2JPAA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA04
2HGHA 2EM2A 2MKNA 1ZR9A 2ENAA 2EOEA 2DLKA 2EM0A 2YSPA 1A1JA 2WBUA 2LVHA 4R2CA 2EOSA 2YTJA 2EMIA 2LV2A 1UBDC 2R1FA 4F6NA 2EN3A 2M9AA 2EM4A 2EM6A 1A1LA 2EN7A 2WBSA 2EL6A 2EP3A 2EQ0A 2EMYA 2LCEA 2EPZA 1A1GA 4WSGA 2EMHA 2EN1A 1JK2A 5KL7A 1AAYA 2GLIA 4GZNC 2DRPA 2EMWA 2ENHA 2YRKA 1ZAAC 2EPAA 1A1HA 2YRHA 5KL3A 1TF6A 2CTDA 1TF3A 1X5WA 2I13A 2ELYA 4FK5C 2EQ1A 2EOXA 4M9VC 2EOFA 1X6EA 1WJPA 2MKDA 3EPLA 1YSAC 4R2EA 2JPAA 3MHSC 2EOIA 1YUJA 1X3CA 2EMLA 4X9JA 2YTEA 1A1KA 2LO3A 2EN4A 1TN9A 1UN6B 2YU5A 4R2DA 5KL4A 3VHTB 2LT7A 2EOMA 2YTIA 1BBOA 2YTNA 2ELZA 2EM9A 2EPPA 2YRMA 2WCC3 4R2SA 4R2PA 2EPCA 1P47A 4F6MA 1DGCA 2EPUA 1BB8A 2YTOA 2EOJA 2E72A 1X6FA 4R2RA 2EL5A 2EOZA 1YUIA 2YSOA 2JP9A 2YU8A 2EJ4A 4IS1C 2EQ3A 2J7JA 2GHFA 2EM8A 2EOHA 2EMAA 2EMBA 2YTDA 2EOQA 3M99B 5KL2A 2EE8A 1KJKA 3EPHA 1X6HA 2WBTA 1Z1BA 1G2FC 2D9HA 2A25A 1RMDA 2DLQA 2YTQA 2EM7A 5KL6A 3EPKA 1ZU1A 2BB8A 1JK1A 1A1IA 2MDGA 3EPJA 2YTGA 2RPCA 2EN2A 2EL4A 2YTFA 2EMXA 2EMKA 3UK3C 2CT1A 1NCSA 1F2IG 1A1FA 2VRDA 3MHHC 4IJDA 1LLMC 2DGCA 2EMFA 5KL5A 1G2DC 2NABA 2EN6A 2EM3A 2EMCA 4R2QA 2EOOA 2EMZA 2EMGA 2EOYA 2YTPA 2ADRA 2EM5A 1B69A 2CSHA 2DMIA 4R2AA 2EORA 2ENCA 1MEYC 2RSIA 2EN8A 2EPRA 4F2JC 2EPXA 2PRTA
chains in the Genus database with same CATH superfamily
5A2QC 2HGHA 4J8ZA 2YSPA 3ADLA 2I9IA 2B9DA 4DR1E 4R2CA 2JR1A 2N3HA 4JI5E 2LV2A 4O43A 1X49A 4BBYA 2V8QB 4DV7E 1N33E 2LUQA 4P78A 2N8XA 3C4TA 2JOBA 2LTSA 4ZYHA 4LFCE 1WHNA 1O0WA 2DB2A 2KOUA 2EMHA 1JK2A 2EPNA 4B3RE 5IV8B 4JI4E 1ZAAC 2L2NA 4DKKA 5KL3A 1HNZE 2CTDA 2ODRC 2V85A 4BS9A 4NHRA 4FK5C 4X8WA 2EQ1A 4YHHE 2RS6A 1FJGE 2VE7C 3EPLA 2Q8UA 1YSAC 3JU0A 2MDRA 2EMLA 4JI2E 2MC6A 2VQEE 1WXRA 1N34E 2CPNA 2YTEA 2UUBE 2MC5A 4RH8A 4RHBB 4R2DA 5LL6R 3VHTB 2EOMA 3KWRA 4BMJA 1WHQA 3BBGA 2EWLA 2EM9A 2YRMA 1EH8A 1ZBQA 3IWCA 4R2PA 1X47A 4DV3E 2EPKX 4LFAE 3DF6A 1DGCA 2EOJA 2UXBE 2YSOA 2YU8A 5IXMB 