4L5NC

Crystallographic structure of hhv-1 uracil-dna glycosylase complexed with the bacillus phage pza inhibitor protein p56
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
LDSYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Architecturally diverse proteins converge on an analogous mechanism to inactivate Uracil-DNA glycosylase.
pubmed doi rcsb
source organism Herpes simplex virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 10
structure length 50
sequence length 50
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2013-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l5nC00
2LE2A 4L5NC 3ZOQB
chains in the Genus database with same CATH superfamily
4JI7E 2LBSB 2R1FA 1UN6B 2LO3A 2F8BA 2HGHA 1PJQA 2LJHA 1WXRA 4DV4E 1A1FA 2CT1A 2EN3A 1L4SA 4O5GA 2YTPA 2CSHA 1ZR9A 2WBUA 4F2JC 1P47A 2JY9A 2EPPA 4DV6E 2EM6A 2EOXA 2EPKX 5T6JA 3VYXA 2EM4A 4B3SE 2V86A 4LF8E 2GHFA 3JU0A 1I94E 2KONA 4FK5C 2LCEA 2A25A 2RSIA 2YTQA 3EPHA 2JP9A 1X3CA 1ZBQA 2V83A 2EPUA 2LMZA 5A2QC 4LF7E 4JI0E 3LMLA 2FGGA 2EORA 4NXNE 1NEIA 3ADGA 3HXLA 4ZYEA 2EM3A 2EPRA 2EM5A 2EMXA 4ZYGA 4JI6E 2B3TB 4JYAE 1N3GA 3H09A 1MGTA 5KL2A 2EJ4A 3J7Yp 4ZYHA 2EMKA 1EKZA 1YUJA 3C6KA 4DKKA 3EPJA 4HTGA 2B7TA 2EMBA 1T38A 4JI3E 1GZ6A 3VK6A 1PDAA 1XNQE 1HNZE 1IBME 1HR0E 2N3HA 2ZM6E 2CTDA 4DV2E 2FTXB 4F9BB 3M99B 3HPSA 2YU8A 2MDRA 5AASA 2EQ0A 2V88A 2EM8A 2LUQA 4IS1C 4X64E 2YWQA 3VHTB 2EPCA 4WX9A 3MSWA 4OX9E 2ADRA 1AH5A 4LF6E 2V89A 4KHPE 2DMIA 2KOUA 5F3WA 2LT7A 3OMLA 3UK3C 2EPLX 2L2NA 4LU9A 2UXBE 1ZBTA 3EPKA 1A1GA 5FLXC 1RMDA 5TSEA 4DR2E 5A6BD 2EOHA 2EMFA 4WXCA 1BB8A 4F9AB 3BBGA 2ODRC 5KL7A 2NABA 4N4RB 2E1MA 3T1YE 2V8QB 2YRKA 4X9JA 2EQ1A 1IMUA 1WRJA 1Z1BA 4YY3E 3LLHA 1SR9A 2UUAE 2B9DA 4K0KE 1A1JA 4GKJE 2RPCA 1SFEA 2EPOA 4DR1E 3THNA 3C6MA 2YTGA 1YYOA 1X49A 2EOYA 2V87A 2EL4A 2YT4A 2DSYA 1TF3A 2LV2A 4R2SA 3J81C 1X48A 5KL6A 1A1LA 1YZ9A 3RMPA 1G2FC 2WBSA 1J5EE 4R2QA 4ZYDA 1F2IG 2L2MA 2ENAA 3BGHA 2JPAA 4LF5E 2EM7A 2PRTA 4X65E 5LL6R 4M2ZA 2GLIA 5IV8B 3EQ1A 2NUFA 3MHHC 2Q8UA 4B3ME 2K4VA 1X6HA 2LRSA 2DMYA 2VE7C 4R8OA 2FV4B 2RTXA 