2EP3A

Solution structure of the c2h2 type zinc finger (region 631-663) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 631-663) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ep3A01
2EPXA 2EMCA 2YTGA 4IJDA 2EMGA 2WBTA 4R2CA 1YSAC 2J7JA 2WCC3 1YUJA 2EMIA 2CSHA 2DLKA 2EM3A 2EOOA 4WSGA 2EM8A 2EMXA 1ZR9A 2YRKA 2JP9A 1A1KA 1MEYC 2EN2A 3VHTB 2EQ1A 1TN9A 2EM0A 2EMFA 2YTEA 4R2PA 2DRPA 2EOQA 4X9JA 1BBOA 1A1LA 2EL5A 2YTOA 2RPCA 2YU8A 4IS1C 2EL6A 2CTDA 2EMYA 1X5WA 2R1FA 3M99B 4GZNC 3UK3C 2EOXA 4R2RA 2EQ3A 3MHHC 1LLMC 2EPCA 2EOHA 2EPUA 2EORA 2EMHA 2HGHA 1AAYA 2YTQA 2DLQA 2EN6A 1A1HA 4M9VC 2EN1A 2YTIA 5KL5A 2DMIA 2WBSA 2PRTA 2EN7A 1X6FA 4F6MA 2MKNA 1ZU1A 2EMZA 1A1JA 2EN4A 5KL7A 2YTFA 1G2FC 1A1IA 2WBUA 3EPHA 4R2QA 2ELZA 1X6EA 2EOEA 2LO3A 3MHSC 2ENAA 2NABA 3EPLA 2VRDA 2EOIA 2EPZA 2LT7A 1BB8A 2EE8A 2EN3A 2D9HA 2LVHA 1ZAAC 1A1GA 1KJKA 2YSPA 2EMLA 2YTDA 2ELYA 2EPAA 3EPKA 2ADRA 2EL4A 5KL4A 2ENHA 2BB8A 2EM5A 2EOSA 2EN8A 1TF6A 2EOJA 1X6HA 1B69A 5KL3A 2EOFA 2EOYA 2EOZA 4F2JC 2GLIA 2YRHA 1UBDC 2M9AA 2YTJA 1JK1A 4R2DA 2E72A 2A25A 2EM6A 2LCEA 1JK2A 2EPRA 1RMDA 1G2DC 1TF3A 2MKDA 1X3CA 4R2EA 2YTNA 2EMAA 2YSOA 1YUIA 2EMBA 2EOMA 2EM7A 4R2AA 4F6NA 1Z1BA 2MDGA 1P47A 2EM2A 2EPPA 2RSIA 2EM4A 1NCSA 2JPAA 2YTPA 2DGCA 2EP3A 5KL6A 5KL2A 1A1FA 1F2IG 2EM9A 1UN6B 1WJPA 2EJ4A 2EMKA 2EMWA 2LV2A 2I13A 2CT1A 2ENCA 4R2SA 2GHFA 2YU5A 2EQ0A 2YRMA 1DGCA 3EPJA 4FK5C
chains in the Genus database with same CATH superfamily
2YTGA 2HHHE 4LF9E 3HPZA 2LTRA 2J7JA 2VF1A 4JI4E 4DR1E 2UUBE 3ADLA 5CFFE 3J81C 5AC5A 2DB2A 1A1KA 3VHTB 2EQ1A 1TN9A 3OMLA 2UXBE 2EMFA 2EOQA 4M2ZA 1PJQA 2UUAE 2CTDA 5BR8E 2L6MA 3UK3C 2FGGA 2EOXA 3MHHC 5IV8B 1LLMC 2EOHA 1ZBQA 4KHPE 1WXRA 2EPUA 1T39A 5LMUE 4J8ZA 2EMHA 1AAYA 2DLQA 2EN6A 2YT4A 2EN1A 4DV1E 3RMPA 4BHBA 5LL6R 4DKKA 2YWQA 2PRTA 2MDRA 1X6FA 5A6KA 2EMZA 3F6GA 1G2FC 1A1IA 3MSWA 5A6BD 4R2QA 3ADJA 4GEQB 1X6EA 1YYOA 2LO3A 2LTSA 4RH8A 3MHSC 2LRSA 1J26A 3EPLA 