4ZYEA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
PMLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 42
structure length 152
sequence length 152
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyeA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyeA01
1XCBA 2HR3A 3RKXA 1SFEA 2VE8A 3I53A 3Q9VA 1FZPB 2J5OA 2L3DA 3QPHA 4CZZA 3F8CA 2FSWA 2E1CA 4DQ2A 4G8XA 2XKOA 2L4MA 1QPMA 4HF0A 4KIFA 3BPVA 1R1TA 1ON1A 1FY7A 3N97A 4M74A 1BC7C 1P2FA 2XVCA 5BPIA 3J80K 3WGIA 1ZLKA 2VBXA 5ILSA 2HEOA 5CYVA 1RNLA 1WQ2A 2LDUA 4KMUX 1P4WA 2Q2EA 1SD4A 2IW5A 1LDJA 2A3SA 4Q5SF 4ENKA 2ZO4A 2ELHA 4EGZA 3ZMUA 1ZRCA 2HZTA 1D3YA 2F5EA 2KJCA 3H3ZA 3ABTA 5EEHA 5L3DA 3WE2A 1FYLA 3CLOA 2FMLA 3EQLF 4AD9A 4KMFA 2M1BA 4L5JA 2WV0A 2WC2A 4ESJA 5FLXK 2GZWA 3IKVA 2NYXA 1WWXA 1STZA 3MCZA 4HQMA 1SD6A 6PAXA 2XAGA 2QLZA 3RKYA 2ZMEA 3AAFA 2XRNA 3FZVA 5BMZA 2XAQA 1CF7A 1X3UA 1W4MA 3KP6A 4MHGA 3JTHA 3VB2A 1OYIA 4Q4ZF 2JPCA 5F1RA 1IUYA 4GCVA 3IWZA 2NRAC 4CGZA 2PN6A 4EM2A 2M87A 1H9GA 2L4AA 1XGMA 3HIFA 2V9VA 5D6EA 1QGPA 4NB5A 4A0XA 3F72A 3M8FA 2IP2A 4A2UA 2LF7A 2OD5A 3KEQA 1UFMA 3KP2A 2O3FA 4Q48A 4IRIA 1W5TA 3DQVC 1KGSA 2ZXJA 3TDZC 1XD7A 4BAYA 2D1HA 4UXNA 3KP3A 1S29A 4ESFA 2QVOA 3EYYA 5HS9A 4MQVA 1HBXG 1DPUA 3F6VA 4KIBA 5DCMB 1TW2A 3F8BA 2P4WA 4R79A 2XV4S 1K7AA 2ZMEB 3E6BA 4MGRA 1I5ZA 1QQIA 2DK5A 1XB4A 4B8XA 2LKPA 3DPTA 1S7AA 3K1NA 3IRQA 5ICEA 1QO0D 1T98A 1PDNC 3T5XA 3E5XA 1G3TA 3GXOA 2FNPA 2XROA 1FX7A 3P9KA 2K4JA 3KZYA 1QNTA 4XSXF 3P9CA 4A12A 4BHPA 4KUMA 3WU1B 2YX4A 4O6JA 1IXCA 4XSZF 2ISZA 2K4BA 3JTGA 3DV8A 1T0FA 3DKWA 4GGGA 3GZ6A 3ECOA 1IZ1A 4LG0A 1IN4A 1ZG3A 2WWYA 1FLIA 3M9AA 1XMKA 2LSOA 2TDXA 1KQ9A 4EQQA 3RIRA 2CQKA 1U8RA 2FA5A 3IWFA 1MDMA 2QYOA 3L2CA 2GQQA 4I02A 1HW2A 3WTWC 1YW7A 1B9MA 2VC0A 1KU9A 3R61A 4UHTA 2H6BA 3LQRA 5AIQA 1F1ZA 4MEXF 2EFOA 1MJBA 2R7DA 3R0JA 5ERIA 1XSVA 2F2EA 2F5FA 4LFUA 4XRFA 1H0MA 2Y0MA 3FXQA 4N9IA 4LB6B 5K5QA 1S6LA 3ZN0A 5D5UB 2DLLA 3KETA 4A6EA 5E1ZB 4KN4X 1U5TA 1SD5A 5ICFA 1UHWA 1LJ9A 5D5WB 1TNTA 1Z6RA 2OQRA 2HQNA 3GO5A 4LG0B 3IL2A 2COMA 3DFGA 2IVMA 4H0EA 1Z1DA 4HQEA 1HKQA 3V7CA 2H6CA 2DPDA 5CVVA 3TQNA 3ULQB 3BDDA 2YR2A 1LQ1A 3TDUC 1LDKB 2X0LA 2DI3A 1USTA 2V79A 2ADUA 1NHAA 2MH9A 1XDSA 1IN8A 4FT8A 1OMIA 1R5HA 3M8EA 3KZZA 3LQQA 4WK8F 3GX4X 2EA4A 4IJAA 1LNWA 5CVUA 3HHGA 3FHZA 3I4PA 4OU0A 1EH7A 2ZNZA 3MAJA 1FWZA 3BP8A 3GWZA 4ASNA 3H3UA 1P6RA 4HLXA 3P9IA 5D6FA 2HTSA 1FC3A 4I98B 2STWA 2Q0OA 3Q5FA 1KU7A 5LLQA 3QP6A 3ZMTA 1RUOA 2MC3A 2CO5A 1FNNA 1R1UA 4CYDA 4ZZDA 5DUIA 4HW0A 5D5XB 1WRJA 1DP7P 1XGSA 4XLNF 5EEGA 2ACJA 1UB9A 1B9NA 3DPLC 4M73A 3QPTA 3OV8A 5HOOA 4HZFA 1G3YA 2Z99A 3GW2A 1U5TC 3BROA 4BH9A 3KLOA 4FHTA 1USSA 1PUEE 5AONA 2Y75A 4HV5A 5LEKA 3PQJA 4FX0A 2VODA 4CICA 1P4XA 2CWEA 4A5MA 1ZH5A 5L3CA 2DU9A 1J59A 1Z9CA 4M6XA 3R4KA 4HDUA 4TV7A 2KRFA 1HW5A 1S7OA 4LD5A 5LRRA 4L9JA 4Q47A 4LLNA 4UV8A 5LHIA 4IF4A 4ENJA 2A69F 2BV6A 1QZYA 1OYWA 2V1UA 1CGPA 2IPQX 2V1XA 3FWEA 2D1VA 1BOAA 3HTSB 2DQLA 3QP5A 3LFKA 1ZN2A 4HX4A 3HRTA 4BQAA 3O2PE 3TGNA 1R22A 2EFWA 4Y17A 1KQ0A 2ESHA 2DPUA 4I09A 2YU3A 3KEOA 5DEQA 2FXAA 2P8TA 2RNJA 4A5NA 1BI1A 4U88A 2YPRA 4B09A 4I7HA 2QQAA 5L3FA 3QU6A 1EH6A 3ZPLA 1V3FA 2XAJA 4FX4A 2O03A 1R36A 4LK1F 1OYYA 4RGXA 1DUXC 3HSEA 3HYIA 1DDNA 2R3SA 4E70A 2RVCA 1GXPA 4KYWA 4HV6A 4MEYF 4PCQA 3MZYA 3SHFA 3I64A 4RGUA 4G6QA 3I59A 5FLXZ 1LEBA 1O3RA 3TO9A 