5KL2A

Wilms tumor protein (wt1) znf2-4 in complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl2A00
1X3CA 2EPAA 1X6HA 2LVHA 2EL6A 2YTQA 2EOYA 2RSIA 2R1FA 1UN6B 2EM6A 2EMKA 2EM0A 1DGCA 2WBSA 3VHTB 1F2IG 1G2FC 2JP9A 4F2JC 3UK3C 2ELYA 2EOFA 2EMLA 5KL6A 2EOMA 4F6NA 1TF3A 1UBDC 1JK1A 4M9VC 1BB8A 5KL2A 2EL5A 2EORA 2NABA 2EM8A 2EPUA 1KJKA 2EPZA 2A25A 1TF6A 2EN4A 3MHSC 1X5WA 2YTJA 2EN2A 2EOOA 2EMHA 4R2QA 2EQ3A 2EN1A 2EN7A 2WCC3 2DRPA 2DLKA 2EOXA 5KL5A 4R2AA 4X9JA 1AAYA 1ZU1A 1RMDA 2EM5A 2EOJA 4R2EA 1MEYC 2YTFA 2LT7A 2YTGA 3EPKA 2GLIA 3MHHC 1ZAAC 2YTDA 2JPAA 2M9AA 3EPLA 2EMYA 4FK5C 2EM4A 2EOSA 1YSAC 1TN9A 1A1KA 2ENAA 2EMXA 5KL3A 2EE8A 2WBTA 4R2CA 2EP3A 2EOZA 1A1JA 1ZR9A 2PRTA 2MKDA 2J7JA 2DLQA 2ENCA 2EM7A 2ADRA 2CTDA 2LO3A 2YTOA 2EPRA 1G2DC 5KL4A 2CT1A 2YTPA 1LLMC 2EOQA 3EPJA 1JK2A 2I13A 2YRKA 2VRDA 2YRMA 2YRHA 2EMFA 2EL4A 2EN6A 2LCEA 2EPCA 2MDGA 2MKNA 1YUIA 1A1IA 2EMZA 2EMCA 2BB8A 2GHFA 2RPCA 5KL7A 2YSPA 2EM2A 2DMIA 1A1HA 1B69A 4R2RA 1A1LA 2EMWA 2ELZA 1YUJA 2EMIA 1Z1BA 4IJDA 2ENHA 2HGHA 1A1GA 1P47A 2LV2A 2EJ4A 2EMBA 1WJPA 2EPXA 2EQ1A 2YTNA 2E72A 1X6FA 2YSOA 2YTEA 2EM9A 4R2SA 1BBOA 2CSHA 1X6EA 2EOHA 4GZNC 2EN8A 1A1FA 2EMGA 1NCSA 4R2PA 2EMAA 2WBUA 3EPHA 2YU5A 2D9HA 4IS1C 2EOEA 2EM3A 2EOIA 2DGCA 4R2DA 2YU8A 2EQ0A 2YTIA 2EN3A 4F6MA 4WSGA 2EPPA 3M99B
chains in the Genus database with same CATH superfamily
3ADJA 1X6HA 2EWLA 2B7TA 3TQMA 5AC5A 4F9AB 4HEIA 2KOUA 2M4IA 3P1XA 4AQYE 3UK3C 2RQLA 3JAMC 2LJUA 1GTKA 3F6HA 2EPMX 5KL2A 4BHBA 2EORA 4LF9E 1XMOE 4LF6E 1QNTA 1J26A 1KJKA 5AE2A 4LFAE 5A2QC 3MHSC 2ODRC 3FIGA 4O5GA 2EMHA 2EN7A 1PJTA 2EOXA 5KL5A 2VE7C 4HTGA 2V86A 1AAYA 3J7Yp 3EQ1A 3BBGA 2EM5A 4R2EA 4DV2E 3EPKA 2JPAA 1ZAAC 2VQEE 2LUPB 3EPLA 1NEIA 4WYQB 1GQEA 3ADLA 3HPSA 1TN9A 2HHHE 5A69A 5KL3A 3AUZA 5AE1A 2EP3A 2EOZA 4DR1E 1A1JA 1ZR9A 1FKAE 2MKDA 2H36X 4WSPA 2ENCA 4B3TE 4MLVA 5AASA 2EPNA 3ADGA 4OX9E 3HPZA 5LMUE 3K6QA 2YTPA 1WHNA 2KONA 4GEQB 