4DV1E 5KL3A 4R2DA 2JXPA 4I8OA 5AE3A 4R03A 2YPNA 4JI1E 1UBDC 2F4VE 2D9HA 1IBLE 3J80C 2YSOA 5A6AA 3BF2A 2EZ6A 2UUBE 2NUEA 4F9CB 4R2PA 2WBTA 3DF6A 3THOB 1KJKA 1GTKA 2EMIA 1WJPA 5CFFE 2I9IA 4DR7E 1XMQE 2ENCA 5IXMB 5IWAE 4P78A 4KZSA 1LLMC 4HEIA 3EPLA 2LJUA 1X6EA 4WFTA 3J7AG 2YTJA 2EOSA 3C4TA 2EL6A 1DGCA 2DB2A 4GKKE 3KZZA 3AUZA 2HJJA 2RS6A 4BS9A 2EOEA 2LTRA 2JR1A 2YTNA 2EL5A 2EM9A 2M1SA 4DV3E 2LTSA 2CPNA 3K6QA 4L8NA 2MC5A 1UILA 4JI2E 4R2RA 1ZU1A 1N33E 4O24A 2EP3A 2EMZA 4DUYE 3FIGA 4BMJA 4BHCA 5KL4A 1T4OA 1FKAE 3KZYA 4X66E 1BBOA 1UHZA 1YUIA 2UXCE 1X6FA 1STUA 2YTEA 4MLQA 1TN9A 4M30A 2YU5A 4DV5E 4DV7E 1N36E 4AQYE 1EH8A 2YZTA 4LFBE 2GPIA 1T39A 5A6JA 2WZOA 4DR5E 4RHBB 4WYQB 5ADZA 1EH6A 2EPXA 2J7JA 1DQ3A 2EOMA 2EMHA 3QG5C 1WHQA 1J26A 4OOGC 2ELYA 2K7IA 2L8TA 2V85A 1QNTA 4BBYA 3HTXA 2HHHE 4BC7A 1JK2A 2EM0A 3KWRA 2EN2A 3DJWA 5AC5A 2EMWA 2EN8A 2ODRD 3IWBA 4B3RE 4JI5E 1O0WA 3IWDA 1X5WA 1KYQA 2EPMX 1YYKA 2EN7A 5AE1A 1YSAC 2MDGA 3F6HA 2YRMA 2EOJA 3HQ1A 4DR4E 2EMYA 3MHSC 4LTYA 2E72A 2YTDA 2IHR1 5A69A 4TUGA 2JVAA 2EN6A 2JOXA 4X8WA 1HNXE 2NA2A 4DR3E 4LF9E 5AC4A 1B69A 2UU9E 1XNRE 2VF1A 1HNWE 2EQ3A 2L6MA 2EM2A 2LUPB 2H36X 2YRHA 4DUZE 1FJGE 5IT9C 3ADIA 2L2KB 1T4LB 1T4NA 3JAMC 2JYAA 4MLVA 4YHHE 2EOZA 2RS7A 3OTOE 2VQEE 2MC6A 1A1IA 1YYWA 4NXME 4LFAE 1GQEA 1RQ0A 3ECRA 2EMLA 2RSMA 4O43A 4LFCE 1BBGA 2DIXA 2DGCA 2EN4A 4JI8E 3P1XA 5KL5A 4WSPA 1N32E 1DI2A 2N8XA 1TF6A 5LLQA 4DR6E 3JTZA 2EOOA 4Q35B 2N3GA 2YTOA 4TUIA 1EH7A 1PKPA 2M9AA 3ADLA 4X62E 4BC9A 4O4KA 2R76A 4J8ZA 4B3TE 4WSGA 1X47A 4JV5E 1PJSA 2WCC3 4NZVA 3T1HE 2EOFA 5A6BA 4GZNC 2L3CA 2YTIA 3IWCA 2EE8A 3ADJA 4GEQB 2HC5A 1YPNA 1JK1A 2ENHA 2JWOA 5LMUE 2G7HA 4RH8A 2JOBA 2L92A 2EMCA 2EOIA 4KWYA 4WPYA 1QU6A 1RC7A 2NUGA 1N34E 2DLQA 2ELZA 2DLKA 5AE2A 2EWLA 2UUCE 3BIDA 2B7VA 2RQLA 4L5NC 4NHRA 2KHXA 2M4IA 4R2CA 1WHNA 1A1HA 1NCSA 2EMGA 4WXDA 4DMIA 1AAYA 5DNYA 2E5LE 1PJTA 4P7DA 2EOQA 2BBGA 2EPAA 5A6KA 3ZOQB 4R2AA 3F6GA 2EPZA 2BB8A 4Q28A 2DRPA 2EN1A 4R2EA 4F6MA 4LF4E 1IQSA 1G2DC 2I13A 4M0VA 4IJDA 4M9VC 3AV0A 3L00A 4JI4E 5BR8E 1YFHA 1IQOA 2EPNA 2MKNA 3HPZA 2LE2A 3VYYA 3TQMA 2VQFE 5LMNE 2UXDE 2EMAA 1XMOE 2M7QA 2MKDA 2VRDA 4DV0E 3C4BA 1IBKE 1A1KA 2YTFA 1MEYC 2YSPA 2L3JA 1ZAAC 4BHBA 2L33A 2LVHA 4F6NA 4F54A 4BCAA
