4L5NC

Crystallographic structure of hhv-1 uracil-dna glycosylase complexed with the bacillus phage pza inhibitor protein p56
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
LDSYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
publication title Architecturally diverse proteins converge on an analogous mechanism to inactivate Uracil-DNA glycosylase.
pubmed doi rcsb
source organism Herpes simplex virus type 1
total genus 10
structure length 50
sequence length 50
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2013-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l5nC00
2LE2A 4L5NC 3ZOQB
chains in the Genus database with same CATH superfamily
2EPCA 4R2RA 2EPMX 2EPLX 1XNQE 4WSGA 1EH6A 1G2FC 1YZ9A 2MDRA 2RS7A 2CPNA 2EOXA 4R03A 2L6MA 4DMIA 4X62E 4F9AB 3ADGA 4L8NA 5A69A 1P47A 4O43A 2EMWA 2EOEA 2M1SA 4JI0E 2JYAA 1X48A 3VYXA 2K4VA 2V87A 1EKZA 3ZOQB 4NXME 1BB8A 4BS9A 2EM6A 4M30A 2YTNA 1SFEA 1GZ6A 1YUIA 1IMUA 2N8XA 4IJDA 2EMFA 3BBGA 4ZYEA 4DV5E 2EMAA 3H09A 1XNRE 3EPKA 4M2ZA 4BMJA 2EOMA 1XMOE 2VF1A 3F6HA 5LMUE 2JP9A 1YYOA 2EQ1A 2DB2A 1N34E 2RQLA 2YTJA 2L92A 1HNWE 4O5GA 4JV5E 4ZYDA 2EMKA 1FJGE 2R1FA 3RMPA 1A1JA 5FLXC 2EOSA 2ENAA 4RH8A 5LMNE 2V85A 1GTKA 2B7VA 4BHCA 2MC6A 2YTDA 2HJJA 2YTFA 1TF3A 3T1YE 2WBUA 1GQEA 2DMIA 3C6MA 5A6BD 3C6KA 2ZM6E 2J7JA 1YSAC 2EOFA 3T1HE 1KJKA 1NEIA 4AQYE 1WJPA 4RHBB 3KZYA 2D9HA 4LF8E 1L4SA 2YTIA 2YU5A 2EQ0A 4MLQA 1BBOA 5KL7A 2E1MA 1O0WA 2B7TA 5KL6A 2LUPB 2DLKA 4DUYE 4R2AA 2B3TB 2EM7A 4R2PA 4JI2E 1DGCA 1G2DC 2YU8A 2BBGA 4Q28A 3C4BA 2RSMA 5KL4A 2EPAA 4NHRA 4BBYA 2EL4A 1YFHA 2EPOA 3VHTB 4TUGA 2EM9A 3BGHA 1XMQE 1A1FA 2L2NA 1X6EA 1WHNA 4R8OA 3J81C 2LMZA 1X6HA 3THOB 1AH5A 2NA2A 4DR6E 2YTPA 2VRDA 1N33E 2NUGA 2GPIA 4J8ZA 2B9DA 2EM5A 4DV2E 4NZVA 2DSYA 2YRKA 3K6QA 2EPKX 2M4IA 1IQOA 4X64E 2EN1A 1RQ0A 2JOXA 1UBDC 5DNYA 1RC7A 2LTSA 1QNTA 2DLQA 5IV8B 2ADRA 3AV0A 1TN9A 2LUQA 2EZ6A 1RMDA 4HEIA 3ADIA 3MSWA 2RS6A 4BHBA 5KL2A 2EOQA 2YSOA 4DV3E 2WCC3 1PJTA 4LTYA 3EPLA 3IWCA 4DR5E 1EH8A 1X47A 3QG5C 4DR2E 4DR4E 1T38A 4R2DA 3F6GA 2F4VE 5F3WA 1MGTA 2JOBA 