2UXDE 2YRKA 1N32E 1ZBTA 2EL4A 2EN6A 2MKNA 4WXCA 1A1IA 2RPCA 3KWRA 5A6AA 2DMIA 4DV5E 5ADZA 2JR1A 1B69A 2EMIA 1Z1BA 1A1GA 1HNWE 2YTNA 2DIXA 2L3CA 1X6EA 4KZSA 4GZNC 2EN8A 2WZOA 1EH6A 2LBSB 2D9HA 4IS1C 3IWBA 5CFFE 4R2DA 2EQ0A 2EN3A 4F6MA 2N3GA 3OTOE 4BC9A 4JI4E 2EPPA 3M99B 1PDAA 2F8BA 2JOBA 2LVHA 5LMNE 4DV7E 2EL6A 2YTQA 2R76A 1RQ0A 1UN6B 2V88A 4DR7E 4LF4E 1WXRA 4F2JC 2ELYA 5KL6A 4F6NA 2EOMA 1TF3A 1HNXE 4M2ZA 4NHRA 4M9VC 3RMPA 4GKJE 2YT4A 2L2MA 2EM8A 4DUYE 2N3HA 2EPZA 3L00A 3C4BA 4Q35B 1N33E 2G7HA 2GPIA 2LRSA 1X5WA 2EOOA 4R2QA 2WCC3 2DRPA 1O0WA 4X9JA 4NXME 5FLXC 1EH7A 1MEYC 2EOJA 2Q8UA 3VYXA 4N4RB 4JV5E 1YZ9A 5IXMB 2ODRD 2YTGA 2YTDA 3QG5C 5A6BD 1X49A 1XNRE 2EPOA 2EM4A 2JXPA 4JI6E 1X48A 2EOSA 2UUBE 2L2NA 2LJHA 2RS7A 1A1KA 1KYQA 2EE8A 2FTXB 4R2CA 4DV1E 4X64E 4DV3E 2J7JA 4LTYA 1YYOA 2DLQA 2EM7A 2UU9E 2CTDA 2LO3A 2EPRA 2B9DA 1STUA 2RS6A 2CT1A 4L8NA 3J81C 1HNZE 4Q28A 4TUIA 3OMLA 2EPLX 3EPJA 2YPNA 2I13A 4DR6E 1WRJA 3HTXA 4ZYEA 1HR0E 1T4OA 2LTRA 2EMFA 2LCEA 2L92A 4BC7A 1AH5A 1ZBQA 3VK6A 2HC5A 1XNQE 3DF6A 2V85A 2KHXA 5IWAE 2YWQA 2FGGA 1YUJA 4TUGA 2HGHA 2EJ4A 2EMBA 4M0VA 2EQ1A 2K4VA 2K7IA 2RTXA 1X6FA 3ZOQB 1J5EE 1FJGE 3THOB 2EOHA 4J8ZA 4KWYA 1A1FA 2EMAA 3EPHA 3IWDA 2EM3A 2YU8A 2YTIA 2B7VA 2V8QB 3HXLA 2JY9A 3C6KA 2NUGA 4WSGA 2F4VE 2E5LE 2N8XA 4NZVA 4M30A 5AE3A 2EPAA 4YHHE 3JTZA 4F9CB 1EH8A 2HJJA 2YZTA 2BBGA 1IBME 2R1FA 5BR8E 4BBYA 1WHQA 2EM0A 4WX9A 2WBSA 3VHTB 1F2IG 2JP9A 2JOXA 2NA2A 2EOFA 2M1SA 2NUEA 1X47A 2V83A 2UUAE 1BB8A 3BIDA 4DUZE 2M7QA 4JI0E 2NUFA 4WXDA 4JI2E 2A25A 2EN4A 4LF7E 1PJSA 4LFBE 3AV0A 4DV6E 5AC4A 3ADIA 1IBLE 2DLKA 4R2AA 4LU9A 4LF8E 1SR9A 5IT9C 5F3WA 2YTFA 4K0KE 2LT7A 2JYAA 3C6MA 4ZYGA 2MC5A 3J80C 1T38A 1IMUA 4X62E 2ENAA 2EMXA 1IBKE 1EKZA 4B3RE 2LMZA 2JVAA 2CPNA 5TSEA 3C4TA 3MSWA 1G2DC 5KL4A 2RSMA 4B3SE 2E1MA 2VRDA 4LFCE 5T6JA 2YRMA 2YRHA 1N3GA 2MDGA 2EPCA 3HQ1A 4ZYHA 3THNA 4DR2E 2EMCA 3BGHA 1PJQA 1YYWA 2GHFA 2YSPA 3ECRA 4DR3E 2LTSA 