2B7TA

Structure of adar2 dsrbm1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 18
structure length 73
sequence length 73
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7tA00
2NUEA 1GQEA 1STUA 4X66E 3C4TA 4DV6E 2JVAA 4JI0E 1WHQA 4DR4E 2E5LE 2N3GA 1X47A 1J26A 2B7TA 4DV0E 2B3TB 3VYXA 2RS7A 1IBKE 2UU9E 1HNXE 2L33A 1YYKA 4LFAE 1XMOE 2L2KB 5LMNE 4DR5E 1RQ0A 4DR3E 3T1YE 4JI1E 4X8WA 1HNZE 4JI2E 2LJHA 1YYWA 2RSMA 1J5EE 2L2MA 2UXCE 4X64E 1ZBTA 2NA2A 1T4NA 4DKKA 4LF8E 2UXDE 2LBSB 2DMYA 4LFBE 2VQEE 1XNRE 4DV2E 4JI3E 1RC7A 1YYOA 4JI8E 3ADLA 4B3ME 1XMQE 1N36E 4LF7E 2NUFA 5CFFE 2JY9A 4DUYE 1HNWE 1FJGE 4WYQB 4NXNE 1I94E 4DR1E 4NXME 2RTXA 4OOGC 4JI6E 4LF5E 4LF4E 1EKZA 4LF9E 4LFCE 1IBLE 1QU6A 1T4LB 1DI2A 2L3CA 3C4BA 1N34E 2HHHE 2KHXA 4DR7E 4B3TE 4OX9E 4KHPE 4DR6E 4JI5E 4YHHE 4JI4E 4DV7E 3ADGA 4M30A 2B7VA 5IWAE 1X48A 4X62E 3J7Yp 4DV5E 2LUPB 1UHZA 4YY3E 4DV3E 1UILA 4M2ZA 3ADIA 4DV1E 2ZM6E 2NUGA 2LTSA 3ADJA 4K0KE 3HTXA 2RS6A 4DR2E 1X49A 4AQYE 4B3SE 3OTOE 5LMUE 4JI7E 4DV4E 4X65E 1T4OA 2UUAE 1WHNA 4GKJE 4GKKE 2YT4A 1O0WA 2DB2A 2CPNA 2DIXA 5BR8E 2LUQA 2UUBE 1PKPA 4B3RE 2MDRA 4JV5E 2LRSA 3VYYA 1FKAE 2F4VE 4DUZE 1YZ9A 1N33E 1HR0E 2N3HA 2EZ6A 3LLHA 2LTRA 2UXBE 3T1HE 1IBME 1N32E 2UUCE 2VQFE 2IHR1 2L3JA 1XNQE 4JYAE 4WFTA 2L2NA 4LF6E 3P1XA
chains in the Genus database with same CATH superfamily
2JOBA 1GQEA 3J81C 4MLQA 5AE2A 4X66E 2JVAA 1WHQA 4DR4E 1A1IA 1UBDC 5KL2A 3EPJA 4M9VC 2EL5A 2B3TB 4ZYHA 2UU9E 1HNXE 4M0VA 1YYKA 2MC5A 2EM5A 1YUJA 1XMOE 2EP3A 3J80C 2RPCA 1BB8A 3BBGA 5DNYA 4JI1E 2M7QA 2MDGA 2V8QB 1HNZE 3HQ1A 2ODRC 4JI2E 2ODRD 2PRTA 1YYWA 3LMLA 1ZBTA 3JU0A 1T4NA 1X6HA 2YTDA 4R2QA 2LT7A 1YFHA 3J7AG 5KL4A 2JOXA 2LMZA 3ADLA 2YSPA 1A1HA 5CFFE 2EPCA 2Q8UA 1WRJA 5T6JA 3VHTB 2ADRA 2EM7A 1EH7A 2YTQA 2HJJA 2YTJA 1X6FA 2RTXA 4LF5E 1EKZA 1IBLE 1QU6A 2EN1A 1TF3A 2NABA 4P78A 3ZOQB 2K7IA 2EOOA 1UN6B 2V86A 3ADGA 4R8OA 4WSPA 4X62E 2LUPB 4DV3E 2LO3A 1UILA 4R2DA 2YU8A 3ADIA 2WCC3 5IXMB 4KWYA 2RS6A 4R2SA 5KL3A 4ZYGA 1EH6A 3OTOE 2EMXA 4JI7E 2EMZA 1T4OA 4F54A 2EOMA 2YT4A 3OMLA 2EN6A 2LUQA 2JP9A 4TUIA 3VYYA 3M99B 2L8TA 2FGGA 