2B7TA

Structure of adar2 dsrbm1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
b'PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 18
structure length 73
sequence length 73
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7tA00
1DI2A 5IWAE 1XMOE 2B7VA 1XNRE 2RTXA 2JY9A 3ADJA 1O0WA 1IBKE 4JI1E 1XNQE 2YT4A 2VQFE 3LLHA 1XMQE 3ADIA 2RS7A 4JI8E 2ZM6E 3T1HE 1J26A 2LTRA 2E5LE 4LF5E 4DV3E 1N34E 1T4LB 2L2KB 4LF4E 2B3TB 4JI3E 4JI4E 2NUGA 5LMNE 3HTXA 4LF6E 4DV5E 4DR5E 4LF9E 5LMUE 2UUBE 2L3CA 3OTOE 1YYKA 4DV2E 1UILA 2LBSB 1UHZA 4GKJE 4DKKA 2LRSA 4OX9E 5CFFE 2F4VE 4YY3E 2LUPB 4LFBE 4DV0E 2LTSA 2UU9E 2L3JA 4DR2E 4DUYE 3J7Yp 1X49A 1HNWE 1I94E 4DR1E 4NXME 4M2ZA 2MDRA 2NUFA 4DV1E 2DB2A 2UXDE 4WFTA 2HHHE 1YYWA 2DMYA 4X66E 4B3ME 2N3HA 3T1YE 3ADGA 2L2NA 4AQYE 2CPNA 2UUCE 2L33A 4DR3E 1HR0E 1YZ9A 4JYAE 3C4TA 1STUA 3C4BA 1WHNA 3VYXA 1X48A 1ZBTA 4NXNE 1YYOA 4X65E 1N32E 2UUAE 1J5EE 2NUEA 1PKPA 2RS6A 3ADLA 2JVAA 3VYYA 4LFAE 1N36E 4WYQB 5BR8E 4JI0E 4B3RE 4DUZE 4JI2E 2EZ6A 2N3GA 4JI6E 4DV7E 1WHQA 1X47A 4B3SE 4X64E 4LFCE 1N33E 4M30A 4OOGC 1RQ0A 2LJHA 1IBLE 2DIXA 2IHR1 4DV4E 4DV6E 4KHPE 4DR7E 1FJGE 1T4NA 4DR6E 4JI7E 2UXBE 1T4OA 1EKZA 4LF7E 4K0KE 1HNXE 4X8WA 1QU6A 4X62E 2NA2A 4JI5E 2RSMA 2B7TA 1GQEA 2UXCE 2KHXA 1HNZE 4JV5E 2LUQA 4YHHE 1RC7A 1IBME 4B3TE 4DR4E 4GKKE 1FKAE 2L2MA 4LF8E 2VQEE 3P1XA
chains in the Genus database with same CATH superfamily
4R2AA 2EM7A 1XNRE 2JY9A 2A25A 3ADJA 4M0VA 5AE1A 3AV0A 5LLQA 1EH8A 2RS7A 4F2JC 2EMXA 2ZM6E 3T1HE 2YTQA 2LTRA 1IQOA 4R2EA 4DV3E 2YSOA 1EH7A 1N34E 4DMIA 4JI4E 1YFHA 4LF6E 4LF9E 2L3CA 4WSGA 3OTOE 4DV2E 1UILA 4M9VC 2B9DA 1UHZA 3BF2A 4KWYA 4OX9E 3TQMA 2LMZA 2LV2A 2YPNA 4LU9A 4GZNC 2EN4A 2HJJA 2M9AA 1YSAC 2NABA 1DGCA 4DR2E 1HNWE 4DR1E 5A69A 4DV1E 2DB2A 2UXDE 2EMCA 1ZBQA 1IQSA 4F9CB 5F3WA 4B3ME 3MHSC 2WBUA 2L2NA 4HEIA 2EM2A 2YTEA 5A6BD 1DQ3A 2PRTA 5KL6A 3C4TA 3VYXA 1X48A 1AH5A 2EPRA 2LCEA 2EQ1A 2EQ3A 4R2DA 2EPCA 2EL4A 2EPKX 2YTJA 1GZ6A 2EN8A 4BC7A 3VYYA 2EQ0A 5KL7A 2YTIA 4R8OA 1PDAA 2KOUA 1WJPA 3JU0A 4Q28A 4J8ZA 4JI6E 5AC5A 2EPUA 1WHQA 2JOXA 2M1SA 4B3SE 4RH8A 4TUIA 2J7JA 