2JPAA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
b'ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA04
2EM5A 2WBTA 2EOJA 2EOMA 2R1FA 1AAYA 2ADRA 4R2PA 2EL6A 2EE8A 2VRDA 1X5WA 3UK3C 2YTPA 1LLMC 2YU5A 3VHTB 1A1JA 2ELZA 2EM9A 5KL2A 2WCC3 2EPRA 2EPAA 2DMIA 2EOYA 2EMXA 2PRTA 1X6HA 2DRPA 2EL5A 2EN3A 4R2RA 2WBSA 1YUJA 2J7JA 2MKDA 1DGCA 1UBDC 2JP9A 1BBOA 2EN8A 2EM3A 2EJ4A 2EM0A 2RPCA 2LCEA 2YRKA 3M99B 2EMHA 2LVHA 2EM6A 2YTEA 2YTNA 2EMYA 2YRHA 2EORA 3MHSC 1P47A 1KJKA 2DLQA 2CTDA 2MKNA 2CSHA 4R2SA 2EMIA 5KL6A 4F6MA 2EOOA 1TN9A 2EOSA 1TF6A 4WSGA 2YSOA 1A1IA 1ZR9A 3EPJA 2EM4A 1A1LA 2DGCA 2EM8A 3MHHC 2YTQA 2ENCA 2EOEA 2YTJA 2YTGA 2EN6A 2EN7A 2EMLA 2EL4A 2M9AA 1A1FA 2HGHA 2EQ0A 1MEYC 1X6FA 2EP3A 2BB8A 1X6EA 2NABA 2EPUA 2RSIA 1ZU1A 2LV2A 2EN1A 1X3CA 2EOZA 4R2CA 4F2JC 2WBUA 1BB8A 2EPCA 2EM7A 1G2DC 2DLKA 2LO3A 4GZNC 1UN6B 4R2AA 1YUIA 2YSPA 1Z1BA 1F2IG 2EMBA 2GLIA 2EOXA 2YTOA 2GHFA 1B69A 2CT1A 2E72A 2LT7A 2EMFA 2I13A 1WJPA 4M9VC 3EPLA 2MDGA 1NCSA 2EOIA 2YRMA 2JPAA 1A1HA 2EN4A 2EMWA 2EOFA 2YTIA 4R2DA 4R2QA 2EMAA 2EMCA 1JK1A 2EPZA 1A1GA 2EPPA 1TF3A 2D9HA 2ENHA 1YSAC 2EOQA 2A25A 3EPKA 2EN2A 2EQ3A 2EMKA 4R2EA 4X9JA 2YTDA 2ENAA 5KL5A 2EMZA 5KL7A 2YU8A 2EM2A 4F6NA 2EQ1A 1JK2A 3EPHA 1A1KA 4IS1C 2EOHA 5KL3A 2EMGA 2EPXA 5KL4A 2YTFA 2ELYA 1RMDA 1G2FC 4FK5C 1ZAAC 4IJDA
chains in the Genus database with same CATH superfamily
5AE2A 2L2NA 2R1FA 1NEIA 1WHQA 4F9AB 1YZ9A 2ADRA 2EPOA 4MLQA 4LF8E 2EE8A 2JR1A 1X5WA 4DR7E 5A69A 3UK3C 3L00A 2MC5A 1EH7A 1GQEA 4F9CB 5KL2A 5F3WA 4JI0E 2WCC3 2EPRA 1FKAE 2M7QA 2EOYA 5A6KA 1UILA 2L92A 3AUZA 2EL5A 4R2RA 4DMIA 1YYOA 1STUA 1T4OA 1DGCA 2JP9A 4JYAE 1BBOA 2EM3A 1XMQE 4M2ZA 4WXDA 4WPYA 3M99B 2EM6A 2YTNA 2B7VA 3JU0A 4DR4E 4P78A 4X66E 1IBME 2CSHA 4JI4E 3MSWA 4R2SA 2LBSB 4ZYGA 4DR6E 1GTKA 2EOSA 2V88A 4X65E 1A1IA 3EPJA 1N36E 2LUQA 1X48A 4J8ZA 2EN7A 2B7TA 4M30A 1A1FA 3FIGA 1KYQA 3JAMC 4YHHE 2UXCE 2BB8A 1X6EA 4JI7E 2EPUA 