4KZSA 2VRDA 2Q8UA 2LT7A 4F9AB 1BBGA 4DV0E 2ADRA 1DI2A 2JOXA 2EL4A 2LE2A 2BBGA 4NHRA 4OOGC 4DV5E 2EM5A 2EOSA 5AE3A 3ECRA 1T38A 1FKAE 1IQSA 2EOJA 3LLHA 1X6HA 4DR5E 1GZ6A 4BC9A 4WXCA 4DR6E 3THOB 3OTOE 2GLIA 4X65E 4DV7E 1AH5A 2B3TB 5LMNE 2EM6A 2LCEA 1JK2A 1G2DC 1X3CA 1PJSA 5AE1A 2JWOA 2EPLX 4ZYEA 1Z1BA 3T1YE 2E5LE 5AE2A 2EM2A 3DF6A 2K7IA 2JVAA 4P78A 4DUYE 4RHBB 2JPAA 4LF7E 2EP3A 5KL6A 1F2IG 1YPNA 2V83A 1N3GA 1EH7A 3L00A 4JI8E 4B3TE 2EMWA 2LMZA 2N8XA 2CT1A 2ENCA 1RQ0A 3VK6A 1X48A 4K0KE 5A6BA 2JOBA 2EMCA 3F6HA 2WBTA 1YSAC 3KWRA 1YUJA 2EMIA 2CSHA 1HR0E 1STUA 2DLKA 4WSGA 4YHHE 2EMXA 4JI3E 3C4TA 2DIXA 4WPYA 2YRKA 3HXLA 1MEYC 3BGHA 5A2QC 4LFAE 2DRPA 4F9BB 4WYQB 4X9JA 3VYXA 4MLVA 1X49A 3J7AG 5A69A 4IS1C 3LMLA 1IBLE 2R76A 1XNRE 2EPCA 4M30A 4N4RB 2JR1A 2L2KB 2LJUA 5KL5A 2DMIA 2WBSA 2LBSB 2V85A 2EN7A 1YFHA 4F6MA 2MKNA 5KL7A 2UU9E 3EPHA 2WBUA 4GKJE 1J5EE 4WSPA 4L5NC 2ODRC 2ELZA 2EZ6A 2V89A 3BF2A 1SR9A 4LF5E 2RS7A 2EOIA 3BBGA 2EE8A 1UHZA 2DSYA 2RS6A 2LVHA 3KZZA 4JI0E 2YPNA 4KWYA 2YTDA 2N3GA 5ADZA 3ZOQB 3EQ1A 3IWDA 2EPAA 2HJJA 2H36X 4TUIA 1N33E 1O0WA 5AASA 1FJGE 5FLXC 1XMQE 5AC4A 3BIDA 2LUPB 2EOYA 3HQ1A 2F4VE 2M7QA 2NUGA 1HNXE 2YTJA 1JK1A 2UXDE 4R2DA 2E72A 2A25A 4NXNE 1RMDA 2LJHA 3HPSA 2YTNA 2EM7A 4R2AA 2MDGA 5DNYA 3QG5C 2EPMX 3ADIA 2L2MA 1KYQA 4NZVA 2EJ4A 3VYYA 1WHQA 2LV2A 3AUZA 2YU5A 1I94E 2YRMA 4DV2E 4FK5C 4BHCA 3T1HE 1IBME 2EPXA 2EMGA 4R2CA 3JAMC 2EM3A 2IHR1 4YY3E 4X64E 1SFEA 1N36E 2EM8A 5IT9C 1PKPA 1ZR9A 2L33A 2JP9A 1IQOA 2EN2A 2VQEE 2EM0A 4LTYA 2YTEA 4R2PA 4DV4E 1BBOA 1N34E 2RPCA 2YU8A 4JI7E 2EL6A 2V86A 2EMYA 1X5WA 2R1FA 4B3ME 2NUEA 3IWBA 3K6QA 2I9IA 4X66E 1T4OA 1QNTA 4DR2E 1X47A 5TSEA 4R8OA 2L8TA 4DR7E 2M1SA 4LF8E 2EWLA 4M0VA 2VE7C 1A1JA 2EN4A 3H09A 2YTFA 4WFTA 4DV6E 3J7Yp 2G7HA 2HC5A 4GKKE 2ENAA 1WHNA 1EH8A 2EPZA 4B3SE 1HNWE 1MGTA 4JV5E 1IMUA 5LLQA 1YYKA 1A1GA 2EMLA 2V88A 4I8OA 4BC7A 2ELYA 2WZOA 2EPKX 2EPNA 5KL4A 2EN8A 4L8NA 2DMYA 2GPIA 3JTZA 2UXCE 