2EP3A

Solution structure of the c2h2 type zinc finger (region 631-663) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 631-663) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ep3A01
1ZU1A 2EM0A 2EM6A 1TN9A 2MKNA 2EL4A 2YU5A 2RSIA 2RPCA 2EN4A 2J7JA 1BB8A 1X3CA 1F2IG 2EM5A 2EPXA 2EMLA 4FK5C 2EL5A 3VHTB 3EPLA 3EPHA 1B69A 4R2CA 2EM8A 2YU8A 1G2DC 2EM7A 1UN6B 2ENAA 1A1JA 2EOIA 1DGCA 2YRKA 2EP3A 2E72A 2EE8A 2YRHA 2NABA 2EMFA 1A1GA 2EJ4A 4R2RA 2EMXA 1A1HA 2EN6A 2I13A 1KJKA 2ADRA 2EN3A 2VRDA 1G2FC 2EPAA 5KL4A 1AAYA 2EOYA 2WBUA 1ZAAC 3MHSC 3MHHC 4WSGA 2GLIA 2GHFA 2EMGA 4R2SA 1JK1A 2EQ3A 5KL2A 2EN1A 2JPAA 2EOZA 1MEYC 2CTDA 2YTNA 2EMIA 2EOQA 2DLKA 2YTDA 1YUJA 1A1KA 4R2PA 5KL7A 4M9VC 2EPPA 1BBOA 2EM3A 2JP9A 1X6HA 2EPUA 2LO3A 3EPKA 4IJDA 2BB8A 4R2EA 2EPZA 1JK2A 2EQ0A 2EPCA 4IS1C 1Z1BA 2WCC3 1UBDC 2EM9A 1ZR9A 2EN2A 2LV2A 2EMYA 1TF3A 2EMZA 2YTJA 2EOOA 2DGCA 2DMIA 4X9JA 2HGHA 2YSOA 3EPJA 3UK3C 1A1LA 2EN7A 2MDGA 5KL5A 1P47A 2EMCA 4R2QA 2ENHA 2R1FA 1WJPA 1A1FA 4R2DA 1NCSA 2LT7A 4GZNC 1YUIA 1X6EA 2YRMA 2EOJA 1X5WA 2EOXA 1A1IA 2EMWA 2EOSA 2MKDA 2EORA 2YTFA 2WBTA 1RMDA 2EPRA 2PRTA 2EN8A 2DRPA 2YTOA 2ELZA 2A25A 2EOMA 2EM4A 2YTQA 2M9AA 1YSAC 2EMKA 4R2AA 4F6MA 2YTPA 2CT1A 2EOFA 5KL6A 4F6NA 2LVHA 1LLMC 2EMBA 2D9HA 2EMAA 2LCEA 4F2JC 2EM2A 2EOHA 2DLQA 2EQ1A 2ELYA 2CSHA 1TF6A 2YSPA 3M99B 2YTEA 2YTIA 2ENCA 2EMHA 1X6FA 2WBSA 5KL3A 2YTGA 2EOEA 2EL6A
chains in the Genus database with same CATH superfamily
4ZYEA 1ZU1A 2EM0A 1TN9A 3BGHA 2EL4A 1ZBQA 2UXBE 4P78A 4DR3E 2I9IA 2EPXA 2MC5A 4FK5C 4KZSA 5A6BA 4LF9E 5LMUE 1ZBTA 4F54A 1QU6A 2V89A 4ZYDA 1WHQA 4NHRA 1G2DC 2EM7A 1UN6B 2B3TB 1A1JA 4KWYA 2YRKA 5FLXC 4WXDA 5IV8B 2RS6A 1DI2A 4TUIA 1GZ6A 4DR2E 4R2RA 5IWAE 2EN3A 4LF8E 5AC5A 5A6BD 4DV4E 1AAYA 5LLQA 1DQ3A 4HTGA 2JWOA 2N3HA 4JI5E 1JK1A 4JI8E 5KL2A 1I94E 1MEYC 2EPMX 2EMIA 4LF5E 1EH8A 4F9BB 4DR1E 2VF1A 3HPSA 4DR7E 4R2PA 4M9VC 2EPPA 1BBOA 2L92A 3ECRA 2EM3A 2LO3A 2UXCE 2GPIA 