5KL2A

Wilms tumor protein (wt1) znf2-4 in complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl2A00
2EMBA 1JK2A 2WCC3 2DRPA 2EM6A 1YUIA 1A1LA 2EN4A 2EOJA 5KL4A 4F6NA 3EPJA 2MKNA 1UN6B 2EMLA 2LO3A 2LV2A 2WBSA 1RMDA 5KL7A 2WBUA 2YTIA 1A1FA 2WBTA 2EPAA 2JP9A 2YSPA 2EOSA 4R2DA 1A1KA 2EMCA 1UBDC 2VRDA 2NABA 2EN6A 2EM8A 2HGHA 3M99B 2ENHA 2EMHA 1F2IG 2EMKA 2LVHA 2EPPA 4R2CA 1ZAAC 2YRKA 2YRMA 4R2RA 1KJKA 4X9JA 2BB8A 2E72A 2EPUA 2EJ4A 2ENAA 2J7JA 2CT1A 2YTGA 3UK3C 2EMXA 1YSAC 2MDGA 2YRHA 1TN9A 4R2QA 2PRTA 2YTFA 2YTDA 1A1IA 2ENCA 2DLQA 1JK1A 2EN8A 2YU8A 1DGCA 2YTQA 1X6EA 2JPAA 2EQ0A 2ELZA 2YTEA 1BBOA 2EM4A 2EMGA 4R2EA 1X6FA 4R2PA 5KL3A 1BB8A 2EOXA 2EMYA 1B69A 1A1HA 2EL4A 2EM5A 2EOYA 2EQ3A 2GHFA 1YUJA 2YU5A 2EP3A 2DMIA 2A25A 4F6MA 1MEYC 4F2JC 2EMAA 5KL2A 1G2DC 4FK5C 2R1FA 2EQ1A 2M9AA 4R2AA 2EL5A 2DGCA 5KL5A 2CSHA 2EM0A 2LT7A 1P47A 1X3CA 2YTNA 5KL6A 2EMZA 2EMFA 2ELYA 4WSGA 1ZU1A 1A1JA 2ADRA 1X6HA 2EOMA 2CTDA 2EOQA 2EOHA 2EOOA 2EOFA 3MHSC 1A1GA 2MKDA 3EPHA 2EOIA 4GZNC 2EL6A 1G2FC 1Z1BA 1LLMC 2EN3A 2EM7A 2D9HA 2EORA 2RPCA 2EN2A 2EM2A 2DLKA 2EMIA 2EPCA 4IJDA 1WJPA 2EN1A 2YTPA 2EOEA 4R2SA 2EOZA 1ZR9A 1TF3A 2EN7A 2GLIA 2YTJA 2EE8A 2EPXA 2EPRA 2EPZA 3EPKA 1AAYA 2YSOA 1TF6A 4IS1C 2EM3A 1X5WA 2YTOA 2EMWA 3VHTB 2LCEA 4M9VC 3MHHC 2I13A 1NCSA 2RSIA 2EM9A 3EPLA
chains in the Genus database with same CATH superfamily
1DI2A 2DRPA 2RSMA 2EM6A 1T4LB 1YUIA 5KL4A 2VQEE 2LO3A 2WBSA 1RMDA 4JI8E 2UXDE 2MC6A 1GQEA 4DV0E 4DR7E 2EPAA 1N3GA 2EOSA 4DV2E 4R2DA 1UBDC 2V88A 3HQ1A 4M0VA 2NABA 5AASA 3BBGA 1F2IG 2EMKA 3BGHA 1N34E 3IWBA 4B3TE 1STUA 2E72A 1SR9A 2EPUA 2J7JA 2M7QA 2CT1A 3FIGA 4JI1E 3UK3C 2EMXA 3THOB 4B3SE 4Q28A 4X62E 2JYAA 2B7VA 3J81C 2YU8A 1DGCA 4LF8E 2ELZA 4JI6E 1BBOA 2EM4A 2EMGA 5KL3A 1X49A 4P78A 5A6KA 2EPLX 5ADZA 1PJTA 1L4SA 2DMIA 2MC5A 5TSEA 1MGTA 1QU6A 3THNA 1RQ0A 3ZOQB 1XMQE 2YZTA 2M9AA 3KZZA 2ODRD 2RTXA 1EH8A 2EM0A 3JAMC 2M4IA 2YTNA 2EMZA 4BHCA 