5KL2A

Wilms tumor protein (wt1) znf2-4 in complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
b'EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl2A00
1A1JA 5KL2A 2YRHA 2EM8A 2EMIA 1TN9A 2DLKA 2PRTA 2YRKA 1A1KA 4R2DA 1RMDA 1YSAC 2EM2A 2YTIA 2EMLA 2GLIA 2EM7A 2EOXA 2EPPA 4R2AA 2YTJA 2EOZA 1G2FC 3UK3C 2JP9A 1MEYC 1X6FA 1NCSA 3MHSC 4F6NA 2EMYA 2EOOA 2EMXA 5KL5A 2RPCA 2WCC3 1UN6B 2CSHA 3EPJA 2EOMA 2ADRA 2YU5A 3EPLA 1WJPA 2YTOA 1LLMC 4M9VC 2EOSA 2EN7A 2EPUA 2ENHA 2YTEA 1A1HA 2A25A 2YSOA 2DMIA 4IJDA 2EMFA 2YTFA 2EJ4A 2R1FA 1BB8A 2BB8A 2EM6A 2EM5A 5KL7A 2EMHA 2D9HA 2EN6A 2WBTA 2LT7A 2EN4A 2EN1A 5KL3A 2RSIA 2LCEA 2EPZA 1P47A 2EP3A 1JK2A 2EN2A 4R2EA 2EN3A 4R2SA 1X5WA 2HGHA 2EM0A 2YU8A 2EOHA 1DGCA 2JPAA 2EPRA 2EN8A 2MDGA 2EQ3A 2EMZA 3EPKA 5KL6A 2NABA 2EMAA 2EORA 1Z1BA 2DGCA 4F6MA 2ENAA 2EM3A 2ELYA 1TF6A 2EE8A 1G2DC 4WSGA 2EMWA 1X3CA 4R2QA 1ZU1A 2WBUA 1ZR9A 1UBDC 2EMKA 1JK1A 2EPXA 2DLQA 2EOFA 2EMBA 1X6EA 2EL6A 1A1IA 2ELZA 2EOIA 2EOEA 2YTQA 2YTNA 2YTDA 2EMCA 2CT1A 2EOJA 2GHFA 4R2RA 2LO3A 2EMGA 2EOYA 2EPAA 4IS1C 2VRDA 2ENCA 4R2CA 4R2PA 2MKDA 1A1FA 2YRMA 2YSPA 1F2IG 4X9JA 2EQ0A 1A1GA 2LV2A 4FK5C 2J7JA 2YTGA 2EQ1A 3EPHA 2DRPA 1ZAAC 1TF3A 2EOQA 2EM4A 5KL4A 3VHTB 2EM9A 1X6HA 2EL5A 2CTDA 1YUIA 2M9AA 1KJKA 4GZNC 2LVHA 1B69A 2MKNA 2I13A 3MHHC 4F2JC 2YTPA 2EL4A 1AAYA 1BBOA 3M99B 1YUJA 1A1LA 2WBSA 2E72A 2EPCA
chains in the Genus database with same CATH superfamily
5KL2A 1N33E 3ADLA 2YRHA 2DSYA 2B9DA 1TN9A 4BMJA 4M30A 1YSAC 4JV5E 5AE1A 3C6MA 1YYKA 4WSPA 2EPPA 2YTJA 3UK3C 2M7QA 4X62E 2EMYA 1BBGA 3EPJA 4GKJE 4GEQB 2JOBA 2ADRA 2YU5A 2YTOA 2DIXA 2ENHA 3DF6A 2VQFE 4JI5E 2DMIA 3C4BA 4Q35B 4KHPE 1XNQE 3LLHA 5LLQA 2L3CA 5KL7A 2EMHA 2FGGA 5LMNE 2EN4A 2EN1A 5KL3A 2K7IA 3JTZA 4Q28A 1QNTA 3ADGA 4HEIA 3C4TA 4R2EA 4R03A 4R2SA 2V86A 1X5WA 2EOHA 3KWRA 4HTGA 2MDGA 2EMZA 4OOGC 2NABA 2DGCA 4F6MA 2E5LE 1TF6A 4DUZE 2NUGA 4TUIA 3FIGA 4GKKE 2WZOA 2CPNA 3L00A 5A6AA 2B3TB 