4DV1E 1T39A 3K6QA 4JI0E 2EPCA 3ADLA 2EPNA 1UBDC 1ZR9A 1IQOA 2M1SA 3AV0A 4X8WA 4LF6E 1PJQA 2DGCA 2DMIA 2HHHE 4ZYGA 3J80C 2YSOA 1FJGE 4Q28A 1A1LA 4B3RE 2MDGA 2EMCA 4WFTA 2M4IA 3JAMC 4R2DA 1NCSA 4N4RB 2LT7A 4KHPE 4GZNC 1X6EA 2EPOA 2YRMA 2EPKX 1A1IA 2MKDA 2EORA 1RMDA 4JI4E 3LMLA 2YTOA 1MGTA 2EOMA 2EM4A 1IBKE 1J5EE 4DR6E 4M0VA 1SFEA 2M9AA 1J26A 2EMKA 4F9AB 5KL6A 4F6NA 2VQFE 2L6MA 1LLMC 2EMBA 4YY3E 2LE2A 2B7TA 1T4OA 2ELYA 3C6MA 1TF6A 2YTIA 2ENCA 2EMHA 5KL3A 2YTGA 4X62E 2ODRD 2YU5A 4JV5E 1EH6A 2RSIA 2DSYA 2EN4A 2HC5A 2L2KB 2M7QA 1WHNA 1NEIA 2EL5A 4K0KE 3VHTB 2G7HA 3C4BA 4L8NA 3EPLA 2V87A 1IMUA 3L00A 2LMZA 3EPHA 5CFFE 1B69A 2EM8A 2EPLX 3ZOQB 2JY9A 3C6KA 3KWRA 1X48A 4BC9A 1DGCA 2EP3A 2UXDE 2V83A 4O5GA 2EJ4A 2MC6A 3JTZA 4LF4E 2IHR1 1N32E 1A1HA 2EN6A 2I13A 1KJKA 1UHZA 4LTYA 2EPAA 5KL4A 4JYAE 2EOYA 2WBUA 2UU9E 3MHSC 2VQEE 3VYXA 4WX9A 4MLQA 2EQ3A 2LTSA 2EN1A 4X65E 1GQEA 2EOZA 3OMLA 2N3GA 3H09A 2DLKA 4GKJE 3HPZA 2ODRC 1A1KA 2KHXA 3DF6A 5AE3A 5KL7A 2JP9A 1HNWE 2V8QB 1HNXE 4YHHE 4IJDA 2BB8A 4R2EA 1X49A 2EPZA 1JK2A 2EQ0A 1PJSA 2JR1A 1Z1BA 4B3ME 2WCC3 2EM9A 4DR5E 2EOOA 3IWDA 4JI1E 5AC4A 3T1HE 2ZM6E 5AE1A 2NUEA 2NUFA 1O0WA 1P47A 2DMYA 4R2QA 4NXME 1IBME 4M30A 4RH8A 2EOJA 2EOSA 1XNRE 2LJUA 5A6JA 4RHBB 2WBTA 2EN8A 4LFAE 2ELZA 2K4VA 2KONA 2YZTA 2YWQA 4F6MA 2CT1A 3VK6A 3ADGA 2L2NA 3F6HA 2D9HA 5LL6R 4DKKA 3M99B 2WBSA 5ADZA 2EM6A 4BBYA 2MKNA 2EWLA 4R03A 1XMOE 1BB8A 1X3CA 1F2IG 2L3JA 1IQSA 2CPNA 2EMLA 2LUQA 2V85A 4NZVA 1SR9A 1XNQE 3ADJA 2F4VE 4WYQB 5A2QC 2YT4A 4BHBA 3BF2A 2L3CA 2ENAA 1YZ9A 2H36X 3J7Yp 2LBSB 1EKZA 2LJHA 4O43A 5IT9C 4O4KA 5BR8E 1KYQA 2RS7A 2VE7C 2ADRA 1G2FC 1N34E 1ZAAC 2JXPA 4WSGA 2GLIA 2GHFA 2Q8UA 4R2SA 3JU0A 3VYYA 5IXMB 3P1XA 1HR0E 2CTDA 2EZ6A 1BBGA 2YTDA 1T4NA 2B7VA 2E5LE 3C4TA 4LF7E 1RC7A 1RQ0A 1T4LB 4HEIA 2EPUA 1YFHA 1AH5A 2FGGA 5LMNE 2YPNA 4J8ZA 4IS1C 2LTRA 3HQ1A 3HTXA 2LV2A 2EMYA 1TF3A 2LRSA 4BMJA 2UUAE 2HGHA 5A69A 1X47A 3UK3C 3F6GA 3MSWA 2R1FA 