1EH6A 3JU0A 4DUZE 4ZYDA 2YRHA 4R03A 1UBDC 4JI5E 2RTXA 2KONA 4BS9A 4O43A 2B7TA 2CPNA 2JY9A 2KOUA 4B3RE 1TF3A 2EMAA 2YSOA 1YUIA 4O5GA 2ZM6E 2MC5A 1HNZE 3DJWA 2RSIA 2L92A 2EM4A 2YTPA 2DGCA 4O24A 3C4BA 1N32E 5KL2A 1ZBTA 1UN6B 4P7DA 4DR3E 4R2SA 2GHFA 4BBYA 1PDAA 2EQ0A 4JYAE 2M4IA 3FIGA 3ADGA 2FTXB 1PJTA 5F3WA 4LFCE 2VQFE 2F8BA 2UUCE 1XMOE 4IJDA 2WCC3 4LU9A 2EOOA 2KHXA 1T4NA 2NA2A 4HEIA 2L2NA 1YYWA 3C6KA 4JI2E 1UILA 4LF4E 3HTXA 2V8QB 1A1LA 2EL5A 2YTOA 5A6JA 4LFBE 5IXMB 2V87A 4O4KA 4GZNC 3M99B 4R2RA 2EQ3A 4X62E 3THNA 2EORA 4JI6E 2HGHA 4AQYE 2YTQA 1A1HA 2RQLA 4M9VC 1GTKA 1XNQE 2YTIA 2RSMA 4DMIA 2E1MA 1ZU1A 2JXPA 1L4SA 4JI1E 1WRJA 4LF6E 3P1XA 4OX9E 4ZYHA 1IBKE 2EOEA 4BMJA 4MLQA 4BCAA 1NEIA 2NABA 1DQ3A 1BB8A 2EN3A 2MC6A 2N3HA 2D9HA 2B7VA 1ZAAC 1KJKA 1T4LB 2YSPA 5T6JA 1EKZA 3EPKA 2FV4B 2EPOA 4X8WA 2ENHA 2BB8A 5A6AA 4WX9A 1TF6A 3J80C 1B69A 2L3JA 4HTGA 5KL3A 4DR4E 2EOFA 2K4VA 3AV0A 2EOZA 4F2JC 3C6MA 2M9AA 4F9CB 1GQEA 3IWCA 3KZYA 3TQMA 2EPRA 4TUGA 2ODRD 2MKDA 2JYAA 4R2EA 5IWAE 2EMBA 2EOMA 4F6NA 2B9DA 4Q28A 1P47A 4WXDA 2EPPA 4DV3E 1NCSA 4F54A 2YZTA 1A1FA 4NXME 2EM9A 2NUFA 1WJPA 2EMKA 1RC7A 1YZ9A 2I13A 2L3CA 4Q35B 1QU6A 1DGCA 3EPJA 2LUQA 4ZYGA
chains in the Genus database with same CATH topology
2EPXA 2EMCA 2YTGA 4IJDA 2EMGA 2WBTA 4R2CA 1YSAC 2J7JA 2WCC3 1YUJA 2EMIA 2CSHA 2DLKA 2EM3A 2EOOA 4WSGA 2EM8A 2EMXA 1ZR9A 2YRKA 2JP9A 1A1KA 1MEYC 2EN2A 3VHTB 2EQ1A 1TN9A 2EM0A 2EMFA 2YTEA 4R2PA 2DRPA 2EOQA 4X9JA 1BBOA 1A1LA 2EL5A 2YTOA 2RPCA 2YU8A 4IS1C 2EL6A 2CTDA 2EMYA 1X5WA 2R1FA 3M99B 4GZNC 3UK3C 2EOXA 4R2RA 2EQ3A 3MHHC 1LLMC 2EPCA 2EOHA 2EPUA 2EORA 2EMHA 2HGHA 1AAYA 2YTQA 2DLQA 2EN6A 1A1HA 4M9VC 2EN1A 2YTIA 5KL5A 2DMIA 2WBSA 2PRTA 2EN7A 1X6FA 4F6MA 2MKNA 1ZU1A 2EMZA 1A1JA 2EN4A 5KL7A 2YTFA 1G2FC 1A1IA 2WBUA 3EPHA 4R2QA 2ELZA 1X6EA 2EOEA 2LO3A 3MHSC 2ENAA 2NABA 3EPLA 2VRDA 2EOIA 2EPZA 2LT7A 1BB8A 2EE8A 2EN3A 2D9HA 2LVHA 1ZAAC 1A1GA 1KJKA 2YSPA 2EMLA 2YTDA 2ELYA 