2BBGA 1YPNA 2CTDA 2EOQA 2EOHA 4YY3E 2EOFA 3MHSC 2RS6A 3EPHA 4GZNC 1T4OA 4TUGA 3OMLA 3BF2A 3C6MA 2EN2A 4X8WA 2DLKA 4JV5E 2FTXB 2UUAE 3ECRA 2LMZA 5AC5A 2YTPA 5IT9C 4NZVA 4DR3E 2B7TA 1ZR9A 3LLHA 2EPMX 3DF6A 3AV0A 2L3JA 4DR6E 4NXME 1TF6A 4IS1C 4HTGA 5IV8B 2EM3A 4J8ZA 1X5WA 2R76A 1T39A 3VHTB 2H36X 4MLQA 1PJQA 4JYAE 2LUPB 2L33A 1NCSA 2UUCE 2UXCE 4O4KA 2V86A 1JK2A 1ZBQA 3F6HA 2EN4A 2LJUA 3KWRA 1UN6B 2LV2A 1NEIA 5AE3A 2LTRA 1YFHA 3IWCA 4WYQB 5F3WA 4DR1E 2JP9A 3ADIA 2YSPA 3ADLA 2L3CA 2VRDA 2EN6A 2EM8A 2HGHA 3M99B 3T1YE 2I9IA 2EPPA 2EPOA 4DUYE 4JI0E 2JWOA 4X9JA 4WXDA 1TN9A 4R2QA 2VF1A 2JOXA 2PRTA 4R03A 2YTDA 4YHHE 1J5EE 2DLQA 3TQMA 1A1IA 4K0KE 4AQYE 2FV4B 1X6EA 2EQ0A 4WX9A 2YTEA 4RH8A 1IQSA 1X6FA 2G7HA 2JOBA 4OOGC 4DR5E 4DR4E 3J80C 4X64E 1WHNA 3IWDA 5FLXC 3K6QA 2EOYA 5A6AA 1YUJA 1WRJA 3HXLA 2V89A 1PDAA 2B9DA 2Q8UA 4BHBA 4F6MA 3OTOE 2R1FA 3P1XA 2GPIA 5KL5A 4GKKE 2CSHA 5IWAE 4WFTA 2V8QB 1T38A 4DV3E 3JTZA 4L5NC 3BIDA 3HTXA 2FGGA 1IBLE 2EMFA 4WSGA 1ZU1A 5AE2A 5A69A 2JVAA 2EOIA 5LMNE 4O5GA 1QNTA 1UILA 2N8XA 2EORA 1IBME 1O0WA 1DQ3A 4LF5E 3ADGA 4LF9E 4X66E 4LF7E 2EOZA 4B3RE 1TF3A 2EN7A 3EQ1A 2JXPA 2M1SA 1WXRA 2V83A 3EPKA 2LBSB 4MLVA 5LLQA 2EPKX 4ZYHA 1HNWE 4X65E 2DB2A 2JY9A 4DV6E 1J26A 2NUEA 4WPYA 4JI4E 3L00A 4BBYA 2RSIA 2EM9A 4Q35B 3EPLA 2L6MA 4F9CB 2L2KB 2EMBA 2CPNA 1GZ6A 1YYOA 1A1LA 2EOJA 2MKNA 5KL7A 5BR8E 3C4BA 1A1FA 2WBTA 2KOUA 2F4VE 5AC4A 4N4RB 4O24A 4ZYGA 2UU9E 2EMHA 4NHRA 4R2CA 2YRKA 2YRMA 4I8OA 4R2RA 1KJKA 2BB8A 2N3GA 2DSYA 2YTGA 4F9BB 2MDGA 2YRHA 2HJJA 4O43A 4DUZE 1YYKA 1BBGA 4BC9A 1JK1A 4RHBB 4JI2E 2JPAA 2NUFA 4DKKA 4R2EA 4R2PA 2EOXA 4BS9A 1XNQE 1B69A 2EL4A 2EM5A 3C6KA 1XMOE 4LFCE 4LTYA 2EP3A 5CFFE 2A25A 4BC7A 4DR2E 2EQ1A 1HNXE 2NUGA 1X3CA 3VYYA 5KL6A 2N3HA 2NA2A 1T4NA 1GTKA 2LTSA 1N32E 1YZ9A 1WHQA 1A1JA 1A1GA 2MKDA 4TUIA 1RC7A 2EL6A 1LLMC 2RPCA 4LF6E 2EM2A 4DV7E 2EPCA 4HEIA 2EN1A 1EH6A 2EOEA 4R2SA 2UXBE 2EE8A 2EPXA 2EPZA 1SFEA 2LJHA 4DMIA 