A;  3ISP A;  3N94 A;  1WRJ A;  2VD3 A;  4N4U A;  5F1Q A;  5IZ3 B;  1NV4 A;  5DEX B;  2EOH A;  1N33 E;  3FAT A;  1X49 A;  4H1X A;  1IUD A;  1P1O A;  3E3K A;  2QVU A;  1S7Y A;  4GXS B;  4Q5T A;  5EQ8 A;  3OOA A;  4MNI A;  4R2C A;  1UTH A;  3B50 A;  4TUG A;  1NV1 A;  2RTX A;  1EYI A;  5EYF A;  2EN6 A;  4MLQ A;  1MXX A;  4GWW A;  2R71 A;  4NWD A;  2RQL A;  2HQ0 A;  3ODB A;  4MLV A;  3LML A;  2QMW A;  3IX1 A;  2VT5 A;  4WKM A;  3JAM C;  2MKN A;  2O1M A;  2LBS B;  1SDX A;  4ZEC A;  1IBM E;  1D3K A;  3I6V A;  2EMG A;  4U21 A;  3OSQ A;  2I3V A;  3JZJ A;  1QUI A;  2UVJ A;  3H6W A;  4H5G A;  1PKP A;  5H8S A;  1INP A;  4HXV A;  5K2X A;  1NV3 A;  5H8N A;  4QFL A;  2I58 A;  4K0K E;  1AL3 A;  2GRV A;  1MGT A;  3V8X B;  3ADL A;  4PCD A;  4JI3 E;  4JV5 E;  2XWK A;  5LL6 R;  4F1U A;  1POT A;  3H06 B;  2WBS A;  2EPR A;  2WBU A;  2V85 A;  4JI0 E;  2XXT A;  4JI7 E;  1URG A;  1Y3P A;  3MST A;  1Z7N E;  1MG1 A;  2EOO A;  3DEL B;  4DE8 A;  1X5W A;  4N15 A;  2LE2 A;  1B4H A;  2DSF A;  5LOM A;  3ZKL A;  1YCJ A;  3P7I A;  5DTB A;  1MM7 A;  1PBQ A;  2DWI A;  1Z1B A;  3KGC A;  1LGB C;  2EE8 A;  3MZB A;  4I3Y A;  2IHR 1;  1ZIU A;  2HGH A;  3HO7 A;  1LAX A;  4NED A;  4IB2 A;  1FW0 A;  2F8D A;  1FPG A;  2IA4 A;  4HE0 A;  1B1H A;  4YKP A;  3LUZ A;  3U93 A;  4AS5 A;  3G3G A;  1LBX A;  3G3F A;  1GZ6 A;  3HHF A;  2LTS A;  3TZA A;  3O66 A;  4F9C B;  3CSB A;  4OYV A;  3G3H A;  4I40 A;  4XXU A;  2VGQ A;  2R1F A;  5FBP A;  5LTC A;  4C0R A;  2V88 A;  4MX6 A;  1AH5 A;  4X9T A;  3JTZ A;  3UK4 A;  3K02 A;  4HW8 A;  2VP1 A;  2R8T A;  2LV2 A;  1LBY A;  2ZYN A;  2EPO A;  1TFA A;  1US4 A;  2F7B A;  1Y4T A;  2FIE A;  4GVO A;  3ONM A;  3KC0 A;  2R6G E;  2O7U A;  2EPC A;  2H5Y A;  2EZ6 A;  4IO2 A;  2ODR C;  2BJI A;  1FTA A;  2ZZV A;  2ZYK A;  2VQF E;  2CMO A;  4DV7 E;  4C1T A;  3C4B A;  1S9T A;  4P7D A;  1NV7 A;  4XF5 A;  4KFQ A;  1FQD A;  1QGX A;  2ZZX A;  4J8Z A;  2VD2 A;  5I2K A;  1DPP A;  2YRK A;  4NF4 B;  2EMY A;  3M3K A;  1NUZ A;  2Y7I A;  4NHR A;  2HCA A;  3QUJ A;  1NV0 A;  3LBS A;  4OVJ A;  1B9J A;  2F78 A;  4F2Q A;  4NXM E;  4X8R A;  1A1L A;  2DE2 A;  1Q9D A;  3T0J A;  4DV0 E;  4F6M A;  3K6W A;  1IZ1 A;  4ND9 A;  3MYU A;  1NNP A;  3SEW A;  2QL3 A;  5DYH A;  2EMA A;  4GLI