2B7TA

Structure of adar2 dsrbm1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 18
structure length 73
sequence length 73
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7tA00
2MDRA 2RSMA 4M30A 4NXNE 2N3HA 1X47A 4OOGC 1XMQE 2UUAE 3C4BA 1T4OA 2B3TB 4DV5E 2NUEA 4JI7E 1UILA 4DR2E 2UXCE 2NUGA 3C4TA 2JVAA 1N33E 4B3ME 1QU6A 1DI2A 2LUQA 4JI1E 1FJGE 2L33A 3ADGA 5IWAE 4B3RE 3T1HE 4LF6E 4B3TE 1X49A 1YYOA 1YYWA 1STUA 4X66E 5LMNE 4DR7E 2UXBE 4K0KE 3LLHA 3J7Yp 4DR6E 3ADLA 2DB2A 2VQFE 1HNXE 1RC7A 4X8WA 1T4LB 3P1XA 4JI2E 2KHXA 4DKKA 1N32E 4DV1E 3T1YE 2UXDE 4LF9E 5LMUE 1XNRE 4JI4E 4DUYE 4LFAE 2LUPB 4YY3E 1HNZE 3HTXA 4LF4E 4JI5E 4LFBE 4DV2E 2DIXA 2UU9E 1YYKA 2LJHA 2LRSA 4B3SE 2N3GA 2LTSA 2LBSB 2RS7A 2B7TA 4YHHE 1UHZA 2ZM6E 1GQEA 3ADIA 2RTXA 4X64E 1IBME 3OTOE 1WHNA 4X65E 1WHQA 1J5EE 1FKAE 4JI3E 1O0WA 4X62E 1T4NA 2L3CA 2E5LE 1J26A 3VYYA 1I94E 4KHPE 4WYQB 2L2NA 4DUZE 4NXME 1RQ0A 1N34E 4OX9E 4DV0E 2RS6A 4DR1E 4LFCE 2UUBE 1EKZA 2L3JA 1XMOE 2L2MA 1X48A 2F4VE 4DR4E 4JI6E 1ZBTA 3VYXA 4JYAE 1XNQE 2LTRA 4LF7E 4JI8E 4AQYE 2JY9A 2L2KB 1IBLE 1YZ9A 4WFTA 4DR3E 2DMYA 4LF5E 2HHHE 1N36E 2NUFA 4LF8E 1IBKE 5CFFE 2UUCE 4JI0E 3ADJA 4DR5E 4GKJE 2IHR1 1HNWE 4DV6E 2CPNA 4M2ZA 2NA2A 2B7VA 4DV3E 2YT4A 1HR0E 2EZ6A 2VQEE 4GKKE 4DV7E 4DV4E 5BR8E 1PKPA 4JV5E
chains in the Genus database with same CATH superfamily
1MEYC 2ENCA 4F6MA 5F3WA 3ZOQB 2DSYA 3AUZA 1T4OA 3C4BA 4ZYHA 4ZYEA 1YUIA 5KL7A 2NUEA 4JI7E 5AASA 2EMIA 4L8NA 2EM2A 1N33E 4B3ME 3VK6A 1X6HA 1A1HA 2CT1A 4O43A 1IQSA 3VHTB 3T1HE 1X5WA 4LF6E 2EPZA 3BGHA 2L92A 3EPHA 2V83A 1PJSA 1EH6A 2I13A 3LLHA 2YTIA 2Q8UA 1ZAAC 2EJ4A 1JK1A 2EQ0A 1T4LB 2JWOA 4R2QA 2DMIA 2EL4A 5T6JA 2UXDE 2EN7A 4LFAE 2LUPB 2EOSA 4L5NC 4KZSA 4LF4E 2GHFA 4DV2E 1YYKA 4O5GA 5AC4A 2EN1A 2EORA 2JP9A 2EWLA 2B7TA 2EMXA 1UHZA 2RPCA 3BIDA 4P78A 1GZ6A 1T38A 5KL2A 2ELYA 1UN6B 2MC6A 1IBME 2F8BA 1SR9A 4BBYA 5AE3A 2EN4A 1J5EE 2HJJA 2MKDA 4JI3E 4O4KA 4X62E 2E5LE 3EPKA 4WYQB 2EPNA 1TF6A 2YZTA 3LMLA 4OX9E 2EMWA 1IMUA 3BF2A 2DLKA 3BBGA 2EL5A 3L00A 1WRJA 5ADZA 2L2KB 1YZ9A 2H36X 2EOYA 1A1LA 2LV2A 2V87A 2DLQA 4LF5E 1YFHA 2YTPA 