1WJPA 2NA2A 1A1FA 1N36E 2RSMA 1UILA 4R8OA 3BBGA 4JI6E 2EPRA 2DRPA 2R76A 3T1YE 2A25A 2B9DA 2DB2A 5DNYA 3DJWA 2YTQA 2RQLA 2JOBA 2FV4B 1YSAC 2YTPA 4B3SE 2EOFA 2V86A 4JI7E 1YYKA 3THOB 2LVHA 4BCAA 2EMAA 4F2JC 2EOHA 2DLQA 4DV2E 2YSPA 1XMQE 2YTEA 3LLHA 4I8OA 2EOEA 1IBLE 4Q35B 4JI2E 2RPCA 2JVAA 2J7JA 2WZOA 4GEQB 5A6KA 4NXNE 4DV6E 2BBGA 2EM5A 3TQMA 4O24A 4X64E 2KOUA 3OTOE 4LFBE 2L2MA 4X66E 4AQYE 1GTKA 2RTXA 2DIXA 4R2CA 3RMPA 2YU8A 5T6JA 4LU9A 1T38A 1PDAA 2JOXA 2EOIA 3BIDA 3ADIA 4TUGA 1WRJA 2L33A 2E72A 2EE8A 3HXLA 1WXRA 2YRHA 2NABA 2EMFA 1PKPA 4BS9A 1QNTA 1A1GA 2F8BA 4GKKE 1EH7A 2L8TA 2EMXA 4MLVA 2VRDA 2FTXB 3MHHC 3QG5C 2EMGA 4DMIA 3KZYA 2JPAA 5AASA 3J7AG 2MDRA 2YTNA 2EOQA 1YYWA 1PJTA 1YUJA 4DR4E 2UUCE 4OX9E 2N8XA 4BC7A 1X6HA 4P7DA 4B3TE 1N33E 3AUZA 2HJJA 4DV0E 3EPKA 1N3GA 4BHCA 2E1MA 3IWCA 1YYOA 4L5NC 2NUGA 2EN2A 5TSEA 1YPNA 2EMZA 4WSPA 1FKAE 2YTJA 2K7IA 3J81C 4X9JA 3FIGA 4LFCE 3EPJA 2EN7A 5KL5A 4DV3E 2ENHA 4DUZE 3EQ1A 4F9CB 1HNZE 1STUA 4JI3E 1YUIA 2V88A 5F3WA 1X5WA 2EOXA 3KZZA 2EMWA 2YTFA 5AE2A 4ZYHA 2PRTA 1L4SA 3IWBA 4R2AA 4M2ZA 4DV5E 4WXCA 2LCEA 2JYAA 2EM2A 2EQ1A 4DUYE 4DV7E 4WPYA 2CSHA 3THNA 1X6FA 2UUBE 4OOGC 2LUPB 2EL6A 5A6AA
chains in the Genus database with same CATH topology
1ZU1A 2EM0A 2EM6A 1TN9A 2MKNA 2EL4A 2YU5A 2RSIA 2RPCA 2EN4A 2J7JA 1BB8A 1X3CA 1F2IG 2EM5A 2EPXA 2EMLA 4FK5C 2EL5A 3VHTB 3EPLA 3EPHA 1B69A 4R2CA 2EM8A 2YU8A 1G2DC 2EM7A 1UN6B 2ENAA 1A1JA 2EOIA 1DGCA 2YRKA 2EP3A 2E72A 2EE8A 2YRHA 2NABA 2EMFA 1A1GA 2EJ4A 4R2RA 2EMXA 1A1HA 2EN6A 2I13A 1KJKA 2ADRA 2EN3A 2VRDA 1G2FC 2EPAA 5KL4A 1AAYA 2EOYA 2WBUA 1ZAAC 3MHSC 3MHHC 4WSGA 2GLIA 2GHFA 2EMGA 4R2SA 1JK1A 2EQ3A 5KL2A 2EN1A 2JPAA 2EOZA 1MEYC 2CTDA 2YTNA 2EMIA 2EOQA 2DLKA 2YTDA 1YUJA 1A1KA 4R2PA 5KL7A 4M9VC 2EPPA 1BBOA 2EM3A 2JP9A 1X6HA 2EPUA 2LO3A 3EPKA 4IJDA 2BB8A 4R2EA 2EPZA 1JK2A 2EQ0A 2EPCA 4IS1C 1Z1BA 2WCC3 1UBDC 2EM9A 1ZR9A 2EN2A 2LV2A 2EMYA 1TF3A 2EMZA 2YTJA 2EOOA 2DGCA 2DMIA 