chains in the Genus database with same CATH topology
2V8QB 4JI8E 4JI7E 2LBSB 3P1XA 4WSPA 1N32E 2F8BA 1DI2A 4DUYE 2LJHA 3FIGA 1WXRA 4DV4E 4BMJA 1T4OA 4YY3E 3LLHA 1SR9A 1FKAE 2UUAE 2B9DA 4K0KE 4X66E 4DR6E 3JTZA 1UHZA 2N3GA 4GKJE 2UXCE 1STUA 2JY9A 4TUIA 1PKPA 4DV6E 4DR1E 4M30A 4DV7E 4DV5E 1N36E 3ADLA 4AQYE 5T6JA 3VYXA 2YZTA 4X62E 4LFBE 4BC9A 4B3SE 1YYOA 2V86A 1X49A 3JU0A 2WZOA 4J8ZA 1I94E 2KONA 4DR5E 4B3TE 2V87A 4WYQB 5ADZA 1X47A 4JV5E 3T1HE 2YT4A 2DSYA 3VYYA 3J81C 1X48A 2L3CA 1DQ3A 1YZ9A 3RMPA 1ZBQA 1WHQA 3IWCA 4OOGC 1J5EE 1J26A 2V83A 2L8TA 2V85A 2LMZA 3ADJA 5A2QC 4LF7E 4BBYA 4JI0E 2L2MA 3LMLA 4GEQB 3HTXA 4LF5E 2FGGA 4NXNE 2HHHE 3ADGA 4X65E 5LL6R 3HXLA 4M2ZA 2NUFA 4BC7A 4JI6E 2JWOA 2B3TB 5LMUE 2G7HA 3H09A 4JYAE 3J7Yp 3KWRA 2JOBA 2L92A 4B3ME 2K4VA 2LRSA 2DMYA 2VE7C 4R8OA 4WPYA 1QU6A 2FV4B 3DJWA 1EKZA 2RTXA 4DV1E 4I8OA 5AE3A 4R03A 1RC7A 2NUGA 2ODRD 4JI1E 4DKKA 3IWBA 1N34E 4B3RE 2F4VE 4JI5E 5AE2A 1IBLE 1O0WA 2B7TA 2EWLA 3J80C 3IWDA 2UUCE 4JI3E 2UXDE 2B7VA 2EZ6A 2UUBE 2NUEA 1GZ6A 4L5NC 4F9CB 3VK6A 1YYKA 2KHXA 2M4IA 1XNQE 5AE1A 3T1YE 1HNZE 1WHNA 1IBME 3F6HA 1HR0E 2N3HA 3DF6A 3HQ1A 2ZM6E 4DMIA 4DV2E 4DR4E 5DNYA 2FTXB 2E5LE 4P7DA 4F9BB 4LTYA 4TUGA 2IHR1 3HPSA 2JVAA 2JOXA 1HNXE 4X8WA 2NA2A 2MDRA 5CFFE 5AASA 4DR3E 3ZOQB 4LF9E 4DR7E 3F6GA 2V88A 1XMQE 5IWAE 2LUQA 2UU9E 4P78A 1XNRE 2VF1A 4Q28A 4KZSA 4X64E 4LF8E 4LF4E 3MSWA 4OX9E 4WFTA 1HNWE 2L6MA 4LF6E 3J7AG 2V89A 2LUPB 4KHPE 4M0VA 2H36X 3C4TA 3AV0A 2KOUA 4JI4E 5BR8E 4DUZE 1FJGE 5IT9C 3ADIA 5F3WA 2DB2A 2L2KB 1T4LB 1T4NA 3OMLA 3JAMC 4GKKE 2L2NA 3AUZA 3HPZA 2LE2A 4YHHE 4LU9A 5LMNE 2RS7A 2VQFE 2RS6A 3OTOE 2MC6A 1ZBTA 4BS9A 2VQEE 2M7QA 2LTRA 1XMOE 2JR1A 2UXBE 4DV0E 1YYWA 4NXME 4LFAE 1GQEA 3C4BA 1RQ0A 5FLXC 1IBKE 2M1SA 4DV3E 4DR2E 2LTSA 2CPNA 3K6QA 4L8NA 2L3JA 4F9AB 2L33A 2ODRC 2RSMA 2MC5A 1UILA 4F54A 4LFCE 2DIXA 4JI2E 2E1MA 1N33E 4BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE2 A;  4L5N C;  3ZOQ B; 