2HHHE 2NUFA 4RHBB 2EQ1A 5AE2A 5CFFE 1HNWE 4Q28A 3C6KA 4WSPA 2EMCA 2EPUA 1UBDC 2MDGA 2NA2A 5DNYA 2YPNA 4DV4E 4NHRA 5BR8E 1PKPA 1DQ3A 4IJDA 2MDRA 4NXNE 2KOUA 4R2RA 2WBTA 2EN6A 2WZOA 2ENHA 4X9JA 4BS9A 2B3TB 3M99B 1A1KA 2BBGA 4IS1C 2UXCE 1Z1BA 1QU6A 1DI2A 1MGTA 2VRDA 2YSPA 4F54A 2YTJA 3ADGA 4BHBA 5IWAE 2E1MA 2VF1A 1T39A 3MSWA 5KL5A 1YYWA 5LMNE 2EOQA 4I8OA 5KL3A 1G2FC 4R2SA 3EPLA 2WBUA 2K4VA 4DR6E 3ADLA 2DB2A 3RMPA 2VQFE 1B69A 3THNA 2JR1A 1HNXE 2FGGA 1RC7A 1EH7A 2E72A 2ODRC 2R1FA 2ENAA 4TUIA 1BBGA 3T1YE 1XNRE 5LMUE 2HGHA 4JI4E 4DUYE 4YY3E 2EQ3A 2V85A 4LFBE 2EM9A 2DIXA 2LRSA 2LTSA 3HPZA 2M7QA 2RS7A 1A1IA 4BC9A 3KZZA 2V89A 1GQEA 5A6BD 2RTXA 4DMIA 1WHNA 2JOXA 4J8ZA 1FKAE 1WXRA 1O0WA 2EPLX 1KJKA 3DF6A 4Q35B 4KHPE 2FTXB 2L2NA 2VE7C 4DUZE 2FV4B 1RQ0A 5KL6A 1N34E 1NCSA 4DR1E 5TSEA 2EMBA 4M0VA 1XMOE 2YRKA 2JYAA 3VYXA 4LF7E 4JI8E 4AQYE 2JY9A 1RMDA 4DR3E 2EOIA 1N36E 3JTZA 4LF8E 2YWQA 2LCEA 2UUCE 4GKJE 3HQ1A 1G2DC 2CPNA 4ZYDA 1ZU1A 2EOHA 2EMYA 2EM8A 2M1SA 2EPCA 1HR0E 5A69A 2YT4A 4DV3E 2VQEE 2N8XA 4GKKE 1PDAA 5A6KA 4JV5E 2EM4A 4R2CA 3JU0A 2RSMA 4M30A 2N3HA 4TUGA 5KL4A 2CSHA 1P47A 1X47A 4OOGC 2UUAE 5A6AA 2ELZA 4DV5E 1UILA 3C6MA 2EN3A 5FLXC 2JVAA 4HEIA 3DJWA 1FJGE 1AAYA 1N3GA 4B3RE 4WXDA 1X49A 2KONA 1STUA 2EOFA 1ZR9A 4MLVA 3J7AG 3IWBA 2EN2A 1WJPA 4DR7E 2I9IA 2EOOA 4WSGA 3J7Yp 3TQMA 2YTGA 1A1GA 1YUJA 4X8WA 3P1XA 2WCC3 4JI2E 2KHXA 1TF3A 2WBSA 1A1JA 2YTDA 1N32E 2L6MA 2RQLA 1HNZE 1JK2A 3HTXA 2R76A 2NABA 2EM0A 4JI5E 2M4IA 2LT7A 5LLQA 2LJHA 2N3GA 5A2QC 2LBSB 4YHHE 2EP3A 2G7HA 2EL6A 3J81C 3ADIA 3EQ1A 2EPKX 2LJUA 2GPIA 4X64E 2EE8A 1WHQA 2YTFA 4BHCA 2L3CA 2EMAA 3F6HA 3VYYA 2A25A 4R2AA 2EMKA 4R8OA 2PRTA 2EN8A 4DV0E 2LMZA 2RS6A 3IWCA 4NZVA 2ADRA 1EKZA 2L3JA 2L2MA 4DR4E 4JI6E 4JYAE 2B9DA 4HTGA 1IBLE 5AE1A 4WFTA 2EM7A 2ODRD 1NEIA 2YSOA 1L4SA 1IBKE 4JI0E 2IHR1 2HC5A 4WXCA 2EM6A 2YU5A 4M2ZA 4R2DA 5A6JA 2EMLA 2L8TA 2YRHA 5LL6R 2EPRA 4BCAA 4DV7E 2YU8A 2YTOA 3H09A 2JOBA 4F9BB 1PJQA 1KYQA 1X3CA 2LVHA 1XMQE 2MC5A 2EM3A 4F9AB 4WPYA 4DR2E 2NUGA 2LO3A 3C4TA 2EMFA 2YTQA 4WX9A 3J80C 2LUQA 4JI1E 1BB8A 4O24A 2L33A 2YTNA 4FK5C 3F6GA 4B3TE 