4DR2E 1ZU1A 2LJHA 4R03A 2JWOA 4R2CA 2DSYA 4BBYA 3C4BA 1BB8A 2NUGA 2F4VE 4B3RE 2EM7A 5IXMB 1PJSA 4R2AA 2YSPA 4GKKE 3ADGA 5LMUE 1IQSA 2N8XA 1I94E 2CT1A 2EWLA 4O4KA 1T4NA 2I13A 1WJPA 2EOIA 2YRMA 4JI5E 2JPAA 2YTIA 4DV1E 1TF3A 4TUGA 2EPZA 1A1GA 1HR0E 1EH6A 4N4RB 2RQLA 2A25A 3EPKA 4JI8E 2EMKA 4X9JA 5KL5A 2YU8A 4JV5E 2EQ1A 1A1KA 2NA2A 5KL3A 3P1XA 2EPXA 4B3SE 4Q28A 1DI2A 1G2FC 1HNXE 2NUFA 3OMLA 1ZAAC 2LTRA 4LTYA 3ADLA 2L2KB 4M0VA 4P7DA 2EOMA 2LMZA 4BCAA 1AAYA 2KHXA 4O5GA 1YPNA 2F8BA 3J81C 2UXBE 3J80C 2L6MA 1UHZA 2YTPA 1A1JA 2ELZA 2VQEE 2EPKX 4WFTA 3THOB 4BMJA 2EMXA 1WRJA 4NXNE 2EPNA 4X8WA 4WSPA 3F6GA 2J7JA 4ZYEA 2UUBE 4B3ME 4DKKA 4DV2E 2IHR1 5A2QC 2YRKA 2LVHA 2YTEA 3MHSC 2EMYA 5TSEA 1P47A 1KJKA 2GPIA 2V8QB 4RH8A 4BC9A 3VYYA 2K4VA 2MKNA 3HTXA 2H36X 2LE2A 5KL6A 1N34E 2B9DA 3LMLA 2EM4A 2EM8A 3MHHC 2YWQA 1ZBQA 4LF6E 3JTZA 2EMLA 2EL4A 2M9AA 2HGHA 4OX9E 5CFFE 2NABA 3LLHA 2RSIA 3THNA 2LV2A 2WBUA 3KZZA 4NHRA 2N3GA 1IMUA 4GZNC 1UN6B 1IQOA 1YUIA 1Z1BA 2ZM6E 3C6MA 2YTOA 1RQ0A 2FGGA 4AQYE 2E72A 2VQFE 2LUPB 3VYXA 1QU6A 2EMFA 1EKZA 4M9VC 2HHHE 2UUCE 3T1YE 4X64E 3K6QA 2LRSA 1A1HA 2EN4A 2G7HA 2V87A 1YSAC 4DV6E 2EN2A 5IV8B 1J26A 4R2EA 4DR5E 2JYAA 4LF5E 2UXDE 3J7Yp 2E1MA 2EPMX 4NXME 4DV3E 2EOHA 1DQ3A 3HQ1A 5KL4A 2EZ6A 2YTFA 3T1HE 2DB2A 3BGHA 4FK5C 2EM5A 2WBTA 2V86A 5IT9C 5BR8E 2E5LE 2VRDA 1MGTA 3HPSA 1LLMC 3VHTB 4JI6E 2L8TA 4RHBB 5A6BA 4LU9A 4DR1E 4DUYE 1XNQE 1X6HA 2RSMA 4LFCE 2DRPA 5DNYA 2EN3A 1PKPA 2MKDA 2FV4B 2EN8A 2EJ4A 2EM0A 1PJQA 2N3HA 3C6KA 2LCEA 1N3GA 4DUZE 3BIDA 4WYQB 1AH5A 2L33A 2CTDA 2RS7A 3ZOQB 2KONA 1HNWE 2EMIA 5FLXC 4F6MA 4LFBE 3KZYA 4GEQB 2M4IA 4WSGA 1ZBTA 1YFHA 2DGCA 1XNRE 2YTQA 2EOEA 2VE7C 3KWRA 5AE3A 4JI2E 3BF2A 1FJGE 2EQ0A 2LTSA 1MEYC 1X6FA 3BBGA 4DV5E 4BC7A 3IWCA 4LFAE 2R76A 5A6JA 3ADJA 4LF9E 2L3CA 3F6HA 2DLKA 2HC5A 2YZTA 4Q35B 3HXLA 1SFEA 4L5NC 3C4TA 2LJUA 2GLIA 3HPZA 2EOXA 2GHFA 2L2MA 2KOUA 1B69A 1X47A 2RS6A 2V89A 3DF6A 2UUAE 1GZ6A 