4K0KE 2VQFE 1UILA 3VK6A 5BR8E 2EN6A 1A1IA 4Q35B 2NABA 4X9JA 2LRSA 4DV7E 2JY9A 1N36E 2EMIA 2I9IA 5KL5A 1N3GA 3KZZA 2EOJA 2EMLA 1X49A 2JR1A 2N3HA 1SR9A 1T39A 2NUFA 2EM0A 2EPNA 2KHXA 2LBSB 1N32E 5AC5A 1YUJA 2JXPA 4LFCE 1DQ3A 1A1GA 4LF7E 4M0VA 1A1HA 2YWQA 2EORA 2JWOA 3KWRA 4DV1E 4LF6E 2UXCE 5AASA 1AAYA 2EOHA 2CSHA 2KOUA 1PDAA 4JI3E 4I8OA 4JI1E 2EOIA 2EN2A 4R2QA 2L2KB 2I13A 1T4OA 3J7Yp 1ZU1A 1MEYC 1J5EE 4KWYA 1IBME 2YRMA 4DV6E 1ZR9A 3HTXA 2ELZA 3LMLA 2YT4A 1YYWA 3DJWA 4F2JC 1HNXE 1T4NA 4WSPA 2EP3A 2EPPA 2EPZA 2R76A 5T6JA 2MKNA 4BC7A 4DKKA 4BCAA 2LJHA 3HPZA 3THNA 2DMYA 2V89A 4F9CB 4JI7E 4WXDA 2EL6A 2K7IA 2RPCA 4GZNC 2ODRC 2HGHA 2WZOA 4JI5E 1UN6B 2BB8A 2EM3A 2FV4B 1J26A 2CT1A 3ECRA 2L3CA 4P7DA 2ODRD 2EPXA 1PJQA 1I94E 4WYQB 2DIXA 2EE8A 2GHFA 1WXRA 2EN8A 1HNZE 4B3SE 2UUBE 2G7HA 2WBSA 4WPYA 1TF6A 2VQEE 2FGGA 3VYYA 4LF9E 4R2CA 2RSIA 3IWDA 2A25A 4LF5E 1WRJA 4MLVA 2MC5A 3BIDA 2EM2A 2YTOA 3UK3C 3C4TA 3ADLA 4B3RE 2EOOA 2EWLA 1JK1A 2NUEA 2L3JA 2LE2A 2EMZA 1NCSA 2L33A 2N3GA 4ZYHA 5A6BA 2UUCE 4DR1E 3AUZA 4ZYGA 3JAMC 4JI6E 3M99B 4DV0E 5A2QC 4M9VC 3EPHA 2ENHA 4X66E 2EM8A 5CFFE 4GKJE 4FK5C 1ZBTA 2M9AA 4OX9E 4KHPE 2YTEA 4KZSA 2KONA 2DRPA 2EJ4A 1Z1BA 3MHHC 5AE3A 3IWBA 4BC9A 2UUAE 2H36X 1FKAE 2ENCA 1BBGA 2EPRA 4N4RB 1UHZA 2F8BA 5IWAE 4JI4E 2V88A 4OOGC 5LLQA 2RTXA 4DUZE 3HXLA 2MDGA 2LCEA 2EOYA 2FTXB 4LFAE 4GEQB 4O24A 2VE7C 2MKDA 3HPSA 1STUA 4X8WA 2EPUA 4DR3E 2HC5A 4O4KA 2EN4A 1X3CA 5AC4A 2LTRA 2EN3A 5LL6R 2EMGA 3EPJA 4R2EA 2EMHA 2E5LE 1DI2A 3JTZA 5AE2A 2YTGA 5KL3A 4P78A 4B3ME 4HTGA 5TSEA 5A6JA 4JI8E 2YZTA 1QU6A 1IQSA 4L5NC 2WBTA 4DV4E 2EL5A 2JVAA 1F2IG 2EMXA 1IBKE 3DF6A 3OMLA 2Q8UA 2PRTA 2EM4A 2V8QB 4LF4E 1HR0E 2DGCA 1LLMC 2HHHE 1WHQA 2JPAA 2LVHA 3ADJA 3MHSC 2IHR1 2CTDA 1PKPA 2L8TA 2GLIA 2EQ3A 3FIGA 4F9BB 1IBLE 2LT7A 5AE1A 4B3TE 4LFBE 2E72A 4DR7E 5A6KA 4GKKE 4WFTA 2LO3A 4JYAE 1JK2A 4WX9A 3P1XA 2UXBE 4YHHE 1PJSA 5IXMB 2M7QA 2YPNA 2EMCA 3J7AG 3HQ1A 4F54A 2V83A 2YSPA 3JU0A 4NXNE 4TUIA 2L2MA 2LJUA 1ZBQA 3OTOE 5IT9C 1YYKA 1T4LB 1KYQA 2EMYA 2EMBA 3J80C 2YRHA 3BF2A 4IS1C 4F6MA 1YPNA 3TQMA 1B69A 1A1KA 2V86A 3EQ1A 4YY3E 4WXCA 4X65E 2YTQA 4LU9A 1X6FA 5ADZA 1EH7A 1A1LA 1ZAAC 2ELYA 5A6AA 2UU9E 2LV2A 2EOZA 2EN7A 1X5WA 4R2SA 2UXDE 3L00A 3LLHA 4F6NA