2EPAA 3EPKA 2ADRA 2EL4A 5KL4A 2ENHA 2BB8A 2EM5A 2EOSA 2EN8A 1TF6A 2EOJA 1X6HA 1B69A 5KL3A 2EOFA 2EOYA 2EOZA 4F2JC 2GLIA 2YRHA 1UBDC 2M9AA 2YTJA 1JK1A 4R2DA 2E72A 2A25A 2EM6A 2LCEA 1JK2A 2EPRA 1RMDA 1G2DC 1TF3A 2MKDA 1X3CA 4R2EA 2YTNA 2EMAA 2YSOA 1YUIA 2EMBA 2EOMA 2EM7A 4R2AA 4F6NA 1Z1BA 2MDGA 1P47A 2EM2A 2EPPA 2RSIA 2EM4A 1NCSA 2JPAA 2YTPA 2DGCA 2EP3A 5KL6A 5KL2A 1A1FA 1F2IG 2EM9A 1UN6B 1WJPA 2EJ4A 2EMKA 2EMWA 2LV2A 2I13A 2CT1A 2ENCA 4R2SA 2GHFA 2YU5A 2EQ0A 2YRMA 1DGCA 3EPJA 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPX A;  2EMC A;  2YTG A;  4IJD A;  2EMG A;  2WBT A;  4R2C A;  1YSA C;  2J7J A;  2WCC 3;  1YUJ A;  2EMI A;  2CSH A;  2DLK A;  2EM3 A;  2EOO A;  4WSG A;  2EM8 A;  2EMX A;  1ZR9 A;  2YRK A;  2JP9 A;  1A1K A;  1MEY C;  2EN2 A;  3VHT B;  2EQ1 A;  1TN9 A;  2EM0 A;  2EMF A;  2YTE A;  4R2P A;  2DRP A;  2EOQ A;  4X9J A;  1BBO A;  1A1L A;  2EL5 A;  2YTO A;  2RPC A;  2YU8 A;  4IS1 C;  2EL6 A;  2CTD A;  2EMY A;  1X5W A;  2R1F A;  3M99 B;  4GZN C;  3UK3 C;  2EOX A;  4R2R A;  2EQ3 A;  3MHH C;  1LLM C;  2EPC A;  2EOH A;  2EPU A;  2EOR A;  2EMH A;  2HGH A;  1AAY A;  2YTQ A;  2DLQ A;  2EN6 A;  1A1H A;  4M9V C;  2EN1 A;  2YTI A;  5KL5 A;  2DMI A;  2WBS A;  2PRT A;  2EN7 A;  1X6F A;  4F6M A;  2MKN A;  1ZU1 A;  2EMZ A;  1A1J A;  2EN4 A;  5KL7 A;  2YTF A;  1G2F C;  1A1I A;  2WBU A;  3EPH A;  4R2Q A;  2ELZ A;  1X6E A;  2EOE A;  2LO3 A;  3MHS C;  2ENA A;  2NAB A;  3EPL A;  2VRD A;  2EOI A;  2EPZ A;  2LT7 A;  1BB8 A;  2EE8 A;  2EN3 A;  2D9H A;  2LVH A;  1ZAA C;  1A1G A;  1KJK A;  2YSP A;  2EML A;  2YTD A;  2ELY A;  2EPA A;  3EPK A;  2ADR A;  2EL4 A;  5KL4 A;  2ENH A;  2BB8 A;  2EM5 A;  2EOS A;  2EN8 A;  1TF6 A;  2EOJ A;  1X6H A;  1B69 A;  5KL3 A;  2EOF A;  2EOY A;  2EOZ A;  4F2J C;  2GLI A;  2YRH A;  1UBD C;  2M9A A;  2YTJ A;  1JK1 A;  4R2D A;  2E72 A;  2A25 A;  2EM6 A;  2LCE A;  1JK2 A;  2EPR A;  1RMD A;  1G2D C;  1TF3 A;  2MKD A;  1X3C A;  