2JPAA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jpaA04
2EOZA 2VRDA 2MKDA 1ZAAC 2EOQA 2EMKA 2EPCA 2EM4A 2EOIA 1YSAC 2EOMA 2EN3A 1B69A 1JK1A 2WCC3 2LO3A 4R2EA 1NCSA 2EM3A 2EM8A 2YTFA 4R2SA 1Z1BA 1UBDC 2CTDA 2EOOA 2EMAA 2EP3A 2EMLA 4FK5C 1ZR9A 2EMIA 2DLQA 2EPUA 2YTNA 2EJ4A 3EPJA 1YUJA 2I13A 2EPAA 1P47A 3MHHC 2EMFA 4F6MA 2EN7A 2R1FA 2YRHA 5KL2A 2BB8A 1X6FA 2ELZA 1LLMC 2EL5A 1A1LA 1ZU1A 3VHTB 4IJDA 2EMBA 2LCEA 2MDGA 4R2CA 5KL6A 4IS1C 4F6NA 2ADRA 2YTIA 2EOXA 4X9JA 2EN4A 2MKNA 5KL3A 2ENCA 2EPRA 1WJPA 2EM7A 2M9AA 5KL4A 1MEYC 4R2PA 1A1IA 3EPKA 2EN6A 2EL6A 1A1KA 1A1HA 1TN9A 2EM9A 2EL4A 1BBOA 2WBUA 5KL5A 2GHFA 2EOFA 2EOHA 2YTQA 2EN8A 3MHSC 2YU5A 2YRMA 1UN6B 2EMZA 2CSHA 2EMWA 2LVHA 2NABA 2JP9A 2EN2A 4R2RA 1X3CA 1TF6A 2EPXA 1X6EA 2YTDA 1TF3A 2WBTA 1F2IG 4WSGA 2EM2A 2EOYA 2ENHA 2EMXA 2YTEA 2EQ3A 2WBSA 1JK2A 2A25A 4R2DA 1A1JA 2RSIA 1A1FA 2EM5A 2EQ1A 2EN1A 2DRPA 2HGHA 2EM0A 1AAYA 2LT7A 1RMDA 2E72A 2EOJA 2YTOA 2DLKA 1KJKA 2JPAA 1X6HA 2EPPA 4GZNC 2EQ0A 2EMHA 4R2QA 3EPLA 5KL7A 2EMGA 1A1GA 3EPHA 2DMIA 2PRTA 2YSOA 4M9VC 4F2JC 2LV2A 2GLIA 2EE8A 2EMYA 3UK3C 2EORA 2DGCA 2EOSA 2CT1A 2J7JA 1X5WA 2YTGA 2YRKA 2D9HA 3M99B 2EM6A 1BB8A 1G2FC 1DGCA 2RPCA 2EMCA 2YTPA 1YUIA 2ELYA 2ENAA 4R2AA 2YU8A 2EPZA 2YSPA 1G2DC 2EOEA 2YTJA
chains in the Genus database with same CATH superfamily
2EOQA 2DB2A 1IBKE 2EM4A 2EOIA 3HPSA 4JI7E 4I8OA 5LLQA 2DSYA 2F8BA 4JI8E 2WCC3 1NCSA 2YTFA 2CTDA 2L33A 4P7DA 3HXLA 4DR2E 3ADGA 4O4KA 4DV7E 3HQ1A 4RHBB 1IBLE 3VYXA 2YT4A 1PKPA 3DJWA 4LFAE 1P47A 2Q8UA 2B7TA 2VE7C 1YYOA 2BB8A 2ELZA 1YYWA 3ADIA 1SR9A 2LCEA 4R2CA 4GEQB 4Q35B 4GKKE 2YTIA 2EOXA 4X9JA 2EM7A 2M9AA 1MEYC 4R8OA 4DMIA 4B3SE 2VF1A 2LRSA 3IWDA 3MSWA 1N33E 3BIDA 2EL4A 2V88A 5AE2A 4BS9A 1BBOA 2HJJA 1ZBTA 5KL5A 2YTQA 2EOHA 3THNA 1FJGE 2EN8A 3OMLA 2EMZA 2HC5A 1PJTA 1EH6A 2LVHA 2NABA 2V85A 2HHHE 2B3TB 1T38A 2NA2A 2RS6A 4ZYHA 1N34E 1YYKA 1X3CA 2JYAA 3HPZA 3AUZA 2F4VE 2R76A 2NUFA 