4BC7A 2EOMA 2JPAA 1YYOA 2EMGA 3UK3C 2MKNA 2JXPA 4GZNC 3FIGA 4F6NA 4X66E 2V86A 1YSAC 2V88A 3HPSA 3KZYA 2UXBE 4K0KE 2EPOA 5IT9C 2EPAA 1SFEA 2EMZA 4LU9A 4RH8A 2GLIA 2CTDA 4KWYA 1X6EA 3HXLA 4M9VC 3IWDA 2EOEA 4R2EA 4DKKA 4F2JC 4DV1E 4R03A 2DRPA 4LF9E 2EOZA 2BB8A 2M9AA 3KWRA 4P7DA 2UU9E 4MLQA 4R2PA 4F9CB 4B3SE 2K7IA 2LE2A 2ZM6E 1LLMC 3MHSC 1IQOA 3JAMC 4ZYGA 4GEQB 5AC5A 1BBOA 2EPPA 3ECRA 1X6FA 3OTOE 4X65E 1A1FA 1GTKA 1T4NA 3EPJA 3OMLA 1J26A 1I94E 1DGCA 4NXME 2RSIA 2J7JA 2EMHA 4LFCE 1QNTA 5IXMB 2UUBE 2EM5A 1AH5A 4LTYA 2F4VE 1X48A 1ZBTA 1XNQE 2LTRA 2EPMX 4N4RB 1PJTA 4BMJA 2DMYA 2DGCA 3AV0A 2EOJA 1EH8A 3THOB 3ADJA 4DR5E 2D9HA 1YPNA 4DV6E 2YRMA 2V8QB 1ZBQA 2B7VA 2EPXA 2YTEA 5IV8B 1TN9A 2EZ6A 3MHHC 3QG5C 3K6QA 2EOXA 1F2IG 5A6BA
chains in the Genus database with same CATH topology
3JU0A 2MDRA 2RSMA 2KOUA 4M30A 4NXNE 2N3HA 3H09A 2JOBA 4F9BB 4TUGA 5F3WA 1X47A 3ZOQB 2WZOA 4OOGC 1XMQE 2UUAE 2DSYA 3AUZA 1T4OA 2MC5A 3C4BA 4BS9A 2B3TB 4DV5E 4F9AB 4JI7E 4WPYA 1UILA 5AASA 4L8NA 4DR2E 2NUEA 2NUGA 3C4TA 2JVAA 5FLXC 2UXCE 1N33E 4B3ME 1QU6A 3VK6A 3J80C 2LUQA 4JI1E 1DI2A 3DJWA 4F54A 1FJGE 2L33A 3ADGA 5IWAE 4B3RE 3T1HE 4LF6E 3F6GA 4B3TE 2E1MA 1X49A 4BC7A 2VF1A 1YYOA 2L92A 3MSWA 2KONA 2V83A 3FIGA 1STUA 1YYWA 4X66E 2V86A 3J7AG 2V88A 3HPSA 5LMNE 4I8OA 3IWBA 4DR7E 2UXBE 4K0KE 5IT9C 3LLHA 4LU9A 2K4VA 3J7Yp 4DR6E 3ADLA 2DB2A 3RMPA 2VQFE 2JR1A 1HNXE 2FGGA 1RC7A 2UXDE 3HXLA 4X8WA 1T4LB 2JWOA 3P1XA 3IWDA 2ODRC 4JI2E 4TUIA 2KHXA 4DKKA 1N32E 5T6JA 4R03A 4DV1E 3T1YE 5LMUE 4LF9E 4JI4E 1XNRE 4DUYE 2L6MA 2LUPB 4YY3E 1HNZE 4LFAE 3HTXA 4L5NC 4KZSA 3KWRA 2V85A 4LF4E 4JI5E 4P7DA 2M4IA 4LFBE 4DV2E 2DIXA 2UU9E 1YYKA 2LJHA 2LRSA 4F9CB 4B3SE 2N3GA 5A2QC 2LTSA 2LBSB 2LE2A 3HPZA 2EWLA 2RS7A 2M7QA 2B7TA 4BC9A 4YHHE 1UHZA 2ZM6E 2G7HA 2V89A 1GQEA 3J81C 3ADIA 4P78A 1GZ6A 3JAMC 2RTXA 4GEQB 4X64E 2MC6A 4DMIA 1IBME 3OTOE 1WHNA 1SR9A 1WHQA 2F8BA 4BBYA 2JOXA 4J8ZA 5AE3A 4X65E 1J5EE 1FKAE 4JI3E 1WXRA 1O0WA 4X62E 1T4NA 2L3CA 3OMLA 2E5LE 1J26A 3DF6A 3F6HA 3VYYA 1I94E 4KHPE 2FTXB 2L2NA 2VE7C 4WYQB 2FV4B 4DUZE 4NXME 1RQ0A 2YZTA 1N34E 4R8OA 3LMLA 4OX9E 4DV0E 