4X9JA 2HGHA 2YSOA 3EPJA 3UK3C 1A1LA 2EN7A 2MDGA 5KL5A 1P47A 2EMCA 4R2QA 2ENHA 2R1FA 1WJPA 1A1FA 4R2DA 1NCSA 2LT7A 4GZNC 1YUIA 1X6EA 2YRMA 2EOJA 1X5WA 2EOXA 1A1IA 2EMWA 2EOSA 2MKDA 2EORA 2YTFA 2WBTA 1RMDA 2EPRA 2PRTA 2EN8A 2DRPA 2YTOA 2ELZA 2A25A 2EOMA 2EM4A 2YTQA 2M9AA 1YSAC 2EMKA 4R2AA 4F6MA 2YTPA 2CT1A 2EOFA 5KL6A 4F6NA 2LVHA 1LLMC 2EMBA 2D9HA 2EMAA 2LCEA 4F2JC 2EM2A 2EOHA 2DLQA 2EQ1A 2ELYA 2CSHA 1TF6A 2YSPA 3M99B 2YTEA 2YTIA 2ENCA 2EMHA 1X6FA 2WBSA 5KL3A 2YTGA 2EOEA 2EL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2EM0 A;  2EM6 A;  1TN9 A;  2MKN A;  2EL4 A;  2YU5 A;  2RSI A;  2RPC A;  2EN4 A;  2J7J A;  1BB8 A;  1X3C A;  1F2I G;  2EM5 A;  2EPX A;  2EML A;  4FK5 C;  2EL5 A;  3VHT B;  3EPL A;  3EPH A;  1B69 A;  4R2C A;  2EM8 A;  2YU8 A;  1G2D C;  2EM7 A;  1UN6 B;  2ENA A;  1A1J A;  2EOI A;  1DGC A;  2YRK A;  2EP3 A;  2E72 A;  2EE8 A;  2YRH A;  2NAB A;  2EMF A;  1A1G A;  2EJ4 A;  4R2R A;  2EMX A;  1A1H A;  2EN6 A;  2I13 A;  1KJK A;  2ADR A;  2EN3 A;  2VRD A;  1G2F C;  2EPA A;  5KL4 A;  1AAY A;  2EOY A;  2WBU A;  1ZAA C;  3MHS C;  3MHH C;  4WSG A;  2GLI A;  2GHF A;  2EMG A;  4R2S A;  1JK1 A;  2EQ3 A;  5KL2 A;  2EN1 A;  2JPA A;  2EOZ A;  1MEY C;  2CTD A;  2YTN A;  2EMI A;  2EOQ A;  2DLK A;  2YTD A;  1YUJ A;  1A1K A;  4R2P A;  5KL7 A;  4M9V C;  2EPP A;  1BBO A;  2EM3 A;  2JP9 A;  1X6H A;  2EPU A;  2LO3 A;  3EPK A;  4IJD A;  2BB8 A;  4R2E A;  2EPZ A;  1JK2 A;  2EQ0 A;  2EPC A;  4IS1 C;  1Z1B A;  2WCC 3;  1UBD C;  2EM9 A;  1ZR9 A;  2EN2 A;  2LV2 A;  2EMY A;  1TF3 A;  2EMZ A;  2YTJ A;  2EOO A;  2DGC A;  2DMI A;  4X9J A;  2HGH A;  2YSO A;  3EPJ A;  3UK3 C;  1A1L A;  2EN7 A;  2MDG A;  5KL5 A;  1P47 A;  2EMC A;  4R2Q A;  2ENH A;  2R1F A;  1WJP A;  1A1F A;  4R2D A;  1NCS A;  2LT7 A;  4GZN C;  1YUI A;  1X6E A;  2YRM A;  2EOJ A;  1X5W A;  2EOX A;  1A1I A;  2EMW A;  2EOS A;  2MKD A;  2EOR A;  2YTF A;  2WBT A;  1RMD A;  2EPR A;  2PRT A;  2EN8 A;  