1XMQE 4WSGA 1UILA 2EM2A 2ENHA 2EQ3A 3DF6A 4O5GA 2RSIA 4LFCE 3VYYA 1O0WA 4F9BB 4KWYA 5LMNE 2RQLA 3IWBA 4LFBE 2DMYA 1GTKA 3EPLA 2EMHA 3BGHA 1FKAE 1A1GA 1KYQA 1WXRA 1DQ3A 2RSMA 2LMZA 3UK3C 2J7JA 1X5WA 2YTGA 4JI0E 3M99B 2K7IA 3OTOE 4WPYA 1DGCA 4LU9A 4DR5E 2UXDE 2DIXA 2L3JA 2EPNA 2JOXA 4X8WA 2YSPA 3LMLA 4HEIA 2LJHA 3THOB 1ZAAC 5TSEA 2M1SA 5IV8B 2ZM6E 1EH7A 5A6AA 5A6BA 1YSAC 2EOMA 3HTXA 4B3TE 4DV5E 1N3GA 2FTXB 4MLVA 4RH8A 4B3RE 1T39A 2LO3A 5LMUE 2EMAA 4LF7E 2I9IA 1QNTA 4TUGA 1ZR9A 2M7QA 2VQEE 2DLQA 2EPUA 3EPJA 5A6KA 2I13A 2L2KB 2EMFA 5IT9C 2R1FA 4NXNE 3C6MA 4M2ZA 3AV0A 2EL5A 4IJDA 4JI1E 2EMBA 4F9CB 5AC4A 1AH5A 4F6NA 2ADRA 3JU0A 5AE1A 2H36X 4OX9E 2EPRA 4R2PA 4YY3E 2JWOA 1N36E 2KOUA 3K6QA 2WBUA 5ADZA 3MHSC 2YU5A 4KHPE 4DUYE 1RC7A 4ZYDA 3T1HE 2EMWA 4R03A 1XNQE 2EN2A 1GQEA 2L2NA 1X47A 2YPNA 1TF6A 2YTDA 2LTSA 4F9AB 2UXBE 2EOYA 4JI5E 1STUA 2K4VA 2E1MA 2JY9A 4R2DA 3EQ1A 4B3ME 2L3CA 4X62E 1HNZE 2EN1A 5CFFE 3VK6A 5AASA 3BF2A 4LF6E 1RMDA 1T4NA 2YTOA 1HR0E 1GZ6A 1EKZA 2JPAA 1PJSA 2EPPA 2YZTA 1I94E 4R2QA 4BHCA 5KL7A 4BBYA 3EPHA 2DMIA 4BMJA 2PRTA 2LV2A 2GLIA 4O24A 2DGCA 2M4IA 3TQMA 2D9HA 4JV5E 1BB8A 4OOGC 1J5EE 2RPCA 2EMCA 3C4BA 2ELYA 2VQFE 2ODRC 5F3WA 2EOZA 2V86A 2MKDA 3LLHA 2EPCA 2LUPB 3P1XA 3QG5C 4J8ZA 2V8QB 2JXPA 2EN3A 2KONA 4BHBA 2FV4B 1Z1BA 2EM8A 4LF9E 1UBDC 3F6GA 2EMLA 2UUBE 1IQSA 1N32E 4DV2E 1ZBQA 4F6MA 1WHQA 2EN7A 2YRHA 2N3HA 3C6KA 1LLMC 3J80C 4ZYGA 2WZOA 1HNXE 2EWLA 4BC7A 4DV6E 4IS1C 5A6BD 4DKKA 4NXME 5KL3A 1WJPA 5KL4A 1A1IA 3EPKA 2EN6A 2RTXA 1A1HA 1TN9A 4AQYE 4BCAA 2RS7A 4ZYEA 2FGGA 1XNRE 2GHFA 1PJQA 2EOFA 5BR8E 4WXCA 1UHZA 2L8TA 2UU9E 2NUGA 4NHRA 4X66E 1X6EA 3T1YE 2L6MA 3J81C 2WBTA 1WRJA 1SFEA 1RQ0A 1F2IG 1JK2A 2EPKX 2GPIA 2MC5A 2UUCE 2A25A 5IWAE 2EQ1A 4O43A 2DRPA 5AC5A 2E72A 2B9DA 3IWCA 4GZNC 2EQ0A 5A69A 4LF4E 2LJUA 3JAMC 2JOBA 2YSOA 5T6JA 4M9VC 4F2JC 2EORA 4TUIA 2EOSA 4DV0E 2CT1A 1L4SA 2CPNA 2YRKA 2EM6A 1XMOE 4JI3E 1G2FC 2LUQA 