2EP3A

Solution structure of the c2h2 type zinc finger (region 631-663) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 631-663) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ep3A01
2EM8A 1AAYA 4IJDA 1YUIA 5KL2A 2DRPA 1YUJA 4R2EA 2EOQA 1P47A 4R2PA 1A1FA 4R2SA 1X6EA 2EM2A 2WBTA 2YTDA 2EPUA 5KL5A 2YTFA 4M9VC 2EMBA 1A1IA 2EOZA 4WSGA 2EPCA 2EMWA 1BBOA 2EQ0A 3MHSC 2YTNA 2EN4A 4F6MA 2NABA 2E72A 2YTOA 2EMZA 2EOJA 2ELZA 2LO3A 4R2DA 4R2QA 2VRDA 1G2FC 2EMAA 1LLMC 1F2IG 2I13A 3EPLA 1A1LA 1YSAC 2DGCA 2CT1A 3MHHC 5KL7A 1A1HA 1TF6A 2EPPA 2EQ1A 2MKNA 2YTIA 2EOHA 1Z1BA 2JPAA 2CSHA 2EN8A 3EPJA 1ZU1A 2WBSA 2EPZA 2BB8A 2YSOA 2EM9A 2EOFA 1RMDA 1WJPA 2GHFA 5KL6A 2EMHA 2A25A 1X6FA 2EMYA 2M9AA 2YSPA 2EL6A 2LT7A 1JK2A 1JK1A 1UN6B 2EMLA 1A1GA 2EOOA 3EPKA 2EM0A 4GZNC 1MEYC 2ENHA 2EPAA 3UK3C 2WBUA 2EL4A 4F6NA 2EOEA 2ELYA 2EMKA 2ADRA 1UBDC 2EN2A 2LV2A 2EMGA 2DMIA 1ZR9A 2HGHA 2EM4A 2EOMA 1G2DC 2EN7A 2YTEA 2GLIA 2EOYA 2EPXA 2EM3A 3M99B 2EMXA 2EMCA 1A1JA 2YRHA 2PRTA 1NCSA 2CTDA 2J7JA 2EMFA 1X3CA 2YTJA 5KL3A 2MKDA 2EQ3A 2EMIA 2EJ4A 2EM7A 1TN9A 2D9HA 2EE8A 2EOIA 5KL4A 2EOSA 2EN6A 2EL5A 4FK5C 1DGCA 2EM5A 2DLKA 2LVHA 2YTPA 2EM6A 2YRMA 2LCEA 2YTGA 2YRKA 4IS1C 1X5WA 4R2RA 2YU5A 4R2CA 1BB8A 1A1KA 2R1FA 2EN3A 2EP3A 1X6HA 1KJKA 2YTQA 4F2JC 2JP9A 2RPCA 1TF3A 2EOXA 3VHTB 2ENCA 2RSIA 3EPHA 2MDGA 2DLQA 2EPRA 2EORA 2ENAA 4R2AA 2EN1A 1B69A 4X9JA 2WCC3 1ZAAC 2YU8A
chains in the Genus database with same CATH superfamily
2B3TB 1HNZE 2FGGA 1NEIA 1P47A 5A69A 2EM2A 4JI7E 4LFCE 2YTDA 2HHHE 4M9VC 2EMBA 3T1YE 4KZSA 1X48A 2V88A 3MHSC 4L8NA 2E1MA 2NABA 3C4BA 5IV8B 2E72A 3HXLA 3LLHA 4R2QA 3ADGA 2VRDA 4WFTA 1LLMC 2I13A 4BC7A 4BS9A 1ZBQA 4LU9A 2DGCA 5LL6R 2EPPA 2L33A 5AE3A 2HJJA 2WBSA 1N34E 2L2KB 4LF8E 4F9CB 2GHFA 4DV3E 4DMIA 2M9AA 2EMYA 1UN6B 4LF4E 2EMLA 3ADJA 2EOOA 2KOUA 5FLXC 1MGTA 5LLQA 4F6NA 2ELYA 2EMKA 2EWLA 1UBDC 2E5LE 3J81C 1ZR9A 3VYYA 5AC4A 2LTSA 3J7Yp 3HPZA 2EMCA 3AUZA 4WXDA 1QNTA 