2EP3A

Solution structure of the c2h2 type zinc finger (region 631-663) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 631-663) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ep3A01
2EN6A 2E72A 2DGCA 2EOMA 2YSOA 4IJDA 4R2PA 2EL6A 2EOJA 2EOZA 2LVHA 2YTGA 2MDGA 2YTFA 1Z1BA 2EN3A 1A1LA 1G2FC 1A1IA 1G2DC 1BB8A 2EORA 2MKNA 2DLKA 2EPPA 2EMGA 1UBDC 2RSIA 1X6EA 2EMAA 1ZU1A 2EOXA 2YU8A 2NABA 1X5WA 1AAYA 2EMKA 2DLQA 2D9HA 2ENAA 2EPRA 5KL2A 4IS1C 5KL4A 4R2SA 2EN7A 1YUJA 1TF6A 1ZR9A 2WCC3 2EPCA 2YTOA 2EOHA 1X3CA 3EPKA 4F2JC 3MHSC 2YU5A 2PRTA 1X6HA 4FK5C 1B69A 2EM0A 1P47A 1A1HA 2EQ0A 2EMYA 2ELYA 2M9AA 4GZNC 2JPAA 2GLIA 2WBSA 1JK2A 2EQ3A 2WBUA 2EN1A 2EMLA 2RPCA 2YTDA 2LCEA 2EPZA 2EOYA 1A1FA 1A1GA 2EOQA 2EOSA 2R1FA 2YTEA 2JP9A 1JK1A 1RMDA 2EM3A 4WSGA 1BBOA 2EQ1A 2EM8A 3EPJA 2EN2A 2EM4A 2EMFA 5KL7A 2EMZA 2LV2A 4R2DA 2EOIA 2J7JA 5KL5A 2MKDA 3M99B 4X9JA 1DGCA 1YSAC 2EPUA 2YTJA 2CSHA 1TF3A 2LO3A 4R2EA 1TN9A 1YUIA 2DRPA 4R2QA 2I13A 2EM9A 2EOEA 2EOOA 1A1JA 4R2RA 2EE8A 2VRDA 2EMBA 1KJKA 2EP3A 2A25A 2YTIA 2ELZA 2ENCA 2CT1A 4F6MA 2GHFA 2EMHA 5KL3A 1UN6B 2WBTA 4F6NA 2YTQA 3UK3C 1ZAAC 4R2CA 2YTNA 2YSPA 1A1KA 2BB8A 1NCSA 2EM7A 2EMXA 2YRMA 5KL6A 2YRKA 1X6FA 2DMIA 2EPAA 2HGHA 4R2AA 1F2IG 2EN8A 4M9VC 2EMWA 2CTDA 2ADRA 2EMIA 3EPLA 1LLMC 1MEYC 3EPHA 2EL5A 2EMCA 1WJPA 2YRHA 2EM6A 2EPXA 3VHTB 2EM5A 2EM2A 2EOFA 2YTPA 2EL4A 2EJ4A 3MHHC 2LT7A 2ENHA 2EN4A
chains in the Genus database with same CATH superfamily
5LLQA 3QG5C 4JI8E 4DV2E 4LF9E 2EL6A 2EOZA 2LVHA 4OOGC 2YTFA 1G2DC 1QNTA 2ODRC 4X8WA 4GKJE 2EORA 2EPNA 1UBDC 2E1MA 2EMAA 4ZYDA 2EOXA 2JOBA 2RS7A 2YU8A 1IBLE 4R03A 3MSWA 3C6KA 2ENAA 2WZOA 2EN7A 4WXDA 1ZR9A 4BHBA 1DI2A 1WHQA 4FK5C 3J80C 3LLHA 2JWOA 4M2ZA 2EQ0A 2RS6A 2DSYA 2JR1A 2B3TB 2FGGA 4LF4E 2L3JA 2WBUA 2EMLA 2RPCA 3DJWA 1ZBQA 5CFFE 3C4BA 2EOYA 3THNA 3IWBA 2EOQA 2DB2A 1GQEA 1ZBTA 1RMDA 5A2QC 1T38A 2EM8A 1STUA 3ECRA 5IV8B 2EM4A 4WXCA 2EMZA 2NA2A 2VF1A 2LV2A 4HTGA 