#chains in the Genus database with same CATH topology
 4JI7 E;  2LBS B;  2R1F A;  1UN6 B;  2LO3 A;  2F8B A;  2HGH A;  1PJQ A;  2LJH A;  1WXR A;  4DV4 E;  1A1F A;  2CT1 A;  2EN3 A;  1L4S A;  4O5G A;  2YTP A;  2CSH A;  1ZR9 A;  2WBU A;  4F2J C;  1P47 A;  2JY9 A;  2EPP A;  4DV6 E;  2EM6 A;  2EOX A;  2EPK X;  5T6J A;  3VYX A;  2EM4 A;  4B3S E;  2V86 A;  4LF8 E;  2GHF A;  3JU0 A;  1I94 E;  2KON A;  4FK5 C;  2LCE A;  2A25 A;  2RSI A;  2YTQ A;  3EPH A;  2JP9 A;  1X3C A;  1ZBQ A;  2V83 A;  2EPU A;  2LMZ A;  5A2Q C;  4LF7 E;  4JI0 E;  3LML A;  2FGG A;  2EOR A;  4NXN E;  1NEI A;  3ADG A;  3HXL A;  4ZYE A;  2EM3 A;  2EPR A;  2EM5 A;  2EMX A;  4ZYG A;  4JI6 E;  2B3T B;  4JYA E;  1N3G A;  3H09 A;  1MGT A;  5KL2 A;  2EJ4 A;  3J7Y p;  4ZYH A;  2EMK A;  1EKZ A;  1YUJ A;  3C6K A;  4DKK A;  3EPJ A;  4HTG A;  2B7T A;  2EMB A;  1T38 A;  4JI3 E;  1GZ6 A;  3VK6 A;  1PDA A;  1XNQ E;  1HNZ E;  1IBM E;  1HR0 E;  2N3H A;  2ZM6 E;  2CTD A;  4DV2 E;  2FTX B;  4F9B B;  3M99 B;  3HPS A;  2YU8 A;  2MDR A;  5AAS A;  2EQ0 A;  2V88 A;  2EM8 A;  2LUQ A;  4IS1 C;  4X64 E;  2YWQ A;  3VHT B;  2EPC A;  4WX9 A;  3MSW A;  4OX9 E;  2ADR A;  1AH5 A;  4LF6 E;  2V89 A;  4KHP E;  2DMI A;  2KOU A;  5F3W A;  2LT7 A;  3OML A;  3UK3 C;  2EPL X;  2L2N A;  4LU9 A;  2UXB E;  1ZBT A;  3EPK A;  1A1G A;  5FLX C;  1RMD A;  5TSE A;  4DR2 E;  5A6B D;  2EOH A;  2EMF A;  4WXC A;  1BB8 A;  4F9A B;  3BBG A;  2ODR C;  5KL7 A;  2NAB A;  4N4R B;  2E1M A;  3T1Y E;  2V8Q B;  2YRK A;  4X9J A;  2EQ1 A;  1IMU A;  1WRJ A;  1Z1B A;  4YY3 E;  3LLH A;  1SR9 A;  2UUA E;  2B9D A;  4K0K E;  1A1J A;  4GKJ E;  2RPC A;  1SFE A;  2EPO A;  4DR1 E;  3THN A;  3C6M A;  2YTG A;  1YYO A;  1X49 A;  2EOY A;  2V87 A;  2EL4 A;  2YT4 A;  2DSY A;  1TF3 A;  2LV2 A;  4R2S A;  3J81 C;  1X48 A;  5KL6 A;  1A1L A;  1YZ9 A;  3RMP A;  1G2F C;  2WBS A;  1J5E E;  4R2Q A;  4ZYD A;  1F2I G;  2L2M A;  2ENA A;  3BGH A;  2JPA A;  4LF5 E;  2EM7 A;  2PRT A;  4X65 E;  5LL6 R;  4M2Z A;  2GLI A;  5IV8 B;  3EQ1 A;  2NUF A;  3MHH C;  2Q8U A;  4B3M E;  2K4V A;  1X6H