4ZYGA 1PJSA 4WXCA 2F4VE 1YYKA 2EJ4A 2EM7A 2EZ6A 4K0KE 2EOIA 5KL4A 2EOSA 1FJGE 3DF6A 1J5EE 1DGCA 5AC5A 2EM6A 2FTXB 2ODRD 4WSPA 2YTGA 3MSWA 3HPSA 4O4KA 4TUGA 4BMJA 2R1FA 4LF7E 4OX9E 1X6HA 4F2JC 3THOB 1GQEA 2EOXA 3ECRA 3LMLA 2V86A 3HQ1A 2JOBA 2MDRA 1N3GA 2RSIA 2M7QA 3EPHA 2MDGA 2EPRA 2Q8UA 2LMZA 4F54A 4YHHE 4DV7E 2EORA 2N3HA 2EN1A 2MC6A 2RS7A 3IWCA 1XMOE 3QG5C 4M30A 1EH6A 5IT9C 1AH5A 4GZNC 2JVAA 4MLVA 2EM8A 1AAYA 4GKKE 1YUJA 2EOQA 4NXME 1O0WA 4R2SA 2LE2A 3BGHA 4JI3E 4JI5E 2WZOA 3H09A 3THNA 4MLQA 4NHRA 3ADIA 5T6JA 2CPNA 4DR4E 3EQ1A 1IQOA 1G2FC 1F2IG 1EH7A 1A1LA 2EPKX 2NA2A 2JYAA 1A1HA 2MKNA 4JI4E 5TSEA 2VQEE 1IBLE 2JPAA 2UXBE 4GKJE 2CSHA 3IWBA 4O24A 1N32E 2EPZA 4HTGA 2JY9A 1DI2A 5IWAE 1WJPA 2K7IA 5KL6A 2EMHA 1WHQA 1X6FA 2A25A 4KWYA 4ZYDA 1WXRA 5CFFE 1MEYC 3VYXA 2EPAA 3UK3C 2EL4A 4DR3E 2DIXA 4JI1E 2L6MA 4P78A 2LUQA 3JU0A 1J26A 2V87A 4OOGC 2UU9E 4LFAE 4N4RB 1PKPA 4ZYEA 2EOYA 4J8ZA 2V85A 3JAMC 4KHPE 2EPOA 2EMXA 2GPIA 2RTXA 1A1JA 3OTOE 2L3JA 3C4TA 3ADLA 2CTDA 2YT4A 2EMFA 1X3CA 3IWDA 2MC5A 2L92A 1T4OA 2RQLA 5ADZA 3DJWA 3P1XA 1WRJA 3VK6A 2YTPA 2V8QB 4M0VA 1T38A 4R2CA 1BB8A 1A1KA 2EN3A 2EP3A 2LJHA 1YFHA 4RH8A 1PJQA 2DB2A 2L8TA 5AASA 2M1SA 5DNYA 4TUIA 2DSYA 4NZVA 2B9DA 1RC7A 4R2AA 1B69A 4X9JA 1YPNA 4DV5E 2HC5A 3T1HE 1YUIA 1EH8A 4X65E 5A2QC 1UHZA 4R2PA 1X6EA 4JI2E 2EPUA 5KL5A 2YTFA 3F6HA 2RS6A 4JV5E 2EOZA 3C6KA 4WSGA 5A6BA 2EPCA 2EMWA 1BBOA 2EQ0A 5A6JA 4DUYE 2LUPB 1HR0E 2V83A 2ELZA 2LO3A 4R2DA 4WPYA 2JOXA 1GZ6A 3KZYA 5KL7A 1IMUA 2B7TA 2L2NA 1PJTA 2EQ1A 2YTIA 2R76A 2EN8A 3EPJA 1ZU1A 3BIDA 2BB8A 1HNXE 2EOFA 1RMDA 4B3SE 2YSPA 2EL6A 4DV0E 1A1GA 2UUBE 4B3TE 3TQMA 2EM0A 4I8OA 3RMPA 5LMNE 3JTZA 4DV4E 4LFBE 3L00A 2WBUA 1HNWE 2EOEA 1IBME 2ODRC 2HGHA 2LV2A 2L2MA 4L5NC 4DR2E 2EM4A 2YPNA 4LTYA 4NXNE 4DR5E 2YTEA 4X8WA 2V89A 3AV0A 2EPXA 1DQ3A 2EM3A 3M99B 4F9BB 4LF5E 2F8BA 2I9IA 4RHBB 4LF6E 2LBSB 2YRHA 2PRTA 1NCSA 5LMUE 3C6MA 2YTJA 3J80C 5KL3A 2MKDA 4R8OA 2EQ3A 2NUFA 