1A1HA 2EMWA 4JI8E 2ENHA 1P47A 4NXNE 2ZM6E 3BF2A 3IWCA 5LLQA 2EPXA 1T39A 1I94E 2E72A 2EZ6A 2YTEA 1BBOA 2EM9A 2V89A 2CSHA 4O24A 4O4KA 4DMIA 4JYAE 4JI7E 2LE2A 2WBUA 2YU5A 4GKKE 4R03A 4RHBB 4JI3E 2L2KB 1X3CA 2EOYA 1RC7A 2RSIA 4BMJA 2EM6A 2EMKA 4L5NC 4DKKA 1DGCA 2V87A 2DSYA 4X65E 2MDRA 1G2FC 4DR5E 1T4NA 5IV8B 1UHZA 3T1YE 2EMLA 2DB2A 4DV4E 1L4SA 2VQFE 1UBDC 1JK1A 1IQOA 2EL5A 2UUCE 1QU6A 1DI2A 2NABA 2EPUA 4YY3E 1TF6A 2UXBE 4WPYA 2YTJA 2EN2A 4B3ME 5A6JA 2MC6A 2EQ3A 2EN1A 3F6GA 5A6BA 1DQ3A 4F54A 1IQSA 2JWOA 1ZU1A 1RMDA 4ZYDA 3JU0A 2IHR1 1N34E 2GLIA 5LL6R 5DNYA 3MHHC 2FV4B 1T4LB 4MLQA 2EPKX 2M9AA 2EMYA 4FK5C 2B3TB 2DMYA 1YYKA 4I8OA 1YSAC 1BBGA 2UXCE 4LF5E 1UILA 3DJWA 2WBTA 4X66E 2VF1A 1YFHA 4JI1E 2PRTA 2ADRA 4R8OA 2YTOA 2L3JA 4O43A 1XMQE 4BHCA 4BCAA 4KHPE 1LLMC 2EOQA 2I9IA 2L6MA 1JK2A 3J7AG 4WFTA 3LMLA 4OOGC 1MGTA 4BS9A 3VYYA 1YUIA 2EMZA 3H09A 4X8WA 2BB8A 3KZYA 5KL7A 2EM2A 1YPNA 4P7DA 4DV0E 1PKPA 4P78A 4F9BB 4R2RA 1A1LA 2ELZA 4IJDA 2LV2A 1WJPA 2YSOA 4R2SA 4DR4E 1N36E 2L33A 1SFEA 2EMGA 5A6KA 4JI5E 1NCSA 4R2PA 3T1HE 1GZ6A 2LUQA 2EOEA 2EOIA 3LLHA 2L8TA 2DGCA 3KZZA 4RH8A
chains in the Genus database with same CATH topology
1X3CA 2EPAA 1X6HA 2LVHA 2EL6A 2YTQA 2EOYA 2RSIA 2R1FA 1UN6B 2EM6A 2EMKA 2EM0A 1DGCA 2WBSA 3VHTB 1F2IG 1G2FC 2JP9A 4F2JC 3UK3C 2ELYA 2EOFA 2EMLA 5KL6A 2EOMA 4F6NA 1TF3A 1UBDC 1JK1A 4M9VC 1BB8A 5KL2A 2EL5A 2EORA 2NABA 2EM8A 2EPUA 1KJKA 2EPZA 2A25A 1TF6A 2EN4A 3MHSC 1X5WA 2YTJA 2EN2A 2EOOA 2EMHA 4R2QA 2EQ3A 2EN1A 2EN7A 2WCC3 2DRPA 2DLKA 2EOXA 5KL5A 4R2AA 4X9JA 1AAYA 1ZU1A 1RMDA 2EM5A 2EOJA 4R2EA 1MEYC 2YTFA 2LT7A 2YTGA 3EPKA 2GLIA 3MHHC 1ZAAC 2YTDA 2JPAA 2M9AA 3EPLA 2EMYA 4FK5C 2EM4A 2EOSA 1YSAC 1TN9A 1A1KA 2ENAA 2EMXA 5KL3A 2EE8A 2WBTA 4R2CA 2EP3A 2EOZA 1A1JA 1ZR9A 2PRTA 2MKDA 2J7JA 2DLQA 2ENCA 2EM7A 2ADRA 2CTDA 2LO3A 2YTOA 2EPRA 1G2DC 5KL4A 2CT1A 2YTPA 1LLMC 2EOQA 3EPJA 1JK2A 2I13A 2YRKA 2VRDA 2YRMA 2YRHA 2EMFA 2EL4A 2EN6A 