2YT4A 4BHCA 2EOQA 2EE8A 1X6HA 2WBTA 3KZZA 3ZOQB 2HHHE 2V83A 3T1HE 2D9HA 5AE3A 2DLQA 4GKJE 2YTQA 2EM7A 2KHXA 3ECRA 4DV1E 4JI8E 1JK1A 2MDGA 2RPCA 5A6KA 4LF9E 4X66E 4O5GA 2B7TA 2LMZA 1F2IG 4IJDA 4F9CB 2JY9A 2NA2A 5KL5A 2BBGA 2EN6A 2JXPA 4BHBA 2EOOA 2EOYA 1RC7A 4YY3E 4LU9A 4KHPE 4BC7A 1B69A 2DSYA 2JYAA 4R2AA 1MEYC 4JI3E 2RSIA 1X48A 4F2JC 2EPXA 1YYOA 3VYXA 4L5NC 1YYKA 2MKNA 2H36X 1A1JA 1KYQA 2EM0A 1EKZA 1PJTA 4JI0E 4P7DA 2R76A 4WYQB 4NZVA 2EN7A 2WBSA 2EL6A 2EQ0A 1GTKA 2LTRA 1T4OA 1A1GA 4L8NA 4WSGA 2GLIA 4OX9E 4GZNC 1UHZA 4K0KE 2UXDE 2EMWA 2YRKA 2EPAA 2L33A 1A1HA 2NUGA 1PKPA 1GZ6A 4LFBE 1AH5A 4MLVA 3IWDA 2I13A 2ELYA 3F6HA 1HNXE 4NXME 2EOFA 2M1SA 4BC9A 4WSPA 2LBSB 1YYWA 5A6BA 4F9BB 2JPAA 4B3SE 5A6BD 3RMPA 4F9AB 4X9JA 3JTZA 2GPIA 4M0VA 2EN4A 4NXNE 5AC5A 5KL4A 2HC5A 2LT7A 1J5EE 2YTIA 5FLXC 5AE1A 2ELZA 1DQ3A 2L3JA 2WCC3 4JI1E 1L4SA 1T38A 3L00A 3LLHA 2F8BA 1P47A 4F6MA 1BB8A 1X6FA 2JP9A 5A6JA 5ADZA 2EJ4A 2GHFA 2EM8A 5CFFE 2EMBA 2YTDA 4O24A 3JAMC 3EPHA 4ZYDA 1NEIA 4LTYA 1G2FC 2LJHA 1RMDA 4DR6E 1XNRE 5KL6A 1IBLE 1RQ0A 2VQFE 5LLQA 2EZ6A 2YTGA 1SR9A 1T4NA 2YTFA 2ZM6E 2CT1A 1NCSA 4KZSA 3MHHC 2DGCA 3HQ1A 1LLMC 2DIXA 3OTOE 3IWBA 3HTXA 3K6QA 4MLQA 4O4KA 4TUIA 2EMGA 4DR2E 2YTPA 4WPYA 1XMQE 2UUCE 2ADRA 4M2ZA 3J80C 3AV0A 2DMIA 3J81C 3VK6A 2PRTA 2V87A 4GEQB 1I94E 2V86A 2EM2A 3VYYA 1YFHA 2ENAA 4LF4E 2LVHA 3OMLA 2EPLX 1UBDC 4DV2E 2R1FA 4BCAA 3J7Yp 2EM6A 2E1MA 2G7HA 1A1LA 1GQEA 2EMYA 2LCEA 2L6MA 2NUEA 2B3TB 5KL7A 1AAYA 3QG5C 5DNYA 2ENHA 3C4BA 2N3GA 2EPOA 1X5WA 1QU6A 2EOXA 4M9VC 4DR4E 1WJPA 3HPSA 3EQ1A 3BF2A 4R2EA 1YUJA 1X3CA 4Q28A 4Q35B 2F4VE 2L3CA 1UN6B 1IQOA 3KZYA 2E5LE 4R03A 1UILA 1BBOA 2YTNA 3BIDA 2EPPA 4R2SA 1PDAA 1FKAE 3DJWA 1ZBTA 4R8OA 4DV5E 2KONA 3ADGA 4DMIA 5AASA 4JYAE 4X64E 2EPUA 2E72A 1MGTA 2FV4B 2EOZA 4HTGA 2UXCE 2EQ3A 2J7JA 4B3ME 2EOHA 1N3GA 4WXDA 5KL2A 2LUPB 5IWAE 3HPZA 4OOGC 4M30A 2LRSA 2YWQA 2A25A 4LF7E 4JV5E 2M7QA 4X62E 2LJUA 3EPKA 4KWYA 