2RS6A 2LMZA 4DR1E 4LFCE 3IWCA 2UUBE 4M0VA 1EKZA 2L3JA 1XMOE 4LTYA 2L2MA 1X48A 2F4VE 4DR4E 4JI6E 1ZBTA 3VYXA 4JYAE 1XNQE 5ADZA 2LTRA 2B9DA 4JI8E 4LF7E 4AQYE 2JY9A 2L2KB 1IBLE 5AE1A 1YZ9A 2H36X 4WFTA 4BMJA 2ODRD 2V87A 4DR3E 2DMYA 4LF5E 2HHHE 3AV0A 1N36E 2NUFA 3JTZA 4LF8E 1IBKE 5AE2A 5CFFE 2UUCE 4JI0E 3ADJA 4DR5E 4Q28A 2IHR1 4GKJE 1HNWE 3HQ1A 4WSPA 4DV6E 2CPNA 4M2ZA 2V8QB 2NA2A 2M1SA 5DNYA 2L8TA 1ZBQA 2B7VA 2YT4A 5LL6R 4DV3E 1HR0E 2VQEE 2EZ6A 4BCAA 4GKKE 4DV7E 4DV4E 5BR8E 1PKPA 3K6QA 4JV5E 1DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDR A;  2RSM A;  4M30 A;  4NXN E;  2N3H A;  1X47 A;  4OOG C;  1XMQ E;  2UUA E;  3C4B A;  1T4O A;  2B3T B;  4DV5 E;  2NUE A;  4JI7 E;  1UIL A;  4DR2 E;  2UXC E;  2NUG A;  3C4T A;  2JVA A;  1N33 E;  4B3M E;  1QU6 A;  1DI2 A;  2LUQ A;  4JI1 E;  1FJG E;  2L33 A;  3ADG A;  5IWA E;  4B3R E;  3T1H E;  4LF6 E;  4B3T E;  1X49 A;  1YYO A;  1YYW A;  1STU A;  4X66 E;  5LMN E;  4DR7 E;  2UXB E;  4K0K E;  3LLH A;  3J7Y p;  4DR6 E;  3ADL A;  2DB2 A;  2VQF E;  1HNX E;  1RC7 A;  4X8W A;  1T4L B;  3P1X A;  4JI2 E;  2KHX A;  4DKK A;  1N32 E;  4DV1 E;  3T1Y E;  2UXD E;  4LF9 E;  5LMU E;  1XNR E;  4JI4 E;  4DUY E;  4LFA E;  2LUP B;  4YY3 E;  1HNZ E;  3HTX A;  4LF4 E;  4JI5 E;  4LFB E;  4DV2 E;  2DIX A;  2UU9 E;  1YYK A;  2LJH A;  2LRS A;  4B3S E;  2N3G A;  2LTS A;  2LBS B;  2RS7 A;  2B7T A;  4YHH E;  1UHZ A;  2ZM6 E;  1GQE A;  3ADI A;  2RTX A;  4X64 E;  1IBM E;  3OTO E;  1WHN A;  4X65 E;  1WHQ A;  1J5E E;  1FKA E;  4JI3 E;  1O0W A;  4X62 E;  1T4N A;  2L3C A;  2E5L E;  1J26 A;  3VYY A;  1I94 E;  4KHP E;  4WYQ B;  2L2N A;  4DUZ E;  4NXM E;  1RQ0 A;  1N34 E;  4OX9 E;  4DV0 E;  2RS6 A;  4DR1 E;  4LFC E;  2UUB E;  1EKZ A;  2L3J A;  1XMO E;  2L2M A;  1X48 A;  2F4V E;  4DR4 E;  4JI6 E;  1ZBT A;  3VYX A;  4JYA E;  1XNQ E;  2LTR A;  4LF7 E;  4JI8 E;  4AQY E;  2JY9 A;  2L2K B;  1IBL E;  1YZ9 A;  4WFT A;  4DR3 E;  2DMY A;  4LF5 E;  2HHH E;  1N36 E;  2NUF A;  4LF8 E;  1IBK E;  5CFF E;  2UUC E;  4JI0 E;  3ADJ A;  4DR5 E;  4GKJ E;  2IHR 1;  1HNW E;  4DV6 E;  2CPN A;  4M2Z A;  2NA2 A;  2B7V A;  4DV3 E;  2YT4 A;  1HR0 E;  2EZ6 A;  2VQE E;  4GKK E;  4DV7 E;  4DV4 E;  5BR8 E;  1PKP A;  4JV5 E; 