2YSOA 2ODRC 1X47A 1I94E 1HNZE 2WZOA 3VK6A 4ZYDA 3QG5C 2V85A 3MHHC 4KZSA 2I13A 1PJSA 2ZM6E 3T1HE 5LL6R 2WCC3 2KHXA 2L92A 4DV4E 4F6NA 1KYQA 3EPJA 2EMLA 2YPNA 2WBUA 2YTIA 4JI3E 2HHHE 4R8OA 1A1KA 2EMCA 2RS7A 1PKPA 1N36E 1IMUA 3KZYA 3HPZA 2ENHA 4NXNE 2V87A 2YWQA 2LVHA 1ZAAC 3F6GA 2K7IA 4KHPE 2EJ4A 2ENAA 4M30A 1YSAC 4WSPA 3LMLA 2EPNA 3C4TA 2YTFA 2ENCA 3AUZA 4F9AB 2LUQA 2L2NA 2L8TA 3H09A 2EN8A 4B3ME 1IQOA 1FJGE 2YTQA 1BB8A 2EMYA 1AH5A 1HR0E 1A1HA 5A6JA 4ZYEA 2EZ6A 2EQ3A 4LFAE 2GHFA 4BMJA 2YU5A 2JR1A 2KONA 2HC5A 5T6JA 4WXCA 1MEYC 4F2JC 2EMAA 5KL2A 1G2DC 4JI5E 2MDRA 4FK5C 2DGCA 4R2AA 1FKAE 2EL5A 4L8NA 2E5LE 2K4VA 2DIXA 2LT7A 1P47A 5A6BD 4OX9E 1IBKE 2ELYA 2LE2A 2ADRA 1X6HA 5IXMB 5DNYA 2EOMA 4JI7E 2EOOA 3ADJA 4P7DA 3HPSA 3DJWA 4LF4E 4LU9A 2F8BA 2UUBE 1G2FC 1Z1BA 1UHZA 3RMPA 1ZBTA 2EM7A 2EN3A 2D9HA 2YT4A 2RQLA 2VQFE 4DV1E 1N33E 2EMIA 4IJDA 1WJPA 4GKJE 4BCAA 4M2ZA 4KWYA 5A6BA 2GLIA 2EWLA 2VE7C 2LRSA 2YTJA 1EKZA 2L2MA 2EPRA 1EH7A 5A2QC 4F54A 1AAYA 2IHR1 3VYXA 2E1MA 3JU0A 1YYWA 3J7AG 2YTOA 2EMWA 4DV5E 1X48A 4GEQB 2LCEA 1XNRE 5LMUE 4M9VC 5AE1A 2DMYA 2B3TB 4LFBE 3MSWA 3J7Yp
chains in the Genus database with same CATH topology
2EMBA 1JK2A 2WCC3 2DRPA 2EM6A 1YUIA 1A1LA 2EN4A 2EOJA 5KL4A 4F6NA 3EPJA 2MKNA 1UN6B 2EMLA 2LO3A 2LV2A 2WBSA 1RMDA 5KL7A 2WBUA 2YTIA 1A1FA 2WBTA 2EPAA 2JP9A 2YSPA 2EOSA 4R2DA 1A1KA 2EMCA 1UBDC 2VRDA 2NABA 2EN6A 2EM8A 2HGHA 3M99B 2ENHA 2EMHA 1F2IG 2EMKA 2LVHA 2EPPA 4R2CA 1ZAAC 2YRKA 2YRMA 4R2RA 1KJKA 4X9JA 2BB8A 2E72A 2EPUA 2EJ4A 2ENAA 2J7JA 2CT1A 2YTGA 3UK3C 2EMXA 1YSAC 2MDGA 2YRHA 1TN9A 4R2QA 2PRTA 2YTFA 2YTDA 1A1IA 2ENCA 2DLQA 1JK1A 2EN8A 2YU8A 1DGCA 2YTQA 1X6EA 2JPAA 2EQ0A 2ELZA 2YTEA 1BBOA 2EM4A 2EMGA 4R2EA 1X6FA 4R2PA 5KL3A 1BB8A 2EOXA 2EMYA 1B69A 1A1HA 2EL4A 2EM5A 2EOYA 2EQ3A 2GHFA 1YUJA 2YU5A 2EP3A 2DMIA 2A25A 4F6MA 1MEYC 4F2JC 2EMAA 5KL2A 1G2DC 4FK5C 2R1FA 2EQ1A 2M9AA 4R2AA 2EL5A 2DGCA 5KL5A 2CSHA 2EM0A 2LT7A 1P47A 1X3CA 