1A1IA 3J7AG 4X65E 2EL4A 4JI6E 2EMXA 2EMKA 4JI7E 1EH7A 3UK3C 2V88A 2VRDA 4LF5E 4F54A 2RTXA 3THNA 2EM3A 2HJJA 1J26A 2EMZA 4AQYE 5IT9C 2LE2A 1DI2A 1IBKE 2L8TA 1QNTA 2ENCA 1HR0E 1ZR9A 2EOEA 2DLKA 2WBUA 4WX9A 1STUA 4GKKE 2EOSA 2YTJA 1PJSA 2M4IA 2EMIA 3THOB 2IHR1 3HXLA 1YPNA 3ADJA 4DV0E 3LMLA 4F6NA 2ODRD 2EN3A 2M9AA 4LF6E 2EM4A 2JWOA 2DMYA 2EP3A 4WFTA 2EPZA 4LF8E 3C6KA 1WRJA 2EN1A 5F3WA 2DRPA 2L2KB 4DR7E 2RQLA 2YRHA 1TF6A 2FGGA 1TF3A 4HEIA 2K7IA 5LMNE 5A6AA 1XMOE 4DUYE 2UU9E 4I8OA 1SFEA 1X6EA 2UUAE 2YPNA 2MKDA 4DR5E 1BBGA 5A69A 2EPMX 2RS7A 3MHSC 2EOIA 3H09A 2L2MA 2B7VA 1A1KA 2LO3A 4ZYEA 1TN9A 2YU5A 1PJQA 2RSMA 4DR3E 4DV4E 2FTXB 3MSWA 3FIGA 2VF1A 5AE2A 2EPCA 3P1XA 3TQMA 2YTOA 3T1YE 4R2RA 2EL5A 4B3TE 4N4RB 1YUIA 4IS1C 2NUFA 1IBME 2EMAA 4ZYGA 3M99B 1EH6A 1N36E 2YZTA 1KJKA 1N32E 1Z1BA 4DUZE 1T39A 4TUGA 5TSEA 1YZ9A 3F6GA 4WXCA 2K4VA 1ZU1A 2L92A 2BB8A 5AC4A 2JVAA 3EPJA 2EN2A 1XNQE 2WZOA 1IQSA 1T4LB 1HNWE 1A1FA 2V89A 2JOXA 5LMUE 3ADIA 2EMFA 1G2DC 2NABA 5T6JA 2EMCA 5BR8E 4R2QA 2EM5A 4DV6E 1IMUA 2CSHA 3C6MA 2EORA 3AUZA 3BGHA 2EN8A 2EPRA
chains in the Genus database with same CATH topology
2HGHA 2EM2A 2MKNA 1ZR9A 2ENAA 2EOEA 2DLKA 2EM0A 2YSPA 1A1JA 2WBUA 2LVHA 4R2CA 2EOSA 2YTJA 2EMIA 2LV2A 1UBDC 2R1FA 4F6NA 2EN3A 2M9AA 2EM4A 2EM6A 1A1LA 2EN7A 2WBSA 2EL6A 2EP3A 2EQ0A 2EMYA 2LCEA 2EPZA 1A1GA 4WSGA 2EMHA 2EN1A 1JK2A 5KL7A 1AAYA 2GLIA 4GZNC 2DRPA 2EMWA 2ENHA 2YRKA 1ZAAC 2EPAA 1A1HA 2YRHA 5KL3A 1TF6A 2CTDA 1TF3A 1X5WA 2I13A 2ELYA 4FK5C 2EQ1A 2EOXA 4M9VC 2EOFA 1X6EA 1WJPA 2MKDA 3EPLA 1YSAC 4R2EA 2JPAA 3MHSC 2EOIA 1YUJA 1X3CA 2EMLA 4X9JA 2YTEA 1A1KA 2LO3A 2EN4A 1TN9A 1UN6B 2YU5A 4R2DA 5KL4A 3VHTB 2LT7A 2EOMA 2YTIA 1BBOA 2YTNA 2ELZA 2EM9A 2EPPA 2YRMA 2WCC3 4R2SA 4R2PA 2EPCA 1P47A 4F6MA 1DGCA 2EPUA 1BB8A 2YTOA 2EOJA 2E72A 1X6FA 4R2RA 2EL5A 2EOZA 1YUIA 2YSOA 2JP9A 2YU8A 2EJ4A 4IS1C 2EQ3A 2J7JA 2GHFA 2EM8A 2EOHA 2EMAA 2EMBA 2YTDA 2EOQA 3M99B 5KL2A 