5F6FA 5J6XA 4AIHA 3W6KB 3C3WA 2QWWA 3WTXC 2F5CA 4N0BA 3HOTA 2CG4A 2PFBA 3ELKA 1ONVA 1BI2A 1FP1D 2FE3A 5FO5A 1UCRA 2LF8A 1F4KA 1XN7A 4LJZF 1TNSA 3T1BA 5LBQA 1MKMA 1I6XA 2DBBA 2DK8A 5E17F 4P9UA 3J81K 3R6SA 2C6YA 2DFIA 1O7FA 4KDPA 2BGCA 1G6NA 2J5PA 4MNUA 3EUHA 1XGNA 4WXDA 3MQ0A 5LGTA 1XDUA 2HWVA 4OINF 3KP4A 5LRSA 1VTNC 2OZ6A 3JSPA 5ED4A 2HKXA 4M9ZA 1Z7UA 4ZYDA 1S3JA 4U7DA 1G3WA 4ZZLA 2EV5A 3F8FA 4HBLA 5ILVA 1I27A 1KQ8A 3LSTA 1MZBA 1TTYA 4HOBA 4IVNA 3V8JA 2E7WA 1TBXA 2CSOA 3WGHA 2VONA 2H09A 2UWMA 4WF2A 2A07F 4M71A 5HDKA 3C1DA 5ILUA 2DAOA 4EJTA 5A2QK 4GO1A 2XKPA 1T6SA 4OOIA 1G3SA 4A0ZA 1JGSA 3KE2A 5CJ9A 1J9IA 2DTRA 2EJRA 4PGGA 3ERED 1ZGAA 4R1HA 2H27A 5FGMA 5DD8A 3VOEA 1HXDA 5DCFA 4AWXB 1IW7F 3CUOA 3F22A 3KP7A 4M9SA 1Z6TA 3GFIA 5HLHA 4I2OA 1KA8A 5LHGA 3VEPA 5E8IA 2O61A 2O8XA 2D45A 3T8RA 3DP7A 5DDGA 1GVJA 1BBYA 2MLGA 2MH2A 1O7LA 2FNAA 4D0PA 3H92A 1P4AA 3Q9SA 2HFHA 2MA3A 3F8NA 3GZ5A 2YX7A 4WX9A 3WTUC 2K02A 2E7XA 3FF5A 5H20A 3E6CC 5AIPA 4JK1X 4UVBA 1J5YA 3L00A 3G3ZA 2P6SA 1YS6A 3NEUA 1PP8F 3U9GA 1U6GA 2OU2A 1ZLJA 4HLYA 4ZYHA 2IT0A 3ZN1A 3P7NA 4G6DA 1KU2A 5E18F 4A0YA 2GXGA 3LAJA 2OAZA 3KP5A 2NNYA 3OOPA 5DYMA 2M5WA 4GYIA 3O6BB 5HLIA 4LGWA 3CTAA 4U7BA 3JAMK 4PGHA 2RV8A 2X4HA 2ZCWA 2HKOA 5K5RA 4KFCA 4PDKA 3HRMA 3PFIA 2P5KA 1FPQA 2EK5A 2FU4A 2RDPA 5K5OA 3FMSA 2KIUA 1W7PB 4MQ9F 4UVCA 5HDGA 3V7SA 4I01A 3K69A 2QENA 5FD5A 4YFKF 1J7KA 1HSTA 5BOXA 2HDCA 2R7FA 3IC7A 3D0SA 4RB2C 5IT3A 3RDIA 3QRFF 2BBYA 3FM3A 2ZKZA 1ULYA 2KIFA 3HSRA 3R0AA 5D4RA 1Y0UA 2M30A 1P92A 4BHCA 3ISPA 1MJAA 2VC1A 1TQPA 5FB2A 4RB1A 3W6JB 5FFZA 4R8HA 2HS5A 1B1BA 1BI3A 3RI4A 2B0LA 5IT9K 2VN2A 2KJBA 2PI0A 1B4AA 3F6OA 4L9TA 4IRGA 3RYRA 1W7PD 2HGCA 2GXBA 3TKYA 3CO7C 2HQRA 4NQWA 3NQOA 2RC4A 4QLCU 5L3GA 4A6DA 1F9NA 1YYVA 3S2WA 5A2QZ 4GYGA 3GVAA 4LLGF 1F5TA 3ZP5A 2XAHA 4PZJA 3HRUA 1O57A 3FMRA 2FF4A 1FSEA 2FQ3A 3QOPA 1O3SA 5HVQC 1HQCA 3WGGA 1ZGJA 3LWFA 2W25A 2PJPA 3V8LA 3KCCA 2ZFWA 4KNYA 1HSJA 4EJOA 2FBHA 1IXRC 1B59A 2HYGD 3E3VA 3U2RA 4I0BA 1A04A 5DV5A 2VBZA 1LDDA 3ROUA 2IJLA 1EH8A 4JBAA 4AIJA 1XGOA 2IA1A 3BZ6A 3L7WA 2M8EA 3HUGA 3LA7A 2GA2A 1I1GA 2IA0A 2QM3A 1J0RA 4ZYGA 2P7CB 1D8KA 4EM1A 1IN7A 3COAC 3BJ6A 4OIPF 2A68F 2BE5F 5D8LB 1YW8A 2G9WA 4IHTA 2ETHA 4OIQF 2GAUA 4XLPF 1BIBA 4DNCA 2OQGA 3L09A 1BN5A 1UHMA 2RN7A 1FYKA 2JPBA 2AXLA 3J80Z 1ZRDA 1TW3A 2IA2A 5F64A 2VT2A 4ENNA 1U5TB 4KN7X 5DD4A 4G7ZF 4RGSA 2VOPA 2XGXA 4KICA 4AIKA 1J75A 3DF8A 2FEZA 3REOA 3TO6A 2P5LC 5E8GA 2GWRA 3HSFA 1U2WA 4BNCA 3WTVC 1WKMA 1JXSA 2ZNYA 3B02A 4ESBA 1LVAA 3JW4A 1YO5C 3CO6C 4BHBA 2AS5F 3M1EA 5JFRA 3QU3A 5BS6A 2DQRA 1FOKA 1XSXA 3ECHA 2FBIA 3V4GA 4UVAA 1YW9A 1G4DA 2RQPA 3F21A 5L3BA 3GFLA 3T8TA 5TJJA 1IXSB 4UNOA 3SZTA 4U0WA 4OMYA 4S04A 2D2WA 2IRFG 4RAZA 2RGVA 5HS8A 3SQNA 4I0AA 4YFNF 2PEXA 3BJOA 1HW1A 2V6CA 2VT3A 1GXQA 4HAMA 2JTVA 1WSUA 1AOYA 2CW0F 2FRHA 3QAHA 1T39A 2E1NA 3LA2A 1JE8A 5LEJA 1SAXA 3F23A 1FYMA 4HYEA 4RGRA 2ZJ2A 5HDNA 1XMAA 4EV0A 5TRDA 4MTEA 2EFNA 4P5OA 5J8CA 4CO8A 3VODA 3HTUA 2PQ8A 1YS7A 5CVIA 2DO7A 1R23A 2NS0A 2V1DA 1DPRA 2JZYA 2LNBA 3MFKA 1Z05A 1K79A 3EDPA 1SMTA 3SXYA 1MJ9A 3GFMA 5LGNA 1SFXA 4L5IA 1K78B 4RB0A 1R1VA 3KFWX 3CJNA 1U3EM 3RPUA 1IN5A 1FT9A 3U1DA 4EM0B 5LHHA 1BIAA 5CLSA 3RPQA 3RJPA 2STTA 1T38A 1EV7A 2PLYA 4RS8A 4EMSA 2A6HF 4HX8A 3WTZA 1BJAA 4L9NA 4G7HF 1MDMB 1K6OA 3GUDA 1FP2A 2L02A 1ZREA 1YFHA 3EYIA 2MLKA 