chains in the Genus database with same CATH topology
2RSMA 1J5EE 1IBME 2FTXB 4DV6E 4BBYA 3HTXA 3LMLA 1XNQE 2YT4A 4LFAE 1YYWA 4GEQB 3DJWA 2VE7C 1YZ9A 2MDRA 1HNXE 1T4NA 2RS7A 3HPSA 4WSPA 4TUGA 1STUA 2CPNA 2L2NA 4X8WA 1XMQE 1WHNA 4R8OA 4R03A 2L6MA 4DR3E 4DMIA 3J81C 2LMZA 5T6JA 4BC7A 4X62E 4DKKA 4BCAA 2LJHA 3HPZA 4F9AB 3ADGA 2LTRA 2NA2A 4DR6E 1N33E 5LL6R 2DMYA 2V89A 4F9CB 4L8NA 2NUGA 4JI7E 4J8ZA 2E5LE 2B9DA 2M1SA 4JI0E 1DI2A 3JTZA 2ODRC 4DV2E 1X48A 2WZOA 5AE2A 4JI5E 2K4VA 2FV4B 2V87A 3ZOQB 1EKZA 4NXME 2DSYA 4P78A 1J26A 3K6QA 4BS9A 2L3CA 4M30A 4B3ME 4P7DA 1GZ6A 2ODRD 2M4IA 4X64E 4JI8E 1I94E 4WYQB 1RQ0A 1QU6A 2JOXA 2YZTA 5DNYA 2DIXA 4DV5E 4L5NC 1WXRA 1RC7A 2LTSA 4DV4E 1HNZE 2JVAA 2UUBE 3AV0A 4B3SE 2LUQA 3H09A 3DF6A 1IBKE 2G7HA 3OMLA 1XNRE 2EZ6A 3ADIA 3MSWA 2RS6A 4M2ZA 4BMJA 1XMOE 2VF1A 3VYXA 3F6HA 4WPYA 4DV3E 5LMUE 2V8QB 2VQEE 2FGGA 3VYYA 1YYOA 1HR0E 4LF4E 4LTYA 4LF9E 2HHHE 1WHQA 3ADJA 2DB2A 1N34E 2IHR1 2L92A 3IWCA 1X47A 4DR5E 4DR2E 1PKPA 3IWDA 4DR4E 1HNWE 2L8TA 4LF5E 3F6GA 2F4VE 4JV5E 5F3WA 2MC5A 3FIGA 1FJGE 4F9BB 3RMPA 1IBLE 2JOBA 4K0KE 5AE1A 5FLXC 2VQFE 4B3TE 4LFBE 1UILA 3C4TA 3ADLA 3VK6A 4DR7E 4B3RE 5LMNE 2EWLA 5BR8E 2V85A 4GKKE 2NUEA 2L3JA 2B7VA 4WFTA 2LE2A 2MC6A 4JYAE 2L33A 2N3GA 2UUCE 4DR1E 3AUZA 3P1XA 2LRSA 3JAMC 4DV7E 2JY9A 3T1YE 1N36E 2ZM6E 1GQEA 4JI6E 2UXBE 4DV0E 4YHHE 5A2QC 4X66E 3T1HE 4GKJE 5CFFE 4AQYE 1ZBTA 2M7QA 4OX9E 3J7AG 4KHPE 1X49A 3HQ1A 4KZSA 4F54A 2KONA 2N3HA 2JR1A 1SR9A 2V83A 4LF8E 3JU0A 4NXNE 4TUIA 2L2MA 1ZBQA 5AE3A 3OTOE 5IT9C 2NUFA 3IWBA 1YYKA 4BC9A 2KHXA 2LBSB 1T4LB 1N32E 3J80C 2H36X 2UUAE 4LFCE 1FKAE 1DQ3A 4LF7E 1UHZA 2V86A 4M0VA 2F8BA 2E1MA 2JWOA 1O0WA 2B7TA 3KWRA 4YY3E 4DV1E 5IWAE 4X65E 4DUYE 2LUPB 4JI4E 4LF6E 2V88A 4LU9A 4OOGC 5AASA 5ADZA 2UXCE 2RTXA 2B3TB 2KOUA 4JI3E 4DUZE 4I8OA 2UU9E 4JI2E 3HXLA 4JI1E 2L2KB 2UXDE 4Q28A 1T4OA 3LLHA 3J7Yp 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE2 A;  4L5N C;  3ZOQ B; 