2MKDA 5A2QC 2HGHA 2WBUA 2EOEA 4X9JA 2UUCE 2YRKA 2EM4A 2ENCA 5F3WA 2NUEA 3C6MA 1STUA 3C4TA 2EPOA 4F6NA 1PJQA 2N3GA 2YTNA 1X47A 2EMHA 2KONA 2EE8A 4WXCA 2RS7A 2EOQA 4R2RA 2EMFA 1KJKA 1YSAC 3FIGA 2EPUA 2YU5A 1MGTA 4R03A 2L2KB 5LMNE 2JXPA 4BCAA 1AH5A 2LV2A 4F6MA 4L8NA 1RQ0A 2ENAA 1LLMC 2DMIA 2EN4A 3C6KA 1RMDA 1A1GA 2EN8A 4KZSA 2RSMA 1AAYA 1SR9A 2L2MA 1IMUA 2UXCE 2EORA 2CSHA 2LBSB 1DQ3A 4JI3E 1MEYC 1YYOA 3VK6A 2YRHA 3K6QA 4B3ME 2I13A 4LTYA 1N36E 1IQSA 4LF7E 5AC4A 3THNA 4RHBB 2EPRA 2K4VA 1ZBQA 4WYQB 4NXNE 2VE7C 4NXME 4OOGC 4LF4E 2LVHA 2EMGA 4O43A 5LL6R 3IWDA 2EMLA 2R76A 3C4BA 3IWBA 3THOB 2BB8A 4OX9E 2EWLA 2EN2A 4YHHE 2EOFA 2L6MA 4DV7E 2EM9A 5IWAE 1X48A 4IJDA 2EQ0A 3J7Yp 5AASA 1UHZA 3KWRA 3EQ1A 1WXRA 3EPHA 4M2ZA 3AV0A 4R2PA 1PJSA 4DV1E 2YZTA 3MHSC 2ZM6E 4K0KE 5LLQA 4O4KA 1TF6A 2EM8A 1GZ6A 3H09A 5FLXC 1NCSA 4DV4E 2EL6A 4X65E 2EM2A 2JPAA 1PDAA 1WHNA 4GKJE 2EPNA 1O0WA 2DB2A 5BR8E 2DIXA 2UUBE 1BBOA 2EOZA 2MDRA 2LRSA 1FKAE 3EPLA 2R1FA 1A1JA 4BMJA 5AC5A 2EOSA 4BHCA 1A1FA 2UXBE 2EQ3A 1IBME 2V83A 1EH8A 2DSYA 2CTDA 2VQFE 2IHR1 2L3JA 4JYAE 4LF6E 4DV6E 2V88A 3TQMA 1JK2A 4O24A 2EM3A 2YTIA 1J26A 1F2IG 4ZYEA 2B7TA 4MLVA 4DV0E 2YWQA 1G2DC 2L33A 4N4RB 3HXLA 4WSGA 5KL6A 2EM6A 5A6BD 4DR3E 1JK1A 4HTGA 2LCEA 5A6JA 4X8WA 4O5GA 2EPMX 1GTKA 2EM0A 2YRMA 4DKKA 2DRPA 4LF8E 3KZZA 4I8OA 4GEQB 5ADZA 1NEIA 2DMYA 3IWCA 2D9HA 2H36X 4F9BB 2VQEE 4DV2E 1XNRE 2YSOA 5TSEA 1RC7A 2A25A 3DJWA 1BBGA 4JI8E 4LU9A 1YUIA 2EOYA 1TN9A 2EPKX 2WZOA 2YTGA 4DUYE 5AE3A 1FJGE 2YTFA 4WPYA 1G2FC 4NHRA 1A1KA 1A1LA 4LF9E 1Z1BA 2L3CA 1N34E 2HHHE 2KHXA 4DR7E 4NZVA 1L4SA 4KHPE 2VRDA 2GHFA 4JI5E 4JI4E 2LE2A 5IT9C 4F2JC 3JTZA 3ECRA 2J7JA 2NUGA 2EMKA 2YPNA 4DMIA 2FV4B 1X49A 3JAMC 3HPSA 5KL5A 1WJPA 2DGCA 4B3SE 2E1MA 5LMUE 2KOUA 3F6GA 2ELYA 2DLKA 4WXDA 2EPPA 1IQOA 4GKKE 3RMPA 2E72A 4B3RE 1PKPA 4JV5E 3MSWA 2F4VE 4BS9A 1N33E 2EPAA 2GLIA 2VF1A 5KL7A 2EMWA 1N32E 4P7DA 1XNQE 2GPIA 3F6HA 5IV8B 2EL4A 2BBGA 4JI0E 4F9CB 4WFTA 3KZYA 4R2CA 2WBSA 2E5LE 4BC7A 1ZU1A 3VYXA 2EOXA 4WX9A 1T38A 2YTPA 1IBKE 4LFAE 3EPKA 2CT1A 4IS1C 4DR5E 2M1SA 2V85A 3T1YE 1X6EA 2HC5A 4BHBA 3L00A 2M9AA 