A;  2LRS A;  2DMY A;  2VE7 C;  4R8O A;  2FV4 B;  2RTX A;  4DV1 E;  5KL3 A;  4R2D A;  2JXP A;  4I8O A;  5AE3 A;  4R03 A;  2YPN A;  4JI1 E;  1UBD C;  2F4V E;  2D9H A;  1IBL E;  3J80 C;  2YSO A;  5A6A A;  3BF2 A;  2EZ6 A;  2UUB E;  2NUE A;  4F9C B;  4R2P A;  2WBT A;  3DF6 A;  3THO B;  1KJK A;  1GTK A;  2EMI A;  1WJP A;  5CFF E;  2I9I A;  4DR7 E;  1XMQ E;  2ENC A;  5IXM B;  5IWA E;  4P78 A;  4KZS A;  1LLM C;  4HEI A;  3EPL A;  2LJU A;  1X6E A;  4WFT A;  3J7A G;  2YTJ A;  2EOS A;  3C4T A;  2EL6 A;  1DGC A;  2DB2 A;  4GKK E;  3KZZ A;  3AUZ A;  2HJJ A;  2RS6 A;  4BS9 A;  2EOE A;  2LTR A;  2JR1 A;  2YTN A;  2EL5 A;  2EM9 A;  2M1S A;  4DV3 E;  2LTS A;  2CPN A;  3K6Q A;  4L8N A;  2MC5 A;  1UIL A;  4JI2 E;  4R2R A;  1ZU1 A;  1N33 E;  4O24 A;  2EP3 A;  2EMZ A;  4DUY E;  3FIG A;  4BMJ A;  4BHC A;  5KL4 A;  1T4O A;  1FKA E;  3KZY A;  4X66 E;  1BBO A;  1UHZ A;  1YUI A;  2UXC E;  1X6F A;  1STU A;  2YTE A;  4MLQ A;  1TN9 A;  4M30 A;  2YU5 A;  4DV5 E;  4DV7 E;  1N36 E;  4AQY E;  1EH8 A;  2YZT A;  4LFB E;  2GPI A;  1T39 A;  5A6J A;  2WZO A;  4DR5 E;  4RHB B;  4WYQ B;  5ADZ A;  1EH6 A;  2EPX A;  2J7J A;  1DQ3 A;  2EOM A;  2EMH A;  3QG5 C;  1WHQ A;  1J26 A;  4OOG C;  2ELY A;  2K7I A;  2L8T A;  2V85 A;  1QNT A;  4BBY A;  3HTX A;  2HHH E;  4BC7 A;  1JK2 A;  2EM0 A;  3KWR A;  2EN2 A;  3DJW A;  5AC5 A;  2EMW A;  2EN8 A;  2ODR D;  3IWB A;  4B3R E;  4JI5 E;  1O0W A;  3IWD A;  1X5W A;  1KYQ A;  2EPM X;  1YYK A;  2EN7 A;  5AE1 A;  1YSA C;  2MDG A;  3F6H A;  2YRM A;  2EOJ A;  3HQ1 A;  4DR4 E;  2EMY A;  3MHS C;  4LTY A;  2E72 A;  2YTD A;  2IHR 1;  5A69 A;  4TUG A;  2JVA A;  2EN6 A;  2JOX A;  4X8W A;  1HNX E;  2NA2 A;  4DR3 E;  4LF9 E;  5AC4 A;  1B69 A;  2UU9 E;  1XNR E;  2VF1 A;  1HNW E;  2EQ3 A;  2L6M A;  2EM2 A;  2LUP B;  2H36 X;  2YRH A;  4DUZ E;  1FJG E;  5IT9 C;  3ADI A;  2L2K B;  1T4L B;  1T4N A;  3JAM C;  2JYA A;  4MLV A;  4YHH E;  2EOZ A;  2RS7 A;  3OTO E;  2VQE E;  2MC6 A;  1A1I A;  1YYW A;  4NXM E;  4LFA E;  1GQE A;  1RQ0 A;  3ECR A;  2EML A;  2RSM A;  4O43 A;  4LFC E;  1BBG A;  2DIX A;  