4K2EA 4LB5A 2RKHA 5FFXA 3ML6A 1XCVA 3WTTC 3F3XA 3IHUA 1RIOH 3FXUA 1S8NA 3KLNA 1OPCA 1Q1HA 3K9TA 2JT1A 1YLFA 5E1XA 3ZMVA 3RYPA 1MD0A 4IXAA 4KA4A 2QBYA 2H94A 3T0YA 2CYYA 1IRGA 1RZ4A 4M72A 2FMYA 2OBPA 4L9VA 2EB7A 2K86A 3HHHA 4WCGA 4XBFA 2QQ9A 3NRVA 3LAPA 4BYYA 3GLXA 1ZAOA 3DEUA 2JRTA 3FMQA 3WODF 1YQAA 2Z3YA 5D5VB 4EJVA 1LB2A 1RUNA 2YSRA 3CUQB 2DW4A 5H6QA 3ZMDA 2EFQA 2Q8KA 4L0YB 1QZZA 4IRHA 2FOKA 1L0OC 2QUFA 1ODDA 2ZBKA 2NAZA 1W7PA 3WU0A 4LK0F 3I59B 3BY6A 4Y15A 3CDHA 4U0YA 1SMYF 2ISYA 1AWCA 2L54A 1WI9A 1H9TA 4CHUA 2XIGA 5ICGA 2XHKA 3TOBA 3ABUA 2GIVA 3I58A 3M7GA 4JQFA 4NHJA 1L3LA 1XSDA 1YIOA 4HDVA 4G9YA 3J7AO 4U0VA 4L0ZB 4IHSA 3V7RA 4P9FA 3FX3A 3N4MA 1R00A 2EWNA 3JSOA 5BPDA 1ON2A 5E20A 3GEZA 1W5SA 2UXNA 1OKRA 2A5YB 2W84A 5JR3A 2K27A 3WG9A 5IT9Z 2XASA 3LA3A 4G94A 4YG2F 2Z5UA 3I0TA 3D5LA 4CXFA 4RB3C 3WTYC 2DT5A 4F7ZA 4HX7A 2XUBA 3GYHX 4OIRF 1E17A 1I1SA 4IPAA 5JVTA 2VXZA 2VBWA 4G7OF 2QBYB 2M45A 5HS7A 1BM9A 4EJWA 4GXOA 5DUKA 5JI6A 1HKTA 3IRRA 1JHHA 2EV6A 3CUQA 2O6GE 1IN6A 5LGUA 1C0WA 2UXXA 1R5GA 2VOOA 1IRFA 1TQIA 2OA4A 1D8JA 1ZHFA 1D5VA 5K1YA 1YTYA 3MWMA 3ZMZA 4HA8A 1FBUA 1ZG5A 4EGYA 5CVRA 3GF2A 5D4SA 1T2KA 2P5VA 4YIFA 4L18B 4EJUA 5KK1A 3RTRA 2W24A 4LMYA 1TLHB 3B73A 4MTDA 5HLGA 3L9FA 3BOQA 2Z9OA 3ZQ7A 4AVPA 1KYWA 5L3EA 3E6DA 2W85A 3DXJF 3FM5A 1LEAA 4OIOF 3I54A 5KVRA 4ETSA 1V4RA 3EETA 2VBYA 1RI7A 3TO7A 4YFXF 4YIIA 4WWCA 4OMZA 3ZMSA 2WTEA 1GHCA 1YG2A 4ENMA 1BI0A 1TQMA 5H6RA 1SFUA 2HTJA 5BQTA 5J8FA 1ZYRF 1QBJA 1ZARA 1MGTA 4P96A 2BEOA 1O3TA 3IKTA 1BC8C 2ESNA 3BPXA 1K78A 2P7VB 4WXHA 1B6AA 2JSCA 3G73A 2EA2A 4KIGA 4EVIA 1Z91A 3MEXA 2P6TA 3K1MA 5E1WA 2HOEA 4Z2YA 4UV9A 3FXRA 1ZG1A 2XAFA 1OR7A 4O5VA 3R60A 3JAMZ 2QQBA 1CF7B 3WE3A 3BJAA 5JHUA 3E97A 4M6YA 2Z33A 3GFJA 1FBSA 2A6EF 1JHFA 3J81Z 4CDGA 5DCMA 5ICCA 3C7JA 4M9XA 4HF2A 1ZRFA 3HRSA 2A61A 1KYZA 3C18A 3E5QA 3RKWA 1U78A 2W57A 2CFXA 4QWQA 2PMUA 2QZ8A 4N9HA 5CVJA 3CUQC 1HKSA 4P55A 4WXCA 2Y48A 4RAYA 1E2XA 1REPC 1R58A 2EV0A 2NNNA 2G7HA 2MD5A 2PBIA 3E6MA 5D8KB 4HF1A 2VE9A 3I5UA 4ZH4F 4KT5C 3F8MA 2KKOA 4ZYEA 2KIMA 2GA1A 1J2XA 5FD6A 4LLLA 3PQKA 4S05A 2FBKA 3SFZA 3WTSC 2PMHA 3K0LA 2K7LA 2MBFA 2F5DA 1KU3A 2BYVE 2EFPA 2PG4A 2O0YA 2L01A 1SD7A 3K1PA 2HYFA 2OZUA 4UUVA 1IAWA 4Y13A 1R7JA 1IF1A 1FSHA 3BWGA 3MZHA 3VFZA 3E5UA 2UZKA 3SZPA 3O3KA 1O3QA 3TOAA 4BXUA 1FBQA 4O3MA 2G7UA 4ON0A 3HOSA 2CGPA 3V8KA 1PP7U 3I71A 3K2ZA
chains in the Genus database with same CATH superfamily
2RQLA 4G12A 3NWTA 1WI3A 1XCBA 2HR3A 1GTKA 1Y1WJ 1A5JA 3RKXA 1SFEA 2VE8A 1V5EA 3I53A 2UU9E 3Q9VA 5A6JA 5A6AA 4KT6A 1FZPB 3S1MJ 2J5OA 2L3DA 1Z21A 4GEQB 3QPHA 5EGOA 5C4JJ 4NHRA 2EOEA 4CZZA 5M3MJ 4J19A 1WGXA 3F8CA 4E4HA 2FSWA 2E1CA 2FQ4A 4DQ2A 2AHQA 4G8XA 3EUKL 4NNJA 4IHXA 2EMLA 3OL3A 2XKOA 2L4MA 1QPMA 5EJCA 2E34A 2A25A 2QCOA 3K4JA 4HF0A 4DV5E 2IS2A 4KIFA 3BPVA 2HQ5A 1R1TA 1YRNB 1ON1A 1FY7A 3N97A 4M74A 3FXLA 3ZXSA 1P2FA 2XVCA 1BC7C 5BPIA 3J80K 1UELB 3H5AA 5KL5A 4DV1E 2HDWA 3WGIA 2Y69H 1ZLKA 1YOVB 2VBXA 5ILSA 3JR9A 2DMUA 2L7KA 2QEXI 3AV0A 4Y4RA 2HEOA 1R49A 2VKHA 5CYVA 2EM3A 1K83J 2ZJRF 5CQEA 1RNLA 1WQ2A 2LDUA 4KMUX 3KWRA 4RLFA 2BY1A 2EPAA 2EM4A 1ERDA 1P4WA 2Q2EA 1SD4A 4FISA 3K4NA 2CUJA 2E1OA 2IW5A 1LDJA 2A3SA 4XLEA 3DBLB 2Y31A 4Q5SF 2DA2A 3H1CA 2CTDA 4ENKA 3C6KA 4FCYA 2CUFA 5FLXC 2ZO4A 2K4VA 2ELHA 4EGZA 1V54H 2MSYA 5E79C 3ZMUA 1ZRCA 2HZTA 1MMNA 1D3YA 3CJRB 2ZM6E 