2LCEA 2EPCA 2MDGA 2MKNA 1YUIA 1A1IA 2EMZA 2EMCA 2BB8A 2GHFA 2RPCA 5KL7A 2YSPA 2EM2A 2DMIA 1A1HA 1B69A 4R2RA 1A1LA 2EMWA 2ELZA 1YUJA 2EMIA 1Z1BA 4IJDA 2ENHA 2HGHA 1A1GA 1P47A 2LV2A 2EJ4A 2EMBA 1WJPA 2EPXA 2EQ1A 2YTNA 2E72A 1X6FA 2YSOA 2YTEA 2EM9A 4R2SA 1BBOA 2CSHA 1X6EA 2EOHA 4GZNC 2EN8A 1A1FA 2EMGA 1NCSA 4R2PA 2EMAA 2WBUA 3EPHA 2YU5A 2D9HA 4IS1C 2EOEA 2EM3A 2EOIA 2DGCA 4R2DA 2YU8A 2EQ0A 2YTIA 2EN3A 4F6MA 4WSGA 2EPPA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  2EPA A;  1X6H A;  2LVH A;  2EL6 A;  2YTQ A;  2EOY A;  2RSI A;  2R1F A;  1UN6 B;  2EM6 A;  2EMK A;  2EM0 A;  1DGC A;  2WBS A;  3VHT B;  1F2I G;  1G2F C;  2JP9 A;  4F2J C;  3UK3 C;  2ELY A;  2EOF A;  2EML A;  5KL6 A;  2EOM A;  4F6N A;  1TF3 A;  1UBD C;  1JK1 A;  4M9V C;  1BB8 A;  5KL2 A;  2EL5 A;  2EOR A;  2NAB A;  2EM8 A;  2EPU A;  1KJK A;  2EPZ A;  2A25 A;  1TF6 A;  2EN4 A;  3MHS C;  1X5W A;  2YTJ A;  2EN2 A;  2EOO A;  2EMH A;  4R2Q A;  2EQ3 A;  2EN1 A;  2EN7 A;  2WCC 3;  2DRP A;  2DLK A;  2EOX A;  5KL5 A;  4R2A A;  4X9J A;  1AAY A;  1ZU1 A;  1RMD A;  2EM5 A;  2EOJ A;  4R2E A;  1MEY C;  2YTF A;  2LT7 A;  2YTG A;  3EPK A;  2GLI A;  3MHH C;  1ZAA C;  2YTD A;  2JPA A;  2M9A A;  3EPL A;  2EMY A;  4FK5 C;  2EM4 A;  2EOS A;  1YSA C;  1TN9 A;  1A1K A;  2ENA A;  2EMX A;  5KL3 A;  2EE8 A;  2WBT A;  4R2C A;  2EP3 A;  2EOZ A;  1A1J A;  1ZR9 A;  2PRT A;  2MKD A;  2J7J A;  2DLQ A;  2ENC A;  2EM7 A;  2ADR A;  2CTD A;  2LO3 A;  2YTO A;  2EPR A;  1G2D C;  5KL4 A;  2CT1 A;  2YTP A;  1LLM C;  2EOQ A;  3EPJ A;  1JK2 A;  2I13 A;  2YRK A;  2VRD A;  2YRM A;  2YRH A;  2EMF A;  2EL4 A;  2EN6 A;  2LCE A;  2EPC A;  2MDG A;  2MKN A;  1YUI A;  1A1I A;  2EMZ A;  2EMC A;  2BB8 A;  2GHF A;  2RPC A;  5KL7 A;  2YSP A;  2EM2 A;  2DMI A;  1A1H A;  1B69 A;  4R2R A;  1A1L A;  2EMW A;  2ELZ A;  1YUJ A;  2EMI A;  1Z1B A;  4IJD A;  2ENH A;  2HGH A;  1A1G A;  1P47 A;  2LV2 A;  2EJ4 A;  2EMB A;  1WJP A;  2EPX