#chains in the Genus database with same CATH topology
 2EPC A;  4R2R A;  2EPM X;  2EPL X;  1XNQ E;  4WSG A;  1EH6 A;  1G2F C;  1YZ9 A;  2MDR A;  2RS7 A;  2CPN A;  2EOX A;  4R03 A;  2L6M A;  4DMI A;  4X62 E;  4F9A B;  3ADG A;  4L8N A;  5A69 A;  1P47 A;  4O43 A;  2EMW A;  2EOE A;  2M1S A;  4JI0 E;  2JYA A;  1X48 A;  3VYX A;  2K4V A;  2V87 A;  1EKZ A;  3ZOQ B;  4NXM E;  1BB8 A;  4BS9 A;  2EM6 A;  4M30 A;  2YTN A;  1SFE A;  1GZ6 A;  1YUI A;  1IMU A;  2N8X A;  4IJD A;  2EMF A;  3BBG A;  4ZYE A;  4DV5 E;  2EMA A;  3H09 A;  1XNR E;  3EPK A;  4M2Z A;  4BMJ A;  2EOM A;  1XMO E;  2VF1 A;  3F6H A;  5LMU E;  2JP9 A;  1YYO A;  2EQ1 A;  2DB2 A;  1N34 E;  2RQL A;  2YTJ A;  2L92 A;  1HNW E;  4O5G A;  4JV5 E;  4ZYD A;  2EMK A;  1FJG E;  2R1F A;  3RMP A;  1A1J A;  5FLX C;  2EOS A;  2ENA A;  4RH8 A;  5LMN E;  2V85 A;  1GTK A;  2B7V A;  4BHC A;  2MC6 A;  2YTD A;  2HJJ A;  2YTF A;  1TF3 A;  3T1Y E;  2WBU A;  1GQE A;  2DMI A;  3C6M A;  5A6B D;  3C6K A;  2ZM6 E;  2J7J A;  1YSA C;  2EOF A;  3T1H E;  1KJK A;  1NEI A;  4AQY E;  1WJP A;  4RHB B;  3KZY A;  2D9H A;  4LF8 E;  1L4S A;  2YTI A;  2YU5 A;  2EQ0 A;  4MLQ A;  1BBO A;  5KL7 A;  2E1M A;  1O0W A;  2B7T A;  5KL6 A;  2LUP B;  2DLK A;  4DUY E;  4R2A A;  2B3T B;  2EM7 A;  4R2P A;  4JI2 E;  1DGC A;  1G2D C;  2YU8 A;  2BBG A;  4Q28 A;  3C4B A;  2RSM A;  5KL4 A;  2EPA A;  4NHR A;  4BBY A;  2EL4 A;  1YFH A;  2EPO A;  3VHT B;  4TUG A;  2EM9 A;  3BGH A;  1XMQ E;  1A1F A;  2L2N A;  1X6E A;  1WHN A;  4R8O A;  3J81 C;  2LMZ A;  1X6H A;  3THO B;  1AH5 A;  2NA2 A;  4DR6 E;  2YTP A;  2VRD A;  1N33 E;  2NUG A;  2GPI A;  4J8Z A;  2B9D A;  2EM5 A;  4DV2 E;  4NZV A;  2DSY A;  2YRK A;  3K6Q A;  2EPK X;  2M4I A;  1IQO A;  4X64 E;  2EN1 A;  1RQ0 A;  2JOX A;  1UBD C;  5DNY A;  1RC7 A;  2LTS A;  1QNT A;  2DLQ A;  5IV8 B;  2ADR A;  3AV0 A;  1TN9 A;  2LUQ A;  2EZ6 A;  1RMD A;  4HEI A;  3ADI A;  3MSW A;  2RS6 A;  4BHB A;  5KL2 A;  2EOQ A;  2YSO A;  4DV3 E;  2WCC 3;  1PJT A;  4LTY A;  3EPL A;  3IWC A;  4DR5 E;  1EH8 A;  1X47 A;  3QG5 C;  4DR2 E;  4DR4 E;  