3J7Yp 1IBKE 2EOIA 5A6JA 2EPOA 4R2RA 4NXME 4R2CA 2UUBE 2MKDA 2YRMA 4LTYA 4X9JA 2Q8UA 1PKPA 4BHCA 4FK5C 1N34E 4NXNE 4LF9E 4LF4E 3ADIA 2RTXA 4LU9A 2DB2A 2N8XA 2EOQA 1X6HA 2LUQA 1YUIA 2M9AA 4F9CB 4GZNC 2MKNA 1N3GA 2I13A 4BC9A 3OTOE 4LFBE 1STUA 2WBSA 1WXRA 4WX9A 2EPCA 1A1JA 2LJHA 1PJTA 4RHBB 2UU9E 2EM8A 3JU0A 2DLKA 4AQYE 2YRKA 4RH8A 2YTIA 5IT9C 2MC5A 3HPZA 4R2AA 1G2FC 1X48A 4WFTA 4JI8E 5DNYA 1NCSA 4LF8E 2WCC3 1UN6B 2RPCA 4ZYHA 4X64E 2JR1A 1X47A 4NHRA 4O43A 1WJPA 1T4LB 4X8WA 2M1SA 2EZ6A 1A1HA 2HC5A 2ODRD 2YSOA 4KZSA 2R1FA 2EM6A 1UILA 2D9HA 2WBTA 4K0KE 2L2MA 2F4VE 4DUYE 1DQ3A 1NEIA 2EN2A 2UXBE 2B7TA 4B3RE 2EN3A 2L8TA 3T1HE 3HQ1A 1DGCA 1N32E 1WHNA 2EPRA 1X49A 5A6BD 1I94E 3IWCA 5TSEA 4F54A 4X65E 3BBGA 3BIDA 1Z1BA 4LF5E 2EM3A 2L92A 2EPLX 2EE8A 4BC7A 4WSGA 2VF1A 4R2QA 1ZU1A 2WBUA 1ZR9A 4I8OA 2EPXA 4LFCE 1J26A 2EPNA 3AUZA 2EOFA 5IV8B 2VQEE 2EL6A 3C6KA 2ELZA 2LRSA 3P1XA 1ZBTA 2YTDA 2EOJA 3K6QA 1GTKA 2UUCE 2V83A 2EMGA 3J7AG 4DV0E 5F3WA 3ZOQB 4BCAA 2VRDA 1T4NA 2ENCA 5A6KA 4YY3E 4R2PA 2FV4B 2YSPA 3KZZA 2LUPB 2NUEA 1XMQE 3HTXA 3EPHA 2DRPA 4ZYGA 1ZAAC 4B3ME 5AASA 2EWLA 5AC4A 5KL4A 5LMUE 2MDRA 3VHTB 1YYOA 4DR5E 4DR6E 2EM9A 2N3HA 2V85A 2EL5A 2NA2A 3H09A 2UXDE 4F9AB 2UXCE 2YTPA 2EL4A 2LTSA 3J81C 2V88A 1IBME 2MC6A 3DJWA 4L8NA 1HNZE 2EM2A 2GLIA 1N36E 2EOXA 2VE7C 2LJUA 3IWDA 2JP9A 1MEYC 1X6FA 3HXLA 4MLVA 1RC7A 2EOOA 1YFHA 2KHXA 2DMYA 2EOMA 3VK6A 5FLXC 3ECRA 1PDAA 4DV4E 1LLMC 4JI0E 2R76A 4M9VC 4DV7E 2ZM6E 4JYAE 4DMIA 2YTEA 2YWQA 5LL6R 4DV5E 4IJDA 4B3SE 1XMOE 2EJ4A 1BB8A 2V8QB 1HR0E 2EM5A 4OX9E 3THNA 4BBYA 2EN6A 2LT7A 2H36X 3TQMA 1SR9A 1O0WA 2RSIA 2EPZA 1P47A 1JK2A 2LBSB 2JPAA 2YU8A 2EN8A 2GPIA 3EPKA 5KL6A 1EH7A 2EMAA 2RSMA 2ENAA 2ELYA 1HNXE 1IQOA 2EMWA 1X3CA 2I9IA 4M2ZA 2K4VA 2EMKA 2JXPA 2F8BA 2YZTA 2EMBA 3QG5C 4NZVA 5IWAE 1PJSA 2KOUA 3RMPA 2BBGA 2LE2A 2LO3A 1EKZA 4X66E 2JYAA 3T1YE 1A1FA 1F2IG 2G7HA 2L2NA 2EQ0A 2J7JA 3LMLA 2HJJA 2IHR1 3JAMC 5A6BA 3BGHA 1MGTA 4JI6E 2NUFA 2L2KB 1T4OA 4DV1E 1YZ9A 1WHQA 3OMLA 5AE3A 4WYQB 5AC5A 1KJKA 1B69A 3MHHC 4O24A 3KZYA 4F2JC 3ADJA 5A69A 1WRJA 1AAYA 1T39A 4WXDA 3M99B 1SFEA 1BBOA 4TUGA 1XNRE 4KWYA 2E72A 2JVAA 1UHZA 2JOXA 4L5NC 4P78A 2N3GA 2EMIA 2PRTA 3HPSA 1GQEA 1A1KA 4R2DA 1RMDA 1DI2A 4J8ZA 2EMLA 3F6GA 2UUAE 2EM7A 1PJQA 2EOZA 4DKKA 3MHSC 1KYQA 2L33A 4MLQA 2LMZA 4WXCA 4F6NA 3AV0A 2B7VA 2EMXA 5KL5A 4DR2E 3VYYA 2CSHA 4DR1E 4LFAE 2E1MA 1ZBQA 2ODRC 3EPLA 1FKAE 2YT4A 3IWBA 2EOSA 2EN7A 2EPUA 4N4RB 2A25A 3MSWA 2EMFA 2YTFA 4O5GA 5CFFE 2HHHE 1FJGE 1RQ0A 2BB8A 2LTRA 2FTXB 2L6MA 2KONA 1T38A 2LCEA 4ZYDA 4BS9A 1HNWE 2EP3A 2EPKX 2HGHA 2EM0A 4YHHE 1IQSA 1AH5A 2EQ3A 4BHBA 4O4KA 4WPYA 1YYWA 4DR4E 4R8OA 2EORA 4LF6E 1J5EE 1G2DC 1YPNA 5AE2A 5A2QC 4B3TE 1UBDC 3F6HA 4JI2E 1JK1A 4F9BB 2DLQA 4LF7E 2M4IA 3THOB 1X6EA 1L4SA 1QU6A 2RS6A 1A1IA 2EOEA 2YTQA 2YTNA 4P7DA 2EMCA 2CT1A 1EH6A 2GHFA 4IS1C 2EOYA 2EPAA 3EQ1A 2V89A 5BR8E 2RS7A 1A1GA 4JI7E 2LV2A 1EH8A 2YTGA 2EQ1A 2YPNA 4ZYEA 4M0VA 2L3JA 5IXMB 5T6JA 3J80C 4JI1E 1TF3A 1GZ6A 1IMUA 2EM4A 2JY9A 4DR7E 2JWOA 4DV6E 1IBLE 3BF2A 4DR3E 2CTDA 4JI3E 2EPMX 2LVHA 2RQLA 2V87A 1YUJA 3VYXA 5ADZA 4DV3E 1A1LA 4DV2E 4JI4E
chains in the Genus database with same CATH topology
1A1JA 5KL2A 2YRHA 2EM8A 2EMIA 1TN9A 2DLKA 2PRTA 2YRKA 1A1KA 4R2DA 1RMDA 1YSAC 2EM2A 2YTIA 2EMLA 2GLIA 2EM7A 2EOXA 2EPPA 4R2AA 2YTJA 2EOZA 1G2FC 3UK3C 2JP9A 1MEYC 1X6FA 1NCSA 3MHSC 4F6NA 2EMYA 2EOOA 2EMXA 5KL5A 2RPCA 2WCC3 1UN6B 2CSHA 3EPJA 2EOMA 2ADRA 2YU5A 3EPLA 1WJPA 2YTOA 1LLMC 4M9VC 2EOSA 2EN7A 2EPUA 2ENHA 2YTEA 1A1HA 2A25A 2YSOA 2DMIA 4IJDA 2EMFA 2YTFA 2EJ4A 2R1FA 1BB8A 2BB8A 2EM6A 2EM5A 5KL7A 2EMHA 2D9HA 2EN6A 2WBTA 2LT7A 2EN4A 2EN1A 5KL3A 2RSIA 2LCEA 2EPZA 1P47A 2EP3A 1JK2A 2EN2A 4R2EA 2EN3A 4R2SA 1X5WA 2HGHA 2EM0A 2YU8A 2EOHA 1DGCA 2JPAA 2EPRA 2EN8A 2MDGA 2EQ3A 2EMZA 3EPKA 5KL6A 2NABA 2EMAA 2EORA 1Z1BA 2DGCA 4F6MA 2ENAA 2EM3A 2ELYA 1TF6A 2EE8A 1G2DC 4WSGA 2EMWA 1X3CA 4R2QA 1ZU1A 2WBUA 