3ZOQB 5A6KA 1X47A 4F9AB 2D9HA 2EL5A 2EN6A 4FK5C 2EM5A 2ZM6E 4WX9A 2YRKA 4IS1C 4R2RA 3BBGA 1PDAA 2JWOA 1KJKA 4B3ME 2YTQA 2JP9A 2RPCA 4Q28A 1TF3A 3OMLA 5AE1A 2EPLX 4X64E 3FIGA 2VF1A 4LF9E 4DUZE 3F6GA 5F3WA 1GTKA 5IXMB 1IBKE 2N3GA 5BR8E 4WYQB 2WCC3 4DV2E 1WHNA 4O43A 4DR1E 4IJDA 5KL2A 2DRPA 4R2EA 4GEQB 1A1FA 3BF2A 1L4SA 2WBTA 1A1IA 4BCAA 2EPNA 2YTNA 3KZZA 2EN4A 4BHBA 4DV6E 4F6MA 4X62E 5A6BD 2YTOA 1YZ9A 2NUGA 2EMZA 2EOJA 2KHXA 4HEIA 2UUCE 2EMAA 1XMQE 3EPLA 1YSAC 2YZTA 2BBGA 2CT1A 2EPMX 3MHHC 1YYOA 1TF6A 1X49A 4JI0E 2EOHA 1Z1BA 3HTXA 2JXPA 1N36E 1FKAE 2VE7C 2YSOA 2EM9A 1IQSA 1I94E 4X66E 1JK1A 2UUAE 2LT7A 1JK2A 4R03A 3EPKA 1STUA 4M2ZA 2ENHA 5AE2A 1RQ0A 2H36X 2ADRA 2EN2A 2EMGA 2DMIA 2M4IA 2UXDE 2EOMA 1G2DC 2LJUA 2EN7A 4DKKA 1BBGA 2GLIA 1UILA 2LRSA 2K4VA 1QU6A 2G7HA 4Q35B 4DR6E 1T4NA 2LTRA 4DV1E 2J7JA 2B7VA 1KYQA 2IHR1 1ZBTA 4DR7E 3KWRA 4BBYA 2EMIA 1T4LB 1YYWA 1TN9A 2N8XA 2FV4B 2JR1A 2EE8A 1XNQE 5A6AA 2DLKA 2LVHA 2YRMA 4ZYHA 2LCEA 1X5WA 1SR9A 2YU5A 2NUEA 4B3RE 4P7DA 1SFEA 2RSMA 4JI8E 4YY3E 3J7AG 2YWQA 2UXCE 1T39A 2VQFE 3VHTB 2ENCA 4O5GA 4BHCA 4AQYE 2DLQA 2DMYA 2L3CA 1EKZA 2ENAA 3K6QA 2KONA 4JYAE 4BC9A 4JI6E 1ZAAC 2YU8A 1XNRE 1N33E
chains in the Genus database with same CATH topology
2EM8A 1AAYA 4IJDA 1YUIA 5KL2A 2DRPA 1YUJA 4R2EA 2EOQA 1P47A 4R2PA 1A1FA 4R2SA 1X6EA 2EM2A 2WBTA 2YTDA 2EPUA 5KL5A 2YTFA 4M9VC 2EMBA 1A1IA 2EOZA 4WSGA 2EPCA 2EMWA 1BBOA 2EQ0A 3MHSC 2YTNA 2EN4A 4F6MA 2NABA 2E72A 2YTOA 2EMZA 2EOJA 2ELZA 2LO3A 4R2DA 4R2QA 2VRDA 1G2FC 2EMAA 1LLMC 1F2IG 2I13A 3EPLA 1A1LA 1YSAC 2DGCA 2CT1A 3MHHC 5KL7A 1A1HA 1TF6A 2EPPA 2EQ1A 2MKNA 2YTIA 2EOHA 1Z1BA 2JPAA 2CSHA 2EN8A 3EPJA 1ZU1A 2WBSA 2EPZA 2BB8A 2YSOA 2EM9A 2EOFA 1RMDA 1WJPA 2GHFA 5KL6A 2EMHA 2A25A 1X6FA 2EMYA 2M9AA 2YSPA 2EL6A 2LT7A 1JK2A 1JK1A 1UN6B 2EMLA 1A1GA 2EOOA 3EPKA 2EM0A 4GZNC 1MEYC 2ENHA 2EPAA 3UK3C 2WBUA 2EL4A 4F6NA 2EOEA 2ELYA 2EMKA 2ADRA 1UBDC 2EN2A 2LV2A 2EMGA 2DMIA 1ZR9A 2HGHA 2EM4A 