#chains in the Genus database with same CATH topology
 1MEY C;  2ENC A;  4F6M A;  5F3W A;  3ZOQ B;  2DSY A;  3AUZ A;  1T4O A;  3C4B A;  4ZYH A;  4ZYE A;  1YUI A;  5KL7 A;  2NUE A;  4JI7 E;  5AAS A;  2EMI A;  4L8N A;  2EM2 A;  1N33 E;  4B3M E;  3VK6 A;  1X6H A;  1A1H A;  2CT1 A;  4O43 A;  1IQS A;  3VHT B;  3T1H E;  1X5W A;  4LF6 E;  2EPZ A;  3BGH A;  2L92 A;  3EPH A;  2V83 A;  1PJS A;  1EH6 A;  2I13 A;  3LLH A;  2YTI A;  2Q8U A;  1ZAA C;  2EJ4 A;  1JK1 A;  2EQ0 A;  1T4L B;  2JWO A;  4R2Q A;  2DMI A;  2EL4 A;  5T6J A;  2UXD E;  2EN7 A;  4LFA E;  2LUP B;  2EOS A;  4L5N C;  4KZS A;  4LF4 E;  2GHF A;  4DV2 E;  1YYK A;  4O5G A;  5AC4 A;  2EN1 A;  2EOR A;  2JP9 A;  2EWL A;  2B7T A;  2EMX A;  1UHZ A;  2RPC A;  3BID A;  4P78 A;  1GZ6 A;  1T38 A;  5KL2 A;  2ELY A;  1UN6 B;  2MC6 A;  1IBM E;  2F8B A;  1SR9 A;  4BBY A;  5AE3 A;  2EN4 A;  1J5E E;  2HJJ A;  2MKD A;  4JI3 E;  4O4K A;  4X62 E;  2E5L E;  3EPK A;  4WYQ B;  2EPN A;  1TF6 A;  2YZT A;  3LML A;  4OX9 E;  2EMW A;  1IMU A;  3BF2 A;  2DLK A;  3BBG A;  2EL5 A;  3L00 A;  1WRJ A;  5ADZ A;  2L2K B;  1YZ9 A;  2H36 X;  2EOY A;  1A1L A;  2LV2 A;  2V87 A;  2DLQ A;  4LF5 E;  1YFH A;  2YTP A;  2HHH E;  2NUF A;  4RHB B;  2EQ1 A;  5AE2 A;  5CFF E;  1HNW E;  4Q28 A;  3C6K A;  4WSP A;  2EMC A;  2EPU A;  1UBD C;  2MDG A;  2NA2 A;  5DNY A;  2YPN A;  4DV4 E;  4NHR A;  5BR8 E;  1PKP A;  1DQ3 A;  4IJD A;  2MDR A;  4NXN E;  2KOU A;  4R2R A;  2WBT A;  2EN6 A;  2WZO A;  2ENH A;  4X9J A;  4BS9 A;  2B3T B;  3M99 B;  1A1K A;  2BBG A;  4IS1 C;  2UXC E;  1Z1B A;  1QU6 A;  1DI2 A;  1MGT A;  2VRD A;  2YSP A;  4F54 A;  2YTJ A;  3ADG A;  4BHB A;  5IWA E;  2E1M A;  2VF1 A;  1T39 A;  3MSW A;  5KL5 A;  1YYW A;  5LMN E;  2EOQ A;  4I8O A;  5KL3 A;  1G2F C;  4R2S A;  3EPL A;  2WBU A;  2K4V A;  4DR6 E;  3ADL A;  2DB2 A;  3RMP A;  2VQF E;  1B69 A;  3THN A;  2JR1 A;  1HNX E;  2FGG A;  1RC7 A;  1EH7 A;  2E72 A;  2ODR C;  2R1F A;  2ENA A;  4TUI A;  1BBG A;  3T1Y E;  1XNR E;  5LMU E;  