2EJ4A 1X5WA 4Q35B 2ELZA 2LJHA 2YTEA 2EMCA 1J5EE 3MHHC 4X64E 3BGHA 4F9AB 2NA2A 2UXDE 4L5NC 4LFBE 3BF2A 2L92A 3HPZA 2EMBA 2EN3A 5A6BA 1T39A 1XMQE 1X3CA 5AE1A 2NUFA 1QNTA 2JY9A 4J8ZA 1HNWE 4BC9A 2JR1A 2JYAA 2MC6A 2F8BA 1I94E 4DR1E 4LFCE 4JI6E 1ZAAC 1DI2A 1T4LB 3BIDA 2EPXA 4B3TE 2FTXB 3DF6A 4DR6E 4M30A 2B7VA 4DV5E 4YY3E 4BBYA 5A69A 2N8XA 2EPLX 5A6KA 1P47A 4TUGA 2I9IA 3UK3C 2DLQA 2RQLA 4R2AA 4GZNC 1DGCA 2LTSA 2RSIA 3ADJA 3HTXA 2EOIA 2WBTA 2EMAA 3AUZA 1SFEA 2M4IA 2V87A 4FK5C 4RH8A 4DR2E 4AQYE 5A6AA 2ENHA 2JWOA 1ZR9A 2EN7A 4HEIA 2UUAE 4Q28A 2LJUA 2MKNA 4R2EA 2G7HA 2CPNA 3QG5C 2YTOA 4DUZE 1YZ9A 1PJTA 2EMIA 1YPNA 2EQ1A 2N3HA 1HR0E 2EOHA 3LLHA 2EZ6A 1B69A 1N3GA 2B9DA 2EMYA 3T1HE 4ZYDA 1KYQA 2EPZA 2EOJA 2V89A 2LTRA 2L2NA 3P1XA
chains in the Genus database with same CATH topology
2JOBA 1GQEA 3J81C 2NUEA 1STUA 3F6HA 5AE2A 4X66E 3C4TA 4DV6E 2JVAA 2V88A 4JI0E 4F9CB 4WFTA 1WHQA 4DR4E 2E5LE 2N3GA 5IT9C 1X47A 2KONA 4BC7A 4DV5E 1J26A 2B7TA 4DV0E 2B3TB 3VYXA 2RS7A 1IBKE 2UU9E 1HNXE 2L33A 4M0VA 4LFAE 2MC5A 1YYKA 3FIGA 3HXLA 1XMOE 4R03A 2L2KB 5LMNE 4DR5E 4BCAA 4L8NA 1RQ0A 3J80C 2M1SA 2V85A 4DR3E 3T1YE 5DNYA 4JI1E 2M7QA 2V8QB 4X8WA 4KZSA 3HQ1A 2ODRC 1HNZE 4JI2E 2LJHA 2ODRD 1YYWA 2RSMA 1SR9A 2L2MA 1J5EE 2UXCE 3LMLA 4X64E 1ZBTA 4F9AB 2NA2A 3JU0A 1T4NA 4DKKA 4LF8E 2UXDE 4I8OA 4GEQB 1DQ3A 4L5NC 5ADZA 2LBSB 2DMYA 3IWCA 4LFBE 4F9BB 2H36X 2VQEE 1XNRE 4DV2E 2L92A 4JI3E 1RC7A 3J7AG 3DJWA 1YYOA 2JOXA 3VK6A 2LMZA 4JI8E 3HPZA 3K6QA 3ADLA 4B3ME 4LU9A 4LTYA 1XMQE 1N36E 5AE1A 4LF7E 2NUFA 5CFFE 2WZOA 2JY9A 4J8ZA 4DUYE 1HNWE 5AE3A 2K4VA 5T6JA 4BC9A 1ZBQA 1FJGE 4WPYA 4WYQB 2JR1A 2MC6A 4NXNE 2F8BA 2VE7C 4DR1E 1I94E 4NXME 2RTXA 4OOGC 4JI6E 4LF5E 4LF4E 1EKZA 4LF9E 4LFCE 1IBLE 1QU6A 5LL6R 3IWDA 1T4LB 2L3CA 1DI2A 3C4BA 1N34E 2HHHE 2KHXA 4P78A 4DR7E 3ZOQB 3IWBA 4B3TE 4OX9E 4KHPE 2FTXB 3DF6A 4DR6E 2EWLA 4JI5E 2V86A 4YHHE 2L6MA 4JI4E 4DV7E 2LE2A 3ADGA 2B7VA 4M30A 4R8OA 1X48A 4WSPA 5IWAE 4X62E 3J7Yp 5AASA 1UHZA 4YY3E 3KWRA 4BBYA 1UILA 4DV3E 2LUPB 1WXRA 4TUGA 4M2ZA 3AV0A 3ADIA 3JTZA 4DV1E 2YZTA 2ZM6E 2NUGA 2LTSA 3ADJA 4K0KE 3HTXA 4DMIA 