2DGC A;  2EN4 A;  4JI8 E;  3P1X A;  5KL5 A;  4WSP A;  1N32 E;  1DI2 A;  2N8X A;  1TF6 A;  5LLQ A;  4DR6 E;  3JTZ A;  2EOO A;  4Q35 B;  2N3G A;  2YTO A;  4TUI A;  1EH7 A;  1PKP A;  2M9A A;  3ADL A;  4X62 E;  4BC9 A;  4O4K A;  2R76 A;  4J8Z A;  4B3T E;  4WSG A;  1X47 A;  4JV5 E;  1PJS A;  2WCC 3;  4NZV A;  3T1H E;  2EOF A;  5A6B A;  4GZN C;  2L3C A;  2YTI A;  3IWC A;  2EE8 A;  3ADJ A;  4GEQ B;  2HC5 A;  1YPN A;  1JK1 A;  2ENH A;  2JWO A;  5LMU E;  2G7H A;  4RH8 A;  2JOB A;  2L92 A;  2EMC A;  2EOI A;  4KWY A;  4WPY A;  1QU6 A;  1RC7 A;  2NUG A;  1N34 E;  2DLQ A;  2ELZ A;  2DLK A;  5AE2 A;  2EWL A;  2UUC E;  3BID A;  2B7V A;  2RQL A;  4L5N C;  4NHR A;  2KHX A;  2M4I A;  4R2C A;  1WHN A;  1A1H A;  1NCS A;  2EMG A;  4WXD A;  4DMI A;  1AAY A;  5DNY A;  2E5L E;  1PJT A;  4P7D A;  2EOQ A;  2BBG A;  2EPA A;  5A6K A;  3ZOQ B;  4R2A A;  3F6G A;  2EPZ A;  2BB8 A;  4Q28 A;  2DRP A;  2EN1 A;  4R2E A;  4F6M A;  4LF4 E;  1IQS A;  1G2D C;  2I13 A;  4M0V A;  4IJD A;  4M9V C;  3AV0 A;  3L00 A;  4JI4 E;  5BR8 E;  1YFH A;  1IQO A;  2EPN A;  2MKN A;  3HPZ A;  2LE2 A;  3VYY A;  3TQM A;  2VQF E;  5LMN E;  2UXD E;  2EMA A;  1XMO E;  2M7Q A;  2MKD A;  2VRD A;  4DV0 E;  3C4B A;  1IBK E;  1A1K A;  2YTF A;  1MEY C;  2YSP A;  2L3J A;  1ZAA C;  4BHB A;  2L33 A;  2LVH A;  4F6N A;  4F54 A;  4BCA A; 
#chains in the Genus database with same CATH homology
 2V8Q B;  4JI8 E;  4JI7 E;  2LBS B;  3P1X A;  4WSP A;  1N32 E;  2F8B A;  1DI2 A;  4DUY E;  2LJH A;  3FIG A;  1WXR A;  4DV4 E;  4BMJ A;  1T4O A;  4YY3 E;  3LLH A;  1SR9 A;  1FKA E;  2UUA E;  2B9D A;  4K0K E;  4X66 E;  4DR6 E;  3JTZ A;  1UHZ A;  2N3G A;  4GKJ E;  2UXC E;  1STU A;  2JY9 A;  4TUI A;  1PKP A;  4DV6 E;  4DR1 E;  4M30 A;  4DV7 E;  4DV5 E;  1N36 E;  3ADL A;  4AQY E;  5T6J A;  3VYX A;  2YZT A;  4X62 E;  4LFB E;  4BC9 A;  4B3S E;  1YYO A;  2V86 A;  1X49 A;  3JU0 A;  2WZO A;  4J8Z A;  1I94 E;  2KON A;  4DR5 E;  4B3T E;  2V87 A;  4WYQ B;  5ADZ A;  1X47 A;  4JV5 E;  3T1H E;  2YT4 A;  2DSY A;  3VYY A;  3J81 C;  1X48 A;  2L3C A;  1DQ3 A;  1YZ9 A;  3RMP