2LBSB 3J7Yp 2YTPA 1YUIA 4DR7E 2MC6A 2YU8A 1T4OA 2YWQA 2V87A 2EOEA 3FIGA 4DR3E 2YTJA 1EH8A 2LTRA 2VRDA 1PDAA 2EMKA 2MDRA 2EZ6A 4L5NC 4L8NA 1IBME 1MGTA 1X48A 1YFHA 2E5LE 2JR1A 1B69A 3KWRA 1JK1A 4R2EA 2EM3A 4K0KE 4R2SA 4X65E 2EPMX 2L92A 1J26A 2EOOA 2EP3A 4YHHE 4FK5C 4JI6E 2NUEA 2V89A 2EMIA 2YTNA 2EJ4A 4N4RB 2B7VA 1YUJA 2EPAA 3H09A 3MHHC 1YZ9A 3L00A 1BBGA 4LTYA 3ADLA 3ZOQB 4DV3E 3JTZA 4DV4E 4DR4E 5KL2A 1X6FA 2LE2A 5FLXC 1A1LA 1ZU1A 3VHTB 5IXMB 2V83A 2MDGA 5AE3A 4DR1E 3RMPA 5KL6A 2UUAE 5A6JA 2EN4A 2MKNA 2ENCA 4WSPA 3KZZA 4DUZE 2JVAA 2EL6A 4P78A 1A1KA 4JI2E 3ADJA 1YPNA 2EM9A 1QU6A 4KZSA 4HTGA 4WX9A 1NEIA 2KHXA 4X64E 2YRMA 4JYAE 2G7HA 1UN6B 4DV1E 2CSHA 1IQOA 4M30A 2JP9A 4R2RA 4Q28A 1DI2A 2N8XA 5DNYA 2EPXA 4BC9A 3KZYA 1TF3A 2UXCE 2EMXA 2YTEA 2WBSA 4F54A 4NZVA 2EPLX 1A1JA 1WHNA 2ODRD 1A1FA 2EM5A 4GKJE 4LF8E 4JI4E 2HGHA 2EM0A 1AAYA 2LT7A 2EOJA 3ECRA 4DR6E 1IMUA 2DLKA 1KJKA 5A2QC 1X49A 1X6HA 5LL6R 2EMGA 4WXDA 4M0VA 1HNWE 2EE8A 2EMYA 2L2MA 2IHR1 2BBGA 1T4LB 3C4TA 4LF5E 4WYQB 3F6HA 2ENAA 4R2AA 4WFTA 2N3GA 2EPZA 4MLQA 1G2DC 3J7AG 2EPOA 3BBGA
chains in the Genus database with same CATH topology
2EOZA 2VRDA 2MKDA 1ZAAC 2EOQA 2EMKA 2EPCA 2EM4A 2EOIA 1YSAC 2EOMA 2EN3A 1B69A 1JK1A 2WCC3 2LO3A 4R2EA 1NCSA 2EM3A 2EM8A 2YTFA 4R2SA 1Z1BA 1UBDC 2CTDA 2EOOA 2EMAA 2EP3A 2EMLA 4FK5C 1ZR9A 2EMIA 2DLQA 2EPUA 2YTNA 2EJ4A 3EPJA 1YUJA 2I13A 2EPAA 1P47A 3MHHC 2EMFA 4F6MA 2EN7A 2R1FA 2YRHA 5KL2A 2BB8A 1X6FA 2ELZA 1LLMC 2EL5A 1A1LA 1ZU1A 3VHTB 4IJDA 2EMBA 2LCEA 2MDGA 4R2CA 5KL6A 4IS1C 4F6NA 2ADRA 2YTIA 2EOXA 4X9JA 2EN4A 2MKNA 5KL3A 2ENCA 2EPRA 1WJPA 2EM7A 2M9AA 5KL4A 1MEYC 4R2PA 1A1IA 3EPKA 2EN6A 2EL6A 1A1KA 1A1HA 1TN9A 2EM9A 2EL4A 1BBOA 2WBUA 5KL5A 2GHFA 2EOFA 2EOHA 2YTQA 2EN8A 3MHSC 2YU5A 2YRMA 1UN6B 2EMZA 2CSHA 2EMWA 2LVHA 2NABA 2JP9A 2EN2A 4R2RA 1X3CA 1TF6A 2EPXA 1X6EA 2YTDA 1TF3A 2WBTA 1F2IG 4WSGA 2EM2A 2EOYA 2ENHA 2EMXA 2YTEA 2EQ3A 2WBSA 1JK2A 2A25A 4R2DA 