4LFCE 1KYQA 4M30A 2YU5A 3HPSA 2LJHA 3KWRA 2ENHA 2EM5A 2IHR1 4DV4E 4KHPE 2EOXA 4R03A 4DR6E 1JK2A 5IV8B 2UXBE 5A6KA 1A1KA 4HTGA 4X8WA 4X62E 2VRDA 1LLMC 4JI5E 2B7TA 4L5NC 1GQEA 2EN1A 2EPZA 4IS1C 2YTGA 2L92A 2UXCE 1HNZE 4JV5E 3EPLA 1X3CA 3L00A 5FLXC 4B3TE 1MGTA 3MSWA 1N3GA 4WSPA 4LF8E 2WBTA 2WBSA 2MDGA 1A1LA 1XMOE 5IT9C 2V86A 4R2RA 4BMJA 2LT7A 2ENCA 5T6JA 4F9BB 2RPCA 1XMQE 1SFEA 2EM9A 1X6HA 2JOBA 5AE2A 5DNYA 1SR9A 2R1FA 4F6MA 4JI3E 3IWBA 5LMNE 2KONA 3HTXA 2EM6A 2EL6A 4DV5E 4DR5E 3AUZA 4O5GA 5ADZA 4BHCA 3BIDA 2LBSB 3IWCA 4WXCA 3THNA 2YRHA 3J7AG 5CFFE 2ELZA 4LTYA 3EPHA 3C6MA 2YTNA 1IMUA 4BS9A 2L3JA 3K6QA 4O43A 1X49A 4M2ZA 2EMKA 5KL3A 1TF3A 2NUFA 3VK6A 1G2FC 2JYAA 4NZVA 2EOOA 1A1IA 2N3HA 2JPAA 2GPIA 1X6FA 4AQYE 2CPNA 2UUCE 4DR3E 1YZ9A 2M4IA 3UK3C 1NCSA 3MHHC 2EOJA 2JXPA 2BB8A 5A2QC 2ENAA 2L6MA 2MKNA 2JVAA 4LFAE 3QG5C 4MLQA 2VE7C 4BBYA 2CTDA 1G2DC 5BR8E 4GEQB 2V89A 2G7HA 3ZOQB 1BB8A 2VF1A 3BGHA 1T38A 1PJSA 1N33E 2MKDA 2EOQA 4DR7E 4DV6E 2WZOA 1T4NA 2WCC3 2EPLX 2EPOA 4JI7E 1T4OA 2DMIA 1EKZA 4LF7E 1HNXE 1A1HA 3LMLA 4WXDA 4R2CA 2EM0A 3HXLA 1GTKA 4NHRA 1ZR9A 2H36X 2LUQA 2Q8UA 2YTOA 2L8TA 2EOZA 2V8QB 1RC7A 1IBME 2EPMX 3JTZA 2K4VA 2EMHA 2EJ4A 2L2MA 4MLVA 1WXRA 2VQEE 4I8OA 3P1XA 2DLKA 1DI2A 2EE8A 2FTXB 2YWQA 5IWAE 2B7VA 2V88A 3EPKA 2RTXA 1O0WA 1IBKE 4ZYDA 4RHBB 5KL2A 2DRPA 2VQFE 3LLHA 3ADIA 2CT1A 5A6JA 2I13A 4BCAA 1J26A 2E5LE 1NEIA 2LO3A 2JWOA 2DLQA 1YPNA 2LJUA 4LF4E 2HC5A 3J81C 2UUBE 2EP3A 1A1JA 5AE3A 2HGHA 1YYKA 2EMWA 4GKJE 4P7DA 4LFBE 4DV0E 2DSYA 2LTSA 2UU9E 2BBGA 2YZTA 2LVHA 3J7Yp 2EN2A 3H09A 4NXME 2EMBA 4BC9A 3BBGA 4WFTA 3DJWA 1AAYA 4WPYA 2DMYA 2EPPA 4X66E 1EH6A 2EOHA 3C6KA 2YU8A 2L33A 1HR0E 2ODRC 2ELYA 4Q35B 3C4BA 2EN3A 2EMZA 3DF6A 4NXNE 1N32E 4X65E 2MC5A 1X5WA 4O24A 1ZAAC 2NUEA 2E72A 5TSEA 1PKPA 2RS6A 2EOIA 1JK1A 3HPZA 4WYQB 2EM8A 4JI0E 2EZ6A 4FK5C 4DV7E 1ZU1A 1Z1BA 1X47A 1TN9A 4P78A 1BBOA 4OOGC 1RQ0A 2EMYA 1B69A 2DIXA 2FGGA 4ZYEA 2EN6A 2GHFA 3EQ1A 3OMLA 5AC4A 2ODRD 3KZZA 2EM4A 3KZYA 4KZSA 4X9JA 4YHHE 3THOB 3J80C 4WX9A 2EMIA 2EPXA 1FKAE 2K7IA 4R2QA 1YUJA 4L8NA 2V83A 1KJKA 5KL4A 3HQ1A 3EPJA 2I9IA 4F6NA 5KL5A 