1T38 A;  4R2D A;  3F6G A;  2F4V E;  5F3W A;  1MGT A;  2JOB A;  4K0K E;  2VQF E;  1UIL A;  3VK6 A;  5BR8 E;  2EN6 A;  1A1I A;  4Q35 B;  2NAB A;  4X9J A;  2LRS A;  4DV7 E;  2JY9 A;  1N36 E;  2EMI A;  2I9I A;  5KL5 A;  1N3G A;  3KZZ A;  2EOJ A;  2EML A;  1X49 A;  2JR1 A;  2N3H A;  1SR9 A;  1T39 A;  2NUF A;  2EM0 A;  2EPN A;  2KHX A;  2LBS B;  1N32 E;  5AC5 A;  1YUJ A;  2JXP A;  4LFC E;  1DQ3 A;  1A1G A;  4LF7 E;  4M0V A;  1A1H A;  2YWQ A;  2EOR A;  2JWO A;  3KWR A;  4DV1 E;  4LF6 E;  2UXC E;  5AAS A;  1AAY A;  2EOH A;  2CSH A;  2KOU A;  1PDA A;  4JI3 E;  4I8O A;  4JI1 E;  2EOI A;  2EN2 A;  4R2Q A;  2L2K B;  2I13 A;  1T4O A;  3J7Y p;  1ZU1 A;  1MEY C;  1J5E E;  4KWY A;  1IBM E;  2YRM A;  4DV6 E;  1ZR9 A;  3HTX A;  2ELZ A;  3LML A;  2YT4 A;  1YYW A;  3DJW A;  4F2J C;  1HNX E;  1T4N A;  4WSP A;  2EP3 A;  2EPP A;  2EPZ A;  2R76 A;  5T6J A;  2MKN A;  4BC7 A;  4DKK A;  4BCA A;  2LJH A;  3HPZ A;  3THN A;  2DMY A;  2V89 A;  4F9C B;  4JI7 E;  4WXD A;  2EL6 A;  2K7I A;  2RPC A;  4GZN C;  2ODR C;  2HGH A;  2WZO A;  4JI5 E;  1UN6 B;  2BB8 A;  2EM3 A;  2FV4 B;  1J26 A;  2CT1 A;  3ECR A;  2L3C A;  4P7D A;  2ODR D;  2EPX A;  1PJQ A;  1I94 E;  4WYQ B;  2DIX A;  2EE8 A;  2GHF A;  1WXR A;  2EN8 A;  1HNZ E;  4B3S E;  2UUB E;  2G7H A;  2WBS A;  4WPY A;  1TF6 A;  2VQE E;  2FGG A;  3VYY A;  4LF9 E;  4R2C A;  2RSI A;  3IWD A;  2A25 A;  4LF5 E;  1WRJ A;  4MLV A;  2MC5 A;  3BID A;  2EM2 A;  2YTO A;  3UK3 C;  3C4T A;  3ADL A;  4B3R E;  2EOO A;  2EWL A;  1JK1 A;  2NUE A;  2L3J A;  2LE2 A;  2EMZ A;  1NCS A;  2L33 A;  2N3G A;  4ZYH A;  5A6B A;  2UUC E;  4DR1 E;  3AUZ A;  4ZYG A;  3JAM C;  4JI6 E;  3M99 B;  4DV0 E;  5A2Q C;  4M9V C;  3EPH A;  2ENH A;  4X66 E;  2EM8 A;  5CFF E;  4GKJ E;  4FK5 C;  1ZBT A;  2M9A A;  4OX9 E;  4KHP E;  2YTE A;  4KZS A;  2KON A;  2DRP A;  2EJ4 A;  1Z1B A;  3MHH C;  5AE3 A;  3IWB A;  4BC9 A;  2UUA E;  2H36 X;  1FKA E;  2ENC A;  1BBG A;  2EPR A;  4N4R B;  1UHZ A;  2F8B A;  5IWA E;  4JI4 E;  2V88 A;  4OOG C;  5LLQ A;  2RTX A;  4DUZ E;  3HXL A;  2MDG A;  2LCE A;  2EOY A;  