1ZR9A 1UBDC 2EMKA 1JK1A 2EPXA 2DLQA 2EOFA 2EMBA 1X6EA 2EL6A 1A1IA 2ELZA 2EOIA 2EOEA 2YTQA 2YTNA 2YTDA 2EMCA 2CT1A 2EOJA 2GHFA 4R2RA 2LO3A 2EMGA 2EOYA 2EPAA 4IS1C 2VRDA 2ENCA 4R2CA 4R2PA 2MKDA 1A1FA 2YRMA 2YSPA 1F2IG 4X9JA 2EQ0A 1A1GA 2LV2A 4FK5C 2J7JA 2YTGA 2EQ1A 3EPHA 2DRPA 1ZAAC 1TF3A 2EOQA 2EM4A 5KL4A 3VHTB 2EM9A 1X6HA 2EL5A 2CTDA 1YUIA 2M9AA 1KJKA 4GZNC 2LVHA 1B69A 2MKNA 2I13A 3MHHC 4F2JC 2YTPA 2EL4A 1AAYA 1BBOA 3M99B 1YUJA 1A1LA 2WBSA 2E72A 2EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1J A;  5KL2 A;  2YRH A;  2EM8 A;  2EMI A;  1TN9 A;  2DLK A;  2PRT A;  2YRK A;  1A1K A;  4R2D A;  1RMD A;  1YSA C;  2EM2 A;  2YTI A;  2EML A;  2GLI A;  2EM7 A;  2EOX A;  2EPP A;  4R2A A;  2YTJ A;  2EOZ A;  1G2F C;  3UK3 C;  2JP9 A;  1MEY C;  1X6F A;  1NCS A;  3MHS C;  4F6N A;  2EMY A;  2EOO A;  2EMX A;  5KL5 A;  2RPC A;  2WCC 3;  1UN6 B;  2CSH A;  3EPJ A;  2EOM A;  2ADR A;  2YU5 A;  3EPL A;  1WJP A;  2YTO A;  1LLM C;  4M9V C;  2EOS A;  2EN7 A;  2EPU A;  2ENH A;  2YTE A;  1A1H A;  2A25 A;  2YSO A;  2DMI A;  4IJD A;  2EMF A;  2YTF A;  2EJ4 A;  2R1F A;  1BB8 A;  2BB8 A;  2EM6 A;  2EM5 A;  5KL7 A;  2EMH A;  2D9H A;  2EN6 A;  2WBT A;  2LT7 A;  2EN4 A;  2EN1 A;  5KL3 A;  2RSI A;  2LCE A;  2EPZ A;  1P47 A;  2EP3 A;  1JK2 A;  2EN2 A;  4R2E A;  2EN3 A;  4R2S A;  1X5W A;  2HGH A;  2EM0 A;  2YU8 A;  2EOH A;  1DGC A;  2JPA A;  2EPR A;  2EN8 A;  2MDG A;  2EQ3 A;  2EMZ A;  3EPK A;  5KL6 A;  2NAB A;  2EMA A;  2EOR A;  1Z1B A;  2DGC A;  4F6M A;  2ENA A;  2EM3 A;  2ELY A;  1TF6 A;  2EE8 A;  1G2D C;  4WSG A;  2EMW A;  1X3C A;  4R2Q A;  1ZU1 A;  2WBU A;  1ZR9 A;  1UBD C;  2EMK A;  1JK1 A;  2EPX A;  2DLQ A;  2EOF A;  2EMB A;  1X6E A;  2EL6 A;  1A1I A;  2ELZ A;  2EOI A;  2EOE A;  2YTQ A;  2YTN A;  2YTD A;  2EMC A;  2CT1 A;  2EOJ A;  2GHF A;  4R2R A;  2LO3 A;  2EMG A;  2EOY A;  2EPA A;  4IS1 C;  2VRD A;  2ENC A;  4R2C A;  4R2P A;  2MKD A;  1A1F A;  2YRM A;  2YSP A;  