4R2E A;  2YTN A;  2EMA A;  2YSO A;  1YUI A;  2EMB A;  2EOM A;  2EM7 A;  4R2A A;  4F6N A;  1Z1B A;  2MDG A;  1P47 A;  2EM2 A;  2EPP A;  2RSI A;  2EM4 A;  1NCS A;  2JPA A;  2YTP A;  2DGC A;  2EP3 A;  5KL6 A;  5KL2 A;  1A1F A;  1F2I G;  2EM9 A;  1UN6 B;  1WJP A;  2EJ4 A;  2EMK A;  2EMW A;  2LV2 A;  2I13 A;  2CT1 A;  2ENC A;  4R2S A;  2GHF A;  2YU5 A;  2EQ0 A;  2YRM A;  1DGC A;  3EPJ A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 2YTG A;  2HHH E;  4LF9 E;  3HPZ A;  2LTR A;  2J7J A;  2VF1 A;  4JI4 E;  4DR1 E;  2UUB E;  3ADL A;  5CFF E;  3J81 C;  5AC5 A;  2DB2 A;  1A1K A;  3VHT B;  2EQ1 A;  1TN9 A;  3OML A;  2UXB E;  2EMF A;  2EOQ A;  4M2Z A;  1PJQ A;  2UUA E;  2CTD A;  5BR8 E;  2L6M A;  3UK3 C;  2FGG A;  2EOX A;  3MHH C;  5IV8 B;  1LLM C;  2EOH A;  1ZBQ A;  4KHP E;  1WXR A;  2EPU A;  1T39 A;  5LMU E;  4J8Z A;  2EMH A;  1AAY A;  2DLQ A;  2EN6 A;  2YT4 A;  2EN1 A;  4DV1 E;  3RMP A;  4BHB A;  5LL6 R;  4DKK A;  2YWQ A;  2PRT A;  2MDR A;  1X6F A;  5A6K A;  2EMZ A;  3F6G A;  1G2F C;  1A1I A;  3MSW A;  5A6B D;  4R2Q A;  3ADJ A;  4GEQ B;  1X6E A;  1YYO A;  2LO3 A;  2LTS A;  4RH8 A;  3MHS C;  2LRS A;  1J26 A;  3EPL A;  4KZS A;  2VRD A;  2Q8U A;  2LT7 A;  4F9A B;  1BBG A;  4DV0 E;  2ADR A;  1DI2 A;  2JOX A;  2EL4 A;  2LE2 A;  2BBG A;  4NHR A;  4OOG C;  4DV5 E;  2EM5 A;  2EOS A;  5AE3 A;  3ECR A;  1T38 A;  1FKA E;  1IQS A;  2EOJ A;  3LLH A;  1X6H A;  4DR5 E;  1GZ6 A;  4BC9 A;  4WXC A;  4DR6 E;  3THO B;  3OTO E;  2GLI A;  4X65 E;  4DV7 E;  1AH5 A;  2B3T B;  5LMN E;  2EM6 A;  2LCE A;  1JK2 A;  1G2D C;  1X3C A;  1PJS A;  5AE1 A;  2JWO A;  2EPL X;  4ZYE A;  1Z1B A;  3T1Y E;  2E5L E;  5AE2 A;  2EM2 A;  3DF6 A;  2K7I A;  2JVA A;  4P78 A;  4DUY E;  4RHB B;  2JPA A;  4LF7 E;  2EP3 A;  5KL6 A;  1F2I G;  1YPN A;  2V83 A;  1N3G A;  1EH7 A;  3L00 A;  4JI8 E;  4B3T E;  2EMW A;  2LMZ A;  2N8X A;  2CT1 A;  2ENC A;  1RQ0 A;  3VK6 A;  1X48 A;  4K0K E;  5A6B A;  