2EMWA 2EOFA 4R2DA 4R2QA 1WXRA 2JXPA 2EMAA 2EMCA 4JI3E 4L8NA 4O24A 2D9HA 2ENHA 2MDRA 3ADIA 2EOQA 2EQ3A 2NUEA 4BHCA 3DJWA 1SR9A 2YTDA 4BS9A 4KWYA 1WHNA 2EM2A 3ECRA 4F6NA 1JK2A 4BHBA 1HNZE 4IS1C 2JOBA 4F54A 2JVAA 1T39A 2K7IA 2UU9E 5LMNE 4IJDA 5AC5A 2EOJA 3TQMA 1EH8A 4R2PA 2V83A 1QNTA 2RTXA 2EL6A 3EQ1A 4R8OA 4KZSA 2ODRC 4ZYDA 4JI1E 1X49A 2YU5A 4LF7E 2EPLX 4DV7E 2EM9A 1N33E 2EPAA 1N32E 2DMIA 4X62E 2PRTA 1YYWA 5LLQA 4O43A 2BBGA 2MC6A 2WBSA 3OTOE 4K0KE 1YUJA 2V85A 1UBDC 1PDAA 4DV0E 2JOXA 2RPCA 4TUIA 2EMHA 1IBKE 2ODRD 2YRHA 2EORA 4B3TE 4I8OA 2DLQA 2B3TB 4OOGC 3IWBA 5AASA 5ADZA 2EOOA 1TN9A 1TF6A 1T38A 5A6BD 2M1SA 2YSOA 1ZR9A 1XMOE 1A1LA 5IWAE 5AC4A 4KHPE 2ENCA 2YTJA 2YTGA 2EN6A 3VK6A 4ZYHA 1BBGA 2WZOA 2I9IA 4HTGA 3IWDA 2EP3A 1RC7A 1L4SA 2EN1A 1X3CA 2EOZA 4F2JC 3H09A 2EPCA 1IBLE 2HJJA 2DIXA 1G2DC 2LO3A 4YY3E 3RMPA 1F2IG 4GKJE 2EMBA 1PJTA 2YT4A 2LT7A 2JY9A 5T6JA 3EPLA 2MDGA 1NCSA 2L3JA 1O0WA 4LF4E 5A6AA 5LL6R 4MLVA 4DR3E 3QG5C 1JK1A 2EPPA 4NZVA 1T4LB 2CPNA 3AV0A 1YYKA 2ENAA 2EMZA 5KL7A 1J5EE 4DV4E 3EPHA 2Q8UA 2FTXB 2VF1A 2EMGA 2YPNA 4HEIA 4F9BB 4WXCA 5AE1A 2ELYA 3J7AG 1RMDA 2DMYA 4WX9A
chains in the Genus database with same CATH topology
2EM5A 2WBTA 2EOJA 2EOMA 2R1FA 1AAYA 2ADRA 4R2PA 2EL6A 2EE8A 2VRDA 1X5WA 3UK3C 2YTPA 1LLMC 2YU5A 3VHTB 1A1JA 2ELZA 2EM9A 5KL2A 2WCC3 2EPRA 2EPAA 2DMIA 2EOYA 2EMXA 2PRTA 1X6HA 2DRPA 2EL5A 2EN3A 4R2RA 2WBSA 1YUJA 2J7JA 2MKDA 1DGCA 1UBDC 2JP9A 1BBOA 2EN8A 2EM3A 2EJ4A 2EM0A 2RPCA 2LCEA 2YRKA 3M99B 2EMHA 2LVHA 2EM6A 2YTEA 2YTNA 2EMYA 2YRHA 2EORA 3MHSC 1P47A 1KJKA 2DLQA 2CTDA 2MKNA 2CSHA 4R2SA 2EMIA 5KL6A 4F6MA 2EOOA 1TN9A 2EOSA 1TF6A 4WSGA 2YSOA 1A1IA 1ZR9A 3EPJA 2EM4A 1A1LA 2DGCA 2EM8A 3MHHC 2YTQA 2ENCA 2EOEA 2YTJA 2YTGA 2EN6A 2EN7A 2EMLA 2EL4A 2M9AA 1A1FA 2HGHA 2EQ0A 1MEYC 1X6FA 2EP3A 2BB8A 1X6EA 2NABA 2EPUA 2RSIA 1ZU1A 2LV2A 2EN1A 1X3CA 2EOZA 4R2CA 4F2JC 2WBUA 1BB8A 2EPCA 2EM7A 1G2DC 2DLKA 2LO3A 4GZNC 1UN6B 4R2AA 