1F2I G;  4X9J A;  2EQ0 A;  1A1G A;  2LV2 A;  4FK5 C;  2J7J A;  2YTG A;  2EQ1 A;  3EPH A;  2DRP A;  1ZAA C;  1TF3 A;  2EOQ A;  2EM4 A;  5KL4 A;  3VHT B;  2EM9 A;  1X6H A;  2EL5 A;  2CTD A;  1YUI A;  2M9A A;  1KJK A;  4GZN C;  2LVH A;  1B69 A;  2MKN A;  2I13 A;  3MHH C;  4F2J C;  2YTP A;  2EL4 A;  1AAY A;  1BBO A;  3M99 B;  1YUJ A;  1A1L A;  2WBS A;  2E72 A;  2EPC A; 
#chains in the Genus database with same CATH topology
 5KL2 A;  1N33 E;  3ADL A;  2YRH A;  2DSY A;  2B9D A;  1TN9 A;  4BMJ A;  4M30 A;  1YSA C;  4JV5 E;  5AE1 A;  3C6M A;  1YYK A;  4WSP A;  2EPP A;  2YTJ A;  3UK3 C;  2M7Q A;  4X62 E;  2EMY A;  1BBG A;  3EPJ A;  4GKJ E;  4GEQ B;  2JOB A;  2ADR A;  2YU5 A;  2YTO A;  2DIX A;  2ENH A;  3DF6 A;  2VQF E;  4JI5 E;  2DMI A;  3C4B A;  4Q35 B;  4KHP E;  1XNQ E;  3LLH A;  5LLQ A;  2L3C A;  5KL7 A;  2EMH A;  2FGG A;  5LMN E;  2EN4 A;  2EN1 A;  5KL3 A;  2K7I A;  3JTZ A;  4Q28 A;  1QNT A;  3ADG A;  4HEI A;  3C4T A;  4R2E A;  4R03 A;  4R2S A;  2V86 A;  1X5W A;  2EOH A;  3KWR A;  4HTG A;  2MDG A;  2EMZ A;  4OOG C;  2NAB A;  2DGC A;  4F6M A;  2E5L E;  1TF6 A;  4DUZ E;  2NUG A;  4TUI A;  3FIG A;  4GKK E;  2WZO A;  2CPN A;  3L00 A;  5A6A A;  2B3T B;  3J7Y p;  1IBK E;  2EOI A;  5A6J A;  2EPO A;  4R2R A;  4NXM E;  4R2C A;  2UUB E;  2MKD A;  2YRM A;  4LTY A;  4X9J A;  2Q8U A;  1PKP A;  4BHC A;  4FK5 C;  1N34 E;  4NXN E;  4LF9 E;  4LF4 E;  3ADI A;  2RTX A;  4LU9 A;  2DB2 A;  2N8X A;  2EOQ A;  1X6H A;  2LUQ A;  1YUI A;  2M9A A;  4F9C B;  4GZN C;  2MKN A;  1N3G A;  2I13 A;  4BC9 A;  3OTO E;  4LFB E;  1STU A;  2WBS A;  1WXR A;  4WX9 A;  2EPC A;  1A1J A;  2LJH A;  1PJT A;  4RHB B;  2UU9 E;  2EM8 A;  3JU0 A;  2DLK A;  4AQY E;  2YRK A;  4RH8 A;  2YTI A;  5IT9 C;  2MC5 A;  3HPZ A;  4R2A A;  1G2F C;  1X48 A;  4WFT A;  4JI8 E;  5DNY A;  1NCS A;  4LF8 E;  2WCC 3;  1UN6 B;  2RPC A;  4ZYH A;  4X64 E;  2JR1 A;  1X47 A;  4NHR A;  4O43 A;  1WJP A;  1T4L B;  4X8W A;  