2YTNA 5KL6A 2EMZA 2EMFA 2ELYA 4WSGA 1ZU1A 1A1JA 2ADRA 1X6HA 2EOMA 2CTDA 2EOQA 2EOHA 2EOOA 2EOFA 3MHSC 1A1GA 2MKDA 3EPHA 2EOIA 4GZNC 2EL6A 1G2FC 1Z1BA 1LLMC 2EN3A 2EM7A 2D9HA 2EORA 2RPCA 2EN2A 2EM2A 2DLKA 2EMIA 2EPCA 4IJDA 1WJPA 2EN1A 2YTPA 2EOEA 4R2SA 2EOZA 1ZR9A 1TF3A 2EN7A 2GLIA 2YTJA 2EE8A 2EPXA 2EPRA 2EPZA 3EPKA 1AAYA 2YSOA 1TF6A 4IS1C 2EM3A 1X5WA 2YTOA 2EMWA 3VHTB 2LCEA 4M9VC 3MHHC 2I13A 1NCSA 2RSIA 2EM9A 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMB A;  1JK2 A;  2WCC 3;  2DRP A;  2EM6 A;  1YUI A;  1A1L A;  2EN4 A;  2EOJ A;  5KL4 A;  4F6N A;  3EPJ A;  2MKN A;  1UN6 B;  2EML A;  2LO3 A;  2LV2 A;  2WBS A;  1RMD A;  5KL7 A;  2WBU A;  2YTI A;  1A1F A;  2WBT A;  2EPA A;  2JP9 A;  2YSP A;  2EOS A;  4R2D A;  1A1K A;  2EMC A;  1UBD C;  2VRD A;  2NAB A;  2EN6 A;  2EM8 A;  2HGH A;  3M99 B;  2ENH A;  2EMH A;  1F2I G;  2EMK A;  2LVH A;  2EPP A;  4R2C A;  1ZAA C;  2YRK A;  2YRM A;  4R2R A;  1KJK A;  4X9J A;  2BB8 A;  2E72 A;  2EPU A;  2EJ4 A;  2ENA A;  2J7J A;  2CT1 A;  2YTG A;  3UK3 C;  2EMX A;  1YSA C;  2MDG A;  2YRH A;  1TN9 A;  4R2Q A;  2PRT A;  2YTF A;  2YTD A;  1A1I A;  2ENC A;  2DLQ A;  1JK1 A;  2EN8 A;  2YU8 A;  1DGC A;  2YTQ A;  1X6E A;  2JPA A;  2EQ0 A;  2ELZ A;  2YTE A;  1BBO A;  2EM4 A;  2EMG A;  4R2E A;  1X6F A;  4R2P A;  5KL3 A;  1BB8 A;  2EOX A;  2EMY A;  1B69 A;  1A1H A;  2EL4 A;  2EM5 A;  2EOY A;  2EQ3 A;  2GHF A;  1YUJ A;  2YU5 A;  2EP3 A;  2DMI A;  2A25 A;  4F6M A;  1MEY C;  4F2J C;  2EMA A;  5KL2 A;  1G2D C;  4FK5 C;  2R1F A;  2EQ1 A;  2M9A A;  4R2A A;  2EL5 A;  2DGC A;  5KL5 A;  2CSH A;  2EM0 A;  2LT7 A;  1P47 A;  1X3C A;  2YTN A;  5KL6 A;  2EMZ A;  2EMF A;  2ELY A;  4WSG A;  1ZU1 A;  1A1J A;  2ADR A;  1X6H A;  2EOM A;  2CTD A;  2EOQ A;  2EOH A;  2EOO A;  2EOF A;  3MHS C;  1A1G A;  2MKD A;  3EPH A;  2EOI A;  4GZN C;  2EL6 A;  1G2F C;  1Z1B A;  1LLM C;  2EN3 A;  2EM7 A;  2D9H A;  2EOR A;  2RPC A;  2EN2 A;  