A;  2EQ1 A;  2YTN A;  2E72 A;  1X6F A;  2YSO A;  2YTE A;  2EM9 A;  4R2S A;  1BBO A;  2CSH A;  1X6E A;  2EOH A;  4GZN C;  2EN8 A;  1A1F A;  2EMG A;  1NCS A;  4R2P A;  2EMA A;  2WBU A;  3EPH A;  2YU5 A;  2D9H A;  4IS1 C;  2EOE A;  2EM3 A;  2EOI A;  2DGC A;  4R2D A;  2YU8 A;  2EQ0 A;  2YTI A;  2EN3 A;  4F6M A;  4WSG A;  2EPP A;  3M99 B; 
#chains in the Genus database with same CATH topology
 3ADJ A;  1X6H A;  2EWL A;  2B7T A;  3TQM A;  5AC5 A;  4F9A B;  4HEI A;  2KOU A;  2M4I A;  3P1X A;  4AQY E;  3UK3 C;  2RQL A;  3JAM C;  2LJU A;  1GTK A;  3F6H A;  2EPM X;  5KL2 A;  4BHB A;  2EOR A;  4LF9 E;  1XMO E;  4LF6 E;  1QNT A;  1J26 A;  1KJK A;  5AE2 A;  4LFA E;  5A2Q C;  3MHS C;  2ODR C;  3FIG A;  4O5G A;  2EMH A;  2EN7 A;  1PJT A;  2EOX A;  5KL5 A;  2VE7 C;  4HTG A;  2V86 A;  1AAY A;  3J7Y p;  3EQ1 A;  3BBG A;  2EM5 A;  4R2E A;  4DV2 E;  3EPK A;  2JPA A;  1ZAA C;  2VQE E;  2LUP B;  3EPL A;  1NEI A;  4WYQ B;  1GQE A;  3ADL A;  3HPS A;  1TN9 A;  2HHH E;  5A69 A;  5KL3 A;  3AUZ A;  5AE1 A;  2EP3 A;  2EOZ A;  4DR1 E;  1A1J A;  1ZR9 A;  1FKA E;  2MKD A;  2H36 X;  4WSP A;  2ENC A;  4B3T E;  4MLV A;  5AAS A;  2EPN A;  3ADG A;  4OX9 E;  3HPZ A;  5LMU E;  3K6Q A;  2YTP A;  1WHN A;  2KON A;  4GEQ B;  2UXD E;  2YRK A;  1N32 E;  1ZBT A;  2EL4 A;  2EN6 A;  2MKN A;  4WXC A;  1A1I A;  2RPC A;  3KWR A;  5A6A A;  2DMI A;  4DV5 E;  5ADZ A;  2JR1 A;  1B69 A;  2EMI A;  1Z1B A;  1A1G A;  1HNW E;  2YTN A;  2DIX A;  2L3C A;  1X6E A;  4KZS A;  4GZN C;  2EN8 A;  2WZO A;  1EH6 A;  2LBS B;  2D9H A;  4IS1 C;  3IWB A;  5CFF E;  4R2D A;  2EQ0 A;  2EN3 A;  4F6M A;  2N3G A;  3OTO E;  4BC9 A;  4JI4 E;  2EPP A;  3M99 B;  1PDA A;  2F8B A;  2JOB A;  2LVH A;  5LMN E;  4DV7 E;  2EL6 A;  2YTQ A;  2R76 A;  1RQ0 A;  1UN6 B;  2V88 A;  4DR7 E;  4LF4 E;  1WXR A;  4F2J C;  2ELY A;  5KL6 A;  4F6N A;  2EOM A;  1TF3 A;  1HNX E;  4M2Z A;  4NHR A;  4M9V C;  3RMP A;  4GKJ E;  2YT4 A;  