2FTXB 4S0HB 4DV3E 3DTEA 2EPKX 4MLOA 1HNXE 4UUSB 2F5EA 4QPOA 3LSHA 4CCKA 2KJCA 3H3ZA 2E60A 3ABTA 5EEHA 5L3DA 3WE2A 1FYLA 1G59A 3IWDA 5A6KA 4JV5E 2WADA 3CLOA 3Q0WA 2HPIA 2JMWA 3TW6A 1ZBTA 2N8XA 3HOXJ 2FMLA 2V9PA 2R1FA 3EQLF 4AD9A 2EMKA 2IXSA 1VQ6I 4KMFA 2VXDA 3MMYB 2RREA 3BGHA 2M1BA 4L5JA 1VQPI 4XIDA 4MLVA 1TF3A 2QGUA 3SZGA 2WV0A 3H3VK 2WC2A 4ESJA 2KOUA 5LMUE 5FLXK 3GTGJ 2GZWA 1A31A 3IKVA 3MD2A 1Y56A 3L2RA 2NYXA 4R2CA 1WWXA 5J4YA 2HOAA 1STZA 2GLIA 3MCZA 4HQMA 3T1HE 1SD6A 6PAXA 2XAGA 1JKPC 1Z7LA 2QLZA 4UUSA 1Z77A 2LVSA 3RKYA 4XRSG 2ZMEA 3AAFA 1E0EA 1X6EA 2XRNA 3BR0A 3FZVA 2L7FP 4AM3A 3ZQIA 2L9SA 1MEYC 5JLXA 2FUG2 5BMZA 3FBIB 2BY3A 1U8BA 3F6HA 2XAQA 3AG4H 5EF6A 1CF7A 2LTPA 4OOGC 3J7AG 1X3UA 1W4MA 3KP6A 1BR4A 4MHGA 2JWOA 2OCEA 3JTHA 3VB2A 1OYIA 4FQGA 3RKQA 2K9MA 4Q4ZF 3WU2C 2JPCA 2X1EA 4XONA 5F1RA 4B4CA 1IUYA 4N4RB 4GCVA 1P47A 3IWZA 1Z0XA 1XMXA 3ESWB 2N8GA 1L4SA 2ZMEC 2Z16A 2NRAC 4CGZA 4A3MJ 3OMLA 5F0HA 4V19K 1X4OA 2PN6A 4EM2A 1MBGA 2DYRH 2M87A 1N34E 2ELKA 1H9GA 1ETYA 1XGMA 2L4AA 2NS7A 4PSWA 2MKDA 3D5SC 3HIFA 2V9VA 3EPKA 5D6EA 1QGPA 4NB5A 1XG1A 4A0XA 3F72A 3M8FA 2IP2A 4XN3A 4D7MA 2L3JA 1FOXA 3ERMA 4A2UA 2JUCA 2OC6A 2Z2SB 2LF7A 2MABA 2OD5A 1GUUA 5KHDA 3KEQA 1XNQE 5TISC 1IBME 1UFMA 1YHQI 3CCUI 4IS1C 3KP2A 2O3FA 4Q48A 4IRIA 1W5TA 5FKLA 3DQVC 1KGSA 4NC8A 2ZXJA 3TDZC 4A3KJ 2JA8J 1XD7A 4XQFA 4BAYA 2K40A 2BY0A 2E5ZA 2ENAA 1S7EA 2D1HA 2XGDA 4YY3E 2XF5A 2NVUB 4A3LJ 4UXNA 4BE1A 2UXDE 2MDRA 3KP3A 1S29A 4ESFA 2R92J 2HQAA 2YTDA 3K10A 3H9QA 2F4IA 2QVOA 3EYYA 5HS9A 1WJ5A 4DBQA 4BJ6C 2GOMA 4C3HJ 2EM6A 1TP4A 4MQVA 1A35A 4WYQB 1HBXG 2R93J 3F6VA 1DPUA 2RQQA 4KIBA 5DCMB 1TW2A 3F8BA 1ZAAC 1XPXA 2EQ0A 4OWRB 5F27A 2P4WA 4R79A 2R7WA 2XV4S 4XM3A 1K7AA 1VQ5I 2ZMEB 2RPCA 3E6BA 4MGRA 1I5ZA 1QQIA 1YI2I 1MMSA 2DK5A 1XB4A 1FJLA 3MVPA 4B8XA 5KNLA 5B3SH 4KITB 3W2WA 4IHVA 2LKPA 4X8WA 3DPTA 2JWTA 1S7AA 4X66E 3K1NA 1HCRA 2ADRA 4R2DA 3IRQA 4NXME 3FISA 2DSYA 4ZTFA 5ICEA 1QO0D 5GAGJ 1T98A 1PDNC 2HU9A 3DKXA 3T5XA 4CZCA 2XF6A 3VPRA 2H1LA 2ELYA 1WJAA 3E5XA 1G3TA 2E71A 3GXOA 3M8JA 4BJTA 2FNPA 2EM5A 2XROA 4LFBE 3THOB 3DWLE 3PFYA 5DM6F 2LG4A 1FX7A 3P9KA 1VFCA 2P0WA 2K4JA 2WV1A 1MH4A 3KZYA 4BY7J 1IMUA 1QNTA 4XSXF 2QF7A 3P9CA 4A12A 1N75A 4BHPA 4KUMA 3WU1B 2R7VA 3C4BA 2VQHA 2YX4A 4E7JA 5B1BH 4O6JA 2A05A 3ZRGA 1IXCA 3G1MA 4XSZF 2M3AA 2ISZA 2K4BA 5HLTA 2QKMB 3LSKA 3S1QJ 3JTGA 3DV8A 1T0FA 3DKWA 1YJ9I 4GGGA 3GZ6A 2KQRA 2EP3A 3ECOA 1OLTA 1IZ1A 2KISA 3H0GJ 4LG0A 2DA6A 2GIZA 1IN4A 2L2OA 1X19A 5IYCJ 4E7IA 2EPPA 5A2QC 3RMPA 5IT9C 1ZG3A 1DI2A 2E35A 2WWYA 1FLIA 3TP3A 3M9AA 2AXTC 2LMZA 2V6EA 3J80C 1X1CA 1D1CA 1XMKA 5GPCA 2LSOA 3ZOQB 4FK5C 4B47A 1T56A 2JRMA 2TDXA 1KQ9A 2VUMJ 5FKNA 1T33A 1YE9A 4V2FA 4BQNA 1AKHB 1VQNI 4JX6A 2XPWA 4EQQA 3OIQA 5J4VA 3RIRA 1A1GA 4BQOA 1T0FC 2J7JA 2CQKA 1YJNI 2EIKH 2KL4A 1U8RA 1PYVA 3IWBA 3OY9A 2H8WA 5J40A 1TT0A 3EPLA 2KONA 2CMPA 2HXOA 1NG7A 4M3GA 4D5CA 1X3ZB 2FA5A 2V86A 2JJ7A 2EMHA 2NUGA 1TWAJ 3IWFA 1MDMA 2QYOA 3HOVJ 3MN2A 3L2CA 1V5GA 2BW3A 3GCMA 4X6AJ 3G6EI 2GQQA 1MIJA 4I02A 3VYRB 3QODA 3WTWC 1YW7A 1HW2A 1B9MA 2VC0A 1KU9A 2IHR1 2ODRD 2R7XA 3R61A 5C44J 4UHTA 2H6BA 3LQRA 5AIQA 2VPRA 1F1ZA 5IWAE 2CFOA 4MEXF 5GTIC 1UG2A 2EOJA 1IBKE 2EFOA 1MJBA 2DCEA 2CH0A 2R7DA 3PSFA 3R0JA 2CV1A 5ERIA 1XSVA 2F2EA 4PK4A 4LFAE 2X51A 4XR6A 2F5FA 4LFUA 4XRFA 1S5LC 2EL5A 4RM3A 1H0MA 2K9SA 2M9HA 3G4SI 