2DRP A;  2YTO A;  2ELZ A;  2A25 A;  2EOM A;  2EM4 A;  2YTQ A;  2M9A A;  1YSA C;  2EMK A;  4R2A A;  4F6M A;  2YTP A;  2CT1 A;  2EOF A;  5KL6 A;  4F6N A;  2LVH A;  1LLM C;  2EMB A;  2D9H A;  2EMA A;  2LCE A;  4F2J C;  2EM2 A;  2EOH A;  2DLQ A;  2EQ1 A;  2ELY A;  2CSH A;  1TF6 A;  2YSP A;  3M99 B;  2YTE A;  2YTI A;  2ENC A;  2EMH A;  1X6F A;  2WBS A;  5KL3 A;  2YTG A;  2EOE A;  2EL6 A; 
#chains in the Genus database with same CATH topology
 4ZYE A;  1ZU1 A;  2EM0 A;  1TN9 A;  3BGH A;  2EL4 A;  1ZBQ A;  2UXB E;  4P78 A;  4DR3 E;  2I9I A;  2EPX A;  2MC5 A;  4FK5 C;  4KZS A;  5A6B A;  4LF9 E;  5LMU E;  1ZBT A;  4F54 A;  1QU6 A;  2V89 A;  4ZYD A;  1WHQ A;  4NHR A;  1G2D C;  2EM7 A;  1UN6 B;  2B3T B;  1A1J A;  4KWY A;  2YRK A;  5FLX C;  4WXD A;  5IV8 B;  2RS6 A;  1DI2 A;  4TUI A;  1GZ6 A;  4DR2 E;  4R2R A;  5IWA E;  2EN3 A;  4LF8 E;  5AC5 A;  5A6B D;  4DV4 E;  1AAY A;  5LLQ A;  1DQ3 A;  4HTG A;  2JWO A;  2N3H A;  4JI5 E;  1JK1 A;  4JI8 E;  5KL2 A;  1I94 E;  1MEY C;  2EPM X;  2EMI A;  4LF5 E;  1EH8 A;  4F9B B;  4DR1 E;  2VF1 A;  3HPS A;  4DR7 E;  4R2P A;  4M9V C;  2EPP A;  1BBO A;  2L92 A;  3ECR A;  2EM3 A;  2LO3 A;  2UXC E;  2GPI A;  4DV1 E;  1T39 A;  3K6Q A;  4JI0 E;  2EPC A;  3ADL A;  2EPN A;  1UBD C;  1ZR9 A;  1IQO A;  2M1S A;  3AV0 A;  4X8W A;  4LF6 E;  1PJQ A;  2DGC A;  2DMI A;  2HHH E;  4ZYG A;  3J80 C;  2YSO A;  1FJG E;  4Q28 A;  1A1L A;  4B3R E;  2MDG A;  2EMC A;  4WFT A;  2M4I A;  3JAM C;  4R2D A;  1NCS A;  4N4R B;  2LT7 A;  4KHP E;  4GZN C;  1X6E A;  2EPO A;  2YRM A;  2EPK X;  1A1I A;  2MKD A;  2EOR A;  1RMD A;  4JI4 E;  3LML A;  2YTO A;  1MGT A;  2EOM A;  2EM4 A;  1IBK E;  1J5E E;  4DR6 E;  4M0V A;  1SFE A;  2M9A A;  1J26 A;  2EMK A;  4F9A B;  5KL6 A;  4F6N A;  2VQF E;  2L6M A;  1LLM C;  2EMB A;  4YY3 E;  2LE2 A;  2B7T A;  1T4O A;  2ELY A;  3C6M A;  1TF6 A;  2YTI A;  2ENC A;  2EMH A;  5KL3 A;  2YTG A;  4X62 E;  2ODR D;  2YU5 A;  4JV5 E;  