1A1JA 2RSIA 1A1FA 2EM5A 2EQ1A 2EN1A 2DRPA 2HGHA 2EM0A 1AAYA 2LT7A 1RMDA 2E72A 2EOJA 2YTOA 2DLKA 1KJKA 2JPAA 1X6HA 2EPPA 4GZNC 2EQ0A 2EMHA 4R2QA 3EPLA 5KL7A 2EMGA 1A1GA 3EPHA 2DMIA 2PRTA 2YSOA 4M9VC 4F2JC 2LV2A 2GLIA 2EE8A 2EMYA 3UK3C 2EORA 2DGCA 2EOSA 2CT1A 2J7JA 1X5WA 2YTGA 2YRKA 2D9HA 3M99B 2EM6A 1BB8A 1G2FC 1DGCA 2RPCA 2EMCA 2YTPA 1YUIA 2ELYA 2ENAA 4R2AA 2YU8A 2EPZA 2YSPA 1G2DC 2EOEA 2YTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOZ A;  2VRD A;  2MKD A;  1ZAA C;  2EOQ A;  2EMK A;  2EPC A;  2EM4 A;  2EOI A;  1YSA C;  2EOM A;  2EN3 A;  1B69 A;  1JK1 A;  2WCC 3;  2LO3 A;  4R2E A;  1NCS A;  2EM3 A;  2EM8 A;  2YTF A;  4R2S A;  1Z1B A;  1UBD C;  2CTD A;  2EOO A;  2EMA A;  2EP3 A;  2EML A;  4FK5 C;  1ZR9 A;  2EMI A;  2DLQ A;  2EPU A;  2YTN A;  2EJ4 A;  3EPJ A;  1YUJ A;  2I13 A;  2EPA A;  1P47 A;  3MHH C;  2EMF A;  4F6M A;  2EN7 A;  2R1F A;  2YRH A;  5KL2 A;  2BB8 A;  1X6F A;  2ELZ A;  1LLM C;  2EL5 A;  1A1L A;  1ZU1 A;  3VHT B;  4IJD A;  2EMB A;  2LCE A;  2MDG A;  4R2C A;  5KL6 A;  4IS1 C;  4F6N A;  2ADR A;  2YTI A;  2EOX A;  4X9J A;  2EN4 A;  2MKN A;  5KL3 A;  2ENC A;  2EPR A;  1WJP A;  2EM7 A;  2M9A A;  5KL4 A;  1MEY C;  4R2P A;  1A1I A;  3EPK A;  2EN6 A;  2EL6 A;  1A1K A;  1A1H A;  1TN9 A;  2EM9 A;  2EL4 A;  1BBO A;  2WBU A;  5KL5 A;  2GHF A;  2EOF A;  2EOH A;  2YTQ A;  2EN8 A;  3MHS C;  2YU5 A;  2YRM A;  1UN6 B;  2EMZ A;  2CSH A;  2EMW A;  2LVH A;  2NAB A;  2JP9 A;  2EN2 A;  4R2R A;  1X3C A;  1TF6 A;  2EPX A;  1X6E A;  2YTD A;  1TF3 A;  2WBT A;  1F2I G;  4WSG A;  2EM2 A;  2EOY A;  2ENH A;  2EMX A;  2YTE A;  2EQ3 A;  2WBS A;  1JK2 A;  2A25 A;  4R2D A;  1A1J A;  2RSI A;  1A1F A;  2EM5 A;  2EQ1 A;  2EN1 A;  2DRP A;  2HGH A;  2EM0 A;  1AAY A;  2LT7 A;  1RMD A;  2E72 A;  2EOJ A;  2YTO A;  2DLK A;  1KJK A;  2JPA A;  1X6H A;  2EPP A;  4GZN C;  2EQ0 A;  2EMH A;  4R2Q A;  3EPL A;  5KL7 A;  2EMG A;  1A1G A;  3EPH A;  2DMI A;  2PRT