2L2M A;  2EM8 A;  4DUY E;  2N3H A;  2EPZ A;  3L00 A;  3C4B A;  4Q35 B;  1N33 E;  2G7H A;  2GPI A;  2LRS A;  1X5W A;  2EOO A;  4R2Q A;  2WCC 3;  2DRP A;  1O0W A;  4X9J A;  4NXM E;  5FLX C;  1EH7 A;  1MEY C;  2EOJ A;  2Q8U A;  3VYX A;  4N4R B;  4JV5 E;  1YZ9 A;  5IXM B;  2ODR D;  2YTG A;  2YTD A;  3QG5 C;  5A6B D;  1X49 A;  1XNR E;  2EPO A;  2EM4 A;  2JXP A;  4JI6 E;  1X48 A;  2EOS A;  2UUB E;  2L2N A;  2LJH A;  2RS7 A;  1A1K A;  1KYQ A;  2EE8 A;  2FTX B;  4R2C A;  4DV1 E;  4X64 E;  4DV3 E;  2J7J A;  4LTY A;  1YYO A;  2DLQ A;  2EM7 A;  2UU9 E;  2CTD A;  2LO3 A;  2EPR A;  2B9D A;  1STU A;  2RS6 A;  2CT1 A;  4L8N A;  3J81 C;  1HNZ E;  4Q28 A;  4TUI A;  3OML A;  2EPL X;  3EPJ A;  2YPN A;  2I13 A;  4DR6 E;  1WRJ A;  3HTX A;  4ZYE A;  1HR0 E;  1T4O A;  2LTR A;  2EMF A;  2LCE A;  2L92 A;  4BC7 A;  1AH5 A;  1ZBQ A;  3VK6 A;  2HC5 A;  1XNQ E;  3DF6 A;  2V85 A;  2KHX A;  5IWA E;  2YWQ A;  2FGG A;  1YUJ A;  4TUG A;  2HGH A;  2EJ4 A;  2EMB A;  4M0V A;  2EQ1 A;  2K4V A;  2K7I A;  2RTX A;  1X6F A;  3ZOQ B;  1J5E E;  1FJG E;  3THO B;  2EOH A;  4J8Z A;  4KWY A;  1A1F A;  2EMA A;  3EPH A;  3IWD A;  2EM3 A;  2YU8 A;  2YTI A;  2B7V A;  2V8Q B;  3HXL A;  2JY9 A;  3C6K A;  2NUG A;  4WSG A;  2F4V E;  2E5L E;  2N8X A;  4NZV A;  4M30 A;  5AE3 A;  2EPA A;  4YHH E;  3JTZ A;  4F9C B;  1EH8 A;  2HJJ A;  2YZT A;  2BBG A;  1IBM E;  2R1F A;  5BR8 E;  4BBY A;  1WHQ A;  2EM0 A;  4WX9 A;  2WBS A;  3VHT B;  1F2I G;  2JP9 A;  2JOX A;  2NA2 A;  2EOF A;  2M1S A;  2NUE A;  1X47 A;  2V83 A;  2UUA E;  1BB8 A;  3BID A;  4DUZ E;  2M7Q A;  4JI0 E;  2NUF A;  4WXD A;  4JI2 E;  2A25 A;  2EN4 A;  4LF7 E;  1PJS A;  4LFB E;  3AV0 A;  4DV6 E;  5AC4 A;  3ADI A;  1IBL E;  2DLK A;  4R2A A;  4LU9 A;  4LF8 E;  1SR9 A;  5IT9 C;  5F3W A;  2YTF A;  4K0K E;  2LT7 A;  2JYA A;  3C6M A;  4ZYG A;  2MC5 A;  3J80 C;  1T38 A;  1IMU A;  4X62 E;  2ENA A;  2EMX A;  1IBK E;  1EKZ A;  4B3R E;  2LMZ A;  