1YUIA 2YSPA 1Z1BA 1F2IG 2EMBA 2GLIA 2EOXA 2YTOA 2GHFA 1B69A 2CT1A 2E72A 2LT7A 2EMFA 2I13A 1WJPA 4M9VC 3EPLA 2MDGA 1NCSA 2EOIA 2YRMA 2JPAA 1A1HA 2EN4A 2EMWA 2EOFA 2YTIA 4R2DA 4R2QA 2EMAA 2EMCA 1JK1A 2EPZA 1A1GA 2EPPA 1TF3A 2D9HA 2ENHA 1YSAC 2EOQA 2A25A 3EPKA 2EN2A 2EQ3A 2EMKA 4R2EA 4X9JA 2YTDA 2ENAA 5KL5A 2EMZA 5KL7A 2YU8A 2EM2A 4F6NA 2EQ1A 1JK2A 3EPHA 1A1KA 4IS1C 2EOHA 5KL3A 2EMGA 2EPXA 5KL4A 2YTFA 2ELYA 1RMDA 1G2FC 4FK5C 1ZAAC 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM5 A;  2WBT A;  2EOJ A;  2EOM A;  2R1F A;  1AAY A;  2ADR A;  4R2P A;  2EL6 A;  2EE8 A;  2VRD A;  1X5W A;  3UK3 C;  2YTP A;  1LLM C;  2YU5 A;  3VHT B;  1A1J A;  2ELZ A;  2EM9 A;  5KL2 A;  2WCC 3;  2EPR A;  2EPA A;  2DMI A;  2EOY A;  2EMX A;  2PRT A;  1X6H A;  2DRP A;  2EL5 A;  2EN3 A;  4R2R A;  2WBS A;  1YUJ A;  2J7J A;  2MKD A;  1DGC A;  1UBD C;  2JP9 A;  1BBO A;  2EN8 A;  2EM3 A;  2EJ4 A;  2EM0 A;  2RPC A;  2LCE A;  2YRK A;  3M99 B;  2EMH A;  2LVH A;  2EM6 A;  2YTE A;  2YTN A;  2EMY A;  2YRH A;  2EOR A;  3MHS C;  1P47 A;  1KJK A;  2DLQ A;  2CTD A;  2MKN A;  2CSH A;  4R2S A;  2EMI A;  5KL6 A;  4F6M A;  2EOO A;  1TN9 A;  2EOS A;  1TF6 A;  4WSG A;  2YSO A;  1A1I A;  1ZR9 A;  3EPJ A;  2EM4 A;  1A1L A;  2DGC A;  2EM8 A;  3MHH C;  2YTQ A;  2ENC A;  2EOE A;  2YTJ A;  2YTG A;  2EN6 A;  2EN7 A;  2EML A;  2EL4 A;  2M9A A;  1A1F A;  2HGH A;  2EQ0 A;  1MEY C;  1X6F A;  2EP3 A;  2BB8 A;  1X6E A;  2NAB A;  2EPU A;  2RSI A;  1ZU1 A;  2LV2 A;  2EN1 A;  1X3C A;  2EOZ A;  4R2C A;  4F2J C;  2WBU A;  1BB8 A;  2EPC A;  2EM7 A;  1G2D C;  2DLK A;  2LO3 A;  4GZN C;  1UN6 B;  4R2A A;  1YUI A;  2YSP A;  1Z1B A;  1F2I G;  2EMB A;  2GLI A;  2EOX A;  2YTO A;  2GHF A;  1B69 A;  2CT1 A;  2E72 A;  2LT7 A;  2EMF A;  2I13 A;  1WJP A;  4M9V C;  3EPL A;  2MDG A;  1NCS A;  2EOI A;  2YRM A;  2JPA A;  1A1H A;  2EN4 A;  2EMW A;  2EOF A;  2YTI A;  4R2D A;  4R2Q A;  2EMA A;  2EMC A;  1JK1 A;  