2EE8A 1KJKA 3EPHA 1X6HA 2WBTA 1Z1BA 1G2FC 2D9HA 2A25A 1RMDA 2DLQA 2YTQA 2EM7A 5KL6A 3EPKA 1ZU1A 2BB8A 1JK1A 1A1IA 2MDGA 3EPJA 2YTGA 2RPCA 2EN2A 2EL4A 2YTFA 2EMXA 2EMKA 3UK3C 2CT1A 1NCSA 1F2IG 1A1FA 2VRDA 3MHHC 4IJDA 1LLMC 2DGCA 2EMFA 5KL5A 1G2DC 2NABA 2EN6A 2EM3A 2EMCA 4R2QA 2EOOA 2EMZA 2EMGA 2EOYA 2YTPA 2ADRA 2EM5A 1B69A 2CSHA 2DMIA 4R2AA 2EORA 2ENCA 1MEYC 2RSIA 2EN8A 2EPRA 4F2JC 2EPXA 2PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  2EM2 A;  2MKN A;  1ZR9 A;  2ENA A;  2EOE A;  2DLK A;  2EM0 A;  2YSP A;  1A1J A;  2WBU A;  2LVH A;  4R2C A;  2EOS A;  2YTJ A;  2EMI A;  2LV2 A;  1UBD C;  2R1F A;  4F6N A;  2EN3 A;  2M9A A;  2EM4 A;  2EM6 A;  1A1L A;  2EN7 A;  2WBS A;  2EL6 A;  2EP3 A;  2EQ0 A;  2EMY A;  2LCE A;  2EPZ A;  1A1G A;  4WSG A;  2EMH A;  2EN1 A;  1JK2 A;  5KL7 A;  1AAY A;  2GLI A;  4GZN C;  2DRP A;  2EMW A;  2ENH A;  2YRK A;  1ZAA C;  2EPA A;  1A1H A;  2YRH A;  5KL3 A;  1TF6 A;  2CTD A;  1TF3 A;  1X5W A;  2I13 A;  2ELY A;  4FK5 C;  2EQ1 A;  2EOX A;  4M9V C;  2EOF A;  1X6E A;  1WJP A;  2MKD A;  3EPL A;  1YSA C;  4R2E A;  2JPA A;  3MHS C;  2EOI A;  1YUJ A;  1X3C A;  2EML A;  4X9J A;  2YTE A;  1A1K A;  2LO3 A;  2EN4 A;  1TN9 A;  1UN6 B;  2YU5 A;  4R2D A;  5KL4 A;  3VHT B;  2LT7 A;  2EOM A;  2YTI A;  1BBO A;  2YTN A;  2ELZ A;  2EM9 A;  2EPP A;  2YRM A;  2WCC 3;  4R2S A;  4R2P A;  2EPC A;  1P47 A;  4F6M A;  1DGC A;  2EPU A;  1BB8 A;  2YTO A;  2EOJ A;  2E72 A;  1X6F A;  4R2R A;  2EL5 A;  2EOZ A;  1YUI A;  2YSO A;  2JP9 A;  2YU8 A;  2EJ4 A;  4IS1 C;  2EQ3 A;  2J7J A;  2GHF A;  2EM8 A;  2EOH A;  2EMA A;  2EMB A;  2YTD A;  2EOQ A;  3M99 B;  5KL2 A;  2EE8 A;  1KJK A;  3EPH A;  1X6H A;  2WBT A;  1Z1B A;  1G2F C;  2D9H A;  2A25 A;  1RMD A;  2DLQ A;  2YTQ A;  2EM7 A;  5KL6 A;  3EPK A;  1ZU1 A;  2BB8 A;  1JK1 A;  1A1I A;  2MDG A;  3EPJ A;  2YTG A;  2RPC A;  2EN2 A;  2EL4 A;  2YTF A;  2EMX A;  2EMK A;  3UK3 C;  2CT1 A;  1NCS A;  