2Y0MA 3FXQA 3SYTA 4N9IA 1I50J 4LB6B 5K5QA 3LSRA 3JRHA 2FGGA 5FKKA 1S6LA 3ZN0A 4BBRJ 5D5UB 2VRDA 1BOBA 1R5ID 4FASD 2DLLA 3KETA 5BR8E 1SAUA 4A6EA 4RDUA 4BDYA 5E1ZB 3CD6I 4B3ME 4KN4X 1UJ8A 4M3FA 1H8AC 1U5TA 1SD5A 4XLCA 2JXPA 2MGQA 5ICFA 1E3OC 1IV6A 4QTRA 1UHWA 1LJ9A 3HDDA 5KL6A 1KYQA 2LMDA 5D5WB 1TNTA 4YEJA 4O5GA 1NG6A 1YZ9A 1Z3YA 1Z6RA 2OQRA 1AHDP 5F0FA 2Y9YA 2HQNA 3GO5A 4CCLA 3PL8A 4LG0B 1BR2A 3IL2A 2YZTA 2COMA 3DFGA 2Y0SN 3ZQLA 2IVMA 2M34A 4H0EA 1Z1DA 4HQEA 1HKQA 3CDLA 3V7CA 2H6CA 2DPDA 5CVVA 3TQNA 5TSEA 2UUCE 4XRMA 3OTOE 3ULQB 4XL9A 3BDDA 2Q8UA 2YR2A 1LQ1A 4P1WA 3TDUC 1LDKB 1A1FA 2X0LA 2DI3A 3BR3A 2LV2A 1RQ0A 1USTA 1YX5A 5JLWA 2V79A 1LVKA 2ADUA 2UV1A 1NHAA 2MH9A 2DA7A 2DMPA 1JUSA 2ICWG 1XDSA 3VYUB 1P9QC 2X1CA 1IN8A 4FT8A 3VYTB 1OMIA 1R5HA 3M8EA 3KZZA 2HVRA 3HG9A 3LQQA 3S93A 3B6AA 1AA7A 2EM2A 3GTLJ 3CESA 2FOWA 4A3GJ 4WK8F 2R7OA 2EA4A 3I9V2 3GX4X 4IJAA 4WSGA 5EYRA 1LNWA 1DU6A 5CVUA 3HHGA 2DMYA 3J7ZI 3FHZA 1JKRC 2H36X 4BXFA 4A3BJ 3I4PA 2JOXA 3H5NA 4OU0A 2DT7B 4XOTA 1EH7A 2ZNZA 3FKIJ 3MAJA 2L5QA 1FWZA 2LTRA 3BP8A 2F6CA 2EN7A 3Q0UA 2B3TB 3GWZA 4ASNA 3H3UA 3PIPF 1P6RA 4MLQA 3OWTA 5K7ZA 1TC3C 4OX9E 1ZU1A 3E7LA 4HLXA 2JP9A 3P9IA 5D6FA 1IV8A 1DGWY 4DR7E 2HTSA 2EOYA 4E7HA 3A0BC 1FC3A 4JI8E 4BUPA 1K4SA 1IC8A 4O24A 4NQWB 1WJDA 4I98B 2CQNA 3PJRA 2EPLX 2EPOA 2VQLA 1A1JA 3E0JB 3QQAA 2STWA 2ZB9A 2EZIA 1NEIA 1YIJI 2Q0OA 3Q5FA 3H9JA 1KU7A 4AUXA 5LLQA 4JI1E 3QP6A 1ZELA 1YUIA 3ZMTA 1RUOA 2TRTA 3BG9A 2V83A 2YU9J 2MC3A 3LLHA 5J47A 2CO5A 1FNNA 1UHSA 2YRMA 3HPSA 1R1UA 2VKDA 4CYDA 2DJIA 4ZZDA 5DUIA 5GTHC 1G2HA 2BBGA 4HW0A 2VF1A 4LFCE 5D5XB 1WRJA 1DP7P 2M0CA 1XGSA 4XLNF 5EEGA 2ACJA 5AC5A 3HC7A 1Y39A 1UB9A 2V1NA 1PJSA 1B9NA 2JSPA 4X62E 3CJQB 3DPLC 2WAQN 1YX3A 2L9NA 3QPTA 4M73A 1Y8QB 5F1JA 2L2MA 1VNDA 1ACIA 2VLAA 1ETWA 4OAYA 1TWGJ 3OV8A 5HOOA 2XB0X 3AL0C 4HZFA 4XKCA 1G3YA 2Z99A 4A69C 4HNTA 5GAEJ 4JI6E 3S15J 2XSDC 4JI2E 3GW2A 1U5TC 2DFHA 1X3CA 5LD2C 3BROA 4BH9A 1ZR9A 3OS0A 5DNYA 4DYRA 2M7QA 1GDTA 3KLOA 3X2QH 3D5RC 4FHTA 3UKGA 4D9JA 1USSA 1PUEE 3AL0B 2YTOA 1Y1VJ 5AONA 2Y75A 4HV5A 2EQ3A 3CQZJ 1V5FA 5LEKA 4A3DJ 2UUAE 1FIPA 2MC4A 2DMIA 1Z1BA 2EN2A 3PQJA 4FX0A 2VODA 2R4GA 2EM7A 4M3EA 5HODA 2GLOA 1PDAA 4CICA 1P4XA 2CWEA 4A5MA 4RLQA 1ZH5A 5L3CA 3RQIA 2DU9A 4A3CJ 3CCLI 3WHBA 1ETKA 2M4KA 2NOGA 1J59A 4BCAA 3IH2A 2F4VE 2B7TA 1Z9CA 4GRIA 4M6XA 3R4KA 2DYSH 1MBHA 1Z67A 4HDUA 5GP9A 4TV7A 4BE0A 3QYBA 2YTEA 2KRFA 1HNWE 3BZKA 1HW5A 4DV2E 2LP0A 1S7OA 2EMWA 1KJKA 1PJQA 1MH3A 3HGGA 4LD5A 5LRRA 4L9JA 4Q47A 1LFPA 4LLNA 4UV8A 1X1BA 5LHIA 4IF4A 4XLHA 4ENJA 2A69F 2DA1A 2W7NA 4AU7A 1QVTA 1R4MB 1QZYA 1LFBA 2BV6A 3Q3SA 1TZLA 1OYWA 3PIOF 1CGPA 2IPQX 2V1UA 3FIGA 3A01A 2HI3A 3OIPA 3AKZA 1YSAC 4B3AA 2WBTA 5LMNE 3PM1A 3K4LA 1XS9A 2V1XA 3FWEA 2XPVA 3BTIA 2WA0A 2PJRA 3OYHA 3CCEI 4F92B 2D1VA 1BOAA 4N4OB 5GPAA 1GT0C 1VQLI 4AYBN 3HTSB 1IGNA 2VJIA 2X6WA 1ITYA 2DQLA 3QP5A 1JT6A 3LFKA 4XNFA 1ZN2A 2YTQA 3DEWA 4HX4A 2XAUA 3HXLA 3HRTA 4BQAA 2ENHA 3SJMA 3O2PE 3TGNA 2HPMA 1R22A 3BR1A 4NC7A 2EFWA 3A02A 3OSGA 4Y17A 1ETVA 1KQ0A 2BY2A 1WH5A 4XMYA 2RSMA 2ESHA 1Y6IA 3DPUA 2DPUA 1U0JA 2W00A 4I09A 2NOJB 1X5WA 2YU3A 3KEOA 5FJ8J 3CC2I 3UNGC 5M5WJ 5DEQA 3N05A 1EKZA 5IP7J 5M3FJ 1POGA 2ECBA 1HR0E 2FXAA 2P8TA 2LO3A 3ZCOA 2RNJA 4HSRA 3G71I 1X1PA 4A5NA 1BI1A 4U88A 2JN6A 5IP6A 2N3HA 2EOSA 4CSWA 4CH7A 2YPRA 4B09A 4I7HA 4X9JA 2QQAA 