2EOMA 1G2DC 2EN7A 2YTEA 2GLIA 2EOYA 2EPXA 2EM3A 3M99B 2EMXA 2EMCA 1A1JA 2YRHA 2PRTA 1NCSA 2CTDA 2J7JA 2EMFA 1X3CA 2YTJA 5KL3A 2MKDA 2EQ3A 2EMIA 2EJ4A 2EM7A 1TN9A 2D9HA 2EE8A 2EOIA 5KL4A 2EOSA 2EN6A 2EL5A 4FK5C 1DGCA 2EM5A 2DLKA 2LVHA 2YTPA 2EM6A 2YRMA 2LCEA 2YTGA 2YRKA 4IS1C 1X5WA 4R2RA 2YU5A 4R2CA 1BB8A 1A1KA 2R1FA 2EN3A 2EP3A 1X6HA 1KJKA 2YTQA 4F2JC 2JP9A 2RPCA 1TF3A 2EOXA 3VHTB 2ENCA 2RSIA 3EPHA 2MDGA 2DLQA 2EPRA 2EORA 2ENAA 4R2AA 2EN1A 1B69A 4X9JA 2WCC3 1ZAAC 2YU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM8 A;  1AAY A;  4IJD A;  1YUI A;  5KL2 A;  2DRP A;  1YUJ A;  4R2E A;  2EOQ A;  1P47 A;  4R2P A;  1A1F A;  4R2S A;  1X6E A;  2EM2 A;  2WBT A;  2YTD A;  2EPU A;  5KL5 A;  2YTF A;  4M9V C;  2EMB A;  1A1I A;  2EOZ A;  4WSG A;  2EPC A;  2EMW A;  1BBO A;  2EQ0 A;  3MHS C;  2YTN A;  2EN4 A;  4F6M A;  2NAB A;  2E72 A;  2YTO A;  2EMZ A;  2EOJ A;  2ELZ A;  2LO3 A;  4R2D A;  4R2Q A;  2VRD A;  1G2F C;  2EMA A;  1LLM C;  1F2I G;  2I13 A;  3EPL A;  1A1L A;  1YSA C;  2DGC A;  2CT1 A;  3MHH C;  5KL7 A;  1A1H A;  1TF6 A;  2EPP A;  2EQ1 A;  2MKN A;  2YTI A;  2EOH A;  1Z1B A;  2JPA A;  2CSH A;  2EN8 A;  3EPJ A;  1ZU1 A;  2WBS A;  2EPZ A;  2BB8 A;  2YSO A;  2EM9 A;  2EOF A;  1RMD A;  1WJP A;  2GHF A;  5KL6 A;  2EMH A;  2A25 A;  1X6F A;  2EMY A;  2M9A A;  2YSP A;  2EL6 A;  2LT7 A;  1JK2 A;  1JK1 A;  1UN6 B;  2EML A;  1A1G A;  2EOO A;  3EPK A;  2EM0 A;  4GZN C;  1MEY C;  2ENH A;  2EPA A;  3UK3 C;  2WBU A;  2EL4 A;  4F6N A;  2EOE A;  2ELY A;  2EMK A;  2ADR A;  1UBD C;  2EN2 A;  2LV2 A;  2EMG A;  2DMI A;  1ZR9 A;  2HGH A;  2EM4 A;  2EOM A;  1G2D C;  2EN7 A;  2YTE A;  2GLI A;  2EOY A;  2EPX A;  2EM3 A;  3M99 B;  2EMX A;  2EMC A;  1A1J A;  2YRH A;  2PRT A;  1NCS A;  2CTD A;  2J7J A;  2EMF A;  1X3C A;  2YTJ A;  5KL3 A;  2MKD A;  2EQ3 A;  2EMI A;  2EJ4 A;  2EM7 A;  1TN9 A;  2D9H A;  2EE8 A;  2EOI A;  5KL4 A;  2EOS A;  2EN6 A;  2EL5 A;  4FK5 C;  1DGC A;  2EM5 