2EM2 A;  2DLK A;  2EMI A;  2EPC A;  4IJD A;  1WJP A;  2EN1 A;  2YTP A;  2EOE A;  4R2S A;  2EOZ A;  1ZR9 A;  1TF3 A;  2EN7 A;  2GLI A;  2YTJ A;  2EE8 A;  2EPX A;  2EPR A;  2EPZ A;  3EPK A;  1AAY A;  2YSO A;  1TF6 A;  4IS1 C;  2EM3 A;  1X5W A;  2YTO A;  2EMW A;  3VHT B;  2LCE A;  4M9V C;  3MHH C;  2I13 A;  1NCS A;  2RSI A;  2EM9 A;  3EPL A; 
#chains in the Genus database with same CATH topology
 1DI2 A;  2DRP A;  2RSM A;  2EM6 A;  1T4L B;  1YUI A;  5KL4 A;  2VQE E;  2LO3 A;  2WBS A;  1RMD A;  4JI8 E;  2UXD E;  2MC6 A;  1GQE A;  4DV0 E;  4DR7 E;  2EPA A;  1N3G A;  2EOS A;  4DV2 E;  4R2D A;  1UBD C;  2V88 A;  3HQ1 A;  4M0V A;  2NAB A;  5AAS A;  3BBG A;  1F2I G;  2EMK A;  3BGH A;  1N34 E;  3IWB A;  4B3T E;  1STU A;  2E72 A;  1SR9 A;  2EPU A;  2J7J A;  2M7Q A;  2CT1 A;  3FIG A;  4JI1 E;  3UK3 C;  2EMX A;  3THO B;  4B3S E;  4Q28 A;  4X62 E;  2JYA A;  2B7V A;  3J81 C;  2YU8 A;  1DGC A;  4LF8 E;  2ELZ A;  4JI6 E;  1BBO A;  2EM4 A;  2EMG A;  5KL3 A;  1X49 A;  4P78 A;  5A6K A;  2EPL X;  5ADZ A;  1PJT A;  1L4S A;  2DMI A;  2MC5 A;  5TSE A;  1MGT A;  1QU6 A;  3THN A;  1RQ0 A;  3ZOQ B;  1XMQ E;  2YZT A;  2M9A A;  3KZZ A;  2ODR D;  2RTX A;  1EH8 A;  2EM0 A;  3JAM C;  2M4I A;  2YTN A;  2EMZ A;  4BHC A;  2BBG A;  1YPN A;  2CTD A;  2EOQ A;  2EOH A;  4YY3 E;  2EOF A;  3MHS C;  2RS6 A;  3EPH A;  4GZN C;  1T4O A;  4TUG A;  3OML A;  3BF2 A;  3C6M A;  2EN2 A;  4X8W A;  2DLK A;  4JV5 E;  2FTX B;  2UUA E;  3ECR A;  2LMZ A;  5AC5 A;  2YTP A;  5IT9 C;  4NZV A;  4DR3 E;  2B7T A;  1ZR9 A;  3LLH A;  2EPM X;  3DF6 A;  3AV0 A;  2L3J A;  4DR6 E;  4NXM E;  1TF6 A;  4IS1 C;  4HTG A;  5IV8 B;  2EM3 A;  4J8Z A;  1X5W A;  2R76 A;  1T39 A;  3VHT B;  2H36 X;  4MLQ A;  1PJQ A;  4JYA E;  2LUP B;  2L33 A;  1NCS A;  2UUC E;  2UXC E;  4O4K A;  2V86 A;  1JK2 A;  1ZBQ A;  3F6H A;  2EN4 A;  2LJU A;  3KWR A;  1UN6 B;  2LV2 A;  1NEI A;  5AE3 A;  2LTR A;  1YFH A;  3IWC A;  4WYQ B;  