1EH6 A;  2RSI A;  2DSY A;  2EN4 A;  2HC5 A;  2L2K B;  2M7Q A;  1WHN A;  1NEI A;  2EL5 A;  4K0K E;  3VHT B;  2G7H A;  3C4B A;  4L8N A;  3EPL A;  2V87 A;  1IMU A;  3L00 A;  2LMZ A;  3EPH A;  5CFF E;  1B69 A;  2EM8 A;  2EPL X;  3ZOQ B;  2JY9 A;  3C6K A;  3KWR A;  1X48 A;  4BC9 A;  1DGC A;  2EP3 A;  2UXD E;  2V83 A;  4O5G A;  2EJ4 A;  2MC6 A;  3JTZ A;  4LF4 E;  2IHR 1;  1N32 E;  1A1H A;  2EN6 A;  2I13 A;  1KJK A;  1UHZ A;  4LTY A;  2EPA A;  5KL4 A;  4JYA E;  2EOY A;  2WBU A;  2UU9 E;  3MHS C;  2VQE E;  3VYX A;  4WX9 A;  4MLQ A;  2EQ3 A;  2LTS A;  2EN1 A;  4X65 E;  1GQE A;  2EOZ A;  3OML A;  2N3G A;  3H09 A;  2DLK A;  4GKJ E;  3HPZ A;  2ODR C;  1A1K A;  2KHX A;  3DF6 A;  5AE3 A;  5KL7 A;  2JP9 A;  1HNW E;  2V8Q B;  1HNX E;  4YHH E;  4IJD A;  2BB8 A;  4R2E A;  1X49 A;  2EPZ A;  1JK2 A;  2EQ0 A;  1PJS A;  2JR1 A;  1Z1B A;  4B3M E;  2WCC 3;  2EM9 A;  4DR5 E;  2EOO A;  3IWD A;  4JI1 E;  5AC4 A;  3T1H E;  2ZM6 E;  5AE1 A;  2NUE A;  2NUF A;  1O0W A;  1P47 A;  2DMY A;  4R2Q A;  4NXM E;  1IBM E;  4M30 A;  4RH8 A;  2EOJ A;  2EOS A;  1XNR E;  2LJU A;  5A6J A;  4RHB B;  2WBT A;  2EN8 A;  4LFA E;  2ELZ A;  2K4V A;  2KON A;  2YZT A;  2YWQ A;  4F6M A;  2CT1 A;  3VK6 A;  3ADG A;  2L2N A;  3F6H A;  2D9H A;  5LL6 R;  4DKK A;  3M99 B;  2WBS A;  5ADZ A;  2EM6 A;  4BBY A;  2MKN A;  2EWL A;  4R03 A;  1XMO E;  1BB8 A;  1X3C A;  1F2I G;  2L3J A;  1IQS A;  2CPN A;  2EML A;  2LUQ A;  2V85 A;  4NZV A;  1SR9 A;  1XNQ E;  3ADJ A;  2F4V E;  4WYQ B;  5A2Q C;  2YT4 A;  4BHB A;  3BF2 A;  2L3C A;  2ENA A;  1YZ9 A;  2H36 X;  3J7Y p;  2LBS B;  1EKZ A;  2LJH A;  4O43 A;  5IT9 C;  4O4K A;  5BR8 E;  1KYQ A;  2RS7 A;  2VE7 C;  2ADR A;  1G2F C;  1N34 E;  1ZAA C;  2JXP A;  4WSG A;  2GLI A;  2GHF A;  2Q8U A;  4R2S A;  3JU0 A;  3VYY A;  5IXM B;  3P1X A;  1HR0 E;  2CTD A;  2EZ6 A;  1BBG A;  2YTD A;  1T4N A;  2B7V A;  2E5L E;  3C4T A;  4LF7 E;  1RC7 A;  1RQ0 A;  1T4L B;  4HEI A;  2EPU A;  