4WPYA 4X66E 5IWAE 2RQLA 1PDAA 4BC9A 3LMLA 2L2MA 3T1HE 1YFHA 3BGHA 4KZSA 4R2QA 4BS9A 2V85A 2V88A 4DR1E 1KJKA 4O4KA 1UILA 4KWYA 2N8XA 1SR9A 2ELZA 2ENCA 4B3ME 3BF2A 2GHFA 4JI0E 2EMHA 2JVAA 2YWQA 1BBGA 3FIGA 1UN6B 4F6NA 2GPIA 4WSPA 5A69A 4WYQB 4DUZE 2EPOA 3OTOE 1A1KA 2YRMA 2L3CA 4DMIA 4M30A 2LE2A 2V89A 1X6FA 2FTXB 2DMIA 2B7VA 4JI6E 4R2AA 2EN8A 4M9VC 1LLMC 4BBYA 1MEYC 3EPHA 1L4SA 4AQYE 2YRHA 1T39A 2Q8UA 2H36X 2EL4A 3MHHC 2G7HA 3L00A 2ENHA 2EN4A 2EN6A 1YPNA 2ODRD 4ZYEA 2LJUA 3JU0A 4NXNE 2B9DA 4WFTA 3ADJA 4LFBE 1Z1BA 2EN3A 4LU9A 1A1LA 1A1IA 1HR0E 1FKAE 3AUZA 3VYXA 2L8TA 4OX9E 4DV4E 2UXCE 2EMGA 2MC6A 1T4OA 4NXME 2L2NA 4O24A 2F8BA 1HNZE 1HNWE 2DLQA 2D9HA 1J5EE 5KL4A 2UXDE 1YUJA 1TF6A 2WCC3 1J26A 2EOHA 1X3CA 5IT9C 4JI1E 2DMYA 4F2JC 2NUFA 2UUCE 5LMUE 2F4VE 1XNRE 2EM0A 1P47A 1A1HA 4L8NA 2MDRA 2M9AA 2HJJA 2V8QB 2LUPB 3VYYA 2FV4B 3HPZA 2EPZA 2B7TA 1IQOA 1A1FA 1A1GA 2EOSA 1XMOE 2JP9A 1YYOA 1JK1A 2UUBE 4F54A 1NEIA 3VK6A 2EQ1A 1T4NA 2EN2A 4LF6E 2JOXA 3T1YE 4R2DA 2EOIA 2J7JA 4M0VA 2V87A 4LF5E 3HQ1A 2YTJA 1TF3A 2LO3A 4R2EA 4TUIA 2LBSB 2V86A 4WX9A 4NHRA 2M7QA 2EM9A 2EOEA 2EOOA 1A1JA 2VRDA 2LJHA 4Q28A 3KZZA 3F6HA 1MGTA 1GZ6A 4BMJA 2A25A 2EPKX 1N32E 4F6MA 4BC7A 1PJQA 5BR8E 3ADIA 3UK3C 3K6QA 4X64E 5AE2A 2EMXA 4HEIA 2UUAE 4YHHE 5T6JA 2JXPA 2YRKA 4R8OA 3J7AG 2HGHA 4LTYA 4LFCE 4DV3E 2EL5A 1EH8A 2EM6A 2E5LE 2N3GA 3VHTB 5AE1A 3HPSA 5A6KA 3ZOQB 1N36E 2EJ4A 2M1SA 2E72A 2DGCA 2EOMA 2YSOA 4IJDA 4R2PA 1I94E 2KOUA 2N3HA 1BB8A 1QU6A 3BBGA 1SFEA 1EH7A 4TUGA 2MKNA 2EPPA 4ZYHA 1X6EA 4P7DA 1IBKE 2EMKA 2UXBE 5KL2A 2EPRA 4IS1C 4R2SA 3OMLA 5AE3A 1HNXE 5ADZA 5A6JA 4DKKA 2RTXA 3MHSC 3RMPA 2PRTA 1X6HA 3TQMA 1IBME 1B69A 2EMYA 2ELYA 4DV6E 2M4IA 4GZNC 1KYQA 3F6GA 1YZ9A 2KHXA 2YT4A 2EQ3A 1EKZA 2EN1A 4JI2E 2LCEA 1IQSA 5AASA 2EM3A 4B3TE 1XMQE 1O0WA 4DR2E 4DR3E 5AC5A 5KL7A 1UHZA 5KL5A 4DV5E 1YSAC 1DGCA 3P1XA 2EPUA 4DV0E 2K7IA 4K0KE 3JTZA 5LL6R 1YUIA 5A6BD 1N34E 1TN9A 4R2RA 3AV0A 3KZYA 1IMUA 