5F3W A;  4DR1 E;  2JP9 A;  3ADI A;  2YSP A;  3ADL A;  2L3C A;  2VRD A;  2EN6 A;  2EM8 A;  2HGH A;  3M99 B;  3T1Y E;  2I9I A;  2EPP A;  2EPO A;  4DUY E;  4JI0 E;  2JWO A;  4X9J A;  4WXD A;  1TN9 A;  4R2Q A;  2VF1 A;  2JOX A;  2PRT A;  4R03 A;  2YTD A;  4YHH E;  1J5E E;  2DLQ A;  3TQM A;  1A1I A;  4K0K E;  4AQY E;  2FV4 B;  1X6E A;  2EQ0 A;  4WX9 A;  2YTE A;  4RH8 A;  1IQS A;  1X6F A;  2G7H A;  2JOB A;  4OOG C;  4DR5 E;  4DR4 E;  3J80 C;  4X64 E;  1WHN A;  3IWD A;  5FLX C;  3K6Q A;  2EOY A;  5A6A A;  1YUJ A;  1WRJ A;  3HXL A;  2V89 A;  1PDA A;  2B9D A;  2Q8U A;  4BHB A;  4F6M A;  3OTO E;  2R1F A;  3P1X A;  2GPI A;  5KL5 A;  4GKK E;  2CSH A;  5IWA E;  4WFT A;  2V8Q B;  1T38 A;  4DV3 E;  3JTZ A;  4L5N C;  3BID A;  3HTX A;  2FGG A;  1IBL E;  2EMF A;  4WSG A;  1ZU1 A;  5AE2 A;  5A69 A;  2JVA A;  2EOI A;  5LMN E;  4O5G A;  1QNT A;  1UIL A;  2N8X A;  2EOR A;  1IBM E;  1O0W A;  1DQ3 A;  4LF5 E;  3ADG A;  4LF9 E;  4X66 E;  4LF7 E;  2EOZ A;  4B3R E;  1TF3 A;  2EN7 A;  3EQ1 A;  2JXP A;  2M1S A;  1WXR A;  2V83 A;  3EPK A;  2LBS B;  4MLV A;  5LLQ A;  2EPK X;  4ZYH A;  1HNW E;  4X65 E;  2DB2 A;  2JY9 A;  4DV6 E;  1J26 A;  2NUE A;  4WPY A;  4JI4 E;  3L00 A;  4BBY A;  2RSI A;  2EM9 A;  4Q35 B;  3EPL A;  2L6M A;  4F9C B;  2L2K B;  2EMB A;  2CPN A;  1GZ6 A;  1YYO A;  1A1L A;  2EOJ A;  2MKN A;  5KL7 A;  5BR8 E;  3C4B A;  1A1F A;  2WBT A;  2KOU A;  2F4V E;  5AC4 A;  4N4R B;  4O24 A;  4ZYG A;  2UU9 E;  2EMH A;  4NHR A;  4R2C A;  2YRK A;  2YRM A;  4I8O A;  4R2R A;  1KJK A;  2BB8 A;  2N3G A;  2DSY A;  2YTG A;  4F9B B;  2MDG A;  2YRH A;  2HJJ A;  4O43 A;  4DUZ E;  1YYK A;  1BBG A;  4BC9 A;  1JK1 A;  4RHB B;  4JI2 E;  2JPA A;  2NUF A;  4DKK A;  4R2E A;  4R2P A;  2EOX A;  4BS9 A;  1XNQ E;  1B69 A;  2EL4 A;  2EM5 A;  3C6K A;  1XMO E;  4LFC E;  4LTY A;  2EP3 A;  5CFF E;  2A25 A;  4BC7 A;  4DR2 E;  2EQ1 A;  1HNX E;  2NUG A;  1X3C A;  3VYY A;  5KL6 A;  2N3H A;  