1YFH A;  1AH5 A;  2FGG A;  5LMN E;  2YPN A;  4J8Z A;  4IS1 C;  2LTR A;  3HQ1 A;  3HTX A;  2LV2 A;  2EMY A;  1TF3 A;  2LRS A;  4BMJ A;  2UUA E;  2HGH A;  5A69 A;  1X47 A;  3UK3 C;  3F6G A;  3MSW A;  2R1F A;  1WJP A;  2NA2 A;  1A1F A;  1N36 E;  2RSM A;  1UIL A;  4R8O A;  3BBG A;  4JI6 E;  2EPR A;  2DRP A;  2R76 A;  3T1Y E;  2A25 A;  2B9D A;  2DB2 A;  5DNY A;  3DJW A;  2YTQ A;  2RQL A;  2JOB A;  2FV4 B;  1YSA C;  2YTP A;  4B3S E;  2EOF A;  2V86 A;  4JI7 E;  1YYK A;  3THO B;  2LVH A;  4BCA A;  2EMA A;  4F2J C;  2EOH A;  2DLQ A;  4DV2 E;  2YSP A;  1XMQ E;  2YTE A;  3LLH A;  4I8O A;  2EOE A;  1IBL E;  4Q35 B;  4JI2 E;  2RPC A;  2JVA A;  2J7J A;  2WZO A;  4GEQ B;  5A6K A;  4NXN E;  4DV6 E;  2BBG A;  2EM5 A;  3TQM A;  4O24 A;  4X64 E;  2KOU A;  3OTO E;  4LFB E;  2L2M A;  4X66 E;  4AQY E;  1GTK A;  2RTX A;  2DIX A;  4R2C A;  3RMP A;  2YU8 A;  5T6J A;  4LU9 A;  1T38 A;  1PDA A;  2JOX A;  2EOI A;  3BID A;  3ADI A;  4TUG A;  1WRJ A;  2L33 A;  2E72 A;  2EE8 A;  3HXL A;  1WXR A;  2YRH A;  2NAB A;  2EMF A;  1PKP A;  4BS9 A;  1QNT A;  1A1G A;  2F8B A;  4GKK E;  1EH7 A;  2L8T A;  2EMX A;  4MLV A;  2VRD A;  2FTX B;  3MHH C;  3QG5 C;  2EMG A;  4DMI A;  3KZY A;  2JPA A;  5AAS A;  3J7A G;  2MDR A;  2YTN A;  2EOQ A;  1YYW A;  1PJT A;  1YUJ A;  4DR4 E;  2UUC E;  4OX9 E;  2N8X A;  4BC7 A;  1X6H A;  4P7D A;  4B3T E;  1N33 E;  3AUZ A;  2HJJ A;  4DV0 E;  3EPK A;  1N3G A;  4BHC A;  2E1M A;  3IWC A;  1YYO A;  4L5N C;  2NUG A;  2EN2 A;  5TSE A;  1YPN A;  2EMZ A;  4WSP A;  1FKA E;  2YTJ A;  2K7I A;  3J81 C;  4X9J A;  3FIG A;  4LFC E;  3EPJ A;  2EN7 A;  5KL5 A;  4DV3 E;  2ENH A;  4DUZ E;  3EQ1 A;  4F9C B;  1HNZ E;  1STU A;  4JI3 E;  1YUI A;  2V88 A;  5F3W A;  1X5W A;  2EOX A;  3KZZ A;  2EMW A;  2YTF A;  5AE2 A;  4ZYH A;  2PRT A;  1L4S A;  3IWB A;  4R2A A;  4M2Z A;  4DV5 E;  4WXC A;  2LCE A;  2JYA A;  2EM2 A;  2EQ1 A;  4DUY E;  4DV7 E;  4WPY A;  2CSH A;  3THN A;  1X6F A;  