2JOB A;  2EMC A;  3F6H A;  2WBT A;  1YSA C;  3KWR A;  1YUJ A;  2EMI A;  2CSH A;  1HR0 E;  1STU A;  2DLK A;  4WSG A;  4YHH E;  2EMX A;  4JI3 E;  3C4T A;  2DIX A;  4WPY A;  2YRK A;  3HXL A;  1MEY C;  3BGH A;  5A2Q C;  4LFA E;  2DRP A;  4F9B B;  4WYQ B;  4X9J A;  3VYX A;  4MLV A;  1X49 A;  3J7A G;  5A69 A;  4IS1 C;  3LML A;  1IBL E;  2R76 A;  1XNR E;  2EPC A;  4M30 A;  4N4R B;  2JR1 A;  2L2K B;  2LJU A;  5KL5 A;  2DMI A;  2WBS A;  2LBS B;  2V85 A;  2EN7 A;  1YFH A;  4F6M A;  2MKN A;  5KL7 A;  2UU9 E;  3EPH A;  2WBU A;  4GKJ E;  1J5E E;  4WSP A;  4L5N C;  2ODR C;  2ELZ A;  2EZ6 A;  2V89 A;  3BF2 A;  1SR9 A;  4LF5 E;  2RS7 A;  2EOI A;  3BBG A;  2EE8 A;  1UHZ A;  2DSY A;  2RS6 A;  2LVH A;  3KZZ A;  4JI0 E;  2YPN A;  4KWY A;  2YTD A;  2N3G A;  5ADZ A;  3ZOQ B;  3EQ1 A;  3IWD A;  2EPA A;  2HJJ A;  2H36 X;  4TUI A;  1N33 E;  1O0W A;  5AAS A;  1FJG E;  5FLX C;  1XMQ E;  5AC4 A;  3BID A;  2LUP B;  2EOY A;  3HQ1 A;  2F4V E;  2M7Q A;  2NUG A;  1HNX E;  2YTJ A;  1JK1 A;  2UXD E;  4R2D A;  2E72 A;  2A25 A;  4NXN E;  1RMD A;  2LJH A;  3HPS A;  2YTN A;  2EM7 A;  4R2A A;  2MDG A;  5DNY A;  3QG5 C;  2EPM X;  3ADI A;  2L2M A;  1KYQ A;  4NZV A;  2EJ4 A;  3VYY A;  1WHQ A;  2LV2 A;  3AUZ A;  2YU5 A;  1I94 E;  2YRM A;  4DV2 E;  4FK5 C;  4BHC A;  3T1H E;  1IBM E;  2EPX A;  2EMG A;  4R2C A;  3JAM C;  2EM3 A;  2IHR 1;  4YY3 E;  4X64 E;  1SFE A;  1N36 E;  2EM8 A;  5IT9 C;  1PKP A;  1ZR9 A;  2L33 A;  2JP9 A;  1IQO A;  2EN2 A;  2VQE E;  2EM0 A;  4LTY A;  2YTE A;  4R2P A;  4DV4 E;  1BBO A;  1N34 E;  2RPC A;  2YU8 A;  4JI7 E;  2EL6 A;  2V86 A;  2EMY A;  1X5W A;  2R1F A;  4B3M E;  2NUE A;  3IWB A;  3K6Q A;  2I9I A;  4X66 E;  1T4O A;  1QNT A;  4DR2 E;  1X47 A;  5TSE A;  4R8O A;  2L8T A;  4DR7 E;  2M1S A;  4LF8 E;  2EWL A;  4M0V A;  2VE7 C;  1A1J A;  2EN4 A;  3H09 A;  2YTF A;  4WFT A;  4DV6 E;  3J7Y p;  2G7H A;  2HC5 A;  4GKK E;  2ENA A;  1WHN A;  1EH8 A;  2EPZ A;  4B3S E;  