2M1S A;  2EZ6 A;  1A1H A;  2HC5 A;  2ODR D;  2YSO A;  4KZS A;  2R1F A;  2EM6 A;  1UIL A;  2D9H A;  2WBT A;  4K0K E;  2L2M A;  2F4V E;  4DUY E;  1DQ3 A;  1NEI A;  2EN2 A;  2UXB E;  2B7T A;  4B3R E;  2EN3 A;  2L8T A;  3T1H E;  3HQ1 A;  1DGC A;  1N32 E;  1WHN A;  2EPR A;  1X49 A;  5A6B D;  1I94 E;  3IWC A;  5TSE A;  4F54 A;  4X65 E;  3BBG A;  3BID A;  1Z1B A;  4LF5 E;  2EM3 A;  2L92 A;  2EPL X;  2EE8 A;  4BC7 A;  4WSG A;  2VF1 A;  4R2Q A;  1ZU1 A;  2WBU A;  1ZR9 A;  4I8O A;  2EPX A;  4LFC E;  1J26 A;  2EPN A;  3AUZ A;  2EOF A;  5IV8 B;  2VQE E;  2EL6 A;  3C6K A;  2ELZ A;  2LRS A;  3P1X A;  1ZBT A;  2YTD A;  2EOJ A;  3K6Q A;  1GTK A;  2UUC E;  2V83 A;  2EMG A;  3J7A G;  4DV0 E;  5F3W A;  3ZOQ B;  4BCA A;  2VRD A;  1T4N A;  2ENC A;  5A6K A;  4YY3 E;  4R2P A;  2FV4 B;  2YSP A;  3KZZ A;  2LUP B;  2NUE A;  1XMQ E;  3HTX A;  3EPH A;  2DRP A;  4ZYG A;  1ZAA C;  4B3M E;  5AAS A;  2EWL A;  5AC4 A;  5KL4 A;  5LMU E;  2MDR A;  3VHT B;  1YYO A;  4DR5 E;  4DR6 E;  2EM9 A;  2N3H A;  2V85 A;  2EL5 A;  2NA2 A;  3H09 A;  2UXD E;  4F9A B;  2UXC E;  2YTP A;  2EL4 A;  2LTS A;  3J81 C;  2V88 A;  1IBM E;  2MC6 A;  3DJW A;  4L8N A;  1HNZ E;  2EM2 A;  2GLI A;  1N36 E;  2EOX A;  2VE7 C;  2LJU A;  3IWD A;  2JP9 A;  1MEY C;  1X6F A;  3HXL A;  4MLV A;  1RC7 A;  2EOO A;  1YFH A;  2KHX A;  2DMY A;  2EOM A;  3VK6 A;  5FLX C;  3ECR A;  1PDA A;  4DV4 E;  1LLM C;  4JI0 E;  2R76 A;  4M9V C;  4DV7 E;  2ZM6 E;  4JYA E;  4DMI A;  2YTE A;  2YWQ A;  5LL6 R;  4DV5 E;  4IJD A;  4B3S E;  1XMO E;  2EJ4 A;  1BB8 A;  2V8Q B;  1HR0 E;  2EM5 A;  4OX9 E;  3THN A;  4BBY A;  2EN6 A;  2LT7 A;  2H36 X;  3TQM A;  1SR9 A;  1O0W A;  2RSI A;  2EPZ A;  1P47 A;  1JK2 A;  2LBS B;  2JPA A;  2YU8 A;  2EN8 A;  2GPI A;  3EPK A;  5KL6 A;  1EH7 A;  2EMA A;  2RSM A;  2ENA A;  2ELY A;  1HNX E;  1IQO A;  2EMW A;  1X3C A;  2I9I A;  4M2Z A;  2K4V A;  2EMK A;  2JXP A;  2F8B A;  2YZT A;  2EMB A;  3QG5 C;  4NZV