2JVA A;  2CPN A;  5TSE A;  3C4T A;  3MSW A;  1G2D C;  5KL4 A;  2RSM A;  4B3S E;  2E1M A;  2VRD A;  4LFC E;  5T6J A;  2YRM A;  2YRH A;  1N3G A;  2MDG A;  2EPC A;  3HQ1 A;  4ZYH A;  3THN A;  4DR2 E;  2EMC A;  3BGH A;  1PJQ A;  1YYW A;  2GHF A;  2YSP A;  3ECR A;  4DR3 E;  2LTS A;  1A1H A;  2EMW A;  4JI8 E;  2ENH A;  1P47 A;  4NXN E;  2ZM6 E;  3BF2 A;  3IWC A;  5LLQ A;  2EPX A;  1T39 A;  1I94 E;  2E72 A;  2EZ6 A;  2YTE A;  1BBO A;  2EM9 A;  2V89 A;  2CSH A;  4O24 A;  4O4K A;  4DMI A;  4JYA E;  4JI7 E;  2LE2 A;  2WBU A;  2YU5 A;  4GKK E;  4R03 A;  4RHB B;  4JI3 E;  2L2K B;  1X3C A;  2EOY A;  1RC7 A;  2RSI A;  4BMJ A;  2EM6 A;  2EMK A;  4L5N C;  4DKK A;  1DGC A;  2V87 A;  2DSY A;  4X65 E;  2MDR A;  1G2F C;  4DR5 E;  1T4N A;  5IV8 B;  1UHZ A;  3T1Y E;  2EML A;  2DB2 A;  4DV4 E;  1L4S A;  2VQF E;  1UBD C;  1JK1 A;  1IQO A;  2EL5 A;  2UUC E;  1QU6 A;  1DI2 A;  2NAB A;  2EPU A;  4YY3 E;  1TF6 A;  2UXB E;  4WPY A;  2YTJ A;  2EN2 A;  4B3M E;  5A6J A;  2MC6 A;  2EQ3 A;  2EN1 A;  3F6G A;  5A6B A;  1DQ3 A;  4F54 A;  1IQS A;  2JWO A;  1ZU1 A;  1RMD A;  4ZYD A;  3JU0 A;  2IHR 1;  1N34 E;  2GLI A;  5LL6 R;  5DNY A;  3MHH C;  2FV4 B;  1T4L B;  4MLQ A;  2EPK X;  2M9A A;  2EMY A;  4FK5 C;  2B3T B;  2DMY A;  1YYK A;  4I8O A;  1YSA C;  1BBG A;  2UXC E;  4LF5 E;  1UIL A;  3DJW A;  2WBT A;  4X66 E;  2VF1 A;  1YFH A;  4JI1 E;  2PRT A;  2ADR A;  4R8O A;  2YTO A;  2L3J A;  4O43 A;  1XMQ E;  4BHC A;  4BCA A;  4KHP E;  1LLM C;  2EOQ A;  2I9I A;  2L6M A;  1JK2 A;  3J7A G;  4WFT A;  3LML A;  4OOG C;  1MGT A;  4BS9 A;  3VYY A;  1YUI A;  2EMZ A;  3H09 A;  4X8W A;  2BB8 A;  3KZY A;  5KL7 A;  2EM2 A;  1YPN A;  4P7D A;  4DV0 E;  1PKP A;  4P78 A;  4F9B B;  4R2R A;  1A1L A;  2ELZ A;  4IJD A;  2LV2 A;  1WJP A;  2YSO A;  4R2S A;  4DR4 E;  1N36 E;  2L33 A;  1SFE A;  2EMG A;  5A6K A;  4JI5 E;  1NCS A;  4R2P A;  3T1H E;  1GZ6 A;  2LUQ A;  2EOE A;  2EOI A;  3LLH A;  2L8T A;  2DGC A;  3KZZ A;  4RH8 A; 