A;  2YSO A;  4M9V C;  4F2J C;  2LV2 A;  2GLI A;  2EE8 A;  2EMY A;  3UK3 C;  2EOR A;  2DGC A;  2EOS A;  2CT1 A;  2J7J A;  1X5W A;  2YTG A;  2YRK A;  2D9H A;  3M99 B;  2EM6 A;  1BB8 A;  1G2F C;  1DGC A;  2RPC A;  2EMC A;  2YTP A;  1YUI A;  2ELY A;  2ENA A;  4R2A A;  2YU8 A;  2EPZ A;  2YSP A;  1G2D C;  2EOE A;  2YTJ A; 
#chains in the Genus database with same CATH topology
 2EOQ A;  2DB2 A;  1IBK E;  2EM4 A;  2EOI A;  3HPS A;  4JI7 E;  4I8O A;  5LLQ A;  2DSY A;  2F8B A;  4JI8 E;  2WCC 3;  1NCS A;  2YTF A;  2CTD A;  2L33 A;  4P7D A;  3HXL A;  4DR2 E;  3ADG A;  4O4K A;  4DV7 E;  3HQ1 A;  4RHB B;  1IBL E;  3VYX A;  2YT4 A;  1PKP A;  3DJW A;  4LFA E;  1P47 A;  2Q8U A;  2B7T A;  2VE7 C;  1YYO A;  2BB8 A;  2ELZ A;  1YYW A;  3ADI A;  1SR9 A;  2LCE A;  4R2C A;  4GEQ B;  4Q35 B;  4GKK E;  2YTI A;  2EOX A;  4X9J A;  2EM7 A;  2M9A A;  1MEY C;  4R8O A;  4DMI A;  4B3S E;  2VF1 A;  2LRS A;  3IWD A;  3MSW A;  1N33 E;  3BID A;  2EL4 A;  2V88 A;  5AE2 A;  4BS9 A;  1BBO A;  2HJJ A;  1ZBT A;  5KL5 A;  2YTQ A;  2EOH A;  3THN A;  1FJG E;  2EN8 A;  3OML A;  2EMZ A;  2HC5 A;  1PJT A;  1EH6 A;  2LVH A;  2NAB A;  2V85 A;  2HHH E;  2B3T B;  1T38 A;  2NA2 A;  2RS6 A;  4ZYH A;  1N34 E;  1YYK A;  1X3C A;  2JYA A;  3HPZ A;  3AUZ A;  2F4V E;  2R76 A;  2NUF A;  1XMQ E;  4WSG A;  1UIL A;  2EM2 A;  2ENH A;  2EQ3 A;  3DF6 A;  4O5G A;  2RSI A;  4LFC E;  3VYY A;  1O0W A;  4F9B B;  4KWY A;  5LMN E;  2RQL A;  3IWB A;  4LFB E;  2DMY A;  1GTK A;  3EPL A;  2EMH A;  3BGH A;  1FKA E;  1A1G A;  1KYQ A;  1WXR A;  1DQ3 A;  2RSM A;  2LMZ A;  3UK3 C;  2J7J A;  1X5W A;  2YTG A;  4JI0 E;  3M99 B;  2K7I A;  3OTO E;  4WPY A;  1DGC A;  4LU9 A;  4DR5 E;  2UXD E;  2DIX A;  2L3J A;  2EPN A;  2JOX A;  4X8W A;  2YSP A;  3LML A;  4HEI A;  2LJH A;  3THO B;  1ZAA C;  5TSE A;  2M1S A;  5IV8 B;  2ZM6 E;  1EH7 A;  5A6A A;  5A6B A;  1YSA C;  2EOM A;  3HTX A;  4B3T E;  4DV5 E;  1N3G A;  2FTX B;  