2FTX B;  4LFA E;  4GEQ B;  4O24 A;  2VE7 C;  2MKD A;  3HPS A;  1STU A;  4X8W A;  2EPU A;  4DR3 E;  2HC5 A;  4O4K A;  2EN4 A;  1X3C A;  5AC4 A;  2LTR A;  2EN3 A;  5LL6 R;  2EMG A;  3EPJ A;  4R2E A;  2EMH A;  2E5L E;  1DI2 A;  3JTZ A;  5AE2 A;  2YTG A;  5KL3 A;  4P78 A;  4B3M E;  4HTG A;  5TSE A;  5A6J A;  4JI8 E;  2YZT A;  1QU6 A;  1IQS A;  4L5N C;  2WBT A;  4DV4 E;  2EL5 A;  2JVA A;  1F2I G;  2EMX A;  1IBK E;  3DF6 A;  3OML A;  2Q8U A;  2PRT A;  2EM4 A;  2V8Q B;  4LF4 E;  1HR0 E;  2DGC A;  1LLM C;  2HHH E;  1WHQ A;  2JPA A;  2LVH A;  3ADJ A;  3MHS C;  2IHR 1;  2CTD A;  1PKP A;  2L8T A;  2GLI A;  2EQ3 A;  3FIG A;  4F9B B;  1IBL E;  2LT7 A;  5AE1 A;  4B3T E;  4LFB E;  2E72 A;  4DR7 E;  5A6K A;  4GKK E;  4WFT A;  2LO3 A;  4JYA E;  1JK2 A;  4WX9 A;  3P1X A;  2UXB E;  4YHH E;  1PJS A;  5IXM B;  2M7Q A;  2YPN A;  2EMC A;  3J7A G;  3HQ1 A;  4F54 A;  2V83 A;  2YSP A;  3JU0 A;  4NXN E;  4TUI A;  2L2M A;  2LJU A;  1ZBQ A;  3OTO E;  5IT9 C;  1YYK A;  1T4L B;  1KYQ A;  2EMY A;  2EMB A;  3J80 C;  2YRH A;  3BF2 A;  4IS1 C;  4F6M A;  1YPN A;  3TQM A;  1B69 A;  1A1K A;  2V86 A;  3EQ1 A;  4YY3 E;  4WXC A;  4X65 E;  2YTQ A;  4LU9 A;  1X6F A;  5ADZ A;  1EH7 A;  1A1L A;  1ZAA C;  2ELY A;  5A6A A;  2UU9 E;  2LV2 A;  2EOZ A;  2EN7 A;  1X5W A;  4R2S A;  2UXD E;  3L00 A;  3LLH A;  4F6N A; 
#chains in the Genus database with same CATH homology
 2RSM A;  1J5E E;  1IBM E;  2FTX B;  4DV6 E;  4BBY A;  3HTX A;  3LML A;  1XNQ E;  2YT4 A;  4LFA E;  1YYW A;  4GEQ B;  3DJW A;  2VE7 C;  1YZ9 A;  2MDR A;  1HNX E;  1T4N A;  2RS7 A;  3HPS A;  4WSP A;  4TUG A;  1STU A;  2CPN A;  2L2N A;  4X8W A;  1XMQ E;  1WHN A;  4R8O A;  4R03 A;  2L6M A;  4DR3 E;  4DMI A;  3J81 C;  2LMZ A;  5T6J A;  4BC7 A;  4X62 E;  4DKK A;  4BCA A;  2LJH A;  3HPZ A;  4F9A B;  3ADG A;  2LTR A;  2NA2 A;  4DR6 E;  1N33 E;  5LL6 R;  2DMY A;  2V89 A;  4F9C B;  4L8N A;  2NUG A;  4JI7 E;  4J8Z A;  2E5L E;  2B9D A;  2M1S A;  4JI0 E;  1DI2 A;  3JTZ A;  2ODR C;  4DV2 E;  1X48 A;  2WZO A;  5AE2 A;  4JI5 E;  2K4V A;  2FV4 B;  2V87 A;  3ZOQ B;  1EKZ A;  4NXM E;  2DSY A;  4P78 A;  1J26 A;  3K6Q A;  4BS9 A;  2L3C A;  4M30 A;  4B3M E;  4P7D A;  1GZ6 A;  2ODR D;  2M4I A;  4X64 E;  4JI8 E;  1I94 E;  4WYQ B;  1RQ0 A;  1QU6 A;  2JOX A;  2YZT A;  5DNY A;  2DIX A;  4DV5 E;  4L5N C;  1WXR A;  1RC7 A;  2LTS A;  4DV4 E;  1HNZ E;  2JVA A;  2UUB E;  3AV0 A;  4B3S E;  2LUQ A;  3H09 A;  3DF6 A;  1IBK E;  2G7H A;  3OML A;  1XNR E;  2EZ6 A;  3ADI A;  3MSW A;  2RS6 A;  4M2Z A;  4BMJ A;  1XMO E;  2VF1 A;  3VYX A;  3F6H A;  4WPY A;  4DV3 E;  5LMU E;  2V8Q B;  2VQE E;  2FGG A;  3VYY A;  1YYO A;  1HR0 E;  4LF4 E;  4LTY A;  4LF9 E;  2HHH E;  1WHQ A;  3ADJ A;  2DB2 A;  1N34 E;  2IHR 1;  2L92 A;  3IWC A;  1X47 A;  4DR5 E;  4DR2 E;  1PKP A;  3IWD A;  4DR4 E;  1HNW E;  2L8T A;  4LF5 E;  3F6G A;  2F4V E;  4JV5 E;  5F3W A;  2MC5 A;  3FIG A;  1FJG E;  4F9B B;  3RMP A;  1IBL E;  2JOB A;  4K0K E;  5AE1 A;  5FLX C;  2VQF E;  4B3T E;  4LFB E;  1UIL A;  3C4T A;  3ADL A;  3VK6 A;  4DR7 E;  4B3R E;  5LMN E;  2EWL A;  5BR8 E;  2V85 A;  4GKK E;  2NUE A;  2L3J A;  2B7V A;  4WFT A;  2LE2 A;  2MC6 A;  4JYA E;  2L33 A;  2N3G A;  2UUC E;  4DR1 E;  3AUZ A;  3P1X A;  2LRS A;  3JAM C;  4DV7 E;  2JY9 A;  3T1Y E;  1N36 E;  2ZM6 E;  1GQE A;  4JI6 E;  2UXB E;  4DV0 E;  4YHH E;  5A2Q C;  4X66 E;  3T1H E;  4GKJ E;  5CFF E;  4AQY E;  1ZBT A;  2M7Q A;  4OX9 E;  3J7A G;  4KHP E;  1X49 A;  3HQ1 A;  4KZS A;  4F54 A;  2KON A;  2N3H A;  2JR1 A;  1SR9 A;  2V83 A;  4LF8 E;  3JU0 A;  4NXN E;  4TUI A;  2L2M A;  1ZBQ A;  5AE3 A;  3OTO E;  5IT9 C;  2NUF A;  3IWB A;  1YYK A;  4BC9 A;  2KHX A;  2LBS B;  1T4L B;  1N32 E;  3J80 C;  2H36 X;  2UUA E;  4LFC E;  1FKA E;  1DQ3 A;  4LF7 E;  1UHZ A;  2V86 A;  4M0V A;  2F8B A;  2E1M A;  2JWO A;  1O0W A;  2B7T A;  3KWR A;  4YY3 E;  4DV1 E;  5IWA E;  4X65 E;  4DUY E;  2LUP B;  4JI4 E;  4LF6 E;  2V88 A;  4LU9 A;  4OOG C;  5AAS A;  5ADZ A;  2UXC E;  2RTX A;  2B3T B;  2KOU A;  4JI3 E;  4DUZ E;  4I8O A;  2UU9 E;  4JI2 E;  3HXL A;  4JI1 E;  2L2K B;  2UXD E;  4Q28 A;  1T4O A;  3LLH A;  3J7Y p;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...