5L3FA 3NARA 3QU6A 1JUPA 1EH6A 3ZPLA 2IEKA 2YT4A 2DLKA 5AC4A 1V3FA 2XAJA 1FKAE 1K6YA 4FX4A 2O03A 3H09A 1R36A 4LK1F 1HNZE 2EMBA 1IO2A 1SEUA 3PNYA 4FE7A 1OYYA 4RGXA 2MW8A 1DUXC 1JGGA 3HSEA 3ECRA 4GZNC 4J8ZA 4E6KG 1Y0NA 5CFFE 3HYIA 1DDNA 2YSPA 2R3SA 4E70A 1JKOC 2GHFA 1IBLE 2RVCA 1WHUA 1H89C 5IXMB 1GXPA 4CCOA 4DJAA 1HOMA 3SDGA 4CCNA 2DFEA 4NXNE 1UAAA 2ZSIB 2EILH 5J1UA 4KYWA 2AQEA 4HV6A 4MEYF 4PCQA 3CDIA 3MZYA 3SHFA 4XK4A 3OYLA 4LTYA 1G2DC 3I64A 3OYIA 4RGUA 3OYNA 2ENCA 4BU2A 4G6QA 3I59A 4W1UA 5FLXZ 1LEBA 1O3RA 1BB8A 1ETQA 3H36A 3IAM2 5C3EJ 3MKZA 1WPKA 3OSFA 1WHNA 3M99B 3TO9A 2HVQA 2WZOA 3WG7H 5F6FA 3IWCA 5J6XA 4AIHA 2EOXA 3BR6A 3H9GA 3W6KB 1MW7A 3C3WA 3BR5A 2QWWA 2YPNA 1EKEA 1FIAA 4II3A 2YTIA 2LCEA 1ZR4A 3WTXC 1R6RA 2F5CA 4N0BA 3BR2A 3HOTA 2CG4A 2PFBA 4DV0E 3ELKA 4IQ4A 3C2HA 1ONVA 1BI2A 1FP1D 2FE3A 1WJCA 2M7AA 3VHTB 5FO5A 1UCRA 4Z6YA 2LF8A 2LY2A 1F4KA 2BHZA 1AH5A 3FXJA 1XN7A 1WCMJ 4LJZF 1TNSA 2DOFA 3T1BA 1MKMA 5LBQA 2R7ZJ 1I6XA 2DBBA 2LY9A 2VQEE 5B5EC 2JA6J 2NXNB 2HJJA 2DK8A 3WHCA 3JRDA 5E17F 4P9UA 3J81K 3R6SA 2C6YA 3S14J 2DGCA 2DFIA 3ADIA 3AG3H 1O7FA 3VSKA 4KDPA 1DGRM 3FKJA 2BGCA 1G6NA 2J5PA 3ADJA 4MNUA 4D7NA 2I13A 3EUHA 3O8GA 1XGNA 2XPUA 4WXDA 2BVMA 2RS6A 3MQ0A 1RMDA 5LGTA 2KHXA 1D0XA 1XDUA 2OJED 2HWVA 3DBHB 4JX4A 3EPZA 4OINF 3KP4A 3GTJJ 5LRSA 1VTNC 3BQZA 5EEAA 2HOTA 2VL8A 2OZ6A 3JSPA 4X1EA 5ED4A 1OCTC 2HKXA 3ZOBA 1IRZA 3RPUD 4M9ZA 1Z7UA 4WFTA 2XF7A 4ZYDA 1S3JA 1K61A 4N4NB 4U7DA 3GTKJ 3ASOH 1HA8A 4YHHE 1G3WA 4ZZLA 2EV5A 1X3WB 2ELJA 1HC8A 3F8FA 2EPCA 3CC7I 3BTCA 4HBLA 5ILVA 2WY7Q 2LRDA 2EN6A 1I27A 3H0DA 1KQ8A 3LSTA 2QSFX 4C2MJ 2LBSB 1MZBA 1TTYA 2LC2A 4HOBA 2V7FA 3KZIC 4IVNA 2R5YB 1W0TA 3K4MA 1BBOA 4JI7E 1FMWA 5IYBJ 3V8JA 2E7WA 4CA0A 1XC5A 2E5NA 5IV8B 1TBXA 2CJJA 1X2NA 2CSOA 5E3LA 3WGHA 3K70C 1MSFC 2H09A 3CZ6A 3OYFA 2VONA 3JCUC 3ASNH 1LLMC 2UWMA 1WHQA 1IG7A 2ZXWH 3HPHA 5KAIC 1PJTA 4WF2A 4NDLA 2LFBA 1LUJB 2W82A 4DZJA 2A07F 2DXIA 4M71A 5HDKA 2X9DA 2IAIA 3C1DA 4LG3A 2NVQJ 4R2EA 5ILUA 2WAQA 2DAOA 3AFHA 4EJTA 4CYCB 2EOIA 5A2QK 4F55A 4GO1A 1GV2A 4G6TB 4RMNA 2YUSA 4FE4A 3ZR8X 2XKPA 4DR2E 1T6SA 4OOIA 1ZK8A 1G3SA 4A0ZA 1NCSA 2VASA 2X6YA 2HXIA 1JGSA 4EEFG 1B69A 2IGKA 4CUGA 3KE2A 2JPAA 4IX7A 1R9TJ 2BZTA 5CJ9A 1J9IA 3JRAA 5A6BD 1I94E 2DTRA 2KDZA 2EJRA 4PGGA 2M8GX 1ZGAA 4R1HA 3ERED 1FJGE 2H27A 5FGMA 2Y9ZA 4AC0A 1NK2P 5DD8A 3ZQCA 3VOEA 3EPHA 1HXDA 1QPIA 4HPQA 2EOMA 2DA5A 5DCFA 3J81C 1SVOA 4AWXB 1IW7F 2MD0A 3CUOA 4B44A 3F22A 2LUPB 5EDNA 3CJTB 3KP7A 4HNUA 2MC5A 1UN6B 3W2AA 2NVYJ 4M9SA 1Z6TA 3MZ8A 2EE8A 4Y52J 2E1MA 4F9CB 2UXBE 3ONQA 2L9RA 3GFIA 2EZ6A 5HLHA 4NUBA 4I2OA 2EWLA 1HDPA 2EZLA 3PSIA 1TN9A 1KA8A 2EOZA 1IQSA 2EIMH 5LHGA 3OYBA 3VEPA 5E8IA 2O61A 2O8XA 3KYLA 2D45A 1X4PA 3CP8A 3T8RA 2IS4A 3KIOA 4PJMA 3NWSA 3DP7A 5DDGA 1GVJA 3BIDA 3I4MJ 1BBYA 2MLGA 3BQYA 2HOSA 2N3GA 3BTLA 2R7RA 2MH2A 1O7LA 1W36D 2YTGA 2DT6A 4DBRA 4ZDOA 2FNAA 3JREA 3SEQA 4D0PA 4F2JC 3H92A 3JRIA 4C2UA 1P4AA 3Q9SA 1VQ4I 2DMNA 1FTTA 2HFHA 3EQ1A 2B9SA 2VB6A 4E7KA 1ETOA 3CCMI 1VQ7I 2MA3A 3F8NA 3GZ5A 2LBFB 5J1RA 1RC7A 4M6VA 4LF4E 2YX7A 4WX9A 5F0CA 3WTUC 1AKHA 2K02A 2E7XA 4LOCA 3RZDJ 5M5YJ 3FF5A 1X47A 5H20A 3LSMA 3E6CC 5AIPA 4JK1X 2M2EA 4UVBA 1B8IB 1J5YA 2ZXIA 5A69A 2JVAA 3RCOA 2B7EA 5GAHJ 5FRNA 3L00A 1A6IA 3G3ZA 2M9AA 3BTJA 2P6SA 1JTXA 1D5YA 4IKFA 1YS6A 3K2AA 4RM2A 1WJBA 3NEUA 1PP8F 2LKSA 3U9GA 1U6GA 