2HGH A;  4JI4 E;  4DUY E;  4YY3 E;  2EQ3 A;  2V85 A;  4LFB E;  2EM9 A;  2DIX A;  2LRS A;  2LTS A;  3HPZ A;  2M7Q A;  2RS7 A;  1A1I A;  4BC9 A;  3KZZ A;  2V89 A;  1GQE A;  5A6B D;  2RTX A;  4DMI A;  1WHN A;  2JOX A;  4J8Z A;  1FKA E;  1WXR A;  1O0W A;  2EPL X;  1KJK A;  3DF6 A;  4Q35 B;  4KHP E;  2FTX B;  2L2N A;  2VE7 C;  4DUZ E;  2FV4 B;  1RQ0 A;  5KL6 A;  1N34 E;  1NCS A;  4DR1 E;  5TSE A;  2EMB A;  4M0V A;  1XMO E;  2YRK A;  2JYA A;  3VYX A;  4LF7 E;  4JI8 E;  4AQY E;  2JY9 A;  1RMD A;  4DR3 E;  2EOI A;  1N36 E;  3JTZ A;  4LF8 E;  2YWQ A;  2LCE A;  2UUC E;  4GKJ E;  3HQ1 A;  1G2D C;  2CPN A;  4ZYD A;  1ZU1 A;  2EOH A;  2EMY A;  2EM8 A;  2M1S A;  2EPC A;  1HR0 E;  5A69 A;  2YT4 A;  4DV3 E;  2VQE E;  2N8X A;  4GKK E;  1PDA A;  5A6K A;  4JV5 E;  2EM4 A;  4R2C A;  3JU0 A;  2RSM A;  4M30 A;  2N3H A;  4TUG A;  5KL4 A;  2CSH A;  1P47 A;  1X47 A;  4OOG C;  2UUA E;  5A6A A;  2ELZ A;  4DV5 E;  1UIL A;  3C6M A;  2EN3 A;  5FLX C;  2JVA A;  4HEI A;  3DJW A;  1FJG E;  1AAY A;  1N3G A;  4B3R E;  4WXD A;  1X49 A;  2KON A;  1STU A;  2EOF A;  1ZR9 A;  4MLV A;  3J7A G;  3IWB A;  2EN2 A;  1WJP A;  4DR7 E;  2I9I A;  2EOO A;  4WSG A;  3J7Y p;  3TQM A;  2YTG A;  1A1G A;  1YUJ A;  4X8W A;  3P1X A;  2WCC 3;  4JI2 E;  2KHX A;  1TF3 A;  2WBS A;  1A1J A;  2YTD A;  1N32 E;  2L6M A;  2RQL A;  1HNZ E;  1JK2 A;  3HTX A;  2R76 A;  2NAB A;  2EM0 A;  4JI5 E;  2M4I A;  2LT7 A;  5LLQ A;  2LJH A;  2N3G A;  5A2Q C;  2LBS B;  4YHH E;  2EP3 A;  2G7H A;  2EL6 A;  3J81 C;  3ADI A;  3EQ1 A;  2EPK X;  2LJU A;  2GPI A;  4X64 E;  2EE8 A;  1WHQ A;  2YTF A;  4BHC A;  2L3C A;  2EMA A;  3F6H A;  3VYY A;  2A25 A;  4R2A A;  2EMK A;  4R8O A;  2PRT A;  2EN8 A;  4DV0 E;  2LMZ A;  2RS6 A;  3IWC A;  4NZV A;  2ADR A;  1EKZ A;  2L3J A;  2L2M A;  4DR4 E;  4JI6 E;  4JYA E;  2B9D A;  4HTG A;  1IBL E;  5AE1 A;  4WFT A;  2EM7 A;  2ODR D;  1NEI A;  2YSO A;  1L4S A;  1IBK E;  4JI0 E;  2IHR 1;  2HC5 A;  4WXC A;  2EM6 A;  2YU5 A;  4M2Z A;  4R2D A;  5A6J A;  2EML A;  2L8T A;  2YRH A;  5LL6 R;  2EPR A;  4BCA A;  4DV7 E;  2YU8 A;  2YTO A;  3H09 A;  2JOB A;  4F9B