#chains in the Genus database with same CATH homology
 1X3C A;  2EPA A;  1X6H A;  2LVH A;  2EL6 A;  2YTQ A;  2EOY A;  2RSI A;  2R1F A;  1UN6 B;  2EM6 A;  2EMK A;  2EM0 A;  1DGC A;  2WBS A;  3VHT B;  1F2I G;  1G2F C;  2JP9 A;  4F2J C;  3UK3 C;  2ELY A;  2EOF A;  2EML A;  5KL6 A;  2EOM A;  4F6N A;  1TF3 A;  1UBD C;  1JK1 A;  4M9V C;  1BB8 A;  5KL2 A;  2EL5 A;  2EOR A;  2NAB A;  2EM8 A;  2EPU A;  1KJK A;  2EPZ A;  2A25 A;  1TF6 A;  2EN4 A;  3MHS C;  1X5W A;  2YTJ A;  2EN2 A;  2EOO A;  2EMH A;  4R2Q A;  2EQ3 A;  2EN1 A;  2EN7 A;  2WCC 3;  2DRP A;  2DLK A;  2EOX A;  5KL5 A;  4R2A A;  4X9J A;  1AAY A;  1ZU1 A;  1RMD A;  2EM5 A;  2EOJ A;  4R2E A;  1MEY C;  2YTF A;  2LT7 A;  2YTG A;  3EPK A;  2GLI A;  3MHH C;  1ZAA C;  2YTD A;  2JPA A;  2M9A A;  3EPL A;  2EMY A;  4FK5 C;  2EM4 A;  2EOS A;  1YSA C;  1TN9 A;  1A1K A;  2ENA A;  2EMX A;  5KL3 A;  2EE8 A;  2WBT A;  4R2C A;  2EP3 A;  2EOZ A;  1A1J A;  1ZR9 A;  2PRT A;  2MKD A;  2J7J A;  2DLQ A;  2ENC A;  2EM7 A;  2ADR A;  2CTD A;  2LO3 A;  2YTO A;  2EPR A;  1G2D C;  5KL4 A;  2CT1 A;  2YTP A;  1LLM C;  2EOQ A;  3EPJ A;  1JK2 A;  2I13 A;  2YRK A;  2VRD A;  2YRM A;  2YRH A;  2EMF A;  2EL4 A;  2EN6 A;  2LCE A;  2EPC A;  2MDG A;  2MKN A;  1YUI A;  1A1I A;  2EMZ A;  2EMC A;  2BB8 A;  2GHF A;  2RPC A;  5KL7 A;  2YSP A;  2EM2 A;  2DMI A;  1A1H A;  1B69 A;  4R2R A;  1A1L A;  2EMW A;  2ELZ A;  1YUJ A;  2EMI A;  1Z1B A;  4IJD A;  2ENH A;  2HGH A;  1A1G A;  1P47 A;  2LV2 A;  2EJ4 A;  2EMB A;  1WJP A;  2EPX A;  2EQ1 A;  2YTN A;  2E72 A;  1X6F A;  2YSO A;  2YTE A;  2EM9 A;  4R2S A;  1BBO A;  2CSH A;  1X6E A;  2EOH A;  4GZN C;  2EN8 A;  1A1F A;  2EMG A;  1NCS A;  4R2P A;  2EMA A;  2WBU A;  3EPH A;  2YU5 A;  2D9H A;  4IS1 C;  2EOE A;  2EM3 A;  2EOI A;  2DGC A;  4R2D A;  2YU8 A;  2EQ0 A;  2YTI A;  2EN3 A;  4F6M A;  4WSG A;  2EPP A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...