2EPZ A;  1A1G A;  2EPP A;  1TF3 A;  2D9H A;  2ENH A;  1YSA C;  2EOQ A;  2A25 A;  3EPK A;  2EN2 A;  2EQ3 A;  2EMK A;  4R2E A;  4X9J A;  2YTD A;  2ENA A;  5KL5 A;  2EMZ A;  5KL7 A;  2YU8 A;  2EM2 A;  4F6N A;  2EQ1 A;  1JK2 A;  3EPH A;  1A1K A;  4IS1 C;  2EOH A;  5KL3 A;  2EMG A;  2EPX A;  5KL4 A;  2YTF A;  2ELY A;  1RMD A;  1G2F C;  4FK5 C;  1ZAA C;  4IJD A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  2L2N A;  2R1F A;  1NEI A;  1WHQ A;  4F9A B;  1YZ9 A;  2ADR A;  2EPO A;  4MLQ A;  4LF8 E;  2EE8 A;  2JR1 A;  1X5W A;  4DR7 E;  5A69 A;  3UK3 C;  3L00 A;  2MC5 A;  1EH7 A;  1GQE A;  4F9C B;  5KL2 A;  5F3W A;  4JI0 E;  2WCC 3;  2EPR A;  1FKA E;  2M7Q A;  2EOY A;  5A6K A;  1UIL A;  2L92 A;  3AUZ A;  2EL5 A;  4R2R A;  4DMI A;  1YYO A;  1STU A;  1T4O A;  1DGC A;  2JP9 A;  4JYA E;  1BBO A;  2EM3 A;  1XMQ E;  4M2Z A;  4WXD A;  4WPY A;  3M99 B;  2EM6 A;  2YTN A;  2B7V A;  3JU0 A;  4DR4 E;  4P78 A;  4X66 E;  1IBM E;  2CSH A;  4JI4 E;  3MSW A;  4R2S A;  2LBS B;  4ZYG A;  4DR6 E;  1GTK A;  2EOS A;  2V88 A;  4X65 E;  1A1I A;  3EPJ A;  1N36 E;  2LUQ A;  1X48 A;  4J8Z A;  2EN7 A;  2B7T A;  4M30 A;  1A1F A;  3FIG A;  1KYQ A;  3JAM C;  4YHH E;  2UXC E;  2BB8 A;  1X6E A;  4JI7 E;  2EPU A;  4DR2 E;  1ZU1 A;  2LJH A;  4R03 A;  2JWO A;  4R2C A;  2DSY A;  4BBY A;  3C4B A;  1BB8 A;  2NUG A;  2F4V E;  4B3R E;  2EM7 A;  5IXM B;  1PJS A;  4R2A A;  2YSP A;  4GKK E;  3ADG A;  5LMU E;  1IQS A;  2N8X A;  1I94 E;  2CT1 A;  2EWL A;  4O4K A;  1T4N A;  2I13 A;  1WJP A;  2EOI A;  2YRM A;  4JI5 E;  2JPA A;  2YTI A;  4DV1 E;  1TF3 A;  4TUG A;  2EPZ A;  1A1G A;  1HR0 E;  1EH6 A;  4N4R B;  2RQL A;  2A25 A;  3EPK A;  4JI8 E;  2EMK A;  4X9J A;  5KL5 A;  2YU8 A;  4JV5 E;  2EQ1 A;  1A1K A;  2NA2 A;  5KL3 A;  3P1X A;  2EPX A;  4B3S E;  4Q28 A;  1DI2 A;  1G2F C;  1HNX E;  2NUF A;  3OML A;  1ZAA C;  2LTR A;  4LTY A;  3ADL A;  2L2K B;  4M0V A;  4P7D A;  2EOM A;  2LMZ A;  