B;  1PJQ A;  1KYQ A;  1X3C A;  2LVH A;  1XMQ E;  2MC5 A;  2EM3 A;  4F9A B;  4WPY A;  4DR2 E;  2NUG A;  2LO3 A;  3C4T A;  2EMF A;  2YTQ A;  4WX9 A;  3J80 C;  2LUQ A;  4JI1 E;  1BB8 A;  4O24 A;  2L33 A;  2YTN A;  4FK5 C;  3F6G A;  4B3T E;  4BC7 A;  2EOM A;  2JPA A;  1YYO A;  2EMG A;  3UK3 C;  2MKN A;  2JXP A;  4GZN C;  3FIG A;  4F6N A;  4X66 E;  2V86 A;  1YSA C;  2V88 A;  3HPS A;  3KZY A;  2UXB E;  4K0K E;  2EPO A;  5IT9 C;  2EPA A;  1SFE A;  2EMZ A;  4LU9 A;  4RH8 A;  2GLI A;  2CTD A;  4KWY A;  1X6E A;  3HXL A;  4M9V C;  3IWD A;  2EOE A;  4R2E A;  4DKK A;  4F2J C;  4DV1 E;  4R03 A;  2DRP A;  4LF9 E;  2EOZ A;  2BB8 A;  2M9A A;  3KWR A;  4P7D A;  2UU9 E;  4MLQ A;  4R2P A;  4F9C B;  4B3S E;  2K7I A;  2LE2 A;  2ZM6 E;  1LLM C;  3MHS C;  1IQO A;  3JAM C;  4ZYG A;  4GEQ B;  5AC5 A;  1BBO A;  2EPP A;  3ECR A;  1X6F A;  3OTO E;  4X65 E;  1A1F A;  1GTK A;  1T4N A;  3EPJ A;  3OML A;  1J26 A;  1I94 E;  1DGC A;  4NXM E;  2RSI A;  2J7J A;  2EMH A;  4LFC E;  1QNT A;  5IXM B;  2UUB E;  2EM5 A;  1AH5 A;  4LTY A;  2F4V E;  1X48 A;  1ZBT A;  1XNQ E;  2LTR A;  2EPM X;  4N4R B;  1PJT A;  4BMJ A;  2DMY A;  2DGC A;  3AV0 A;  2EOJ A;  1EH8 A;  3THO B;  3ADJ A;  4DR5 E;  2D9H A;  1YPN A;  4DV6 E;  2YRM A;  2V8Q B;  1ZBQ A;  2B7V A;  2EPX A;  2YTE A;  5IV8 B;  1TN9 A;  2EZ6 A;  3MHH C;  3QG5 C;  3K6Q A;  2EOX A;  1F2I G;  5A6B A; 
#chains in the Genus database with same CATH homology
 3JU0 A;  2MDR A;  2RSM A;  2KOU A;  4M30 A;  4NXN E;  2N3H A;  3H09 A;  2JOB A;  4F9B B;  4TUG A;  5F3W A;  1X47 A;  3ZOQ B;  2WZO A;  4OOG C;  1XMQ E;  2UUA E;  2DSY A;  3AUZ A;  1T4O A;  2MC5 A;  3C4B A;  4BS9 A;  2B3T B;  4DV5 E;  4F9A B;  4JI7 E;  4WPY A;  1UIL A;  5AAS A;  4L8N A;  4DR2 E;  2NUE A;  2NUG A;  3C4T A;  2JVA A;  5FLX C;  2UXC E;  1N33 E;  4B3M E;  1QU6 A;  3VK6 A;  3J80 C;  2LUQ A;  4JI1 E;  1DI2 A;  3DJW A;  4F54 A;  1FJG E;  2L33 A;  3ADG A;  5IWA E;  4B3R E;  3T1H E;  4LF6 E;  3F6G A;  4B3T E;  2E1M A;  1X49 A;  4BC7 A;  2VF1 A;  1YYO A;  2L92 A;  3MSW A;  2KON A;  2V83 A;  3FIG A;  1STU A;  1YYW A;  4X66 E;  2V86 