4MLV A;  4RH8 A;  4B3R E;  1T39 A;  2LO3 A;  5LMU E;  2EMA A;  4LF7 E;  2I9I A;  1QNT A;  4TUG A;  1ZR9 A;  2M7Q A;  2VQE E;  2DLQ A;  2EPU A;  3EPJ A;  5A6K A;  2I13 A;  2L2K B;  2EMF A;  5IT9 C;  2R1F A;  4NXN E;  3C6M A;  4M2Z A;  3AV0 A;  2EL5 A;  4IJD A;  4JI1 E;  2EMB A;  4F9C B;  5AC4 A;  1AH5 A;  4F6N A;  2ADR A;  3JU0 A;  5AE1 A;  2H36 X;  4OX9 E;  2EPR A;  4R2P A;  4YY3 E;  2JWO A;  1N36 E;  2KOU A;  3K6Q A;  2WBU A;  5ADZ A;  3MHS C;  2YU5 A;  4KHP E;  4DUY E;  1RC7 A;  4ZYD A;  3T1H E;  2EMW A;  4R03 A;  1XNQ E;  2EN2 A;  1GQE A;  2L2N A;  1X47 A;  2YPN A;  1TF6 A;  2YTD A;  2LTS A;  4F9A B;  2UXB E;  2EOY A;  4JI5 E;  1STU A;  2K4V A;  2E1M A;  2JY9 A;  4R2D A;  3EQ1 A;  4B3M E;  2L3C A;  4X62 E;  1HNZ E;  2EN1 A;  5CFF E;  3VK6 A;  5AAS A;  3BF2 A;  4LF6 E;  1RMD A;  1T4N A;  2YTO A;  1HR0 E;  1GZ6 A;  1EKZ A;  2JPA A;  1PJS A;  2EPP A;  2YZT A;  1I94 E;  4R2Q A;  4BHC A;  5KL7 A;  4BBY A;  3EPH A;  2DMI A;  4BMJ A;  2PRT A;  2LV2 A;  2GLI A;  4O24 A;  2DGC A;  2M4I A;  3TQM A;  2D9H A;  4JV5 E;  1BB8 A;  4OOG C;  1J5E E;  2RPC A;  2EMC A;  3C4B A;  2ELY A;  2VQF E;  2ODR C;  5F3W A;  2EOZ A;  2V86 A;  2MKD A;  3LLH A;  2EPC A;  2LUP B;  3P1X A;  3QG5 C;  4J8Z A;  2V8Q B;  2JXP A;  2EN3 A;  2KON A;  4BHB A;  2FV4 B;  1Z1B A;  2EM8 A;  4LF9 E;  1UBD C;  3F6G A;  2EML A;  2UUB E;  1IQS A;  1N32 E;  4DV2 E;  1ZBQ A;  4F6M A;  1WHQ A;  2EN7 A;  2YRH A;  2N3H A;  3C6K A;  1LLM C;  3J80 C;  4ZYG A;  2WZO A;  1HNX E;  2EWL A;  4BC7 A;  4DV6 E;  4IS1 C;  5A6B D;  4DKK A;  4NXM E;  5KL3 A;  1WJP A;  5KL4 A;  1A1I A;  3EPK A;  2EN6 A;  2RTX A;  1A1H A;  1TN9 A;  4AQY E;  4BCA A;  2RS7 A;  4ZYE A;  2FGG A;  1XNR E;  2GHF A;  1PJQ A;  2EOF A;  5BR8 E;  4WXC A;  1UHZ A;  2L8T A;  2UU9 E;  2NUG A;  4NHR A;  4X66 E;  1X6E A;  3T1Y E;  2L6M A;  3J81 C;  2WBT A;  1WRJ A;  1SFE A;  1RQ0 A;  1F2I G;  1JK2 A;  2EPK X;  2GPI A;  2MC5 