2FV4B 2RS6A 3AUZA 2M4IA 2V87A 4DR2E 1X49A 3JAMC 1GZ6A 3HPSA 3H09A 4AQYE 4B3SE 3OTOE 2E1MA 5FLXC 5LMUE 4JI7E 2JWOA 4DV4E 2KOUA 4X65E 1T4OA 3F6GA 4F54A 2UUAE 1WHNA 4Q28A 4GKJE 2YT4A 3RMPA 2G7HA 4GKKE 1O0WA 2DB2A 2CPNA 2DIXA 3OMLA 2LUQA 5BR8E 1PKPA 4TUIA 2MDRA 2UUBE 4B3RE 2LRSA 3MSWA 3VYYA 1FKAE 2F4VE 4BS9A 4DUZE 2L8TA 1YZ9A 4JV5E 1N33E 1HR0E 2FGGA 2N3HA 2EZ6A 3LLHA 4BMJA 2VF1A 2B9DA 2UXBE 5A2QC 3T1HE 1IBME 2V83A 1N32E 2DSYA 2UUCE 4P7DA 2VQFE 2IHR1 2L3JA 1XNQE 2V89A 4JYAE 2LTRA 2L2NA 5F3WA 4LF6E 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUE A;  1GQE A;  1STU A;  4X66 E;  3C4T A;  4DV6 E;  2JVA A;  4JI0 E;  1WHQ A;  4DR4 E;  2E5L E;  2N3G A;  1X47 A;  1J26 A;  2B7T A;  4DV0 E;  2B3T B;  3VYX A;  2RS7 A;  1IBK E;  2UU9 E;  1HNX E;  2L33 A;  1YYK A;  4LFA E;  1XMO E;  2L2K B;  5LMN E;  4DR5 E;  1RQ0 A;  4DR3 E;  3T1Y E;  4JI1 E;  4X8W A;  1HNZ E;  4JI2 E;  2LJH A;  1YYW A;  2RSM A;  1J5E E;  2L2M A;  2UXC E;  4X64 E;  1ZBT A;  2NA2 A;  1T4N A;  4DKK A;  4LF8 E;  2UXD E;  2LBS B;  2DMY A;  4LFB E;  2VQE E;  1XNR E;  4DV2 E;  4JI3 E;  1RC7 A;  1YYO A;  4JI8 E;  3ADL A;  4B3M E;  1XMQ E;  1N36 E;  4LF7 E;  2NUF A;  5CFF E;  2JY9 A;  4DUY E;  1HNW E;  1FJG E;  4WYQ B;  4NXN E;  1I94 E;  4DR1 E;  4NXM E;  2RTX A;  4OOG C;  4JI6 E;  4LF5 E;  4LF4 E;  1EKZ A;  4LF9 E;  4LFC E;  1IBL E;  1QU6 A;  1T4L B;  1DI2 A;  2L3C A;  3C4B A;  1N34 E;  2HHH E;  2KHX A;  4DR7 E;  4B3T E;  4OX9 E;  4KHP E;  4DR6 E;  4JI5 E;  4YHH E;  4JI4 E;  4DV7 E;  3ADG A;  4M30 A;  2B7V A;  5IWA E;  1X48 A;  4X62 E;  3J7Y p;  4DV5 E;  2LUP B;  1UHZ A;  4YY3 E;  4DV3 E;  1UIL A;  4M2Z A;  3ADI A;  4DV1 E;  2ZM6 E;  2NUG A;  2LTS A;  3ADJ A;  4K0K E;  3HTX A;  2RS6 A;  4DR2 E;  1X49 A;  4AQY E;  4B3S E;  3OTO E;  5LMU E;  4JI7 E;  4DV4 E;  4X65 E;  1T4O A;  2UUA E;  1WHN A;  4GKJ E;  4GKK E;  2YT4 A;  1O0W A;  2DB2 A;  2CPN A;  2DIX A;  5BR8 E;  2LUQ A;  2UUB E;  1PKP A;  4B3R E;  2MDR A;  4JV5 E;  2LRS A;  3VYY A;  1FKA E;  2F4V E;  4DUZ E;  1YZ9 A;  1N33 E;  1HR0 E;  2N3H A;  2EZ6 A;  3LLH A;  2LTR A;  2UXB E;  3T1H E;  1IBM E;  1N32 E;  2UUC E;  2VQF E;  2IHR 1;  2L3J A;  1XNQ E;  4JYA E;  4WFT A;  2L2N A;  4LF6 E;  3P1X A; 