2YTDA 4JI1E 1XNQE 2YT4A 2JP9A 5AASA 4R2SA 5IXMB 4JI8E 2EL5A 4LF5E 2EMLA 1P47A 1A1GA 2FV4B 2L2KB 1T4LB 1UN6B 2LE2A 4N4RB 2B3TB 1PJTA 2NUGA 1MEYC 5A6AA 5LMUE 2GLIA 5LL6R 4R2PA 4DKKA 2LRSA 2RSIA 2F4VE 4YY3E 4BHBA 2LUPB 1QNTA 2YSPA 4DUYE 4F9AB 1I94E 2RQLA 2MDRA 3F6GA 2HHHE 2YTFA 1YYWA 3VHTB 2ADRA 1X6EA 2YRKA 3T1YE 3ADGA 1TF6A 3M99B 2JR1A 2MC6A 2EMAA 4TUGA 4JYAE 1STUA 1RMDA 1WHNA 4F54A 1ZBTA 1YYOA 4ZYHA 2UUAE 1J5EE 2YRMA 1F2IG 2DGCA 3ADLA 2EOYA 2EORA 3IWDA 1N36E 2YTPA 4B3RE 3ECRA 4DUZE 4JI2E 2N3GA 2V87A 2EMFA 3RMPA 2EM3A 1L4SA 2M7QA 2N8XA 2E1MA 4X64E 2EPAA 4IJDA 2EMGA 2EOMA 2V85A 1IBLE 1PJQA 1FJGE 2EOFA 4O4KA 4K0KE 2EOSA 1QU6A 3F6HA 1YUIA 2NA2A 5A6BA 3FIGA 2EPNA 1WRJA 3JAMC 2RSMA 1BBGA 2F8BA 2KHXA 2CSHA 2EWLA 1T39A 2R76A 1A1FA 2EOEA 4DR4E 4GKKE 2D9HA 1UBDC 2EN7A 4ZYGA
chains in the Genus database with same CATH topology
1DI2A 2FTXB 3HQ1A 5IWAE 1XMOE 2B7VA 2V88A 1XNRE 2RTXA 2JY9A 5IT9C 2V86A 3ADJA 1O0WA 1IBKE 4M0VA 4BMJA 3AV0A 2YT4A 5T6JA 5AE1A 4F9BB 2VQFE 1XNQE 5AASA 3LLHA 1XMQE 3ADIA 2RS7A 4JI8E 4BCAA 2ZM6E 3T1HE 1J26A 2LTRA 2JOBA 2E5LE 4LF5E 5AE2A 5DNYA 1SR9A 4DV3E 1N34E 4DMIA 2FV4B 2JWOA 2L2KB 1T4LB 2LE2A 4LF4E 2B3TB 4JI3E 4JI4E 2NUGA 3IWBA 5LMNE 2KONA 3HTXA 4LF6E 4DV5E 4DR5E 4LF9E 3AUZA 3J81C 5LMUE 2UUBE 2L3CA 3OTOE 5AE3A 1YYKA 5ADZA 4DV2E 5LL6R 1UILA 2B9DA 2LBSB 1UHZA 3IWCA 4P7DA 4GKJE 4DKKA 2LRSA 4OX9E 5CFFE 4LTYA 2LMZA 4LU9A 4YY3E 3J7AG 2F4VE 2LUPB 4LFBE 4DV0E 2DSYA 2LTSA 4BS9A 2L3JA 2UU9E 2YZTA 3K6QA 4DUYE 4F9AB 4DR2E 3J7Yp 1X49A 1HNWE 1I94E 3H09A 4DR1E 4M2ZA 4BC9A 4NXME 2MDRA 2NUFA 3F6GA 4DV1E 3VK6A 2DB2A 2UXDE 4WFTA 3DJWA 2HHHE 1ZBQA 4F9CB 4WPYA 5F3WA 2DMYA 1YYWA 4X66E 4B3ME 2N3HA 3T1YE 3ADGA 2L2NA 4AQYE 2CPNA 2JR1A 2UUCE 1DQ3A 2L33A 2ODRC 2MC6A 4DR3E 2M4IA 1HR0E 4TUGA 1YZ9A 4JYAE 3C4TA 1STUA 3C4BA 1WHNA 4F54A 1X48A 3DF6A 3VYXA 1ZBTA 4NXNE 1YYOA 4X65E 1N32E 2MC5A 5A2QC 1J5EE 2UUAE 2NUEA 2L6MA 1GZ6A 1PKPA 2RS6A 3ADLA 2JVAA 4BC7A 3VYYA 4LFAE 2VE7C 4BBYA 3HPZA 3IWDA 4R8OA 4WYQB 1N36E 5BR8E 2KOUA 4JI0E 4B3RE 4GEQB 4DUZE 3JU0A 4Q28A 4JI2E 2EZ6A 2N3GA 2V87A 4J8ZA 2V89A 4JI6E 3RMPA 2G7HA 3ZOQB 