1HNW E;  1MGT A;  4JV5 E;  1IMU A;  5LLQ A;  1YYK A;  1A1G A;  2EML A;  2V88 A;  4I8O A;  4BC7 A;  2ELY A;  2WZO A;  2EPK X;  2EPN A;  5KL4 A;  2EN8 A;  4L8N A;  2DMY A;  2GPI A;  3JTZ A;  2UXC E;  1EH6 A;  3JU0 A;  4DUZ E;  4ZYD A;  2YRH A;  4R03 A;  1UBD C;  4JI5 E;  2RTX A;  2KON A;  4BS9 A;  4O43 A;  2B7T A;  2CPN A;  2JY9 A;  2KOU A;  4B3R E;  1TF3 A;  2EMA A;  2YSO A;  1YUI A;  4O5G A;  2ZM6 E;  2MC5 A;  1HNZ E;  3DJW A;  2RSI A;  2L92 A;  2EM4 A;  2YTP A;  2DGC A;  4O24 A;  3C4B A;  1N32 E;  5KL2 A;  1ZBT A;  1UN6 B;  4P7D A;  4DR3 E;  4R2S A;  2GHF A;  4BBY A;  1PDA A;  2EQ0 A;  4JYA E;  2M4I A;  3FIG A;  3ADG A;  2FTX B;  1PJT A;  5F3W A;  4LFC E;  2VQF E;  2F8B A;  2UUC E;  1XMO E;  4IJD A;  2WCC 3;  4LU9 A;  2EOO A;  2KHX A;  1T4N A;  2NA2 A;  4HEI A;  2L2N A;  1YYW A;  3C6K A;  4JI2 E;  1UIL A;  4LF4 E;  3HTX A;  2V8Q B;  1A1L A;  2EL5 A;  2YTO A;  5A6J A;  4LFB E;  5IXM B;  2V87 A;  4O4K A;  4GZN C;  3M99 B;  4R2R A;  2EQ3 A;  4X62 E;  3THN A;  2EOR A;  4JI6 E;  2HGH A;  4AQY E;  2YTQ A;  1A1H A;  2RQL A;  4M9V C;  1GTK A;  1XNQ E;  2YTI A;  2RSM A;  4DMI A;  2E1M A;  1ZU1 A;  2JXP A;  1L4S A;  4JI1 E;  1WRJ A;  4LF6 E;  3P1X A;  4OX9 E;  4ZYH A;  1IBK E;  2EOE A;  4BMJ A;  4MLQ A;  4BCA A;  1NEI A;  2NAB A;  1DQ3 A;  1BB8 A;  2EN3 A;  2MC6 A;  2N3H A;  2D9H A;  2B7V A;  1ZAA C;  1KJK A;  1T4L B;  2YSP A;  5T6J A;  1EKZ A;  3EPK A;  2FV4 B;  2EPO A;  4X8W A;  2ENH A;  2BB8 A;  5A6A A;  4WX9 A;  1TF6 A;  3J80 C;  1B69 A;  2L3J A;  4HTG A;  5KL3 A;  4DR4 E;  2EOF A;  2K4V A;  3AV0 A;  2EOZ A;  4F2J C;  3C6M A;  2M9A A;  4F9C B;  1GQE A;  3IWC A;  3KZY A;  3TQM A;  2EPR A;  4TUG A;  2ODR D;  2MKD A;  2JYA A;  4R2E A;  5IWA E;  2EMB A;  2EOM A;  4F6N A;  2B9D A;  4Q28 A;  1P47 A;  4WXD A;  2EPP A;  4DV3 E;  1NCS A;  4F54 A;  2YZT A;  1A1F A;  4NXM E;  2EM9 A;  2NUF A;  1WJP A;  2EMK A;  1RC7 A;  1YZ9 A;  2I13 A;  2L3C A;  4Q35 