4BCA A;  1AAY A;  2KHX A;  4O5G A;  1YPN A;  2F8B A;  3J81 C;  2UXB E;  3J80 C;  2L6M A;  1UHZ A;  2YTP A;  1A1J A;  2ELZ A;  2VQE E;  2EPK X;  4WFT A;  3THO B;  4BMJ A;  2EMX A;  1WRJ A;  4NXN E;  2EPN A;  4X8W A;  4WSP A;  3F6G A;  2J7J A;  4ZYE A;  2UUB E;  4B3M E;  4DKK A;  4DV2 E;  2IHR 1;  5A2Q C;  2YRK A;  2LVH A;  2YTE A;  3MHS C;  2EMY A;  5TSE A;  1P47 A;  1KJK A;  2GPI A;  2V8Q B;  4RH8 A;  4BC9 A;  3VYY A;  2K4V A;  2MKN A;  3HTX A;  2H36 X;  2LE2 A;  5KL6 A;  1N34 E;  2B9D A;  3LML A;  2EM4 A;  2EM8 A;  3MHH C;  2YWQ A;  1ZBQ A;  4LF6 E;  3JTZ A;  2EML A;  2EL4 A;  2M9A A;  2HGH A;  4OX9 E;  5CFF E;  2NAB A;  3LLH A;  2RSI A;  3THN A;  2LV2 A;  2WBU A;  3KZZ A;  4NHR A;  2N3G A;  1IMU A;  4GZN C;  1UN6 B;  1IQO A;  1YUI A;  1Z1B A;  2ZM6 E;  3C6M A;  2YTO A;  1RQ0 A;  2FGG A;  4AQY E;  2E72 A;  2VQF E;  2LUP B;  3VYX A;  1QU6 A;  2EMF A;  1EKZ A;  4M9V C;  2HHH E;  2UUC E;  3T1Y E;  4X64 E;  3K6Q A;  2LRS A;  1A1H A;  2EN4 A;  2G7H A;  2V87 A;  1YSA C;  4DV6 E;  2EN2 A;  5IV8 B;  1J26 A;  4R2E A;  4DR5 E;  2JYA A;  4LF5 E;  2UXD E;  3J7Y p;  2E1M A;  2EPM X;  4NXM E;  4DV3 E;  2EOH A;  1DQ3 A;  3HQ1 A;  5KL4 A;  2EZ6 A;  2YTF A;  3T1H E;  2DB2 A;  3BGH A;  4FK5 C;  2EM5 A;  2WBT A;  2V86 A;  5IT9 C;  5BR8 E;  2E5L E;  2VRD A;  1MGT A;  3HPS A;  1LLM C;  3VHT B;  4JI6 E;  2L8T A;  4RHB B;  5A6B A;  4LU9 A;  4DR1 E;  4DUY E;  1XNQ E;  1X6H A;  2RSM A;  4LFC E;  2DRP A;  5DNY A;  2EN3 A;  1PKP A;  2MKD A;  2FV4 B;  2EN8 A;  2EJ4 A;  2EM0 A;  1PJQ A;  2N3H A;  3C6K A;  2LCE A;  1N3G A;  4DUZ E;  3BID A;  4WYQ B;  1AH5 A;  2L33 A;  2CTD A;  2RS7 A;  3ZOQ B;  2KON A;  1HNW E;  2EMI A;  5FLX C;  4F6M A;  4LFB E;  3KZY A;  4GEQ B;  2M4I A;  4WSG A;  1ZBT A;  1YFH A;  2DGC A;  1XNR E;  2YTQ A;  2EOE A;  2VE7 C;  3KWR A;  5AE3 A;  4JI2 E;  3BF2 A;  1FJG E;  2EQ0 A;  2LTS A;  1MEY C;  1X6F A;  3BBG A;  4DV5 E;  4BC7 A;  3IWC A;  