2OU2A 4HSTA 4ABZA 2JR1A 2IGNA 2KP6A 1CQTA 2E2IJ 5E3OA 1ZLJA 4HLYA 4DZPA 4LF5E 3BG7A 1P7JA 1T4NA 3ADLA 1APLC 2X85A 2UUZA 4DV7E 3HUGB 2I9IA 4ZYHA 2LVHA 2IT0A 3ZN1A 3P7NA 2DIXA 1FOYA 5AE2A 4G6DA 1KU2A 3K4BA 3F0CA 5E18F 1F36A 4II2A 4A0YA 2GXGA 2R76A 4A93J 3LAJA 2OAZA 3NAUA 3KP5A 2NNYA 3OOUA 3OOPA 5DYMA 2EMCA 1ZBQA 4F54A 4JI4E 2M5WA 4GYIA 3O6BB 5HLIA 4LGWA 3GLLA 3CTAA 1PUFB 4P7DA 4U7BA 4J00A 9ANTA 3M3YJ 3JAMK 4PGHA 2RV8A 2X4HA 4UB8C 4KISA 1X6FA 1GVDA 3LOCA 1LE8B 2ZCWA 2CV2A 5C4XJ 3MHHC 2HKOA 5K5RA 2EN3A 2LK2A 3BLYA 4IQJA 1B72B 1YYWA 2W4SA 3ZQGA 4OAZA 3ABLH 2LH9A 4KFCA 4PDKA 4AIDA 4LIVA 3HRMA 3MKLA 2NUEA 4HG2A 2CQQA 4MFDA 4KHPE 3PFIA 2P5KA 1UHZA 4E7SA 1HLVA 1VZ0A 1FPQA 4DYCA 2EK5A 2FU4A 1QVUA 4XOPA 2RDPA 2EINH 5K5OA 3FMSA 2KIUA 3HB9A 1W7PB 4MQ9F 2R7UA 1PUFA 2L9VA 4UVCA 5EZHA 5HDGA 3QG5C 3V7SA 4R03A 2CS3A 1IDZA 4I01A 2EMZA 3HJEA 3K69A 5F04A 2QENA 5FD5A 4YFKF 1J7KA 1HSTA 5BOXA 1YJWI 1A36A 1N25A 2HDCA 2R7FA 4FTHA 3IC7A 3OS1A 4TUIA 4BL0B 2EPUA 1NTCA 3D0SA 4RB2C 3A0HC 1R4NB 5IT3A 3RDIA 1J26A 4IJDA 2CQ7A 4L8NA 3QRFF 2BBYA 1JTYA 2XB5A 1W0UA 1DP3A 1OCCH 3FM3A 2OTLI 2WCC3 2ZKZA 2IS6A 4LIUA 1ULYA 3LMLA 2KIFA 3HSRA 2JVGA 1QHGA 2EL4A 1K4TA 1HF0A 4V2GA 3R0AA 5TGTA 5D4RA 1Y0UA 2VJ5A 3LL7A 2M30A 1P92A 3EUAA 4MFEA 3SDBA 2VQFE 4JI0E 4BHCA 3ISPA 1VQ9I 1MJAA 1N32E 2VC1A 1D0YA 4RA2A 5E3NA 5JVGF 2HZDA 2VKVA 1TQPA 5FB2A 5H2FC 2M7BA 2QA4I 4BY1J 4R2RA 2I5UA 2EM8A 1RR8C 4QPQA 3W6JB 4RB1A 5FFZA 4R8HA 2WY8Q 2HS5A 2MC6A 1B1BA 1BI3A 5IY5H 3RI4A 3HM5A 2V8QB 3MSWA 2B0LA 2MYSA 2K3FA 5IT9K 1SANA 2VI6A 2VN2A 3LMMA 4XLFA 2A6TA 3RQ4A 2KJBA 2PI0A 3CMYA 1B4AA 1NH3A 2HNHA 3F6OA 3H35A 4WSPA 4L9TA 4IRGA 3RYRA 4I8OA 4LF7E 1W7PD 2HGCA 5IOYA 3S32A 3VYSB 3A2KA 1D1BA 5GADJ 2GXBA 5JHFA 3OYCA 1WZ2A 3OYEA 1GZ6A 3TKYA 1JJ8C 3CO7C 2HQRA 4NQWA 3ZQQA 3NQOA 2RC4A 4QLCU 5L3GA 2EZKA 3VYYA 4A6DA 1F9NA 1YYVA 1BJZA 4X0GA 2LJHA 5KL3A 2FJ1A 3S2WA 2E1MB 1MBKA 2VJJA 5A2QZ 4IOAF 4GYGA 3GVAA 4LLGF 4F3QA 1F5TA 3HEFA 3ZP5A 2XAHA 4PZJA 3HRUA 2FV4B 1O57A 1OR7C 1YYKA 3FMRA 2FF4A 3DLAA 4LF8E 4GKJE 2QSGX 1FSEA 2NVXJ 2FQ3A 3QOPA 1MBFA 3QPSA 2X6OA 2YU5A 3TW7A 2LY1A 1O3SA 2B9DA 2EZHA 4M3BA 1KONA 2PX9A 2YSOA 4A3EJ 5HVQC 1HQCA 3DKYA 3WGGA 1ZGJA 3S2HJ 3HOWJ 3LWFA 4D1QA 3S3NA 2W25A 2XGEA 2PJPA 3TBIA 3ABKH 4F91B 5DTDA 2EN1A 3V8LA 3KCCA 2ZFWA 4KNYA 1HSJA 3K7AJ 4EJOA 2FBHA 1ENHA 3AG2H 1ZR2A 3T1YE 1UBDC 1IXRC 4WPYA 1RR7A 2EOHA 3JAMC 3BC8A 3KYCB 2E72A 1B59A 1OCOH 2HYGD 3FHNA 4XKVA 3E3VA 2Q2EB 4JYAE 2V9KA 3U2RA 4I0BA 5IYDJ 2YTJA 1WJPA 1A04A 5DV5A 2RTXA 2VBZA 4Y3OA 3CP2A 2HHHE 1LDDA 3ROUA 1UMQA 5E3MA 2IJLA 3S1NJ 1EH8A 2VQGA 3CCVI 1T4OA 2F4MB 4JBAA 2E2HJ 4P78A 4AIJA 1XGOA 2IA1A 2BW3B 3BZ6A 2CW7A 2Y2ZA 2RS7A 3L7WA 4R2SA 5T6JA 2M8EA 3HUGA 3LA7A 2K9NA 4XORA 2GA2A 3JRFA 4C3JJ 1AAYA 1I1GA 2IA0A 3DBRB 3UR3C 2EPXA 2QM3A 4B3SE 1J0RA 4PJLA 4EATA 4X64E 2M4GA 4ZYGA 2P7CB 4IHYA 2L7MP 2Z1DA 1D8KA 4EM1A 3S3MA 1IN7A 1IJWC 4X65E 3COAC 3BJ6A 4OIPF 3IH3A 3DEEA 4BDZA 2A68F 2OPTA 2LOOA 2BE5F 5D8LB 5M5XJ 5EGOB 4A3IJ 4M2ZA 3FK7A 1YW8A 2G9WA 3KX2A 3S2DJ 4IHTA 2ETHA 2ZSHB 4LF9E 4B3RE 2KMUA 2LYCA 3PO3J 3C2GA 4OIQF 2GAUA 1WJFA 2YRHA 4B1RA 4XLPF 1BIBA 3W2VA 4DNCA 3PO2J 2FD5A 2PRTA 2EM0A 4L5NC 3CF2A 3A03A 4PSXA 2OQGA 3L09A 3QYFA 1BN5A 1UHMA 3S1RJ 2RN7A 4AVZA 2ZFUA 5B1AH 2JPBA 1FYKA 3FK6A 2G0EA 4FETA 3LSIA 2EMFA 2AXLA 3J80Z 1ZRDA 4BEHB 1TW3A 2IA2A 2O5RA 5F64A 2VT2A 