A;  1FQC A;  2XD3 A;  3T93 B;  1JK2 A;  4YU0 A;  3N5L A;  3CG3 A;  1RDX A;  2CZI A;  2RC7 A;  1TFD A;  5H8Q A;  3K0V A;  5ITP A;  2QFL A;  3JYR A;  1YAE A;  2RIN A;  1YFH A;  5B70 A;  1XNQ E;  3UGW A;  2E1M A;  3D4G A;  4KQP A;  2LJH A;  1KWH A;  3FGS A;  2PFY A;  4OFO A;  1TF6 A;  1D9V A;  3CIJ A;  1JP4 A;  3OML A;  3A3U A;  4LF6 E;  1J1N A;  4DR2 E;  2DS9 A;  2QS4 A;  2PYY A;  3TCG A;  3KN7 A;  1H43 A;  5CMK A;  1YZ9 A;  5CBR A;  5JK4 A;  2M4I A;  4KPT A;  2H4I A;  4F3P A;  1NV5 A;  2EMX A;  3IOT A;  1IMU A;  4BDR A;  3GXA A;  1PDA A;  3U8Q A;  5TSE A;  3FVK A;  4RYA A;  3LSF B;  3IOR A;  2V3T A;  5FHM A;  2V84 A;  3W9V A;  2B3T B;  1QUL A;  1D4N A;  2PFZ A;  2ZNU A;  3O9P A;  1URS A;  3QK6 A;  1A1J A;  4NF6 A;  2WBT A;  1B6H A;  5LMN E;  1J5E E;  1SI0 A;  4PFW A;  3PTY A;  1FTK A;  2PCR A;  3VXB A;  2AIX A;  3O28 A;  1X6H A;  1UBD C;  2O69 A;  3GYY A;  1A1I A;  5AAS A;  4YY3 E;  5FTH A;  5EHM A;  2K7I A;  2F6P A;  4FIM A;  3C6M A;  4QFN A;  1JVY A;  4P8B A;  3MWB A;  1O7T A;  2FYI A;  3N26 A;  1JVX A;  4H5F A;  2Z22 A;  1RYO A;  1JEV A;  1PJQ A;  2ADR A;  4WSP A;  2LAO A;  1D9Q A;  2VE7 C;  3FXQ A;  2Z8F A;  2NVU B;  3MPK A;  1NH8 A;  4R2Q A;  2FVZ A;  4Z7E A;  4OVT A;  4DR6 E;  5JTY B;  3O2A A;  2WBD A;  3TOD A;  3FVN A;  4OFJ A;  4O7I A;  1FJ6 A;  4BDO A;  4F2J C;  1A1G A;  4G61 A;  1IME A;  1MY0 A;  4N6K A;  4YAH X;  1FKA E;  3J7Y p; 
#chains in the Genus database with same CATH homology
 1DTZ A;  1H44 A;  4QFO A;  1UTB A;  2P0S A;  4WED A;  2V25 A;  2QPQ A;  4ZE9 A;  3SKP A;  3C34 A;  4RPO A;  4U2R A;  3PUZ E;  1GGG A;  3I5O A;  4MH5 A;  3L6H A;  3PMW A;  3QAX A;  4EF2 A;  4RNS A;  1H76 A;  3H7M A;  1ZU0 A;  2OZZ A;  2XX7 A;  3T22 A;  5AA4 A;  2B3B A;  3TMG A;  3I3V A;  2HAU A;  4YZZ A;  4UAC A;  2DWH A;  4YB6 A;  1I6Q A;  3G3K A;  1XC1 A;  1Y1M A;  2HAV A;  2XXI A;  3Q28 A;  4FAT A;  4F22 A;  3LSL A;  4RPN A;  3OMB A;  4QHQ A;  2XHD A;  5L9O A;  3DP4 A;  2NWJ A;  2WKY A;  1ZJL A;  3QXM A;  4HCY A;  2Y7W A;  3TPA A;  1QKA A;  3C33 A;  4RY1 A;  4LZ8 A;  4F39 A;  1IXC A;  4QSE A;  3U1O A;  3UA8 A;  2X26 A;  1N0T A;  3PV0 E;  4NF8 A;  1MPB A;  3K2D A;  3DP8 A;  4RK9 A;  3LSW A;  3BFT A;  3TTL A;  1I6A A;  5I58 A;  2HZK A;  