4DV7E 1WHQA 2JOXA 2M1SA 2VF1A 1X47A 2M7QA 4B3SE 4JI1E 2E1MA 4X64E 4P78A 4TUIA 4LFCE 1N33E 4M30A 4OOGC 3HPSA 1RQ0A 2LJHA 2V85A 3KWRA 2DIXA 2FGGA 2IHR1 4DV4E 4DV6E 2WZOA 1IBLE 1FJGE 4KHPE 1T4NA 4R03A 4DR6E 4JI7E 2UXBE 1T4OA 1EKZA 4LF7E 4K0KE 1HNXE 4X8WA 1QU6A 3F6HA 4X62E 2NA2A 3FIGA 3OMLA 4JI5E 3JAMC 2ODRD 3LMLA 2RSMA 2B7TA 4L5NC 1GQEA 2F8BA 3HXLA 2UXCE 2KHXA 2L92A 4KZSA 1HNZE 2EWLA 4JV5E 2H36X 2LUQA 4YHHE 2L8TA 2V8QB 3J80C 1RC7A 5FLXC 1IBME 4B3TE 4DR4E 4GKKE 4DR7E 3MSWA 3JTZA 2K4VA 2L2MA 4WSPA 1FKAE 1WXRA 4L8NA 4LF8E 2VQEE 2V83A 4I8OA 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DI2 A;  5IWA E;  1XMO E;  2B7V A;  1XNR E;  2RTX A;  2JY9 A;  3ADJ A;  1O0W A;  1IBK E;  4JI1 E;  1XNQ E;  2YT4 A;  2VQF E;  3LLH A;  1XMQ E;  3ADI A;  2RS7 A;  4JI8 E;  2ZM6 E;  3T1H E;  1J26 A;  2LTR A;  2E5L E;  4LF5 E;  4DV3 E;  1N34 E;  1T4L B;  2L2K B;  4LF4 E;  2B3T B;  4JI3 E;  4JI4 E;  2NUG A;  5LMN E;  3HTX A;  4LF6 E;  4DV5 E;  4DR5 E;  4LF9 E;  5LMU E;  2UUB E;  2L3C A;  3OTO E;  1YYK A;  4DV2 E;  1UIL A;  2LBS B;  1UHZ A;  4GKJ E;  4DKK A;  2LRS A;  4OX9 E;  5CFF E;  2F4V E;  4YY3 E;  2LUP B;  4LFB E;  4DV0 E;  2LTS A;  2UU9 E;  2L3J A;  4DR2 E;  4DUY E;  3J7Y p;  1X49 A;  1HNW E;  1I94 E;  4DR1 E;  4NXM E;  4M2Z A;  2MDR A;  2NUF A;  4DV1 E;  2DB2 A;  2UXD E;  4WFT A;  2HHH E;  1YYW A;  2DMY A;  4X66 E;  4B3M E;  2N3H A;  3T1Y E;  3ADG A;  2L2N A;  4AQY E;  2CPN A;  2UUC E;  2L33 A;  4DR3 E;  1HR0 E;  1YZ9 A;  4JYA E;  3C4T A;  1STU A;  3C4B A;  1WHN A;  3VYX A;  1X48 A;  1ZBT A;  4NXN E;  1YYO A;  4X65 E;  1N32 E;  2UUA E;  1J5E E;  2NUE A;  1PKP A;  2RS6 A;  3ADL A;  2JVA A;  3VYY A;  4LFA E;  1N36 E;  4WYQ B;  5BR8 E;  4JI0 E;  4B3R E;  4DUZ E;  4JI2 E;  2EZ6 A;  2N3G A;  4JI6 E;  4DV7 E;  1WHQ A;  1X47 A;  4B3S E;  4X64 E;  4LFC E;  1N33 E;  4M30 A;  4OOG C;  1RQ0 A;  2LJH A;  1IBL E;  2DIX A;  2IHR 1;  4DV4 E;  4DV6 E;  4KHP E;  4DR7 E;  1FJG E;  1T4N A;  4DR6 E;  4JI7 E;  2UXB E;  1T4O A;  1EKZ A;  4LF7 E;  4K0K E;  1HNX E;  4X8W A;  1QU6 A;  4X62 E;  2NA2 A;  4JI5 E;  2RSM A;  2B7T A;  1GQE A;  2UXC E;  2KHX A;  1HNZ E;  4JV5 E;  2LUQ A;  4YHH E;  1RC7 A;  1IBM E;  4B3T E;  4DR4 E;  4GKK E;  1FKA E;  2L2M A;  4LF8 E;  2VQE E;  3P1X A; 