A;  2DLK A;  2LVH A;  2YTP A;  2EM6 A;  2YRM A;  2LCE A;  2YTG A;  2YRK A;  4IS1 C;  1X5W A;  4R2R A;  2YU5 A;  4R2C A;  1BB8 A;  1A1K A;  2R1F A;  2EN3 A;  2EP3 A;  1X6H A;  1KJK A;  2YTQ A;  4F2J C;  2JP9 A;  2RPC A;  1TF3 A;  2EOX A;  3VHT B;  2ENC A;  2RSI A;  3EPH A;  2MDG A;  2DLQ A;  2EPR A;  2EOR A;  2ENA A;  4R2A A;  2EN1 A;  1B69 A;  4X9J A;  2WCC 3;  1ZAA C;  2YU8 A; 
#chains in the Genus database with same CATH topology
 2B3T B;  1HNZ E;  2FGG A;  1NEI A;  1P47 A;  5A69 A;  2EM2 A;  4JI7 E;  4LFC E;  2YTD A;  2HHH E;  4M9V C;  2EMB A;  3T1Y E;  4KZS A;  1X48 A;  2V88 A;  3MHS C;  4L8N A;  2E1M A;  2NAB A;  3C4B A;  5IV8 B;  2E72 A;  3HXL A;  3LLH A;  4R2Q A;  3ADG A;  2VRD A;  4WFT A;  1LLM C;  2I13 A;  4BC7 A;  4BS9 A;  1ZBQ A;  4LU9 A;  2DGC A;  5LL6 R;  2EPP A;  2L33 A;  5AE3 A;  2HJJ A;  2WBS A;  1N34 E;  2L2K B;  4LF8 E;  4F9C B;  2GHF A;  4DV3 E;  4DMI A;  2M9A A;  2EMY A;  1UN6 B;  4LF4 E;  2EML A;  3ADJ A;  2EOO A;  2KOU A;  5FLX C;  1MGT A;  5LLQ A;  4F6N A;  2ELY A;  2EMK A;  2EWL A;  1UBD C;  2E5L E;  3J81 C;  1ZR9 A;  3VYY A;  5AC4 A;  2LTS A;  3J7Y p;  3HPZ A;  2EMC A;  3AUZ A;  4WXD A;  1QNT A;  4ZYG A;  1PJS A;  4WXC A;  2F4V E;  1YYK A;  2EJ4 A;  2EM7 A;  2EZ6 A;  4K0K E;  2EOI A;  5KL4 A;  2EOS A;  1FJG E;  3DF6 A;  1J5E E;  1DGC A;  5AC5 A;  2EM6 A;  2FTX B;  2ODR D;  4WSP A;  2YTG A;  3MSW A;  3HPS A;  4O4K A;  4TUG A;  4BMJ A;  2R1F A;  4LF7 E;  4OX9 E;  1X6H A;  4F2J C;  3THO B;  1GQE A;  2EOX A;  3ECR A;  3LML A;  2V86 A;  3HQ1 A;  2JOB A;  2MDR A;  1N3G A;  2RSI A;  2M7Q A;  3EPH A;  2MDG A;  2EPR A;  2Q8U A;  2LMZ A;  4F54 A;  4YHH E;  4DV7 E;  2EOR A;  2N3H A;  2EN1 A;  2MC6 A;  2RS7 A;  3IWC A;  1XMO E;  3QG5 C;  4M30 A;  1EH6 A;  5IT9 C;  1AH5 A;  4GZN C;  2JVA A;  4MLV A;  2EM8 A;  1AAY A;  4GKK E;  1YUJ A;  2EOQ A;  4NXM E;  1O0W A;  4R2S A;  2LE2 A;  3BGH A;  4JI3 E;  4JI5 E;  2WZO A;  3H09 A;  3THN