1RC7A 2YTIA 2JY9A 2LRSA 4DR6E 2HC5A 1PJSA 2WBTA 1DQ3A 2VE7C 5F3WA 4RH8A 2YTQA 1ZAAC 2K4VA 4R2CA 2LTRA 1NCSA 3BIDA 5KL6A 3HTXA 3ADGA 1X47A 4X65E 2HHHE 4ZYGA 4L5NC 3EQ1A 3IWDA 2DIXA 3H09A 2KONA 4I8OA 2CTDA 2EMCA 1WJPA 4DV7E 4Q35B 2NUGA 2EM2A 2EOFA 2YTPA 2LUQA 1YYWA 2VQEE 1N3GA 1XNQE 2EZ6A 2LMZA 4MLVA 4DR4E 2RSMA 2YPNA 4JI7E 2BBGA 2EOJA 2L33A 2YTGA 2MDGA 2MC5A 1G2FC 4GKKE 2UU9E 2EWLA 4MLQA 1X49A 2DLKA 2RSIA 1ZU1A 4GEQB 4O43A 4DUYE 1N33E 2NABA 4RHBB 1X5WA 1AAYA 4F9CB 5TSEA 2JYAA 5A6BA 4B3RE 4KHPE 4BHCA 4DV1E 3IWCA 2EPCA 2YTOA 3EPKA 2NUEA 1WXRA 2YZTA 2YU5A 3DF6A 3C6MA 5IXMB 3J7Yp 2JPAA 2EPMX 2R76A 3JAMC 2GLIA 2WBSA 2L2KB 3HXLA 4JV5E 5LMNE 1JK2A 2EPLX 2YTDA 5A6AA 4JI3E 2R1FA 2YTEA 4WSGA 1WRJA 1BBOA 2IHR1 3EPJA 2VQFE 2EMFA 3THOB 4F9AB 4J8ZA 1PJTA 1FJGE 1X48A 2MKDA 3M99B 4X9JA 4NZVA 4LFAE 1T4LB 2CSHA 2LTSA 2CPNA 4B3SE 2DRPA 2I13A 2L6MA 2EE8A 2EMBA 1WHNA 2EP3A 3C4TA 4YY3E 1EH6A 2I9IA 2CT1A 5KL3A 4DR7E 5FLXC 4F9BB 2YTNA 2YSPA 2BB8A 2EM7A 1RQ0A 4JI4E 3ADLA 3KWRA 4O5GA 3J81C 2EPAA 1F2IG 5DNYA 2EMWA 1AH5A 2ADRA 1PKPA 2EMIA 5AC4A 4P78A 3EPLA 4JYAE 4BCAA 2EPXA 1YYKA 4N4RB 2ZM6E 2L92A 2EM5A 4JI5E 4X62E 4DR5E 1GTKA 4LF7E 4LF8E 2V83A 2LT7A
chains in the Genus database with same CATH topology
2EN6A 2E72A 2DGCA 2EOMA 2YSOA 4IJDA 4R2PA 2EL6A 2EOJA 2EOZA 2LVHA 2YTGA 2MDGA 2YTFA 1Z1BA 2EN3A 1A1LA 1G2FC 1A1IA 1G2DC 1BB8A 2EORA 2MKNA 2DLKA 2EPPA 2EMGA 1UBDC 2RSIA 1X6EA 2EMAA 1ZU1A 2EOXA 2YU8A 2NABA 1X5WA 1AAYA 2EMKA 2DLQA 2D9HA 2ENAA 2EPRA 5KL2A 4IS1C 5KL4A 4R2SA 2EN7A 1YUJA 1TF6A 1ZR9A 2WCC3 2EPCA 2YTOA 2EOHA 1X3CA 3EPKA 4F2JC 3MHSC 2YU5A 2PRTA 1X6HA 4FK5C 1B69A 2EM0A 1P47A 1A1HA 2EQ0A 2EMYA 2ELYA 2M9AA 4GZNC 2JPAA 2GLIA 2WBSA 1JK2A 2EQ3A 2WBUA 2EN1A 2EMLA 2RPCA 2YTDA 2LCEA 2EPZA 2EOYA 1A1FA 1A1GA 2EOQA 2EOSA 2R1FA 2YTEA 2JP9A 1JK1A 1RMDA 2EM3A 4WSGA 1BBOA 2EQ1A 2EM8A 3EPJA 2EN2A 2EM4A 2EMFA 5KL7A 2EMZA 2LV2A 4R2DA 2EOIA 2J7JA 5KL5A 2MKDA 3M99B 4X9JA 1DGCA 1YSAC 