1F2I G;  1A1F A;  2VRD A;  3MHH C;  4IJD A;  1LLM C;  2DGC A;  2EMF A;  5KL5 A;  1G2D C;  2NAB A;  2EN6 A;  2EM3 A;  2EMC A;  4R2Q A;  2EOO A;  2EMZ A;  2EMG A;  2EOY A;  2YTP A;  2ADR A;  2EM5 A;  1B69 A;  2CSH A;  2DMI A;  4R2A A;  2EOR A;  2ENC A;  1MEY C;  2RSI A;  2EN8 A;  2EPR A;  4F2J C;  2EPX A;  2PRT A; 
#chains in the Genus database with same CATH topology
 5A2Q C;  2HGH A;  4J8Z A;  2YSP A;  3ADL A;  2I9I A;  2B9D A;  4DR1 E;  4R2C A;  2JR1 A;  2N3H A;  4JI5 E;  2LV2 A;  4O43 A;  1X49 A;  4BBY A;  2V8Q B;  4DV7 E;  1N33 E;  2LUQ A;  4P78 A;  2N8X A;  3C4T A;  2JOB A;  2LTS A;  4ZYH A;  4LFC E;  1WHN A;  1O0W A;  2DB2 A;  2KOU A;  2EMH A;  1JK2 A;  2EPN A;  4B3R E;  5IV8 B;  4JI4 E;  1ZAA C;  2L2N A;  4DKK A;  5KL3 A;  1HNZ E;  2CTD A;  2ODR C;  2V85 A;  4BS9 A;  4NHR A;  4FK5 C;  4X8W A;  2EQ1 A;  4YHH E;  2RS6 A;  1FJG E;  2VE7 C;  3EPL A;  2Q8U A;  1YSA C;  3JU0 A;  2MDR A;  2EML A;  4JI2 E;  2MC6 A;  2VQE E;  1WXR A;  1N34 E;  2CPN A;  2YTE A;  2UUB E;  2MC5 A;  4RH8 A;  4RHB B;  4R2D A;  5LL6 R;  3VHT B;  2EOM A;  3KWR A;  4BMJ A;  1WHQ A;  3BBG A;  2EWL A;  2EM9 A;  2YRM A;  1EH8 A;  1ZBQ A;  3IWC A;  4R2P A;  1X47 A;  4DV3 E;  2EPK X;  4LFA E;  3DF6 A;  1DGC A;  2EOJ A;  2UXB E;  2YSO A;  2YU8 A;  5IXM B;  2YT4 A;  4BHC A;  2EOQ A;  2EE8 A;  1X6H A;  2WBT A;  3KZZ A;  3ZOQ B;  2HHH E;  2V83 A;  3T1H E;  2D9H A;  5AE3 A;  2DLQ A;  4GKJ E;  2YTQ A;  2EM7 A;  2KHX A;  3ECR A;  4DV1 E;  4JI8 E;  1JK1 A;  2MDG A;  2RPC A;  5A6K A;  4LF9 E;  4X66 E;  4O5G A;  2B7T A;  2LMZ A;  1F2I G;  4IJD A;  4F9C B;  2JY9 A;  2NA2 A;  5KL5 A;  2BBG A;  2EN6 A;  2JXP A;  4BHB A;  2EOO A;  2EOY A;  1RC7 A;  4YY3 E;  4LU9 A;  4KHP E;  4BC7 A;  1B69 A;  2DSY A;  2JYA A;  4R2A A;  1MEY C;  4JI3 E;  2RSI A;  1X48 A;  4F2J C;  2EPX A;  1YYO A;  3VYX A;  4L5N C;  1YYK A;  2MKN A;  2H36 X;  1A1J A;  1KYQ A;  2EM0 A;  1EKZ A;  1PJT A;  4JI0 