A;  2UUC E;  2A25 A;  5IWA E;  2EQ1 A;  4O43 A;  2DRP A;  5AC5 A;  2E72 A;  2B9D A;  3IWC A;  4GZN C;  2EQ0 A;  5A69 A;  4LF4 E;  2LJU A;  3JAM C;  2JOB A;  2YSO A;  5T6J A;  4M9V C;  4F2J C;  2EOR A;  4TUI A;  2EOS A;  4DV0 E;  2CT1 A;  1L4S A;  2CPN A;  2YRK A;  2EM6 A;  1XMO E;  4JI3 E;  1G2F C;  2LUQ A;  2LBS B;  3J7Y p;  2YTP A;  1YUI A;  4DR7 E;  2MC6 A;  2YU8 A;  1T4O A;  2YWQ A;  2V87 A;  2EOE A;  3FIG A;  4DR3 E;  2YTJ A;  1EH8 A;  2LTR A;  2VRD A;  1PDA A;  2EMK A;  2MDR A;  2EZ6 A;  4L5N C;  4L8N A;  1IBM E;  1MGT A;  1X48 A;  1YFH A;  2E5L E;  2JR1 A;  1B69 A;  3KWR A;  1JK1 A;  4R2E A;  2EM3 A;  4K0K E;  4R2S A;  4X65 E;  2EPM X;  2L92 A;  1J26 A;  2EOO A;  2EP3 A;  4YHH E;  4FK5 C;  4JI6 E;  2NUE A;  2V89 A;  2EMI A;  2YTN A;  2EJ4 A;  4N4R B;  2B7V A;  1YUJ A;  2EPA A;  3H09 A;  3MHH C;  1YZ9 A;  3L00 A;  1BBG A;  4LTY A;  3ADL A;  3ZOQ B;  4DV3 E;  3JTZ A;  4DV4 E;  4DR4 E;  5KL2 A;  1X6F A;  2LE2 A;  5FLX C;  1A1L A;  1ZU1 A;  3VHT B;  5IXM B;  2V83 A;  2MDG A;  5AE3 A;  4DR1 E;  3RMP A;  5KL6 A;  2UUA E;  5A6J A;  2EN4 A;  2MKN A;  2ENC A;  4WSP A;  3KZZ A;  4DUZ E;  2JVA A;  2EL6 A;  4P78 A;  1A1K A;  4JI2 E;  3ADJ A;  1YPN A;  2EM9 A;  1QU6 A;  4KZS A;  4HTG A;  4WX9 A;  1NEI A;  2KHX A;  4X64 E;  2YRM A;  4JYA E;  2G7H A;  1UN6 B;  4DV1 E;  2CSH A;  1IQO A;  4M30 A;  2JP9 A;  4R2R A;  4Q28 A;  1DI2 A;  2N8X A;  5DNY A;  2EPX A;  4BC9 A;  3KZY A;  1TF3 A;  2UXC E;  2EMX A;  2YTE A;  2WBS A;  4F54 A;  4NZV A;  2EPL X;  1A1J A;  1WHN A;  2ODR D;  1A1F A;  2EM5 A;  4GKJ E;  4LF8 E;  4JI4 E;  2HGH A;  2EM0 A;  1AAY A;  2LT7 A;  2EOJ A;  3ECR A;  4DR6 E;  1IMU A;  2DLK A;  1KJK A;  5A2Q C;  1X49 A;  1X6H A;  5LL6 R;  2EMG A;  4WXD A;  4M0V A;  1HNW E;  2EE8 A;  2EMY A;  2L2M A;  2IHR 1;  2BBG A;  1T4L B;  3C4T A;  4LF5 E;  4WYQ B;  3F6H A;  2ENA A;  4R2A A;  4WFT A;  2N3G A;  2EPZ A;  4MLQ A;  1G2D C;  3J7A G;  2EPO A;  3BBG A; 