A;  3J7A G;  2V88 A;  3HPS A;  5LMN E;  4I8O A;  3IWB A;  4DR7 E;  2UXB E;  4K0K E;  5IT9 C;  3LLH A;  4LU9 A;  2K4V A;  3J7Y p;  4DR6 E;  3ADL A;  2DB2 A;  3RMP A;  2VQF E;  2JR1 A;  1HNX E;  2FGG A;  1RC7 A;  2UXD E;  3HXL A;  4X8W A;  1T4L B;  2JWO A;  3P1X A;  3IWD A;  2ODR C;  4JI2 E;  4TUI A;  2KHX A;  4DKK A;  1N32 E;  5T6J A;  4R03 A;  4DV1 E;  3T1Y E;  5LMU E;  4LF9 E;  4JI4 E;  1XNR E;  4DUY E;  2L6M A;  2LUP B;  4YY3 E;  1HNZ E;  4LFA E;  3HTX A;  4L5N C;  4KZS A;  3KWR A;  2V85 A;  4LF4 E;  4JI5 E;  4P7D A;  2M4I A;  4LFB E;  4DV2 E;  2DIX A;  2UU9 E;  1YYK A;  2LJH A;  2LRS A;  4F9C B;  4B3S E;  2N3G A;  5A2Q C;  2LTS A;  2LBS B;  2LE2 A;  3HPZ A;  2EWL A;  2RS7 A;  2M7Q A;  2B7T A;  4BC9 A;  4YHH E;  1UHZ A;  2ZM6 E;  2G7H A;  2V89 A;  1GQE A;  3J81 C;  3ADI A;  4P78 A;  1GZ6 A;  3JAM C;  2RTX A;  4GEQ B;  4X64 E;  2MC6 A;  4DMI A;  1IBM E;  3OTO E;  1WHN A;  1SR9 A;  1WHQ A;  2F8B A;  4BBY A;  2JOX A;  4J8Z A;  5AE3 A;  4X65 E;  1J5E E;  1FKA E;  4JI3 E;  1WXR A;  1O0W A;  4X62 E;  1T4N A;  2L3C A;  3OML A;  2E5L E;  1J26 A;  3DF6 A;  3F6H A;  3VYY A;  1I94 E;  4KHP E;  2FTX B;  2L2N A;  2VE7 C;  4WYQ B;  2FV4 B;  4DUZ E;  4NXM E;  1RQ0 A;  2YZT A;  1N34 E;  4R8O A;  3LML A;  4OX9 E;  4DV0 E;  2RS6 A;  2LMZ A;  4DR1 E;  4LFC E;  3IWC A;  2UUB E;  4M0V A;  1EKZ A;  2L3J A;  1XMO E;  4LTY A;  2L2M A;  1X48 A;  2F4V E;  4DR4 E;  4JI6 E;  1ZBT A;  3VYX A;  4JYA E;  1XNQ E;  5ADZ A;  2LTR A;  2B9D A;  4JI8 E;  4LF7 E;  4AQY E;  2JY9 A;  2L2K B;  1IBL E;  5AE1 A;  1YZ9 A;  2H36 X;  4WFT A;  4BMJ A;  2ODR D;  2V87 A;  4DR3 E;  2DMY A;  4LF5 E;  2HHH E;  3AV0 A;  1N36 E;  2NUF A;  3JTZ A;  4LF8 E;  1IBK E;  5AE2 A;  5CFF E;  2UUC E;  4JI0 E;  3ADJ A;  4DR5 E;  4Q28 A;  2IHR 1;  4GKJ E;  1HNW E;  3HQ1 A;  4WSP A;  4DV6 E;  2CPN A;  4M2Z A;  2V8Q B;  2NA2 A;  2M1S A;  5DNY A;  2L8T A;  1ZBQ A;  2B7V A;  2YT4 A;  5LL6 R;  4DV3 E;  1HR0 E;  2VQE E;  2EZ6 A;  4BCA A;  4GKK E;  4DV7 E;  4DV4 E;  5BR8 E;  1PKP A;  3K6Q A;  4JV5 E;  1DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...