#chains in the Genus database with same CATH topology
 2JOB A;  1GQE A;  3J81 C;  4MLQ A;  5AE2 A;  4X66 E;  2JVA A;  1WHQ A;  4DR4 E;  1A1I A;  1UBD C;  5KL2 A;  3EPJ A;  4M9V C;  2EL5 A;  2B3T B;  4ZYH A;  2UU9 E;  1HNX E;  4M0V A;  1YYK A;  2MC5 A;  2EM5 A;  1YUJ A;  1XMO E;  2EP3 A;  3J80 C;  2RPC A;  1BB8 A;  3BBG A;  5DNY A;  4JI1 E;  2M7Q A;  2MDG A;  2V8Q B;  1HNZ E;  3HQ1 A;  2ODR C;  4JI2 E;  2ODR D;  2PRT A;  1YYW A;  3LML A;  1ZBT A;  3JU0 A;  1T4N A;  1X6H A;  2YTD A;  4R2Q A;  2LT7 A;  1YFH A;  3J7A G;  5KL4 A;  2JOX A;  2LMZ A;  3ADL A;  2YSP A;  1A1H A;  5CFF E;  2EPC A;  2Q8U A;  1WRJ A;  5T6J A;  3VHT B;  2ADR A;  2EM7 A;  1EH7 A;  2YTQ A;  2HJJ A;  2YTJ A;  1X6F A;  2RTX A;  4LF5 E;  1EKZ A;  1IBL E;  1QU6 A;  2EN1 A;  1TF3 A;  2NAB A;  4P78 A;  3ZOQ B;  2K7I A;  2EOO A;  1UN6 B;  2V86 A;  3ADG A;  4R8O A;  4WSP A;  4X62 E;  2LUP B;  4DV3 E;  2LO3 A;  1UIL A;  4R2D A;  2YU8 A;  3ADI A;  2WCC 3;  5IXM B;  4KWY A;  2RS6 A;  4R2S A;  5KL3 A;  4ZYG A;  1EH6 A;  3OTO E;  2EMX A;  4JI7 E;  2EMZ A;  1T4O A;  4F54 A;  2EOM A;  2YT4 A;  3OML A;  2EN6 A;  2LUQ A;  2JP9 A;  4TUI A;  3VYY A;  3M99 B;  2L8T A;  2FGG A;  2MKD A;  5A2Q C;  2HGH A;  2WBU A;  2EOE A;  4X9J A;  2UUC E;  2YRK A;  2EM4 A;  2ENC A;  5F3W A;  2NUE A;  3C6M A;  1STU A;  3C4T A;  2EPO A;  4F6N A;  1PJQ A;  2N3G A;  2YTN A;  1X47 A;  2EMH A;  2KON A;  2EE8 A;  4WXC A;  2RS7 A;  2EOQ A;  4R2R A;  2EMF A;  1KJK A;  1YSA C;  3FIG A;  2EPU A;  2YU5 A;  1MGT A;  4R03 A;  2L2K B;  5LMN E;  2JXP A;  4BCA A;  1AH5 A;  2LV2 A;  4F6M A;  4L8N A;  1RQ0 A;  2ENA A;  1LLM C;  2DMI A;  2EN4 A;  3C6K A;  1RMD A;  1A1G A;  2EN8 A;  4KZS A;  2RSM A;  1AAY A;  1SR9 A;  2L2M A;  1IMU A;  2UXC E;  2EOR A;  2CSH A;  2LBS B;  1DQ3 A;  4JI3 E;  1MEY C;  1YYO A;  3VK6 A;  2YRH A;  3K6Q A;  4B3M E;  2I13 A;  4LTY A;  1N36 E;  1IQS A;  4LF7 E;  5AC4 A;  3THN A;  4RHB B;  2EPR A;  2K4V A;  1ZBQ A;  4WYQ B;  4NXN E;  2VE7 C;  4NXM E;  