A;  5IWA E;  1PJS A;  2KOU A;  3RMP A;  2BBG A;  2LE2 A;  2LO3 A;  1EKZ A;  4X66 E;  2JYA A;  3T1Y E;  1A1F A;  1F2I G;  2G7H A;  2L2N A;  2EQ0 A;  2J7J A;  3LML A;  2HJJ A;  2IHR 1;  3JAM C;  5A6B A;  3BGH A;  1MGT A;  4JI6 E;  2NUF A;  2L2K B;  1T4O A;  4DV1 E;  1YZ9 A;  1WHQ A;  3OML A;  5AE3 A;  4WYQ B;  5AC5 A;  1KJK A;  1B69 A;  3MHH C;  4O24 A;  3KZY A;  4F2J C;  3ADJ A;  5A69 A;  1WRJ A;  1AAY A;  1T39 A;  4WXD A;  3M99 B;  1SFE A;  1BBO A;  4TUG A;  1XNR E;  4KWY A;  2E72 A;  2JVA A;  1UHZ A;  2JOX A;  4L5N C;  4P78 A;  2N3G A;  2EMI A;  2PRT A;  3HPS A;  1GQE A;  1A1K A;  4R2D A;  1RMD A;  1DI2 A;  4J8Z A;  2EML A;  3F6G A;  2UUA E;  2EM7 A;  1PJQ A;  2EOZ A;  4DKK A;  3MHS C;  1KYQ A;  2L33 A;  4MLQ A;  2LMZ A;  4WXC A;  4F6N A;  3AV0 A;  2B7V A;  2EMX A;  5KL5 A;  4DR2 E;  3VYY A;  2CSH A;  4DR1 E;  4LFA E;  2E1M A;  1ZBQ A;  2ODR C;  3EPL A;  1FKA E;  2YT4 A;  3IWB A;  2EOS A;  2EN7 A;  2EPU A;  4N4R B;  2A25 A;  3MSW A;  2EMF A;  2YTF A;  4O5G A;  5CFF E;  2HHH E;  1FJG E;  1RQ0 A;  2BB8 A;  2LTR A;  2FTX B;  2L6M A;  2KON A;  1T38 A;  2LCE A;  4ZYD A;  4BS9 A;  1HNW E;  2EP3 A;  2EPK X;  2HGH A;  2EM0 A;  4YHH E;  1IQS A;  1AH5 A;  2EQ3 A;  4BHB A;  4O4K A;  4WPY A;  1YYW A;  4DR4 E;  4R8O A;  2EOR A;  4LF6 E;  1J5E E;  1G2D C;  1YPN A;  5AE2 A;  5A2Q C;  4B3T E;  1UBD C;  3F6H A;  4JI2 E;  1JK1 A;  4F9B B;  2DLQ A;  4LF7 E;  2M4I A;  3THO B;  1X6E A;  1L4S A;  1QU6 A;  2RS6 A;  1A1I A;  2EOE A;  2YTQ A;  2YTN A;  4P7D A;  2EMC A;  2CT1 A;  1EH6 A;  2GHF A;  4IS1 C;  2EOY A;  2EPA A;  3EQ1 A;  2V89 A;  5BR8 E;  2RS7 A;  1A1G A;  4JI7 E;  2LV2 A;  1EH8 A;  2YTG A;  2EQ1 A;  2YPN A;  4ZYE A;  4M0V A;  2L3J A;  5IXM B;  5T6J A;  3J80 C;  4JI1 E;  1TF3 A;  1GZ6 A;  1IMU A;  2EM4 A;  2JY9 A;  4DR7 E;  2JWO A;  4DV6 E;  1IBL E;  3BF2 A;  4DR3 E;  2CTD A;  4JI3 E;  2EPM X;  2LVH A;  2RQL A;  2V87 A;  1YUJ A;  3VYX A;  5ADZ A;  4DV3 E;  1A1L A;  4DV2 E;  4JI4 E; 