A;  4MLQ A;  4NHR A;  3ADI A;  5T6J A;  2CPN A;  4DR4 E;  3EQ1 A;  1IQO A;  1G2F C;  1F2I G;  1EH7 A;  1A1L A;  2EPK X;  2NA2 A;  2JYA A;  1A1H A;  2MKN A;  4JI4 E;  5TSE A;  2VQE E;  1IBL E;  2JPA A;  2UXB E;  4GKJ E;  2CSH A;  3IWB A;  4O24 A;  1N32 E;  2EPZ A;  4HTG A;  2JY9 A;  1DI2 A;  5IWA E;  1WJP A;  2K7I A;  5KL6 A;  2EMH A;  1WHQ A;  1X6F A;  2A25 A;  4KWY A;  4ZYD A;  1WXR A;  5CFF E;  1MEY C;  3VYX A;  2EPA A;  3UK3 C;  2EL4 A;  4DR3 E;  2DIX A;  4JI1 E;  2L6M A;  4P78 A;  2LUQ A;  3JU0 A;  1J26 A;  2V87 A;  4OOG C;  2UU9 E;  4LFA E;  4N4R B;  1PKP A;  4ZYE A;  2EOY A;  4J8Z A;  2V85 A;  3JAM C;  4KHP E;  2EPO A;  2EMX A;  2GPI A;  2RTX A;  1A1J A;  3OTO E;  2L3J A;  3C4T A;  3ADL A;  2CTD A;  2YT4 A;  2EMF A;  1X3C A;  3IWD A;  2MC5 A;  2L92 A;  1T4O A;  2RQL A;  5ADZ A;  3DJW A;  3P1X A;  1WRJ A;  3VK6 A;  2YTP A;  2V8Q B;  4M0V A;  1T38 A;  4R2C A;  1BB8 A;  1A1K A;  2EN3 A;  2EP3 A;  2LJH A;  1YFH A;  4RH8 A;  1PJQ A;  2DB2 A;  2L8T A;  5AAS A;  2M1S A;  5DNY A;  4TUI A;  2DSY A;  4NZV A;  2B9D A;  1RC7 A;  4R2A A;  1B69 A;  4X9J A;  1YPN A;  4DV5 E;  2HC5 A;  3T1H E;  1YUI A;  1EH8 A;  4X65 E;  5A2Q C;  1UHZ A;  4R2P A;  1X6E A;  4JI2 E;  2EPU A;  5KL5 A;  2YTF A;  3F6H A;  2RS6 A;  4JV5 E;  2EOZ A;  3C6K A;  4WSG A;  5A6B A;  2EPC A;  2EMW A;  1BBO A;  2EQ0 A;  5A6J A;  4DUY E;  2LUP B;  1HR0 E;  2V83 A;  2ELZ A;  2LO3 A;  4R2D A;  4WPY A;  2JOX A;  1GZ6 A;  3KZY A;  5KL7 A;  1IMU A;  2B7T A;  2L2N A;  1PJT A;  2EQ1 A;  2YTI A;  2R76 A;  2EN8 A;  3EPJ A;  1ZU1 A;  3BID A;  2BB8 A;  1HNX E;  2EOF A;  1RMD A;  4B3S E;  2YSP A;  2EL6 A;  4DV0 E;  1A1G A;  2UUB E;  4B3T E;  3TQM A;  2EM0 A;  4I8O A;  3RMP A;  5LMN E;  3JTZ A;  4DV4 E;  4LFB E;  3L00 A;  2WBU A;  1HNW E;  2EOE A;  1IBM E;  2ODR C;  2HGH A;  2LV2 A;  2L2M A;  4L5N C;  4DR2 E;  2EM4 A;  2YPN A;  4LTY A;  4NXN E;  4DR5 E;  2YTE A;  4X8W A;  2V89 A;  3AV0 A;  2EPX A;  