2NA2 A;  1T4N A;  1GTK A;  2LTS A;  1N32 E;  1YZ9 A;  1WHQ A;  1A1J A;  1A1G A;  2MKD A;  4TUI A;  1RC7 A;  2EL6 A;  1LLM C;  2RPC A;  4LF6 E;  2EM2 A;  4DV7 E;  2EPC A;  4HEI A;  2EN1 A;  1EH6 A;  2EOE A;  4R2S A;  2UXB E;  2EE8 A;  2EPX A;  2EPZ A;  1SFE A;  2LJH A;  4DMI A;  2YSO A;  2ODR C;  1X47 A;  1I94 E;  1HNZ E;  2WZO A;  3VK6 A;  4ZYD A;  3QG5 C;  2V85 A;  3MHH C;  4KZS A;  2I13 A;  1PJS A;  2ZM6 E;  3T1H E;  5LL6 R;  2WCC 3;  2KHX A;  2L92 A;  4DV4 E;  4F6N A;  1KYQ A;  3EPJ A;  2EML A;  2YPN A;  2WBU A;  2YTI A;  4JI3 E;  2HHH E;  4R8O A;  1A1K A;  2EMC A;  2RS7 A;  1PKP A;  1N36 E;  1IMU A;  3KZY A;  3HPZ A;  2ENH A;  4NXN E;  2V87 A;  2YWQ A;  2LVH A;  1ZAA C;  3F6G A;  2K7I A;  4KHP E;  2EJ4 A;  2ENA A;  4M30 A;  1YSA C;  4WSP A;  3LML A;  2EPN A;  3C4T A;  2YTF A;  2ENC A;  3AUZ A;  4F9A B;  2LUQ A;  2L2N A;  2L8T A;  3H09 A;  2EN8 A;  4B3M E;  1IQO A;  1FJG E;  2YTQ A;  1BB8 A;  2EMY A;  1AH5 A;  1HR0 E;  1A1H A;  5A6J A;  4ZYE A;  2EZ6 A;  2EQ3 A;  4LFA E;  2GHF A;  4BMJ A;  2YU5 A;  2JR1 A;  2KON A;  2HC5 A;  5T6J A;  4WXC A;  1MEY C;  4F2J C;  2EMA A;  5KL2 A;  1G2D C;  4JI5 E;  2MDR A;  4FK5 C;  2DGC A;  4R2A A;  1FKA E;  2EL5 A;  4L8N A;  2E5L E;  2K4V A;  2DIX A;  2LT7 A;  1P47 A;  5A6B D;  4OX9 E;  1IBK E;  2ELY A;  2LE2 A;  2ADR A;  1X6H A;  5IXM B;  5DNY A;  2EOM A;  4JI7 E;  2EOO A;  3ADJ A;  4P7D A;  3HPS A;  3DJW A;  4LF4 E;  4LU9 A;  2F8B A;  2UUB E;  1G2F C;  1Z1B A;  1UHZ A;  3RMP A;  1ZBT A;  2EM7 A;  2EN3 A;  2D9H A;  2YT4 A;  2RQL A;  2VQF E;  4DV1 E;  1N33 E;  2EMI A;  4IJD A;  1WJP A;  4GKJ E;  4BCA A;  4M2Z A;  4KWY A;  5A6B A;  2GLI A;  2EWL A;  2VE7 C;  2LRS A;  2YTJ A;  1EKZ A;  2L2M A;  2EPR A;  1EH7 A;  5A2Q C;  4F54 A;  1AAY A;  2IHR 1;  3VYX A;  2E1M A;  3JU0 A;  1YYW A;  3J7A G;  2YTO A;  2EMW A;  4DV5 E;  1X48 A;  4GEQ B;  2LCE A;  1XNR E;  5LMU E;  4M9V C;  5AE1 A;  2DMY A;  2B3T B;  4LFB E;  3MSW A;  3J7Y p; 