2EPUA 2YTJA 2CSHA 1TF3A 2LO3A 4R2EA 1TN9A 1YUIA 2DRPA 4R2QA 2I13A 2EM9A 2EOEA 2EOOA 1A1JA 4R2RA 2EE8A 2VRDA 2EMBA 1KJKA 2EP3A 2A25A 2YTIA 2ELZA 2ENCA 2CT1A 4F6MA 2GHFA 2EMHA 5KL3A 1UN6B 2WBTA 4F6NA 2YTQA 3UK3C 1ZAAC 4R2CA 2YTNA 2YSPA 1A1KA 2BB8A 1NCSA 2EM7A 2EMXA 2YRMA 5KL6A 2YRKA 1X6FA 2DMIA 2EPAA 2HGHA 4R2AA 1F2IG 2EN8A 4M9VC 2EMWA 2CTDA 2ADRA 2EMIA 3EPLA 1LLMC 1MEYC 3EPHA 2EL5A 2EMCA 1WJPA 2YRHA 2EM6A 2EPXA 3VHTB 2EM5A 2EM2A 2EOFA 2YTPA 2EL4A 2EJ4A 3MHHC 2LT7A 2ENHA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN6 A;  2E72 A;  2DGC A;  2EOM A;  2YSO A;  4IJD A;  4R2P A;  2EL6 A;  2EOJ A;  2EOZ A;  2LVH A;  2YTG A;  2MDG A;  2YTF A;  1Z1B A;  2EN3 A;  1A1L A;  1G2F C;  1A1I A;  1G2D C;  1BB8 A;  2EOR A;  2MKN A;  2DLK A;  2EPP A;  2EMG A;  1UBD C;  2RSI A;  1X6E A;  2EMA A;  1ZU1 A;  2EOX A;  2YU8 A;  2NAB A;  1X5W A;  1AAY A;  2EMK A;  2DLQ A;  2D9H A;  2ENA A;  2EPR A;  5KL2 A;  4IS1 C;  5KL4 A;  4R2S A;  2EN7 A;  1YUJ A;  1TF6 A;  1ZR9 A;  2WCC 3;  2EPC A;  2YTO A;  2EOH A;  1X3C A;  3EPK A;  4F2J C;  3MHS C;  2YU5 A;  2PRT A;  1X6H A;  4FK5 C;  1B69 A;  2EM0 A;  1P47 A;  1A1H A;  2EQ0 A;  2EMY A;  2ELY A;  2M9A A;  4GZN C;  2JPA A;  2GLI A;  2WBS A;  1JK2 A;  2EQ3 A;  2WBU A;  2EN1 A;  2EML A;  2RPC A;  2YTD A;  2LCE A;  2EPZ A;  2EOY A;  1A1F A;  1A1G A;  2EOQ A;  2EOS A;  2R1F A;  2YTE A;  2JP9 A;  1JK1 A;  1RMD A;  2EM3 A;  4WSG A;  1BBO A;  2EQ1 A;  2EM8 A;  3EPJ A;  2EN2 A;  2EM4 A;  2EMF A;  5KL7 A;  2EMZ A;  2LV2 A;  4R2D A;  2EOI A;  2J7J A;  5KL5 A;  2MKD A;  3M99 B;  4X9J A;  1DGC A;  1YSA C;  2EPU A;  2YTJ A;  2CSH A;  1TF3 A;  2LO3 A;  4R2E A;  1TN9 A;  1YUI A;  2DRP A;  4R2Q A;  2I13 A;  2EM9 A;  2EOE A;  2EOO A;  1A1J A;  4R2R A;  2EE8 A;  2VRD A;  2EMB A;  1KJK A;  2EP3 A;  2A25 A;  2YTI A;  2ELZ A;  2ENC A;  2CT1 A;  4F6M A;  2GHF A;  2EMH A;  5KL3 A;  1UN6 B;  2WBT A;  4F6N A;  2YTQ A;  3UK3 C;  1ZAA C;  4R2C