2YJP A;  1LLS A;  3SEV A;  3KOS A;  1D9Y A;  4MF3 A;  1R1N A;  1B3L A;  3K1M A;  3RLF E;  4NF5 A;  3KJT A;  2R9J A;  3FV1 A;  4DIG A;  4QFP A;  4FAJ A;  4XKP A;  5H8H B;  2XXV A;  2I4B A;  1MH4 A;  2DXR A;  4OQO A;  4OEV A;  5I56 A;  1B0H A;  1R9L A;  2Z8D A;  4KCD A;  4ESX A;  2I6E A;  4E0X A;  2Y7K A;  2YLN A;  1PB9 A;  5TU0 A;  4LQ2 A;  3KEI A;  4TLL B;  2W7Y A;  1PB8 A;  4H6D A;  4DZ1 A;  4LAT A;  2UVH A;  1SYI A;  4U22 A;  2XXY A;  3U92 A;  3K01 A;  4KD5 A;  3KG2 A;  4OER A;  4G2Z A;  3HHG A;  2F7A A;  1SW2 A;  2E1S A;  4C1U A;  4H8I A;  3B6Q A;  4F31 B;  1T0K A;  3PMX A;  5H8F A;  4H8J A;  5K2Y A;  3PPN A;  2ESN A;  3O6I A;  1B51 A;  1I6B A;  3IL1 B;  2OK2 A;  5CMM A;  5FHO A;  1JEU A;  2AL4 A;  2PVU A;  4TQU Q;  1MXY A;  1JQF A;  4OES A;  4R2B A;  4ZED A;  1PB7 A;  3IAZ A;  1ZLQ A;  2ALU A;  3K1P A;  3FXU A;  2ZYM A;  3H6U A;  4BLA A;  4Z0I A;  4LA9 A;  3GBA A;  3LR1 A;  3CRB A;  2XX8 A;  2ANJ A;  5I2N A;  2A5T B;  3K1N A;  1OVT A;  3DLN A;  4IO5 A;  2XXH A;  1MY1 A;  1Y4C A;  3QYT A;  2QSX A;  3SEY A;  1USY H;  2QS1 A;  3W9W A;  1TXF A;  3V5A A;  4LZ5 A;  1BKA A;  3OEK A;  1B1X A;  1USY E;  3H03 A;  3D4C A;  3HV1 A;  3VDF A;  3C31 A;  5TP9 A;  4F18 A;  4R9G A;  4ESW A;  3K6U A;  5I59 B;  1ZMG A;  3MQ9 A;  3LSX A;  1L5T A;  3PGF A;  4ISU A;  2DOJ A;  1MQG A;  4EXK A;  1WOD A;  5HBC A;  4XIG Q;  4F3B A;  1SYH A;  4EQ7 A;  3IOU A;  1LCT A;  1N04 A;  2QS3 A;  3QUF A;  4JSD A;  4E0W A;  3O6H A;  1P1N A;  3S2V A;  5AA2 B;  4GL8 A;  5ISU A;  1B7Z A;  4G68 B;  4POW A;  1B32 A;  4R2F A;  1XT8 A;  2XXX A;  1XS5 A;  1R9Q A;  3M3F A;  4YB5 A;  4JBZ A;  2FNC A;  1MQD A;  1HSE A;  1B3G A;  2YPN A;  3OEN A;  4ZDM A;  3FUZ A;  4YKK A;  3RT6 B;  1EH3 A;  3G3I A;  3RTF B;  3T9U A;  3VVD A;  1PC3 A;  1N84 A;  1FQB A;  3PPP A;  4G77 A;  2OWS A;  2XXU A;  4IO7 A;  4HCW A;  2F7C A;  3SET A;  1NKX A;  2B65 A;  1Y20 A;  5A5X A;  3OSR A;  3R6U A;  5DVI A;  1WDN A;  4F19 A;  3K6V A;  1MM6 A;  4GFR A;  3KSJ A;  2XD2 A;  3VVE A;  4YMB A;  2QJE A;  4ZZA A;  1IXG A;  1R6Z A;  4DXU A;  4BDL A;  4JWY A;  3GZG A;  1B2H A;  3PD9 A;  2ONS A;  1LST A;  3HCQ A;  2F97 A;  3K00 A;  1FTM A;  4I1D A;  1JET A;  1P1W A;  3VXC A;  4IY6 A;  4OZ9 A;  3VLW A;  1EU8 A;  