4OOG C;  4LF4 E;  2LVH A;  2EMG A;  4O43 A;  5LL6 R;  3IWD A;  2EML A;  2R76 A;  3C4B A;  3IWB A;  3THO B;  2BB8 A;  4OX9 E;  2EWL A;  2EN2 A;  4YHH E;  2EOF A;  2L6M A;  4DV7 E;  2EM9 A;  5IWA E;  1X48 A;  4IJD A;  2EQ0 A;  3J7Y p;  5AAS A;  1UHZ A;  3KWR A;  3EQ1 A;  1WXR A;  3EPH A;  4M2Z A;  3AV0 A;  4R2P A;  1PJS A;  4DV1 E;  2YZT A;  3MHS C;  2ZM6 E;  4K0K E;  5LLQ A;  4O4K A;  1TF6 A;  2EM8 A;  1GZ6 A;  3H09 A;  5FLX C;  1NCS A;  4DV4 E;  2EL6 A;  4X65 E;  2EM2 A;  2JPA A;  1PDA A;  1WHN A;  4GKJ E;  2EPN A;  1O0W A;  2DB2 A;  5BR8 E;  2DIX A;  2UUB E;  1BBO A;  2EOZ A;  2MDR A;  2LRS A;  1FKA E;  3EPL A;  2R1F A;  1A1J A;  4BMJ A;  5AC5 A;  2EOS A;  4BHC A;  1A1F A;  2UXB E;  2EQ3 A;  1IBM E;  2V83 A;  1EH8 A;  2DSY A;  2CTD A;  2VQF E;  2IHR 1;  2L3J A;  4JYA E;  4LF6 E;  4DV6 E;  2V88 A;  3TQM A;  1JK2 A;  4O24 A;  2EM3 A;  2YTI A;  1J26 A;  1F2I G;  4ZYE A;  2B7T A;  4MLV A;  4DV0 E;  2YWQ A;  1G2D C;  2L33 A;  4N4R B;  3HXL A;  4WSG A;  5KL6 A;  2EM6 A;  5A6B D;  4DR3 E;  1JK1 A;  4HTG A;  2LCE A;  5A6J A;  4X8W A;  4O5G A;  2EPM X;  1GTK A;  2EM0 A;  2YRM A;  4DKK A;  2DRP A;  4LF8 E;  3KZZ A;  4I8O A;  4GEQ B;  5ADZ A;  1NEI A;  2DMY A;  3IWC A;  2D9H A;  2H36 X;  4F9B B;  2VQE E;  4DV2 E;  1XNR E;  2YSO A;  5TSE A;  1RC7 A;  2A25 A;  3DJW A;  1BBG A;  4JI8 E;  4LU9 A;  1YUI A;  2EOY A;  1TN9 A;  2EPK X;  2WZO A;  2YTG A;  4DUY E;  5AE3 A;  1FJG E;  2YTF A;  4WPY A;  1G2F C;  4NHR A;  1A1K A;  1A1L A;  4LF9 E;  1Z1B A;  2L3C A;  1N34 E;  2HHH E;  2KHX A;  4DR7 E;  4NZV A;  1L4S A;  4KHP E;  2VRD A;  2GHF A;  4JI5 E;  4JI4 E;  2LE2 A;  5IT9 C;  4F2J C;  3JTZ A;  3ECR A;  2J7J A;  2NUG A;  2EMK A;  2YPN A;  4DMI A;  2FV4 B;  1X49 A;  3JAM C;  3HPS A;  5KL5 A;  1WJP A;  2DGC A;  4B3S E;  2E1M A;  5LMU E;  2KOU A;  3F6G A;  2ELY A;  2DLK A;  4WXD A;  2EPP A;  1IQO A;  4GKK E;  3RMP A;  2E72 A;  4B3R E;  1PKP A;  4JV5 E;  3MSW A;  2F4V E;  4BS9 A;  1N33 E;  2EPA A;  2GLI A;  2VF1 A;  5KL7 A;  2EMW A;  1N32 E;  4P7D A;  1XNQ E;  2GPI A;  3F6H A;  5IV8 B;  2EL4 A;  2BBG A;  4JI0 E;  