A;  2YTN A;  2YSP A;  1A1K A;  2BB8 A;  1NCS A;  2EM7 A;  2EMX A;  2YRM A;  5KL6 A;  2YRK A;  1X6F A;  2DMI A;  2EPA A;  2HGH A;  4R2A A;  1F2I G;  2EN8 A;  4M9V C;  2EMW A;  2CTD A;  2ADR A;  2EMI A;  3EPL A;  1LLM C;  1MEY C;  3EPH A;  2EL5 A;  2EMC A;  1WJP A;  2YRH A;  2EM6 A;  2EPX A;  3VHT B;  2EM5 A;  2EM2 A;  2EOF A;  2YTP A;  2EL4 A;  2EJ4 A;  3MHH C;  2LT7 A;  2ENH A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 5LLQ A;  3QG5 C;  4JI8 E;  4DV2 E;  4LF9 E;  2EL6 A;  2EOZ A;  2LVH A;  4OOG C;  2YTF A;  1G2D C;  1QNT A;  2ODR C;  4X8W A;  4GKJ E;  2EOR A;  2EPN A;  1UBD C;  2E1M A;  2EMA A;  4ZYD A;  2EOX A;  2JOB A;  2RS7 A;  2YU8 A;  1IBL E;  4R03 A;  3MSW A;  3C6K A;  2ENA A;  2WZO A;  2EN7 A;  4WXD A;  1ZR9 A;  4BHB A;  1DI2 A;  1WHQ A;  4FK5 C;  3J80 C;  3LLH A;  2JWO A;  4M2Z A;  2EQ0 A;  2RS6 A;  2DSY A;  2JR1 A;  2B3T B;  2FGG A;  4LF4 E;  2L3J A;  2WBU A;  2EML A;  2RPC A;  3DJW A;  1ZBQ A;  5CFF E;  3C4B A;  2EOY A;  3THN A;  3IWB A;  2EOQ A;  2DB2 A;  1GQE A;  1ZBT A;  1RMD A;  5A2Q C;  1T38 A;  2EM8 A;  1STU A;  3ECR A;  5IV8 B;  2EM4 A;  4WXC A;  2EMZ A;  2NA2 A;  2VF1 A;  2LV2 A;  4HTG A;  4WPY A;  4X66 E;  5IWA E;  2RQL A;  1PDA A;  4BC9 A;  3LML A;  2L2M A;  3T1H E;  1YFH A;  3BGH A;  4KZS A;  4R2Q A;  4BS9 A;  2V85 A;  2V88 A;  4DR1 E;  1KJK A;  4O4K A;  1UIL A;  4KWY A;  2N8X A;  1SR9 A;  2ELZ A;  2ENC A;  4B3M E;  3BF2 A;  2GHF A;  4JI0 E;  2EMH A;  2JVA A;  2YWQ A;  1BBG A;  3FIG A;  1UN6 B;  4F6N A;  2GPI A;  4WSP A;  5A69 A;  4WYQ B;  4DUZ E;  2EPO A;  3OTO E;  1A1K A;  2YRM A;  2L3C A;  4DMI A;  4M30 A;  2LE2 A;  2V89 A;  1X6F A;  2FTX B;  2DMI A;  2B7V A;  4JI6 E;  4R2A A;  2EN8 A;  4M9V C;  1LLM C;  4BBY A;  1MEY C;  3EPH A;  1L4S A;  4AQY E;  2YRH A;  1T39 A;  2Q8U A;  2H36 X;  2EL4 A;  3MHH C;  2G7H A;  3L00 A;  2ENH A;  2EN4 A;  2EN6 A;  1YPN A;  2ODR D;  4ZYE A;  2LJU A;  3JU0 A;  4NXN E;  2B9D A;  