E;  4P7D A;  2R76 A;  4WYQ B;  4NZV A;  2EN7 A;  2WBS A;  2EL6 A;  2EQ0 A;  1GTK A;  2LTR A;  1T4O A;  1A1G A;  4L8N A;  4WSG A;  2GLI A;  4OX9 E;  4GZN C;  1UHZ A;  4K0K E;  2UXD E;  2EMW A;  2YRK A;  2EPA A;  2L33 A;  1A1H A;  2NUG A;  1PKP A;  1GZ6 A;  4LFB E;  1AH5 A;  4MLV A;  3IWD A;  2I13 A;  2ELY A;  3F6H A;  1HNX E;  4NXM E;  2EOF A;  2M1S A;  4BC9 A;  4WSP A;  2LBS B;  1YYW A;  5A6B A;  4F9B B;  2JPA A;  4B3S E;  5A6B D;  3RMP A;  4F9A B;  4X9J A;  3JTZ A;  2GPI A;  4M0V A;  2EN4 A;  4NXN E;  5AC5 A;  5KL4 A;  2HC5 A;  2LT7 A;  1J5E E;  2YTI A;  5FLX C;  5AE1 A;  2ELZ A;  1DQ3 A;  2L3J A;  2WCC 3;  4JI1 E;  1L4S A;  1T38 A;  3L00 A;  3LLH A;  2F8B A;  1P47 A;  4F6M A;  1BB8 A;  1X6F A;  2JP9 A;  5A6J A;  5ADZ A;  2EJ4 A;  2GHF A;  2EM8 A;  5CFF E;  2EMB A;  2YTD A;  4O24 A;  3JAM C;  3EPH A;  4ZYD A;  1NEI A;  4LTY A;  1G2F C;  2LJH A;  1RMD A;  4DR6 E;  1XNR E;  5KL6 A;  1IBL E;  1RQ0 A;  2VQF E;  5LLQ A;  2EZ6 A;  2YTG A;  1SR9 A;  1T4N A;  2YTF A;  2ZM6 E;  2CT1 A;  1NCS A;  4KZS A;  3MHH C;  2DGC A;  3HQ1 A;  1LLM C;  2DIX A;  3OTO E;  3IWB A;  3HTX A;  3K6Q A;  4MLQ A;  4O4K A;  4TUI A;  2EMG A;  4DR2 E;  2YTP A;  4WPY A;  1XMQ E;  2UUC E;  2ADR A;  4M2Z A;  3J80 C;  3AV0 A;  2DMI A;  3J81 C;  3VK6 A;  2PRT A;  2V87 A;  4GEQ B;  1I94 E;  2V86 A;  2EM2 A;  3VYY A;  1YFH A;  2ENA A;  4LF4 E;  2LVH A;  3OML A;  2EPL X;  1UBD C;  4DV2 E;  2R1F A;  4BCA A;  3J7Y p;  2EM6 A;  2E1M A;  2G7H A;  1A1L A;  1GQE A;  2EMY A;  2LCE A;  2L6M A;  2NUE A;  2B3T B;  5KL7 A;  1AAY A;  3QG5 C;  5DNY A;  2ENH A;  3C4B A;  2N3G A;  2EPO A;  1X5W A;  1QU6 A;  2EOX A;  4M9V C;  4DR4 E;  1WJP A;  3HPS A;  3EQ1 A;  3BF2 A;  4R2E A;  1YUJ A;  1X3C A;  4Q28 A;  4Q35 B;  2F4V E;  2L3C A;  1UN6 B;  1IQO A;  3KZY A;  2E5L E;  4R03 A;  1UIL A;  1BBO A;  2YTN A;  3BID A;  2EPP A;  4R2S A;  1PDA A;  1FKA E;  3DJW A;  1ZBT A;  4R8O A;  4DV5 