4F9C B;  4WFT A;  3KZY A;  4R2C A;  2WBS A;  2E5L E;  4BC7 A;  1ZU1 A;  3VYX A;  2EOX A;  4WX9 A;  1T38 A;  2YTP A;  1IBK E;  4LFA E;  3EPK A;  2CT1 A;  4IS1 C;  4DR5 E;  2M1S A;  2V85 A;  3T1Y E;  1X6E A;  2HC5 A;  4BHB A;  3L00 A;  2M9A A;  2EJ4 A;  1X5W A;  4Q35 B;  2ELZ A;  2LJH A;  2YTE A;  2EMC A;  1J5E E;  3MHH C;  4X64 E;  3BGH A;  4F9A B;  2NA2 A;  2UXD E;  4L5N C;  4LFB E;  3BF2 A;  2L92 A;  3HPZ A;  2EMB A;  2EN3 A;  5A6B A;  1T39 A;  1XMQ E;  1X3C A;  5AE1 A;  2NUF A;  1QNT A;  2JY9 A;  4J8Z A;  1HNW E;  4BC9 A;  2JR1 A;  2JYA A;  2MC6 A;  2F8B A;  1I94 E;  4DR1 E;  4LFC E;  4JI6 E;  1ZAA C;  1DI2 A;  1T4L B;  3BID A;  2EPX A;  4B3T E;  2FTX B;  3DF6 A;  4DR6 E;  4M30 A;  2B7V A;  4DV5 E;  4YY3 E;  4BBY A;  5A69 A;  2N8X A;  2EPL X;  5A6K A;  1P47 A;  4TUG A;  2I9I A;  3UK3 C;  2DLQ A;  2RQL A;  4R2A A;  4GZN C;  1DGC A;  2LTS A;  2RSI A;  3ADJ A;  3HTX A;  2EOI A;  2WBT A;  2EMA A;  3AUZ A;  1SFE A;  2M4I A;  2V87 A;  4FK5 C;  4RH8 A;  4DR2 E;  4AQY E;  5A6A A;  2ENH A;  2JWO A;  1ZR9 A;  2EN7 A;  4HEI A;  2UUA E;  4Q28 A;  2LJU A;  2MKN A;  4R2E A;  2G7H A;  2CPN A;  3QG5 C;  2YTO A;  4DUZ E;  1YZ9 A;  1PJT A;  2EMI A;  1YPN A;  2EQ1 A;  2N3H A;  1HR0 E;  2EOH A;  3LLH A;  2EZ6 A;  1B69 A;  1N3G A;  2B9D A;  2EMY A;  3T1H E;  4ZYD A;  1KYQ A;  2EPZ A;  2EOJ A;  2V89 A;  2LTR A;  2L2N A;  3P1X A; 
#chains in the Genus database with same CATH homology
 2JOB A;  1GQE A;  3J81 C;  2NUE A;  1STU A;  3F6H A;  5AE2 A;  4X66 E;  3C4T A;  4DV6 E;  2JVA A;  2V88 A;  4JI0 E;  4F9C B;  4WFT A;  1WHQ A;  4DR4 E;  2E5L E;  2N3G A;  5IT9 C;  1X47 A;  2KON A;  4BC7 A;  4DV5 E;  1J26 A;  2B7T A;  4DV0 E;  2B3T B;  3VYX A;  2RS7 A;  1IBK E;  2UU9 E;  1HNX E;  2L33 A;  4M0V A;  4LFA E;  2MC5 A;  1YYK A;  3FIG A;  3HXL A;  1XMO E;  4R03 A;  2L2K B;  5LMN E;  4DR5 E;  4BCA A;  4L8N A;  1RQ0 A;  3J80 C;  2M1S A;  2V85 A;  4DR3 E;  3T1Y E;  5DNY A;  4JI1 E;  2M7Q A;  2V8Q B;  4X8W A;  4KZS A;  3HQ1 A;  2ODR C;  1HNZ E;  4JI2 E;  2LJH A;  2ODR D;  1YYW A;  2RSM A;  1SR9 A;  2L2M A;  1J5E E;  2UXC E;  