#chains in the Genus database with same CATH topology
 4R2A A;  2EM7 A;  1XNR E;  2JY9 A;  2A25 A;  3ADJ A;  4M0V A;  5AE1 A;  3AV0 A;  5LLQ A;  1EH8 A;  2RS7 A;  4F2J C;  2EMX A;  2ZM6 E;  3T1H E;  2YTQ A;  2LTR A;  1IQO A;  4R2E A;  4DV3 E;  2YSO A;  1EH7 A;  1N34 E;  4DMI A;  4JI4 E;  1YFH A;  4LF6 E;  4LF9 E;  2L3C A;  4WSG A;  3OTO E;  4DV2 E;  1UIL A;  4M9V C;  2B9D A;  1UHZ A;  3BF2 A;  4KWY A;  4OX9 E;  3TQM A;  2LMZ A;  2LV2 A;  2YPN A;  4LU9 A;  4GZN C;  2EN4 A;  2HJJ A;  2M9A A;  1YSA C;  2NAB A;  1DGC A;  4DR2 E;  1HNW E;  4DR1 E;  5A69 A;  4DV1 E;  2DB2 A;  2UXD E;  2EMC A;  1ZBQ A;  1IQS A;  4F9C B;  5F3W A;  4B3M E;  3MHS C;  2WBU A;  2L2N A;  4HEI A;  2EM2 A;  2YTE A;  5A6B D;  1DQ3 A;  2PRT A;  5KL6 A;  3C4T A;  3VYX A;  1X48 A;  1AH5 A;  2EPR A;  2LCE A;  2EQ1 A;  2EQ3 A;  4R2D A;  2EPC A;  2EL4 A;  2EPK X;  2YTJ A;  1GZ6 A;  2EN8 A;  4BC7 A;  3VYY A;  2EQ0 A;  5KL7 A;  2YTI A;  4R8O A;  1PDA A;  2KOU A;  1WJP A;  3JU0 A;  4Q28 A;  4J8Z A;  4JI6 E;  5AC5 A;  2EPU A;  1WHQ A;  2JOX A;  2M1S A;  4B3S E;  4RH8 A;  4TUI A;  2J7J A;  4LFC E;  1KYQ A;  4M30 A;  2YU5 A;  3HPS A;  2LJH A;  3KWR A;  2ENH A;  2EM5 A;  2IHR 1;  4DV4 E;  4KHP E;  2EOX A;  4R03 A;  4DR6 E;  1JK2 A;  5IV8 B;  2UXB E;  5A6K A;  1A1K A;  4HTG A;  4X8W A;  4X62 E;  2VRD A;  1LLM C;  4JI5 E;  2B7T A;  4L5N C;  1GQE A;  2EN1 A;  2EPZ A;  4IS1 C;  2YTG A;  2L92 A;  2UXC E;  1HNZ E;  4JV5 E;  3EPL A;  1X3C A;  3L00 A;  5FLX C;  4B3T E;  1MGT A;  3MSW A;  1N3G A;  4WSP A;  4LF8 E;  2WBT A;  2WBS A;  2MDG A;  1A1L A;  1XMO E;  5IT9 C;  2V86 A;  4R2R A;  4BMJ A;  2LT7 A;  2ENC A;  5T6J A;  4F9B B;  2RPC A;  1XMQ E;  1SFE A;  2EM9 A;  1X6H A;  2JOB A;  5AE2 A;  5DNY A;  1SR9 A;  2R1F A;  4F6M A;  4JI3 E;  3IWB A;  5LMN E;  2KON A;  3HTX A;  2EM6 A;  2EL6 A;  4DV5 E;  4DR5 E;  3AUZ A;  4O5G A;  5ADZ A;  4BHC A;  3BID A;  2LBS B;  3IWC A;  4WXC A;  3THN A;  2YRH A;  3J7A G;  5CFF