E;  2KON A;  3ADG A;  4DMI A;  5AAS A;  4JYA E;  4X64 E;  2EPU A;  2E72 A;  1MGT A;  2FV4 B;  2EOZ A;  4HTG A;  2UXC E;  2EQ3 A;  2J7J A;  4B3M E;  2EOH A;  1N3G A;  4WXD A;  5KL2 A;  2LUP B;  5IWA E;  3HPZ A;  4OOG C;  4M30 A;  2LRS A;  2YWQ A;  2A25 A;  4LF7 E;  4JV5 E;  2M7Q A;  4X62 E;  2LJU A;  3EPK A;  4KWY A;  1A1I A;  3J7A G;  4X65 E;  2EL4 A;  4JI6 E;  2EMX A;  2EMK A;  4JI7 E;  1EH7 A;  3UK3 C;  2V88 A;  2VRD A;  4LF5 E;  4F54 A;  2RTX A;  3THN A;  2EM3 A;  2HJJ A;  1J26 A;  2EMZ A;  4AQY E;  5IT9 C;  2LE2 A;  1DI2 A;  1IBK E;  2L8T A;  1QNT A;  2ENC A;  1HR0 E;  1ZR9 A;  2EOE A;  2DLK A;  2WBU A;  4WX9 A;  1STU A;  4GKK E;  2EOS A;  2YTJ A;  1PJS A;  2M4I A;  2EMI A;  3THO B;  2IHR 1;  3HXL A;  1YPN A;  3ADJ A;  4DV0 E;  3LML A;  4F6N A;  2ODR D;  2EN3 A;  2M9A A;  4LF6 E;  2EM4 A;  2JWO A;  2DMY A;  2EP3 A;  4WFT A;  2EPZ A;  4LF8 E;  3C6K A;  1WRJ A;  2EN1 A;  5F3W A;  2DRP A;  2L2K B;  4DR7 E;  2RQL A;  2YRH A;  1TF6 A;  2FGG A;  1TF3 A;  4HEI A;  2K7I A;  5LMN E;  5A6A A;  1XMO E;  4DUY E;  2UU9 E;  4I8O A;  1SFE A;  1X6E A;  2UUA E;  2YPN A;  2MKD A;  4DR5 E;  1BBG A;  5A69 A;  2EPM X;  2RS7 A;  3MHS C;  2EOI A;  3H09 A;  2L2M A;  2B7V A;  1A1K A;  2LO3 A;  4ZYE A;  1TN9 A;  2YU5 A;  1PJQ A;  2RSM A;  4DR3 E;  4DV4 E;  2FTX B;  3MSW A;  3FIG A;  2VF1 A;  5AE2 A;  2EPC A;  3P1X A;  3TQM A;  2YTO A;  3T1Y E;  4R2R A;  2EL5 A;  4B3T E;  4N4R B;  1YUI A;  4IS1 C;  2NUF A;  1IBM E;  2EMA A;  4ZYG A;  3M99 B;  1EH6 A;  1N36 E;  2YZT A;  1KJK A;  1N32 E;  1Z1B A;  4DUZ E;  1T39 A;  4TUG A;  5TSE A;  1YZ9 A;  3F6G A;  4WXC A;  2K4V A;  1ZU1 A;  2L92 A;  2BB8 A;  5AC4 A;  2JVA A;  3EPJ A;  2EN2 A;  1XNQ E;  2WZO A;  1IQS A;  1T4L B;  1HNW E;  1A1F A;  2V89 A;  2JOX A;  5LMU E;  3ADI A;  2EMF A;  1G2D C;  2NAB A;  5T6J A;  2EMC A;  5BR8 E;  4R2Q A;  2EM5 A;  4DV6 E;  1IMU A;  2CSH A;  3C6M A;  2EOR A;  3AUZ A;  3BGH A;  2EN8 A;  2EPR A; 