3B6W A;  4U4X A;  1FQF A;  5L9S A;  2OLB A;  3CFX A;  4P11 A;  2H99 A;  1B7H A;  2XXQ A;  5I57 B;  1MQJ A;  2I3W A;  4H0W A;  3O29 A;  3U72 A;  1B3H A;  4KI0 E;  1N76 A;  5EHS A;  1B3E A;  1DPE A;  5TPA A;  1P1U A;  5KDT A;  1NNK A;  1AMF A;  4OTE A;  1SW5 A;  1EZP A;  2DE4 A;  2AL5 A;  2Z8E A;  1UTH B;  2F5X A;  2OJT A;  3TKD A;  1OQG A;  3LUY A;  3G3J A;  4JWO A;  3FAS A;  3Q27 A;  3MVY A;  1QUK A;  4ZEF A;  1SQY A;  4EUO A;  4FEB A;  4DCX A;  2RC8 A;  1Q1K A;  5H8N B;  4RK2 A;  5IKB A;  4UA8 A;  4OET A;  1B05 A;  3V89 B;  1ZBM A;  5FTI A;  3RGY A;  1VR5 A;  3MVZ A;  4YKI A;  3SES A;  4IGR A;  2ZXT A;  4Q8R A;  2DWJ A;  4PQJ A;  4PFU A;  4N13 A;  2ONK E;  3GLB A;  3TDJ A;  1LBC A;  3FV2 A;  4JSO A;  4Q30 B;  4O3A A;  1TT1 A;  4IO6 A;  4R6H A;  1SD3 A;  2F6G A;  2I4C A;  4WXJ A;  2H9B A;  1XHY A;  1MY4 A;  5F7V A;  5H8H A;  3RTW B;  5I84 A;  1RYX A;  3UOR A;  2PMS A;  4AB6 A;  3O6G A;  1NFT A;  3TAJ A;  3QSL A;  4DCY A;  3TQW A;  1POY 1;  1M5D A;  4M4G A;  5DVF A;  2NOO A;  5KCJ A;  3MC2 A;  2UYE A;  2H25 A;  4ZE8 A;  1DTG A;  4R9F A;  1FTL A;  4JXI A;  2PT1 A;  3S9N C;  1CB6 A;  1LAF E;  4GRK A;  1YTV A;  3KZG A;  3PUY E;  2QRY A;  3IR1 A;  4L17 A;  3UN6 A;  3DM0 A;  1B46 A;  3O97 A;  3RY3 A;  3EF7 A;  1MXZ A;  3BBR A;  3T9V A;  1F9B A;  2HXW A;  1XVX A;  1M5C A;  3IB1 A;  2V93 A;  1A8F A;  1QW0 A;  5I2K B;  4OEU A;  2F34 A;  4GIZ A;  1LFG A;  3KN3 A;  2UVG A;  3CR9 A;  3EHU A;  1LFH A;  4GQO A;  4YMA A;  2ZYO A;  3T9X B;  5ITO A;  1UIV A;  4ZEB A;  3PD8 A;  2A5S A;  1MRP A;  4F1V A;  2ZMB A;  2B3F A;  3C32 A;  1S50 A;  5DEX A;  1SW1 A;  4M1V A;  2Q88 A;  3CSG A;  5AA1 A;  2Y7P A;  3A09 A;  2PBW A;  3E4R A;  4RA1 A;  1OQH A;  1EZ9 A;  1MS7 A;  2Y84 A;  1MPD A;  2X7P A;  4YIC A;  3KN8 A;  3SER A;  4WEP A;  4PFT A;  3UIF A;  3H4Z A;  3HN0 A;  2OBG A;  2I49 A;  2HEU A;  4H65 A;  4YKJ A;  4F1Y A;  2PT2 A;  3ZS6 A;  2AYS A;  3MP1 A;  3MP6 A;  3Q29 A;  1B58 A;  5M2V A;  2NUV A;  4HTG A;  3TTK A;  4NF6 B;  2DWA A;  4JWX A;  2H98 A;  3MPL A;  5L9M A;  2VOZ A;  4IY5 A;  1AIV A;  4F2O A;  3FD3 A;  3TTR A;  5BWJ A;  3TFL A;  2ZNT A;  4GD5 A;  3S9L C;  5CBS A;  4LP2 B;  1N3W A;  3OEL A;  4FEC A;  4X1B A;  2DXY A;  3CG1 A;  1XVY A;  4OEN A;  