E;  2ELZ A;  4LTY A;  3EPH A;  3C6M A;  2YTN A;  1IMU A;  4BS9 A;  2L3J A;  3K6Q A;  4O43 A;  1X49 A;  4M2Z A;  2EMK A;  5KL3 A;  1TF3 A;  2NUF A;  3VK6 A;  1G2F C;  2JYA A;  4NZV A;  2EOO A;  1A1I A;  2N3H A;  2JPA A;  2GPI A;  1X6F A;  4AQY E;  2CPN A;  2UUC E;  4DR3 E;  1YZ9 A;  2M4I A;  3UK3 C;  1NCS A;  3MHH C;  2EOJ A;  2JXP A;  2BB8 A;  5A2Q C;  2ENA A;  2L6M A;  2MKN A;  2JVA A;  4LFA E;  3QG5 C;  4MLQ A;  2VE7 C;  4BBY A;  2CTD A;  1G2D C;  5BR8 E;  4GEQ B;  2V89 A;  2G7H A;  3ZOQ B;  1BB8 A;  2VF1 A;  3BGH A;  1T38 A;  1PJS A;  1N33 E;  2MKD A;  2EOQ A;  4DR7 E;  4DV6 E;  2WZO A;  1T4N A;  2WCC 3;  2EPL X;  2EPO A;  4JI7 E;  1T4O A;  2DMI A;  1EKZ A;  4LF7 E;  1HNX E;  1A1H A;  3LML A;  4WXD A;  4R2C A;  2EM0 A;  3HXL A;  1GTK A;  4NHR A;  1ZR9 A;  2H36 X;  2LUQ A;  2Q8U A;  2YTO A;  2L8T A;  2EOZ A;  2V8Q B;  1RC7 A;  1IBM E;  2EPM X;  3JTZ A;  2K4V A;  2EMH A;  2EJ4 A;  2L2M A;  4MLV A;  1WXR A;  2VQE E;  4I8O A;  3P1X A;  2DLK A;  1DI2 A;  2EE8 A;  2FTX B;  2YWQ A;  5IWA E;  2B7V A;  2V88 A;  3EPK A;  2RTX A;  1O0W A;  1IBK E;  4ZYD A;  4RHB B;  5KL2 A;  2DRP A;  2VQF E;  3LLH A;  3ADI A;  2CT1 A;  5A6J A;  2I13 A;  4BCA A;  1J26 A;  2E5L E;  1NEI A;  2LO3 A;  2JWO A;  2DLQ A;  1YPN A;  2LJU A;  4LF4 E;  2HC5 A;  3J81 C;  2UUB E;  2EP3 A;  1A1J A;  5AE3 A;  2HGH A;  1YYK A;  2EMW A;  4GKJ E;  4P7D A;  4LFB E;  4DV0 E;  2DSY A;  2LTS A;  2UU9 E;  2BBG A;  2YZT A;  2LVH A;  3J7Y p;  2EN2 A;  3H09 A;  4NXM E;  2EMB A;  4BC9 A;  3BBG A;  4WFT A;  3DJW A;  1AAY A;  4WPY A;  2DMY A;  2EPP A;  4X66 E;  1EH6 A;  2EOH A;  3C6K A;  2YU8 A;  2L33 A;  1HR0 E;  2ODR C;  2ELY A;  4Q35 B;  3C4B A;  2EN3 A;  2EMZ A;  3DF6 A;  4NXN E;  1N32 E;  4X65 E;  2MC5 A;  1X5W A;  4O24 A;  1ZAA C;  2NUE A;  2E72 A;  5TSE A;  1PKP A;  2RS6 A;  2EOI A;  1JK1 A;  3HPZ A;  4WYQ B;  2EM8 A;  4JI0 E;  2EZ6 A;  4FK5 C;  4DV7 E;  1ZU1 A;  1Z1B A;  1X47 A;  1TN9 A;  4P78 A;  1BBO A;  4OOG C;  1RQ0 A;  2EMY A;  1B69 A;  2DIX A;  2FGG A;  4ZYE A;  2EN6 A;  2GHF A;  3EQ1 A;  3OML A;  5AC4 A;  2ODR D;  3KZZ A;  2EM4 A;  3KZY