#chains in the Genus database with same CATH homology
 2EOZ A;  2VRD A;  2MKD A;  1ZAA C;  2EOQ A;  2EMK A;  2EPC A;  2EM4 A;  2EOI A;  1YSA C;  2EOM A;  2EN3 A;  1B69 A;  1JK1 A;  2WCC 3;  2LO3 A;  4R2E A;  1NCS A;  2EM3 A;  2EM8 A;  2YTF A;  4R2S A;  1Z1B A;  1UBD C;  2CTD A;  2EOO A;  2EMA A;  2EP3 A;  2EML A;  4FK5 C;  1ZR9 A;  2EMI A;  2DLQ A;  2EPU A;  2YTN A;  2EJ4 A;  3EPJ A;  1YUJ A;  2I13 A;  2EPA A;  1P47 A;  3MHH C;  2EMF A;  4F6M A;  2EN7 A;  2R1F A;  2YRH A;  5KL2 A;  2BB8 A;  1X6F A;  2ELZ A;  1LLM C;  2EL5 A;  1A1L A;  1ZU1 A;  3VHT B;  4IJD A;  2EMB A;  2LCE A;  2MDG A;  4R2C A;  5KL6 A;  4IS1 C;  4F6N A;  2ADR A;  2YTI A;  2EOX A;  4X9J A;  2EN4 A;  2MKN A;  5KL3 A;  2ENC A;  2EPR A;  1WJP A;  2EM7 A;  2M9A A;  5KL4 A;  1MEY C;  4R2P A;  1A1I A;  3EPK A;  2EN6 A;  2EL6 A;  1A1K A;  1A1H A;  1TN9 A;  2EM9 A;  2EL4 A;  1BBO A;  2WBU A;  5KL5 A;  2GHF A;  2EOF A;  2EOH A;  2YTQ A;  2EN8 A;  3MHS C;  2YU5 A;  2YRM A;  1UN6 B;  2EMZ A;  2CSH A;  2EMW A;  2LVH A;  2NAB A;  2JP9 A;  2EN2 A;  4R2R A;  1X3C A;  1TF6 A;  2EPX A;  1X6E A;  2YTD A;  1TF3 A;  2WBT A;  1F2I G;  4WSG A;  2EM2 A;  2EOY A;  2ENH A;  2EMX A;  2YTE A;  2EQ3 A;  2WBS A;  1JK2 A;  2A25 A;  4R2D A;  1A1J A;  2RSI A;  1A1F A;  2EM5 A;  2EQ1 A;  2EN1 A;  2DRP A;  2HGH A;  2EM0 A;  1AAY A;  2LT7 A;  1RMD A;  2E72 A;  2EOJ A;  2YTO A;  2DLK A;  1KJK A;  2JPA A;  1X6H A;  2EPP A;  4GZN C;  2EQ0 A;  2EMH A;  4R2Q A;  3EPL A;  5KL7 A;  2EMG A;  1A1G A;  3EPH A;  2DMI A;  2PRT A;  2YSO A;  4M9V C;  4F2J C;  2LV2 A;  2GLI A;  2EE8 A;  2EMY A;  3UK3 C;  2EOR A;  2DGC A;  2EOS A;  2CT1 A;  2J7J A;  1X5W A;  2YTG A;  2YRK A;  2D9H A;  3M99 B;  2EM6 A;  1BB8 A;  1G2F C;  1DGC A;  2RPC A;  2EMC A;  2YTP A;  1YUI A;  2ELY A;  2ENA A;  4R2A A;  2YU8 A;  2EPZ A;  2YSP A;  1G2D C;  2EOE A;  2YTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...