1DQ3 A;  2EM3 A;  3M99 B;  4F9B B;  4LF5 E;  2F8B A;  2I9I A;  4RHB B;  4LF6 E;  2LBS B;  2YRH A;  2PRT A;  1NCS A;  5LMU E;  3C6M A;  2YTJ A;  3J80 C;  5KL3 A;  2MKD A;  4R8O A;  2EQ3 A;  2NUF A;  3ZOQ B;  5A6K A;  1X47 A;  4F9A B;  2D9H A;  2EL5 A;  2EN6 A;  4FK5 C;  2EM5 A;  2ZM6 E;  4WX9 A;  2YRK A;  4IS1 C;  4R2R A;  3BBG A;  1PDA A;  2JWO A;  1KJK A;  4B3M E;  2YTQ A;  2JP9 A;  2RPC A;  4Q28 A;  1TF3 A;  3OML A;  5AE1 A;  2EPL X;  4X64 E;  3FIG A;  2VF1 A;  4LF9 E;  4DUZ E;  3F6G A;  5F3W A;  1GTK A;  5IXM B;  1IBK E;  2N3G A;  5BR8 E;  4WYQ B;  2WCC 3;  4DV2 E;  1WHN A;  4O43 A;  4DR1 E;  4IJD A;  5KL2 A;  2DRP A;  4R2E A;  4GEQ B;  1A1F A;  3BF2 A;  1L4S A;  2WBT A;  1A1I A;  4BCA A;  2EPN A;  2YTN A;  3KZZ A;  2EN4 A;  4BHB A;  4DV6 E;  4F6M A;  4X62 E;  5A6B D;  2YTO A;  1YZ9 A;  2NUG A;  2EMZ A;  2EOJ A;  2KHX A;  4HEI A;  2UUC E;  2EMA A;  1XMQ E;  3EPL A;  1YSA C;  2YZT A;  2BBG A;  2CT1 A;  2EPM X;  3MHH C;  1YYO A;  1TF6 A;  1X49 A;  4JI0 E;  2EOH A;  1Z1B A;  3HTX A;  2JXP A;  1N36 E;  1FKA E;  2VE7 C;  2YSO A;  2EM9 A;  1IQS A;  1I94 E;  4X66 E;  1JK1 A;  2UUA E;  2LT7 A;  1JK2 A;  4R03 A;  3EPK A;  1STU A;  4M2Z A;  2ENH A;  5AE2 A;  1RQ0 A;  2H36 X;  2ADR A;  2EN2 A;  2EMG A;  2DMI A;  2M4I A;  2UXD E;  2EOM A;  1G2D C;  2LJU A;  2EN7 A;  4DKK A;  1BBG A;  2GLI A;  1UIL A;  2LRS A;  2K4V A;  1QU6 A;  2G7H A;  4Q35 B;  4DR6 E;  1T4N A;  2LTR A;  4DV1 E;  2J7J A;  2B7V A;  1KYQ A;  2IHR 1;  1ZBT A;  4DR7 E;  3KWR A;  4BBY A;  2EMI A;  1T4L B;  1YYW A;  1TN9 A;  2N8X A;  2FV4 B;  2JR1 A;  2EE8 A;  1XNQ E;  5A6A A;  2DLK A;  2LVH A;  2YRM A;  4ZYH A;  2LCE A;  1X5W A;  1SR9 A;  2YU5 A;  2NUE A;  4B3R E;  4P7D A;  1SFE A;  2RSM A;  4JI8 E;  4YY3 E;  3J7A G;  2YWQ A;  2UXC E;  1T39 A;  2VQF E;  3VHT B;  2ENC A;  4O5G A;  4BHC A;  4AQY E;  2DLQ A;  2DMY A;  2L3C A;  1EKZ A;  2ENA A;  3K6Q A;  2KON A;  4JYA E;  4BC9 A;  4JI6 E;  1ZAA C;  2YU8 A;  1XNR E;  1N33 E; 