#chains in the Genus database with same CATH homology
 2EMB A;  1JK2 A;  2WCC 3;  2DRP A;  2EM6 A;  1YUI A;  1A1L A;  2EN4 A;  2EOJ A;  5KL4 A;  4F6N A;  3EPJ A;  2MKN A;  1UN6 B;  2EML A;  2LO3 A;  2LV2 A;  2WBS A;  1RMD A;  5KL7 A;  2WBU A;  2YTI A;  1A1F A;  2WBT A;  2EPA A;  2JP9 A;  2YSP A;  2EOS A;  4R2D A;  1A1K A;  2EMC A;  1UBD C;  2VRD A;  2NAB A;  2EN6 A;  2EM8 A;  2HGH A;  3M99 B;  2ENH A;  2EMH A;  1F2I G;  2EMK A;  2LVH A;  2EPP A;  4R2C A;  1ZAA C;  2YRK A;  2YRM A;  4R2R A;  1KJK A;  4X9J A;  2BB8 A;  2E72 A;  2EPU A;  2EJ4 A;  2ENA A;  2J7J A;  2CT1 A;  2YTG A;  3UK3 C;  2EMX A;  1YSA C;  2MDG A;  2YRH A;  1TN9 A;  4R2Q A;  2PRT A;  2YTF A;  2YTD A;  1A1I A;  2ENC A;  2DLQ A;  1JK1 A;  2EN8 A;  2YU8 A;  1DGC A;  2YTQ A;  1X6E A;  2JPA A;  2EQ0 A;  2ELZ A;  2YTE A;  1BBO A;  2EM4 A;  2EMG A;  4R2E A;  1X6F A;  4R2P A;  5KL3 A;  1BB8 A;  2EOX A;  2EMY A;  1B69 A;  1A1H A;  2EL4 A;  2EM5 A;  2EOY A;  2EQ3 A;  2GHF A;  1YUJ A;  2YU5 A;  2EP3 A;  2DMI A;  2A25 A;  4F6M A;  1MEY C;  4F2J C;  2EMA A;  5KL2 A;  1G2D C;  4FK5 C;  2R1F A;  2EQ1 A;  2M9A A;  4R2A A;  2EL5 A;  2DGC A;  5KL5 A;  2CSH A;  2EM0 A;  2LT7 A;  1P47 A;  1X3C A;  2YTN A;  5KL6 A;  2EMZ A;  2EMF A;  2ELY A;  4WSG A;  1ZU1 A;  1A1J A;  2ADR A;  1X6H A;  2EOM A;  2CTD A;  2EOQ A;  2EOH A;  2EOO A;  2EOF A;  3MHS C;  1A1G A;  2MKD A;  3EPH A;  2EOI A;  4GZN C;  2EL6 A;  1G2F C;  1Z1B A;  1LLM C;  2EN3 A;  2EM7 A;  2D9H A;  2EOR A;  2RPC A;  2EN2 A;  2EM2 A;  2DLK A;  2EMI A;  2EPC A;  4IJD A;  1WJP A;  2EN1 A;  2YTP A;  2EOE A;  4R2S A;  2EOZ A;  1ZR9 A;  1TF3 A;  2EN7 A;  2GLI A;  2YTJ A;  2EE8 A;  2EPX A;  2EPR A;  2EPZ A;  3EPK A;  1AAY A;  2YSO A;  1TF6 A;  4IS1 C;  2EM3 A;  1X5W A;  2YTO A;  2EMW A;  3VHT B;  2LCE A;  4M9V C;  3MHH C;  2I13 A;  1NCS A;  2RSI A;  2EM9 A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...