4LFA E;  2R76 A;  5A6J A;  3ADJ A;  4LF9 E;  2L3C A;  3F6H A;  2DLK A;  2HC5 A;  2YZT A;  4Q35 B;  3HXL A;  1SFE A;  4L5N C;  3C4T A;  2LJU A;  2GLI A;  3HPZ A;  2EOX A;  2GHF A;  2L2M A;  2KOU A;  1B69 A;  1X47 A;  2RS6 A;  2V89 A;  3DF6 A;  2UUA E;  1GZ6 A;  2EMW A;  2EOF A;  4R2D A;  4R2Q A;  1WXR A;  2JXP A;  2EMA A;  2EMC A;  4JI3 E;  4L8N A;  4O24 A;  2D9H A;  2ENH A;  2MDR A;  3ADI A;  2EOQ A;  2EQ3 A;  2NUE A;  4BHC A;  3DJW A;  1SR9 A;  2YTD A;  4BS9 A;  4KWY A;  1WHN A;  2EM2 A;  3ECR A;  4F6N A;  1JK2 A;  4BHB A;  1HNZ E;  4IS1 C;  2JOB A;  4F54 A;  2JVA A;  1T39 A;  2K7I A;  2UU9 E;  5LMN E;  4IJD A;  5AC5 A;  2EOJ A;  3TQM A;  1EH8 A;  4R2P A;  2V83 A;  1QNT A;  2RTX A;  2EL6 A;  3EQ1 A;  4R8O A;  4KZS A;  2ODR C;  4ZYD A;  4JI1 E;  1X49 A;  2YU5 A;  4LF7 E;  2EPL X;  4DV7 E;  2EM9 A;  1N33 E;  2EPA A;  1N32 E;  2DMI A;  4X62 E;  2PRT A;  1YYW A;  5LLQ A;  4O43 A;  2BBG A;  2MC6 A;  2WBS A;  3OTO E;  4K0K E;  1YUJ A;  2V85 A;  1UBD C;  1PDA A;  4DV0 E;  2JOX A;  2RPC A;  4TUI A;  2EMH A;  1IBK E;  2ODR D;  2YRH A;  2EOR A;  4B3T E;  4I8O A;  2DLQ A;  2B3T B;  4OOG C;  3IWB A;  5AAS A;  5ADZ A;  2EOO A;  1TN9 A;  1TF6 A;  1T38 A;  5A6B D;  2M1S A;  2YSO A;  1ZR9 A;  1XMO E;  1A1L A;  5IWA E;  5AC4 A;  4KHP E;  2ENC A;  2YTJ A;  2YTG A;  2EN6 A;  3VK6 A;  4ZYH A;  1BBG A;  2WZO A;  2I9I A;  4HTG A;  3IWD A;  2EP3 A;  1RC7 A;  1L4S A;  2EN1 A;  1X3C A;  2EOZ A;  4F2J C;  3H09 A;  2EPC A;  1IBL E;  2HJJ A;  2DIX A;  1G2D C;  2LO3 A;  4YY3 E;  3RMP A;  1F2I G;  4GKJ E;  2EMB A;  1PJT A;  2YT4 A;  2LT7 A;  2JY9 A;  5T6J A;  3EPL A;  2MDG A;  1NCS A;  2L3J A;  1O0W A;  4LF4 E;  5A6A A;  5LL6 R;  4MLV A;  4DR3 E;  3QG5 C;  1JK1 A;  2EPP A;  4NZV A;  1T4L B;  2CPN A;  3AV0 A;  1YYK A;  2ENA A;  2EMZ A;  5KL7 A;  1J5E E;  4DV4 E;  3EPH A;  2Q8U A;  2FTX B;  2VF1 A;  2EMG A;  2YPN A;  4HEI A;  4F9B B;  4WXC A;  5AE1 A;  2ELY A;  