#chains in the Genus database with same CATH homology
 2HGH A;  2EM2 A;  2MKN A;  1ZR9 A;  2ENA A;  2EOE A;  2DLK A;  2EM0 A;  2YSP A;  1A1J A;  2WBU A;  2LVH A;  4R2C A;  2EOS A;  2YTJ A;  2EMI A;  2LV2 A;  1UBD C;  2R1F A;  4F6N A;  2EN3 A;  2M9A A;  2EM4 A;  2EM6 A;  1A1L A;  2EN7 A;  2WBS A;  2EL6 A;  2EP3 A;  2EQ0 A;  2EMY A;  2LCE A;  2EPZ A;  1A1G A;  4WSG A;  2EMH A;  2EN1 A;  1JK2 A;  5KL7 A;  1AAY A;  2GLI A;  4GZN C;  2DRP A;  2EMW A;  2ENH A;  2YRK A;  1ZAA C;  2EPA A;  1A1H A;  2YRH A;  5KL3 A;  1TF6 A;  2CTD A;  1TF3 A;  1X5W A;  2I13 A;  2ELY A;  4FK5 C;  2EQ1 A;  2EOX A;  4M9V C;  2EOF A;  1X6E A;  1WJP A;  2MKD A;  3EPL A;  1YSA C;  4R2E A;  2JPA A;  3MHS C;  2EOI A;  1YUJ A;  1X3C A;  2EML A;  4X9J A;  2YTE A;  1A1K A;  2LO3 A;  2EN4 A;  1TN9 A;  1UN6 B;  2YU5 A;  4R2D A;  5KL4 A;  3VHT B;  2LT7 A;  2EOM A;  2YTI A;  1BBO A;  2YTN A;  2ELZ A;  2EM9 A;  2EPP A;  2YRM A;  2WCC 3;  4R2S A;  4R2P A;  2EPC A;  1P47 A;  4F6M A;  1DGC A;  2EPU A;  1BB8 A;  2YTO A;  2EOJ A;  2E72 A;  1X6F A;  4R2R A;  2EL5 A;  2EOZ A;  1YUI A;  2YSO A;  2JP9 A;  2YU8 A;  2EJ4 A;  4IS1 C;  2EQ3 A;  2J7J A;  2GHF A;  2EM8 A;  2EOH A;  2EMA A;  2EMB A;  2YTD A;  2EOQ A;  3M99 B;  5KL2 A;  2EE8 A;  1KJK A;  3EPH A;  1X6H A;  2WBT A;  1Z1B A;  1G2F C;  2D9H A;  2A25 A;  1RMD A;  2DLQ A;  2YTQ A;  2EM7 A;  5KL6 A;  3EPK A;  1ZU1 A;  2BB8 A;  1JK1 A;  1A1I A;  2MDG A;  3EPJ A;  2YTG A;  2RPC A;  2EN2 A;  2EL4 A;  2YTF A;  2EMX A;  2EMK A;  3UK3 C;  2CT1 A;  1NCS A;  1F2I G;  1A1F A;  2VRD A;  3MHH C;  4IJD A;  1LLM C;  2DGC A;  2EMF A;  5KL5 A;  1G2D C;  2NAB A;  2EN6 A;  2EM3 A;  2EMC A;  4R2Q A;  2EOO A;  2EMZ A;  2EMG A;  2EOY A;  2YTP A;  2ADR A;  2EM5 A;  1B69 A;  2CSH A;  2DMI A;  4R2A A;  2EOR A;  2ENC A;  1MEY C;  2RSI A;  2EN8 A;  2EPR A;  4F2J C;  2EPX A;  2PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...