4WFT A;  3ADJ A;  4LFB E;  1Z1B A;  2EN3 A;  4LU9 A;  1A1L A;  1A1I A;  1HR0 E;  1FKA E;  3AUZ A;  3VYX A;  2L8T A;  4OX9 E;  4DV4 E;  2UXC E;  2EMG A;  2MC6 A;  1T4O A;  4NXM E;  2L2N A;  4O24 A;  2F8B A;  1HNZ E;  1HNW E;  2DLQ A;  2D9H A;  1J5E E;  5KL4 A;  2UXD E;  1YUJ A;  1TF6 A;  2WCC 3;  1J26 A;  2EOH A;  1X3C A;  5IT9 C;  4JI1 E;  2DMY A;  4F2J C;  2NUF A;  2UUC E;  5LMU E;  2F4V E;  1XNR E;  2EM0 A;  1P47 A;  1A1H A;  4L8N A;  2MDR A;  2M9A A;  2HJJ A;  2V8Q B;  2LUP B;  3VYY A;  2FV4 B;  3HPZ A;  2EPZ A;  2B7T A;  1IQO A;  1A1F A;  1A1G A;  2EOS A;  1XMO E;  2JP9 A;  1YYO A;  1JK1 A;  2UUB E;  4F54 A;  1NEI A;  3VK6 A;  2EQ1 A;  1T4N A;  2EN2 A;  4LF6 E;  2JOX A;  3T1Y E;  4R2D A;  2EOI A;  2J7J A;  4M0V A;  2V87 A;  4LF5 E;  3HQ1 A;  2YTJ A;  1TF3 A;  2LO3 A;  4R2E A;  4TUI A;  2LBS B;  2V86 A;  4WX9 A;  4NHR A;  2M7Q A;  2EM9 A;  2EOE A;  2EOO A;  1A1J A;  2VRD A;  2LJH A;  4Q28 A;  3KZZ A;  3F6H A;  1MGT A;  1GZ6 A;  4BMJ A;  2A25 A;  2EPK X;  1N32 E;  4F6M A;  4BC7 A;  1PJQ A;  5BR8 E;  3ADI A;  3UK3 C;  3K6Q A;  4X64 E;  5AE2 A;  2EMX A;  4HEI A;  2UUA E;  4YHH E;  5T6J A;  2JXP A;  2YRK A;  4R8O A;  3J7A G;  2HGH A;  4LTY A;  4LFC E;  4DV3 E;  2EL5 A;  1EH8 A;  2EM6 A;  2E5L E;  2N3G A;  3VHT B;  5AE1 A;  3HPS A;  5A6K A;  3ZOQ B;  1N36 E;  2EJ4 A;  2M1S A;  2E72 A;  2DGC A;  2EOM A;  2YSO A;  4IJD A;  4R2P A;  1I94 E;  2KOU A;  2N3H A;  1BB8 A;  1QU6 A;  3BBG A;  1SFE A;  1EH7 A;  4TUG A;  2MKN A;  2EPP A;  4ZYH A;  1X6E A;  4P7D A;  1IBK E;  2EMK A;  2UXB E;  5KL2 A;  2EPR A;  4IS1 C;  4R2S A;  3OML A;  5AE3 A;  1HNX E;  5ADZ A;  5A6J A;  4DKK A;  2RTX A;  3MHS C;  3RMP A;  2PRT A;  1X6H A;  3TQM A;  1IBM E;  1B69 A;  2EMY A;  2ELY A;  4DV6 E;  2M4I A;  4GZN C;  1KYQ A;  3F6G A;  1YZ9 A;  2KHX A;  2YT4 A;  2EQ3 A;  1EKZ A;  2EN1 A;  4JI2 E;  2LCE A;  1IQS A;  5AAS A;  2EM3 A;  4B3T E;  1XMQ E;  1O0W A;  4DR2 E;  4DR3 E;  