3H6V A;  3DP6 A;  3IJO B;  1BLF A;  2G29 A;  5J1D A;  3VVF A;  1MY3 A;  3SDF A;  1XOC A;  3OO6 A;  1US5 A;  4H67 A;  3EHT A;  1MXV A;  3FIR A;  1LB8 A;  1OMP A;  1IEJ A;  4G68 C;  2O84 X;  2D3I A;  1UTB B;  2PX1 A;  4EF1 A;  1LB9 A;  2V3Q A;  2DYX A;  3N6U A;  3SEU A;  3OO7 A;  4KR5 A;  1VE4 A;  2HZL A;  3PPR A;  3R26 A;  3MVW A;  4QRZ A;  4ELR A;  2M8C A;  3PPQ A;  3GBB A;  2XXR A;  1A7L A;  3FJM A;  3LC8 A;  4AQ4 A;  1P99 A;  4I62 A;  3CI8 A;  1SVX B;  1O64 A;  2FA7 A;  3RQT A;  3TCF A;  4R6Y A;  3C4M A;  4NF4 A;  4R72 A;  5I57 A;  4GOT A;  3HPI A;  1LAG E;  4FED A;  2REG A;  4TLM B;  4XKQ A;  5CRY A;  1DMB A;  4FOR A;  4AB5 A;  2Q2C A;  3S4U A;  4U23 A;  3R7X A;  4Q0C A;  1B5H A;  3THI A;  2V3U A;  1B52 A;  1IXI A;  3OO9 A;  4ZZE A;  5FHN A;  5BUU A;  3H3G A;  4NTL A;  2Q9T A;  3WAF A;  3ILU B;  4NF8 B;  3IO4 A;  3FJ7 A;  3EQ1 A;  5CC2 A;  3CFL A;  5I58 B;  3KSX A;  4PE5 B;  4DDD A;  1B7U A;  1P1Q A;  3PPO A;  3FVO A;  1NNT A;  3E13 X;  4NF5 B;  4R6K A;  3W15 C;  3VFJ A;  1JW4 A;  4THI A;  4KYD A;  4U1Z A;  4DLD A;  1OIB A;  5I56 B;  4XTC Q;  2O68 A;  2XX9 A;  3T96 B;  3TUS A;  1DSN A;  1UIU A;  4X1D A;  3T66 A;  1QUJ A;  2XXW A;  3K6X A;  4P0I A;  3AXF A;  5IAI A;  1IIT A;  5ICT A;  1YPN A;  3TTM A;  5AA3 A;  5ICQ A;  1B3F A;  3RT8 A;  4NWC A;  4OHN A;  4MFI A;  1Q35 A;  3OO8 A;  1A55 A;  2OCU A;  2XXP A;  1N3X A;  4G4P A;  1BTJ A;  4ZEK A;  3VE1 B;  1M5B A;  2P1S A;  4OMB A;  2GHA A;  3CFZ A;  5H8F B;  4FJP A;  2F36 A;  2I48 A;  5KZT A;  1PBP A;  1VFD A;  1OVB A;  3PUV E;  2Q8J A;  3VLU A;  1SW4 A;  4ZS9 A;  3IB2 A;  4BDN A;  4LQ5 A;  5HPQ A;  5JTY A;  1RKM A;  3A3C A;  4OFL A;  4EDP A;  3EHS A;  3ZKK A;  1GVC A;  3Q26 A;  5B7D A;  4LVQ A;  2Q2A A;  1N7X A;  5I2N B;  2UYF A;  3MJN A;  1H3D A;  1URD A;  3N6T A;  4R73 A;  1Z7M E;  1B4Z A;  3WAE A;  4JB7 A;  1MXW A;  3CVG A;  1Y1Z A;  4ONY A;  3M3L A;  1AOV A;  3S9M C;  2X7Q A;  4POX A;  4X48 A;  3TQL A;  4ELO A;  1IXH A;  3TTN A;  3TEP A;  3ECR A;  1TWY A;  1NNF A;  4BDM A;  1HSL A;  1NL5 A;  1ZKB A;  2O1L A;  2F35 A;  4IO4 A;  3EPE A;  5TP9 B;  4PP0 A;  4QSC A;  2GH9 A;  3B6T A;  4U1O A;  1B5I A;  4I9D A;  5DT6 A;  2O7I A;  3IJX B;  2UVI A;  1II5 A;  2I0C A;  4R75 A;  3PUW E;  