B;  1QU6 A;  1DGC A;  3EPJ A;  2LUQ A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 2EPX A;  2EMC A;  2YTG A;  4IJD A;  2EMG A;  2WBT A;  4R2C A;  1YSA C;  2J7J A;  2WCC 3;  1YUJ A;  2EMI A;  2CSH A;  2DLK A;  2EM3 A;  2EOO A;  4WSG A;  2EM8 A;  2EMX A;  1ZR9 A;  2YRK A;  2JP9 A;  1A1K A;  1MEY C;  2EN2 A;  3VHT B;  2EQ1 A;  1TN9 A;  2EM0 A;  2EMF A;  2YTE A;  4R2P A;  2DRP A;  2EOQ A;  4X9J A;  1BBO A;  1A1L A;  2EL5 A;  2YTO A;  2RPC A;  2YU8 A;  4IS1 C;  2EL6 A;  2CTD A;  2EMY A;  1X5W A;  2R1F A;  3M99 B;  4GZN C;  3UK3 C;  2EOX A;  4R2R A;  2EQ3 A;  3MHH C;  1LLM C;  2EPC A;  2EOH A;  2EPU A;  2EOR A;  2EMH A;  2HGH A;  1AAY A;  2YTQ A;  2DLQ A;  2EN6 A;  1A1H A;  4M9V C;  2EN1 A;  2YTI A;  5KL5 A;  2DMI A;  2WBS A;  2PRT A;  2EN7 A;  1X6F A;  4F6M A;  2MKN A;  1ZU1 A;  2EMZ A;  1A1J A;  2EN4 A;  5KL7 A;  2YTF A;  1G2F C;  1A1I A;  2WBU A;  3EPH A;  4R2Q A;  2ELZ A;  1X6E A;  2EOE A;  2LO3 A;  3MHS C;  2ENA A;  2NAB A;  3EPL A;  2VRD A;  2EOI A;  2EPZ A;  2LT7 A;  1BB8 A;  2EE8 A;  2EN3 A;  2D9H A;  2LVH A;  1ZAA C;  1A1G A;  1KJK A;  2YSP A;  2EML A;  2YTD A;  2ELY A;  2EPA A;  3EPK A;  2ADR A;  2EL4 A;  5KL4 A;  2ENH A;  2BB8 A;  2EM5 A;  2EOS A;  2EN8 A;  1TF6 A;  2EOJ A;  1X6H A;  1B69 A;  5KL3 A;  2EOF A;  2EOY A;  2EOZ A;  4F2J C;  2GLI A;  2YRH A;  1UBD C;  2M9A A;  2YTJ A;  1JK1 A;  4R2D A;  2E72 A;  2A25 A;  2EM6 A;  2LCE A;  1JK2 A;  2EPR A;  1RMD A;  1G2D C;  1TF3 A;  2MKD A;  1X3C A;  4R2E A;  2YTN A;  2EMA A;  2YSO A;  1YUI A;  2EMB A;  2EOM A;  2EM7 A;  4R2A A;  4F6N A;  1Z1B A;  2MDG A;  1P47 A;  2EM2 A;  2EPP A;  2RSI A;  2EM4 A;  1NCS A;  2JPA A;  2YTP A;  2DGC A;  2EP3 A;  5KL6 A;  5KL2 A;  1A1F A;  1F2I G;  2EM9 A;  1UN6 B;  1WJP A;  2EJ4 A;  2EMK A;  2EMW A;  2LV2 A;  2I13 A;  2CT1 A;  2ENC A;  4R2S A;  2GHF A;  2YU5 A;  2EQ0 A;  2YRM A;  1DGC A;  3EPJ A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...