5AC5 A;  5KL7 A;  1UHZ A;  5KL5 A;  4DV5 E;  1YSA C;  1DGC A;  3P1X A;  2EPU A;  4DV0 E;  2K7I A;  4K0K E;  3JTZ A;  5LL6 R;  1YUI A;  5A6B D;  1N34 E;  1TN9 A;  4R2R A;  3AV0 A;  3KZY A;  1IMU A;  1RC7 A;  2YTI A;  2JY9 A;  2LRS A;  4DR6 E;  2HC5 A;  1PJS A;  2WBT A;  1DQ3 A;  2VE7 C;  5F3W A;  4RH8 A;  2YTQ A;  1ZAA C;  2K4V A;  4R2C A;  2LTR A;  1NCS A;  3BID A;  5KL6 A;  3HTX A;  3ADG A;  1X47 A;  4X65 E;  2HHH E;  4ZYG A;  4L5N C;  3EQ1 A;  3IWD A;  2DIX A;  3H09 A;  2KON A;  4I8O A;  2CTD A;  2EMC A;  1WJP A;  4DV7 E;  4Q35 B;  2NUG A;  2EM2 A;  2EOF A;  2YTP A;  2LUQ A;  1YYW A;  2VQE E;  1N3G A;  1XNQ E;  2EZ6 A;  2LMZ A;  4MLV A;  4DR4 E;  2RSM A;  2YPN A;  4JI7 E;  2BBG A;  2EOJ A;  2L33 A;  2YTG A;  2MDG A;  2MC5 A;  1G2F C;  4GKK E;  2UU9 E;  2EWL A;  4MLQ A;  1X49 A;  2DLK A;  2RSI A;  1ZU1 A;  4GEQ B;  4O43 A;  4DUY E;  1N33 E;  2NAB A;  4RHB B;  1X5W A;  1AAY A;  4F9C B;  5TSE A;  2JYA A;  5A6B A;  4B3R E;  4KHP E;  4BHC A;  4DV1 E;  3IWC A;  2EPC A;  2YTO A;  3EPK A;  2NUE A;  1WXR A;  2YZT A;  2YU5 A;  3DF6 A;  3C6M A;  5IXM B;  3J7Y p;  2JPA A;  2EPM X;  2R76 A;  3JAM C;  2GLI A;  2WBS A;  2L2K B;  3HXL A;  4JV5 E;  5LMN E;  1JK2 A;  2EPL X;  2YTD A;  5A6A A;  4JI3 E;  2R1F A;  2YTE A;  4WSG A;  1WRJ A;  1BBO A;  2IHR 1;  3EPJ A;  2VQF E;  2EMF A;  3THO B;  4F9A B;  4J8Z A;  1PJT A;  1FJG E;  1X48 A;  2MKD A;  3M99 B;  4X9J A;  4NZV A;  4LFA E;  1T4L B;  2CSH A;  2LTS A;  2CPN A;  4B3S E;  2DRP A;  2I13 A;  2L6M A;  2EE8 A;  2EMB A;  1WHN A;  2EP3 A;  3C4T A;  4YY3 E;  1EH6 A;  2I9I A;  2CT1 A;  5KL3 A;  4DR7 E;  5FLX C;  4F9B B;  2YTN A;  2YSP A;  2BB8 A;  2EM7 A;  1RQ0 A;  4JI4 E;  3ADL A;  3KWR A;  4O5G A;  3J81 C;  2EPA A;  1F2I G;  5DNY A;  2EMW A;  1AH5 A;  2ADR A;  1PKP A;  2EMI A;  5AC4 A;  4P78 A;  3EPL A;  4JYA E;  4BCA A;  2EPX A;  1YYK A;  4N4R B;  2ZM6 E;  2L92 A;  2EM5 A;  4JI5 E;  4X62 E;  4DR5 E;  1GTK A;  4LF7 E;  4LF8 E;  2V83 A;  2LT7 A; 