A;  4KZS A;  4X9J A;  4YHH E;  3THO B;  3J80 C;  4WX9 A;  2EMI A;  2EPX A;  1FKA E;  2K7I A;  4R2Q A;  1YUJ A;  4L8N A;  2V83 A;  1KJK A;  5KL4 A;  3HQ1 A;  3EPJ A;  2I9I A;  4F6N A;  5KL5 A;  2YTD A;  4JI1 E;  1XNQ E;  2YT4 A;  2JP9 A;  5AAS A;  4R2S A;  5IXM B;  4JI8 E;  2EL5 A;  4LF5 E;  2EML A;  1P47 A;  1A1G A;  2FV4 B;  2L2K B;  1T4L B;  1UN6 B;  2LE2 A;  4N4R B;  2B3T B;  1PJT A;  2NUG A;  1MEY C;  5A6A A;  5LMU E;  2GLI A;  5LL6 R;  4R2P A;  4DKK A;  2LRS A;  2RSI A;  2F4V E;  4YY3 E;  4BHB A;  2LUP B;  1QNT A;  2YSP A;  4DUY E;  4F9A B;  1I94 E;  2RQL A;  2MDR A;  3F6G A;  2HHH E;  2YTF A;  1YYW A;  3VHT B;  2ADR A;  1X6E A;  2YRK A;  3T1Y E;  3ADG A;  1TF6 A;  3M99 B;  2JR1 A;  2MC6 A;  2EMA A;  4TUG A;  4JYA E;  1STU A;  1RMD A;  1WHN A;  4F54 A;  1ZBT A;  1YYO A;  4ZYH A;  2UUA E;  1J5E E;  2YRM A;  1F2I G;  2DGC A;  3ADL A;  2EOY A;  2EOR A;  3IWD A;  1N36 E;  2YTP A;  4B3R E;  3ECR A;  4DUZ E;  4JI2 E;  2N3G A;  2V87 A;  2EMF A;  3RMP A;  2EM3 A;  1L4S A;  2M7Q A;  2N8X A;  2E1M A;  4X64 E;  2EPA A;  4IJD A;  2EMG A;  2EOM A;  2V85 A;  1IBL E;  1PJQ A;  1FJG E;  2EOF A;  4O4K A;  4K0K E;  2EOS A;  1QU6 A;  3F6H A;  1YUI A;  2NA2 A;  5A6B A;  3FIG A;  2EPN A;  1WRJ A;  3JAM C;  2RSM A;  1BBG A;  2F8B A;  2KHX A;  2CSH A;  2EWL A;  1T39 A;  2R76 A;  1A1F A;  2EOE A;  4DR4 E;  4GKK E;  2D9H A;  1UBD C;  2EN7 A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 1DI2 A;  2FTX B;  3HQ1 A;  5IWA E;  1XMO E;  2B7V A;  2V88 A;  1XNR E;  2RTX A;  2JY9 A;  5IT9 C;  2V86 A;  3ADJ A;  1O0W A;  1IBK E;  4M0V A;  4BMJ A;  3AV0 A;  2YT4 A;  5T6J A;  5AE1 A;  4F9B B;  2VQF E;  1XNQ E;  5AAS A;  3LLH A;  1XMQ E;  3ADI A;  2RS7 A;  4JI8 E;  4BCA A;  2ZM6 E;  3T1H E;  1J26 A;  2LTR A;  2JOB A;  2E5L E;  4LF5 E;  5AE2 A;  5DNY A;  1SR9 A;  4DV3 E;  1N34 E;  4DMI A;  2FV4 B;  2JWO A;  2L2K B;  1T4L B;  2LE2 A;  4LF4 E;  2B3T B;  4JI3 E;  4JI4 E;  2NUG A;  3IWB A;  5LMN E;  2KON A;  3HTX A;  4LF6 E;  4DV5 E;  4DR5 E;  4LF9 E;  3AUZ A;  3J81 C;  5LMU E;  2UUB E;  2L3C A;  3OTO E;  5AE3 A;  1YYK A;  