3J7A G;  1RMD A;  2DMY A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 2EM5 A;  2WBT A;  2EOJ A;  2EOM A;  2R1F A;  1AAY A;  2ADR A;  4R2P A;  2EL6 A;  2EE8 A;  2VRD A;  1X5W A;  3UK3 C;  2YTP A;  1LLM C;  2YU5 A;  3VHT B;  1A1J A;  2ELZ A;  2EM9 A;  5KL2 A;  2WCC 3;  2EPR A;  2EPA A;  2DMI A;  2EOY A;  2EMX A;  2PRT A;  1X6H A;  2DRP A;  2EL5 A;  2EN3 A;  4R2R A;  2WBS A;  1YUJ A;  2J7J A;  2MKD A;  1DGC A;  1UBD C;  2JP9 A;  1BBO A;  2EN8 A;  2EM3 A;  2EJ4 A;  2EM0 A;  2RPC A;  2LCE A;  2YRK A;  3M99 B;  2EMH A;  2LVH A;  2EM6 A;  2YTE A;  2YTN A;  2EMY A;  2YRH A;  2EOR A;  3MHS C;  1P47 A;  1KJK A;  2DLQ A;  2CTD A;  2MKN A;  2CSH A;  4R2S A;  2EMI A;  5KL6 A;  4F6M A;  2EOO A;  1TN9 A;  2EOS A;  1TF6 A;  4WSG A;  2YSO A;  1A1I A;  1ZR9 A;  3EPJ A;  2EM4 A;  1A1L A;  2DGC A;  2EM8 A;  3MHH C;  2YTQ A;  2ENC A;  2EOE A;  2YTJ A;  2YTG A;  2EN6 A;  2EN7 A;  2EML A;  2EL4 A;  2M9A A;  1A1F A;  2HGH A;  2EQ0 A;  1MEY C;  1X6F A;  2EP3 A;  2BB8 A;  1X6E A;  2NAB A;  2EPU A;  2RSI A;  1ZU1 A;  2LV2 A;  2EN1 A;  1X3C A;  2EOZ A;  4R2C A;  4F2J C;  2WBU A;  1BB8 A;  2EPC A;  2EM7 A;  1G2D C;  2DLK A;  2LO3 A;  4GZN C;  1UN6 B;  4R2A A;  1YUI A;  2YSP A;  1Z1B A;  1F2I G;  2EMB A;  2GLI A;  2EOX A;  2YTO A;  2GHF A;  1B69 A;  2CT1 A;  2E72 A;  2LT7 A;  2EMF A;  2I13 A;  1WJP A;  4M9V C;  3EPL A;  2MDG A;  1NCS A;  2EOI A;  2YRM A;  2JPA A;  1A1H A;  2EN4 A;  2EMW A;  2EOF A;  2YTI A;  4R2D A;  4R2Q A;  2EMA A;  2EMC A;  1JK1 A;  2EPZ A;  1A1G A;  2EPP A;  1TF3 A;  2D9H A;  2ENH A;  1YSA C;  2EOQ A;  2A25 A;  3EPK A;  2EN2 A;  2EQ3 A;  2EMK A;  4R2E A;  4X9J A;  2YTD A;  2ENA A;  5KL5 A;  2EMZ A;  5KL7 A;  2YU8 A;  2EM2 A;  4F6N A;  2EQ1 A;  1JK2 A;  3EPH A;  1A1K A;  4IS1 C;  2EOH A;  5KL3 A;  2EMG A;  2EPX A;  5KL4 A;  2YTF A;  2ELY A;  1RMD A;  1G2F C;  4FK5 C;  1ZAA C;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...