#chains in the Genus database with same CATH homology
 2EN6 A;  2E72 A;  2DGC A;  2EOM A;  2YSO A;  4IJD A;  4R2P A;  2EL6 A;  2EOJ A;  2EOZ A;  2LVH A;  2YTG A;  2MDG A;  2YTF A;  1Z1B A;  2EN3 A;  1A1L A;  1G2F C;  1A1I A;  1G2D C;  1BB8 A;  2EOR A;  2MKN A;  2DLK A;  2EPP A;  2EMG A;  1UBD C;  2RSI A;  1X6E A;  2EMA A;  1ZU1 A;  2EOX A;  2YU8 A;  2NAB A;  1X5W A;  1AAY A;  2EMK A;  2DLQ A;  2D9H A;  2ENA A;  2EPR A;  5KL2 A;  4IS1 C;  5KL4 A;  4R2S A;  2EN7 A;  1YUJ A;  1TF6 A;  1ZR9 A;  2WCC 3;  2EPC A;  2YTO A;  2EOH A;  1X3C A;  3EPK A;  4F2J C;  3MHS C;  2YU5 A;  2PRT A;  1X6H A;  4FK5 C;  1B69 A;  2EM0 A;  1P47 A;  1A1H A;  2EQ0 A;  2EMY A;  2ELY A;  2M9A A;  4GZN C;  2JPA A;  2GLI A;  2WBS A;  1JK2 A;  2EQ3 A;  2WBU A;  2EN1 A;  2EML A;  2RPC A;  2YTD A;  2LCE A;  2EPZ A;  2EOY A;  1A1F A;  1A1G A;  2EOQ A;  2EOS A;  2R1F A;  2YTE A;  2JP9 A;  1JK1 A;  1RMD A;  2EM3 A;  4WSG A;  1BBO A;  2EQ1 A;  2EM8 A;  3EPJ A;  2EN2 A;  2EM4 A;  2EMF A;  5KL7 A;  2EMZ A;  2LV2 A;  4R2D A;  2EOI A;  2J7J A;  5KL5 A;  2MKD A;  3M99 B;  4X9J A;  1DGC A;  1YSA C;  2EPU A;  2YTJ A;  2CSH A;  1TF3 A;  2LO3 A;  4R2E A;  1TN9 A;  1YUI A;  2DRP A;  4R2Q A;  2I13 A;  2EM9 A;  2EOE A;  2EOO A;  1A1J A;  4R2R A;  2EE8 A;  2VRD A;  2EMB A;  1KJK A;  2EP3 A;  2A25 A;  2YTI A;  2ELZ A;  2ENC A;  2CT1 A;  4F6M A;  2GHF A;  2EMH A;  5KL3 A;  1UN6 B;  2WBT A;  4F6N A;  2YTQ A;  3UK3 C;  1ZAA C;  4R2C A;  2YTN A;  2YSP A;  1A1K A;  2BB8 A;  1NCS A;  2EM7 A;  2EMX A;  2YRM A;  5KL6 A;  2YRK A;  1X6F A;  2DMI A;  2EPA A;  2HGH A;  4R2A A;  1F2I G;  2EN8 A;  4M9V C;  2EMW A;  2CTD A;  2ADR A;  2EMI A;  3EPL A;  1LLM C;  1MEY C;  3EPH A;  2EL5 A;  2EMC A;  1WJP A;  2YRH A;  2EM6 A;  2EPX A;  3VHT B;  2EM5 A;  2EM2 A;  2EOF A;  2YTP A;  2EL4 A;  2EJ4 A;  3MHH C;  2LT7 A;  2ENH A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...