#chains in the Genus database with same CATH homology
 1A1J A;  5KL2 A;  2YRH A;  2EM8 A;  2EMI A;  1TN9 A;  2DLK A;  2PRT A;  2YRK A;  1A1K A;  4R2D A;  1RMD A;  1YSA C;  2EM2 A;  2YTI A;  2EML A;  2GLI A;  2EM7 A;  2EOX A;  2EPP A;  4R2A A;  2YTJ A;  2EOZ A;  1G2F C;  3UK3 C;  2JP9 A;  1MEY C;  1X6F A;  1NCS A;  3MHS C;  4F6N A;  2EMY A;  2EOO A;  2EMX A;  5KL5 A;  2RPC A;  2WCC 3;  1UN6 B;  2CSH A;  3EPJ A;  2EOM A;  2ADR A;  2YU5 A;  3EPL A;  1WJP A;  2YTO A;  1LLM C;  4M9V C;  2EOS A;  2EN7 A;  2EPU A;  2ENH A;  2YTE A;  1A1H A;  2A25 A;  2YSO A;  2DMI A;  4IJD A;  2EMF A;  2YTF A;  2EJ4 A;  2R1F A;  1BB8 A;  2BB8 A;  2EM6 A;  2EM5 A;  5KL7 A;  2EMH A;  2D9H A;  2EN6 A;  2WBT A;  2LT7 A;  2EN4 A;  2EN1 A;  5KL3 A;  2RSI A;  2LCE A;  2EPZ A;  1P47 A;  2EP3 A;  1JK2 A;  2EN2 A;  4R2E A;  2EN3 A;  4R2S A;  1X5W A;  2HGH A;  2EM0 A;  2YU8 A;  2EOH A;  1DGC A;  2JPA A;  2EPR A;  2EN8 A;  2MDG A;  2EQ3 A;  2EMZ A;  3EPK A;  5KL6 A;  2NAB A;  2EMA A;  2EOR A;  1Z1B A;  2DGC A;  4F6M A;  2ENA A;  2EM3 A;  2ELY A;  1TF6 A;  2EE8 A;  1G2D C;  4WSG A;  2EMW A;  1X3C A;  4R2Q A;  1ZU1 A;  2WBU A;  1ZR9 A;  1UBD C;  2EMK A;  1JK1 A;  2EPX A;  2DLQ A;  2EOF A;  2EMB A;  1X6E A;  2EL6 A;  1A1I A;  2ELZ A;  2EOI A;  2EOE A;  2YTQ A;  2YTN A;  2YTD A;  2EMC A;  2CT1 A;  2EOJ A;  2GHF A;  4R2R A;  2LO3 A;  2EMG A;  2EOY A;  2EPA A;  4IS1 C;  2VRD A;  2ENC A;  4R2C A;  4R2P A;  2MKD A;  1A1F A;  2YRM A;  2YSP A;  1F2I G;  4X9J A;  2EQ0 A;  1A1G A;  2LV2 A;  4FK5 C;  2J7J A;  2YTG A;  2EQ1 A;  3EPH A;  2DRP A;  1ZAA C;  1TF3 A;  2EOQ A;  2EM4 A;  5KL4 A;  3VHT B;  2EM9 A;  1X6H A;  2EL5 A;  2CTD A;  1YUI A;  2M9A A;  1KJK A;  4GZN C;  2LVH A;  1B69 A;  2MKN A;  2I13 A;  3MHH C;  4F2J C;  2YTP A;  2EL4 A;  1AAY A;  1BBO A;  3M99 B;  1YUJ A;  1A1L A;  2WBS A;  2E72 A;  2EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...