5ADZ A;  4DV2 E;  5LL6 R;  1UIL A;  2B9D A;  2LBS B;  1UHZ A;  3IWC A;  4P7D A;  4GKJ E;  4DKK A;  2LRS A;  4OX9 E;  5CFF E;  4LTY A;  2LMZ A;  4LU9 A;  4YY3 E;  3J7A G;  2F4V E;  2LUP B;  4LFB E;  4DV0 E;  2DSY A;  2LTS A;  4BS9 A;  2L3J A;  2UU9 E;  2YZT A;  3K6Q A;  4DUY E;  4F9A B;  4DR2 E;  3J7Y p;  1X49 A;  1HNW E;  1I94 E;  3H09 A;  4DR1 E;  4M2Z A;  4BC9 A;  4NXM E;  2MDR A;  2NUF A;  3F6G A;  4DV1 E;  3VK6 A;  2DB2 A;  2UXD E;  4WFT A;  3DJW A;  2HHH E;  1ZBQ A;  4F9C B;  4WPY A;  5F3W A;  2DMY A;  1YYW A;  4X66 E;  4B3M E;  2N3H A;  3T1Y E;  3ADG A;  2L2N A;  4AQY E;  2CPN A;  2JR1 A;  2UUC E;  1DQ3 A;  2L33 A;  2ODR C;  2MC6 A;  4DR3 E;  2M4I A;  1HR0 E;  4TUG A;  1YZ9 A;  4JYA E;  3C4T A;  1STU A;  3C4B A;  1WHN A;  4F54 A;  1X48 A;  3DF6 A;  3VYX A;  1ZBT A;  4NXN E;  1YYO A;  4X65 E;  1N32 E;  2MC5 A;  5A2Q C;  1J5E E;  2UUA E;  2NUE A;  2L6M A;  1GZ6 A;  1PKP A;  2RS6 A;  3ADL A;  2JVA A;  4BC7 A;  3VYY A;  4LFA E;  2VE7 C;  4BBY A;  3HPZ A;  3IWD A;  4R8O A;  4WYQ B;  1N36 E;  5BR8 E;  2KOU A;  4JI0 E;  4B3R E;  4GEQ B;  4DUZ E;  3JU0 A;  4Q28 A;  4JI2 E;  2EZ6 A;  2N3G A;  2V87 A;  4J8Z A;  2V89 A;  4JI6 E;  3RMP A;  2G7H A;  3ZOQ B;  4DV7 E;  1WHQ A;  2JOX A;  2M1S A;  2VF1 A;  1X47 A;  2M7Q A;  4B3S E;  4JI1 E;  2E1M A;  4X64 E;  4P78 A;  4TUI A;  4LFC E;  1N33 E;  4M30 A;  4OOG C;  3HPS A;  1RQ0 A;  2LJH A;  2V85 A;  3KWR A;  2DIX A;  2FGG A;  2IHR 1;  4DV4 E;  4DV6 E;  2WZO A;  1IBL E;  1FJG E;  4KHP E;  1T4N A;  4R03 A;  4DR6 E;  4JI7 E;  2UXB E;  1T4O A;  1EKZ A;  4LF7 E;  4K0K E;  1HNX E;  4X8W A;  1QU6 A;  3F6H A;  4X62 E;  2NA2 A;  3FIG A;  3OML A;  4JI5 E;  3JAM C;  2ODR D;  3LML A;  2RSM A;  2B7T A;  4L5N C;  1GQE A;  2F8B A;  3HXL A;  2UXC E;  2KHX A;  2L92 A;  4KZS A;  1HNZ E;  2EWL A;  4JV5 E;  2H36 X;  2LUQ A;  4YHH E;  2L8T A;  2V8Q B;  3J80 C;  1RC7 A;  5FLX C;  1IBM E;  4B3T E;  4DR4 E;  4GKK E;  4DR7 E;  3MSW A;  3JTZ A;  2K4V A;  2L2M A;  4WSP A;  1FKA E;  1WXR A;  4L8N A;  4LF8 E;  2VQE E;  2V83 A;  4I8O A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...