2UUB E;  4OOG C;  2LUP B;  2EL6 A;  5A6A A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2EM0 A;  2EM6 A;  1TN9 A;  2MKN A;  2EL4 A;  2YU5 A;  2RSI A;  2RPC A;  2EN4 A;  2J7J A;  1BB8 A;  1X3C A;  1F2I G;  2EM5 A;  2EPX A;  2EML A;  4FK5 C;  2EL5 A;  3VHT B;  3EPL A;  3EPH A;  1B69 A;  4R2C A;  2EM8 A;  2YU8 A;  1G2D C;  2EM7 A;  1UN6 B;  2ENA A;  1A1J A;  2EOI A;  1DGC A;  2YRK A;  2EP3 A;  2E72 A;  2EE8 A;  2YRH A;  2NAB A;  2EMF A;  1A1G A;  2EJ4 A;  4R2R A;  2EMX A;  1A1H A;  2EN6 A;  2I13 A;  1KJK A;  2ADR A;  2EN3 A;  2VRD A;  1G2F C;  2EPA A;  5KL4 A;  1AAY A;  2EOY A;  2WBU A;  1ZAA C;  3MHS C;  3MHH C;  4WSG A;  2GLI A;  2GHF A;  2EMG A;  4R2S A;  1JK1 A;  2EQ3 A;  5KL2 A;  2EN1 A;  2JPA A;  2EOZ A;  1MEY C;  2CTD A;  2YTN A;  2EMI A;  2EOQ A;  2DLK A;  2YTD A;  1YUJ A;  1A1K A;  4R2P A;  5KL7 A;  4M9V C;  2EPP A;  1BBO A;  2EM3 A;  2JP9 A;  1X6H A;  2EPU A;  2LO3 A;  3EPK A;  4IJD A;  2BB8 A;  4R2E A;  2EPZ A;  1JK2 A;  2EQ0 A;  2EPC A;  4IS1 C;  1Z1B A;  2WCC 3;  1UBD C;  2EM9 A;  1ZR9 A;  2EN2 A;  2LV2 A;  2EMY A;  1TF3 A;  2EMZ A;  2YTJ A;  2EOO A;  2DGC A;  2DMI A;  4X9J A;  2HGH A;  2YSO A;  3EPJ A;  3UK3 C;  1A1L A;  2EN7 A;  2MDG A;  5KL5 A;  1P47 A;  2EMC A;  4R2Q A;  2ENH A;  2R1F A;  1WJP A;  1A1F A;  4R2D A;  1NCS A;  2LT7 A;  4GZN C;  1YUI A;  1X6E A;  2YRM A;  2EOJ A;  1X5W A;  2EOX A;  1A1I A;  2EMW A;  2EOS A;  2MKD A;  2EOR A;  2YTF A;  2WBT A;  1RMD A;  2EPR A;  2PRT A;  2EN8 A;  2DRP A;  2YTO A;  2ELZ A;  2A25 A;  2EOM A;  2EM4 A;  2YTQ A;  2M9A A;  1YSA C;  2EMK A;  4R2A A;  4F6M A;  2YTP A;  2CT1 A;  2EOF A;  5KL6 A;  4F6N A;  2LVH A;  1LLM C;  2EMB A;  2D9H A;  2EMA A;  2LCE A;  4F2J C;  2EM2 A;  2EOH A;  2DLQ A;  2EQ1 A;  2ELY A;  2CSH A;  1TF6 A;  2YSP A;  3M99 B;  2YTE A;  2YTI A;  2ENC A;  2EMH A;  1X6F A;  2WBS A;  5KL3 A;  2YTG A;  2EOE A;  2EL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...