3E9X A;  3C36 A;  1FQE A;  1M5E A;  3ILT B;  2I0B A;  4KYS A;  3RNN A;  1B40 A;  3S9E A;  2O51 A;  1PEB A;  3KBR A;  3MUQ A;  1BP5 A;  1SBP A;  1BIY A;  3H6T A;  1LCF A;  3OXN A;  1MDQ A;  1A8E A;  4QSD A;  3USD A;  4NMY A;  4DXC A;  2RC9 A;  4JDF A;  3SEX A;  3K4U A;  1QKB A;  4N07 A;  1MH3 A;  3VV5 A;  4IO3 A;  2BJJ X;  1QJM A;  3RN8 A;  3V83 A;  2Q89 A;  4ELP A;  1EZO A;  4LZ7 A;  1HSJ A;  4HS7 A;  5A5X B;  2ONR A;  3MBP A;  2THI A;  3C35 A;  2HFB A;  1GV8 A;  2GHB A;  3PUX E;  4O3B A;  5CI5 A;  1MY2 A;  4KYE A;  1B0L A;  3ZSF A;  4G8N A;  3RUM A;  4GF8 A;  3T9H B;  2GFE A;  3U94 A;  1ELJ A;  4OWD A;  4EXL A;  1JW5 A;  2REJ A;  2O6A A;  2Y7R A;  3JV9 A;  1WVJ A;  4OXV A;  4ECF A;  3MAM A;  3EN3 A;  4GWO A;  4N6P A;  1A40 A;  3RPW A;  4RXL A;  3PU5 A;  5TPA B;  2RKM A;  4QF9 A;  4ZEI A;  2ABH A;  5KDT B;  2CZL A;  1IIW A;  1A54 A;  3PMV A;  3MW0 A;  2RF1 A;  4G8H A;  1VFE A;  2RCB A;  1MPC A;  2A5T A;  1LBB A;  5HM4 B;  3HST A;  4TOZ A;  4LON B;  5JEI A;  1JNF A;  3FXR A;  5H8Q B;  1FTO A;  2VHA A;  3FJG A;  4FE8 A;  2OWT A;  4IGT A;  2DQV A;  3BFU A;  3VLV A;  3IO6 A;  3FVG A;  5CMB A;  3UP9 A;  4EQB A;  1A99 A;  1OLA A;  3IB0 A;  3MZ9 A;  4KHZ E;  2DVZ A;  4NE4 A;  5AA2 D;  3G7W A;  1IQ7 A;  4PET A;  1CE2 A;  4GL0 A;  1O63 A;  1DOT A;  3MZ1 A;  4KCC A;  5I59 A;  3F11 A;  2UXA A;  1I69 A;  1NH7 A;  1ATG A;  3FZV A;  4YB7 A;  3MP8 A;  2IEE A;  1MQI A;  3KFM A;  1VSO A;  1QVS A;  2QMX A;  2ZNS A;  2D5W A;  3IK6 B;  3IOV A;  2RCA A;  1M5F A;  2QS2 A;  4F3S A;  1ZTY A;  1LAH E;  2D21 A;  1FQA A;  2P2A A;  5CM6 A;  4LUB A;  5AA2 A;  4G68 A;  3M8U A;  3TEL A;  1LFI A;  4PFY A;  3KOT A;  1ANF A;  4BDQ A;  1UQW A;  4GXA A;  4G8M A;  5KCJ B;  4RJZ A;  2DVC A;  4ELQ A;  3BKI B;  2NXO A;  4U4S A;  1MDP 1;  3TCH A;  4F3G A;  3OEM A;  4QFK A;  4R74 A;  1Y3N A;  2G93 A;  1OLC A;  1H45 A;  1GR2 A;  1MXU A;  5AE4 A;  3MVX A;  1FCK A;  4O3C A;  5DVJ A;  3KJ7 A;  1FTJ A;  5ELV A;  4K3F A;  4EQ9 A;  4MBP A;  3QIM A;  1MQH A;  3IOW A;  1GTK A;  1NMU A;  1JW1 A;  4XKR A;  2DP8 A;  5AA4 B;  3TYH A;  3B7D A;  1Y9U A;  2KLF A;  3Q25 A;  4I8C A;  4P0G A;  1SI1 A;  2DE3 A;  4DXB A;  1N7W A;  2E0S A;  5CMC A;  4XKN A;  5L8D A;  2Z23 A;  1Y3Q A;  4F29 