3LML A;  4X64 E;  1ZBT A;  4F9A B;  2NA2 A;  3JU0 A;  1T4N A;  4DKK A;  4LF8 E;  2UXD E;  4I8O A;  4GEQ B;  1DQ3 A;  4L5N C;  5ADZ A;  2LBS B;  2DMY A;  3IWC A;  4LFB E;  4F9B B;  2H36 X;  2VQE E;  1XNR E;  4DV2 E;  2L92 A;  4JI3 E;  1RC7 A;  3J7A G;  3DJW A;  1YYO A;  2JOX A;  3VK6 A;  2LMZ A;  4JI8 E;  3HPZ A;  3K6Q A;  3ADL A;  4B3M E;  4LU9 A;  4LTY A;  1XMQ E;  1N36 E;  5AE1 A;  4LF7 E;  2NUF A;  5CFF E;  2WZO A;  2JY9 A;  4J8Z A;  4DUY E;  1HNW E;  5AE3 A;  2K4V A;  5T6J A;  4BC9 A;  1ZBQ A;  1FJG E;  4WPY A;  4WYQ B;  2JR1 A;  2MC6 A;  4NXN E;  2F8B A;  2VE7 C;  4DR1 E;  1I94 E;  4NXM E;  2RTX A;  4OOG C;  4JI6 E;  4LF5 E;  4LF4 E;  1EKZ A;  4LF9 E;  4LFC E;  1IBL E;  1QU6 A;  5LL6 R;  3IWD A;  1T4L B;  2L3C A;  1DI2 A;  3C4B A;  1N34 E;  2HHH E;  2KHX A;  4P78 A;  4DR7 E;  3ZOQ B;  3IWB A;  4B3T E;  4OX9 E;  4KHP E;  2FTX B;  3DF6 A;  4DR6 E;  2EWL A;  4JI5 E;  2V86 A;  4YHH E;  2L6M A;  4JI4 E;  4DV7 E;  2LE2 A;  3ADG A;  2B7V A;  4M30 A;  4R8O A;  1X48 A;  4WSP A;  5IWA E;  4X62 E;  3J7Y p;  5AAS A;  1UHZ A;  4YY3 E;  3KWR A;  4BBY A;  1UIL A;  4DV3 E;  2LUP B;  1WXR A;  4TUG A;  4M2Z A;  3AV0 A;  3ADI A;  3JTZ A;  4DV1 E;  2YZT A;  2ZM6 E;  2NUG A;  2LTS A;  3ADJ A;  4K0K E;  3HTX A;  4DMI A;  2FV4 B;  2RS6 A;  3AUZ A;  2M4I A;  2V87 A;  4DR2 E;  1X49 A;  3JAM C;  1GZ6 A;  3HPS A;  3H09 A;  4AQY E;  4B3S E;  3OTO E;  2E1M A;  5FLX C;  5LMU E;  4JI7 E;  2JWO A;  4DV4 E;  2KOU A;  4X65 E;  1T4O A;  3F6G A;  4F54 A;  2UUA E;  1WHN A;  4Q28 A;  4GKJ E;  2YT4 A;  3RMP A;  2G7H A;  4GKK E;  1O0W A;  2DB2 A;  2CPN A;  2DIX A;  3OML A;  2LUQ A;  5BR8 E;  1PKP A;  4TUI A;  2MDR A;  2UUB E;  4B3R E;  2LRS A;  3MSW A;  3VYY A;  1FKA E;  2F4V E;  4BS9 A;  4DUZ E;  2L8T A;  1YZ9 A;  4JV5 E;  1N33 E;  1HR0 E;  2FGG A;  2N3H A;  2EZ6 A;  3LLH A;  4BMJ A;  2VF1 A;  2B9D A;  2UXB E;  5A2Q C;  3T1H E;  1IBM E;  2V83 A;  1N32 E;  2DSY A;  2UUC E;  4P7D A;  2VQF E;  2IHR 1;  2L3J A;  1XNQ E;  2V89 A;  4JYA E;  2LTR A;  2L2N A;  5F3W A;  4LF6 E;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...