A;  1ZBQ A;  1WHQ A;  3IWC A;  4OOG C;  1J5E E;  1J26 A;  2V83 A;  2L8T A;  2V85 A;  2LMZ A;  3ADJ A;  5A2Q C;  4LF7 E;  4BBY A;  4JI0 E;  2L2M A;  3LML A;  4GEQ B;  3HTX A;  4LF5 E;  2FGG A;  4NXN E;  2HHH E;  3ADG A;  4X65 E;  5LL6 R;  3HXL A;  4M2Z A;  2NUF A;  4BC7 A;  4JI6 E;  2JWO A;  2B3T B;  5LMU E;  2G7H A;  3H09 A;  4JYA E;  3J7Y p;  3KWR A;  2JOB A;  2L92 A;  4B3M E;  2K4V A;  2LRS A;  2DMY A;  2VE7 C;  4R8O A;  4WPY A;  1QU6 A;  2FV4 B;  3DJW A;  1EKZ A;  2RTX A;  4DV1 E;  4I8O A;  5AE3 A;  4R03 A;  1RC7 A;  2NUG A;  2ODR D;  4JI1 E;  4DKK A;  3IWB A;  1N34 E;  4B3R E;  2F4V E;  4JI5 E;  5AE2 A;  1IBL E;  1O0W A;  2B7T A;  2EWL A;  3J80 C;  3IWD A;  2UUC E;  4JI3 E;  2UXD E;  2B7V A;  2EZ6 A;  2UUB E;  2NUE A;  1GZ6 A;  4L5N C;  4F9C B;  3VK6 A;  1YYK A;  2KHX A;  2M4I A;  1XNQ E;  5AE1 A;  3T1Y E;  1HNZ E;  1WHN A;  1IBM E;  3F6H A;  1HR0 E;  2N3H A;  3DF6 A;  3HQ1 A;  2ZM6 E;  4DMI A;  4DV2 E;  4DR4 E;  5DNY A;  2FTX B;  2E5L E;  4P7D A;  4F9B B;  4LTY A;  4TUG A;  2IHR 1;  3HPS A;  2JVA A;  2JOX A;  1HNX E;  4X8W A;  2NA2 A;  2MDR A;  5CFF E;  5AAS A;  4DR3 E;  3ZOQ B;  4LF9 E;  4DR7 E;  3F6G A;  2V88 A;  1XMQ E;  5IWA E;  2LUQ A;  2UU9 E;  4P78 A;  1XNR E;  2VF1 A;  4Q28 A;  4KZS A;  4X64 E;  4LF8 E;  4LF4 E;  3MSW A;  4OX9 E;  4WFT A;  1HNW E;  2L6M A;  4LF6 E;  3J7A G;  2V89 A;  2LUP B;  4KHP E;  4M0V A;  2H36 X;  3C4T A;  3AV0 A;  2KOU A;  4JI4 E;  5BR8 E;  4DUZ E;  1FJG E;  5IT9 C;  3ADI A;  5F3W A;  2DB2 A;  2L2K B;  1T4L B;  1T4N A;  3OML A;  3JAM C;  4GKK E;  2L2N A;  3AUZ A;  3HPZ A;  2LE2 A;  4YHH E;  4LU9 A;  5LMN E;  2RS7 A;  2VQF E;  2RS6 A;  3OTO E;  2MC6 A;  1ZBT A;  4BS9 A;  2VQE E;  2M7Q A;  2LTR A;  1XMO E;  2JR1 A;  2UXB E;  4DV0 E;  1YYW A;  4NXM E;  4LFA E;  1GQE A;  3C4B A;  1RQ0 A;  5FLX C;  1IBK E;  2M1S A;  4DV3 E;  4DR2 E;  2LTS A;  2CPN A;  3K6Q A;  4L8N A;  2L3J A;  4F9A B;  2L33 A;  2ODR C;  2RSM A;  2MC5 A;  1UIL A;  4F54 A;  4LFC E;  2DIX A;  4JI2 E;  2E1M A;  1N33 E;  4BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...