A;  3L6G A;  3C9H A;  1B5J A;  3OD7 A;  3N94 A;  2VD3 A;  5F1Q A;  5DEX B;  3FAT A;  4H1X A;  1IUD A;  1P1O A;  3E3K A;  4GXS B;  1S7Y A;  4Q5T A;  3OOA A;  1UTH A;  5EYF A;  4MLQ A;  1MXX A;  2R71 A;  4NWD A;  2HQ0 A;  3ODB A;  4MLV A;  2QMW A;  3IX1 A;  4WKM A;  2O1M A;  1SDX A;  4ZEC A;  1D3K A;  3I6V A;  4U21 A;  3OSQ A;  2I3V A;  3JZJ A;  1QUI A;  2UVJ A;  3H6W A;  4H5G A;  5H8S A;  5K2X A;  5H8N A;  4QFL A;  2I58 A;  1AL3 A;  2GRV A;  3V8X B;  4F1U A;  1POT A;  3H06 B;  2XXT A;  1URG A;  1Y3P A;  1Z7N E;  1MG1 A;  3DEL B;  4DE8 A;  1B4H A;  2DSF A;  5LOM A;  3ZKL A;  1YCJ A;  3P7I A;  5DTB A;  1MM7 A;  1PBQ A;  2DWI A;  3KGC A;  1LGB C;  3MZB A;  1ZIU A;  3HO7 A;  1LAX A;  4NED A;  4IB2 A;  1FW0 A;  2F8D A;  2IA4 A;  1B1H A;  4YKP A;  3U93 A;  3G3G A;  3G3F A;  3HHF A;  3TZA A;  3O66 A;  3CSB A;  4OYV A;  3G3H A;  4XXU A;  2VGQ A;  4C0R A;  1AH5 A;  4X9T A;  3UK4 A;  3K02 A;  4HW8 A;  2VP1 A;  2ZYN A;  1TFA A;  1US4 A;  2F7B A;  1Y4T A;  4GVO A;  3ONM A;  2R6G E;  2O7U A;  2H5Y A;  4IO2 A;  2ZYK A;  2CMO A;  4C1T A;  1S9T A;  4KFQ A;  1FQD A;  2VD2 A;  5I2K A;  1DPP A;  4NF4 B;  3M3K A;  2Y7I A;  2HCA A;  3QUJ A;  3LBS A;  4OVJ A;  1B9J A;  2F78 A;  4F2Q A;  2DE2 A;  3K6W A;  1IZ1 A;  4ND9 A;  3SEW A;  1NNP A;  2QL3 A;  5DYH A;  4GLI A;  1FQC A;  2XD3 A;  3T93 B;  4YU0 A;  3N5L A;  3CG3 A;  2RC7 A;  1TFD A;  5H8Q A;  3K0V A;  5ITP A;  3JYR A;  1YAE A;  2RIN A;  5B70 A;  3UGW A;  3D4G A;  4KQP A;  1KWH A;  3FGS A;  4OFO A;  1D9V A;  3CIJ A;  3A3U A;  1J1N A;  2DS9 A;  2QS4 A;  2PYY A;  3TCG A;  3KN7 A;  1H43 A;  5CMK A;  5CBR A;  5JK4 A;  4KPT A;  2H4I A;  4F3P A;  3IOT A;  4BDR A;  3GXA A;  1PDA A;  3U8Q A;  3FVK A;  4RYA A;  3LSF B;  3IOR A;  2V3T A;  5FHM A;  2V84 A;  3W9V A;  1QUL A;  1D4N A;  2ZNU A;  3O9P A;  1URS A;  3QK6 A;  4NF6 A;  1B6H A;  1SI0 A;  4PFW A;  1FTK A;  3VXB A;  2AIX A;  3O28 A;  2O69 A;  5FTH A;  5EHM A;  2F6P A;  4FIM A;  4QFN A;  1JVY A;  3MWB A;  1O7T A;  2FYI A;  3N26 A;  1JVX A;  4H5F A;  2Z22 A;  1RYO A;  1JEV A;  2LAO A;  3FXQ A;  2Z8F A;  2NVU B;  3MPK A;  1NH8 A;  4Z7E A;  5JTY B;  3O2A A;  3TOD A;  3FVN A;  4OFJ A;  4BDO A;  1MY0 A;  4YAH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...