#chains in the Genus database with same CATH homology
 2EM8 A;  1AAY A;  4IJD A;  1YUI A;  5KL2 A;  2DRP A;  1YUJ A;  4R2E A;  2EOQ A;  1P47 A;  4R2P A;  1A1F A;  4R2S A;  1X6E A;  2EM2 A;  2WBT A;  2YTD A;  2EPU A;  5KL5 A;  2YTF A;  4M9V C;  2EMB A;  1A1I A;  2EOZ A;  4WSG A;  2EPC A;  2EMW A;  1BBO A;  2EQ0 A;  3MHS C;  2YTN A;  2EN4 A;  4F6M A;  2NAB A;  2E72 A;  2YTO A;  2EMZ A;  2EOJ A;  2ELZ A;  2LO3 A;  4R2D A;  4R2Q A;  2VRD A;  1G2F C;  2EMA A;  1LLM C;  1F2I G;  2I13 A;  3EPL A;  1A1L A;  1YSA C;  2DGC A;  2CT1 A;  3MHH C;  5KL7 A;  1A1H A;  1TF6 A;  2EPP A;  2EQ1 A;  2MKN A;  2YTI A;  2EOH A;  1Z1B A;  2JPA A;  2CSH A;  2EN8 A;  3EPJ A;  1ZU1 A;  2WBS A;  2EPZ A;  2BB8 A;  2YSO A;  2EM9 A;  2EOF A;  1RMD A;  1WJP A;  2GHF A;  5KL6 A;  2EMH A;  2A25 A;  1X6F A;  2EMY A;  2M9A A;  2YSP A;  2EL6 A;  2LT7 A;  1JK2 A;  1JK1 A;  1UN6 B;  2EML A;  1A1G A;  2EOO A;  3EPK A;  2EM0 A;  4GZN C;  1MEY C;  2ENH A;  2EPA A;  3UK3 C;  2WBU A;  2EL4 A;  4F6N A;  2EOE A;  2ELY A;  2EMK A;  2ADR A;  1UBD C;  2EN2 A;  2LV2 A;  2EMG A;  2DMI A;  1ZR9 A;  2HGH A;  2EM4 A;  2EOM A;  1G2D C;  2EN7 A;  2YTE A;  2GLI A;  2EOY A;  2EPX A;  2EM3 A;  3M99 B;  2EMX A;  2EMC A;  1A1J A;  2YRH A;  2PRT A;  1NCS A;  2CTD A;  2J7J A;  2EMF A;  1X3C A;  2YTJ A;  5KL3 A;  2MKD A;  2EQ3 A;  2EMI A;  2EJ4 A;  2EM7 A;  1TN9 A;  2D9H A;  2EE8 A;  2EOI A;  5KL4 A;  2EOS A;  2EN6 A;  2EL5 A;  4FK5 C;  1DGC A;  2EM5 A;  2DLK A;  2LVH A;  2YTP A;  2EM6 A;  2YRM A;  2LCE A;  2YTG A;  2YRK A;  4IS1 C;  1X5W A;  4R2R A;  2YU5 A;  4R2C A;  1BB8 A;  1A1K A;  2R1F A;  2EN3 A;  2EP3 A;  1X6H A;  1KJK A;  2YTQ A;  4F2J C;  2JP9 A;  2RPC A;  1TF3 A;  2EOX A;  3VHT B;  2ENC A;  2RSI A;  3EPH A;  2MDG A;  2DLQ A;  2EPR A;  2EOR A;  2ENA A;  4R2A A;  2EN1 A;  1B69 A;  4X9J A;  2WCC 3;  1ZAA C;  2YU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...