4PUSA 4ENNA 3GTOJ 1U5TB 4KN7X 4IEJA 5DD4A 4BS9A 4RGSA 4G7ZF 3FXKA 3S16J 4PJNA 3V42A 2VOPA 3VYXA 2XGXA 4IZZA 1EA3A 4KICA 4AIKA 1OCPA 1X49A 3DF8A 4RAFA 1J75A 2HDDA 2FEZA 3I3LA 4ANJA 4C9YA 3HTXA 2LTSA 3REOA 3TO6A 2B7VA 3I55I 3A4CA 3CCRI 2P5LC 5E8GA 4BKXA 2VIXA 2GWRA 3HSFA 1U2WA 4HRIA 4BNCA 1X6HA 3WTVC 1WKMA 1JXSA 1RETA 4R2QA 2ZNYA 3B02A 4ESBA 2L2NA 3AG1H 1LVAA 4ZYAA 3JW4A 2D5VA 1YO5C 3HQ1A 2EIJH 3TMOA 2V88A 3CO6C 4BHBA 2AS5F 3M1EA 5JFRA 1RKWA 3H5RA 3QU3A 2PMZA 2DQRA 5BS6A 3F9KA 1PVEA 1FOKA 1XSXA 4UY8I 3ECHA 1W5CC 1EF4A 2CPNA 1VQ8I 2FBIA 3V4GA 4KZSA 1XX5A 2R5ZA 3GBGA 2DOAA 4UVAA 3K6QA 1YW9A 1VQMI 1MBEA 2YTNA 1G4DA 2RQPA 3F21A 3MHSC 5EG0A 1SR9A 4RAGA 3GFLA 5L3BA 3T8TA 2JA2A 5TJJA 1IXSB 5CPRB 2AO9A 4PJJA 2OUMA 4JYKA 4UNOA 3SZTA 4U0WA 4OMYA 2KZVA 1OCZH 1OISA 1TWCJ 4DGWB 4DR5E 1LPQA 4S04A 1YPNA 2D2WA 2IRFG 2UXCE 4RAZA 2RGVA 2CSHA 3Q0VA 5HS8A 1GQEA 3HKZA 2NS8A 1I39A 3SQNA 3OR2C 3EPJA 4I0AA 2DODA 4B3XA 2DMTA 4YFNF 2PEXA 3BJOA 1HW1A 3KYDB 1T08B 2V6CA 2XSJC 2V89A 1RESA 1X2MA 2VT3A 1GXQA 2R5ZB 4HAMA 2JTVA 1DU0A 2K5CA 3TEDA 1WSUA 2IBDA 1AOYA 4NBQA 2CW0F 2DMQA 2FRHA 2X48A 3QAHA 3J7Yp 1UILA 1T39A 2E1NA 1F43A 3LA2A 1JE8A 5LEJA 1SAXA 1FEXA 3K4KA 3F23A 2RNGA 3VDXA 2LREA 4DW6A 1FYMA 1N33E 4HYEA 2DN0A 4RGRA 1PJRA 2E5LE 2LE2A 2ZJ2A 3ZGKA 5HDNA 2CUEA 1XMAA 1BR1A 2EMXA 4C3IJ 4AQYE 1Q1VA 4EV0A 5TRDA 4MTEA 2EFNA 4P5OA 5J8CA 4CO8A 4ITVA 4R2PA 3CCQI 3VODA 3AUZA 3CMAI 2ME6A 4DV6E 1BBGA 1VQOI 3HTUA 4F6MA 2PQ8A 4DR6E 2YS9A 1YS7A 2I10A 2KFDA 5CVIA 3TL4X 1GLNA 2TCTA 3C4TA 2DO7A 1R23A 2NS0A 2V1DA 3KPHA 1DPRA 4F9AB 5HNFA 2JZYA 1FOWA 2LNBA 3MFKA 1NK3P 1Z05A 2KHMA 4XKWA 3EDPA 1SMTA 1K79A 3SXYA 4AYBA 1VQKI 2JVHA 2EN8A 2ZXHA 3BBGA 3LSJA 1N36E 3FBNB 2DTZA 1MJ9A 1KZHA 3DTIA 1X48A 3GFMA 2EPFA 5BNGA 5LGNA 1XTAA 4C2TA 5LL6R 1SFXA 4L5IA 4HEIA 1ORKA 1K78B 4RB0A 1R1VA 3KFWX 3CJNA 1U3EM 1I3AA 4XN0A 1DGCA 2EMYA 1H88C 2NA2A 3RPUA 4BC9A 1IN5A 2FX0A 3E1SA 3CF5F 4F52A 4DMIA 1FT9A 4ZJZA 3OYDA 1RRJA 3U1DA 3C2BA 1YITI 4EM0B 5LHHA 1A1HA 1BIAA 4HNVA 5AE3A 5CLSA 3RPQA 3RJPA 2MKNA 2STTA 3G1LA 3HGYA 3ZQFA 2R0QC 1T38A 1N77A 1EV7A 2PLYA 5J1YA 4RS8A 4YRVA 2WBSA 3WTZA 2A6HF 4HX8A 4EMSA 2H8RA 4W97A 1BJAA 4L9NA 4G7HF 1MDMB 4YIRX 1K6OA 2EQ1A 3GUDA 4XKBA 3U1KA 2YTPA 1FP2A 2L02A 3OR1C 1MNDA 1ZREA 2LBFA 3HZJA 1YFHA 3EYIA 2IS1A 4D5FA 4ZC3A 2MLKA 4K2EA 4BACA 3CC4I 4LB5A 4BC7A 1LE8A 2RKHA 2UUBE 1AU7A 5FFXA 3G1OA 2LKXA 5FROA 2OTJI 3ML6A 1XCVA 2ECCA 4PFPA 3WTTC 2EPMX 3BF2A 3F3XA 1O0WA 2PJRB 4JOMA 1XNRE 3IHUA 1RIOH 3FXUA 1S8NA 3KLNA 4BBSJ 1TWFJ 4BQQA 2AQFA 3IP4B 1OPCA 1Q1HA 2BVLA 4DR3E 3K9TA 2HC5A 2JT1A 3OYJA 1YLFA 4IL6C 2EN4A 2OF7A 1W36C 1RKTA 2L33A 2CU7A 5E1XA 3ZMVA 3RYPA 3L2VA 1QA6A 1MD0A 4IXAA 4HTGA 4UB6C 4KA4A 2QBYA 2EOOA 2H94A 3T0YA 2CYYA 4BJ5C 1IRGA 1RZ4A 4M72A 2FMYA 5AASA 2OBPA 4L9VA 1OJLA 2KZGA 3SFIA 2DDAA 2EB7A 1SFOJ 1B72A 2LRSA 2CRGA 3DJWA 3P5JA 2K86A 3HHHA 3I4NJ 2R7TA 4WCGA 3CLQA 3GTQJ 4XBFA 2QQ9A 3L2UA 3NRVA 4BXXJ 3LAPA 1OFCX 3OIOA 5EG0B 2L8TA 4BYYA 2WB1A 4ZDPA 2L7ZA 2M0MA 3GLXA 3M07A 3HPGA 1ZAOA 3DEUA 2JRTA 4O4KA 3FMQA 2K3PA 1YQAA 3WODF 5DS9A 1BA5A 2Z3YA 3THNA 1UZCA 3F6GA 5D5VB 4EJVA 1A6QA 3PUFA 3QYEA 1LB2A 1RUNA 2KLOA 2YSRA 2DB2A 2R5YA 2EPRA 4XICA 3CUQB 2DW4A 5F08A 2R7QA 5H6QA 3K4CA 4L5EA 2EFQA 3ZMDA 2NVTJ 4JP0A 3GTMJ 1TF6A 3O8HA 2Q8KA 4RBOA 3SEZA 4XLAA 1T8IA 4L0YB 1QZZA 4IRHA 3MKWB 1J5EE 1QZEA 3ZQHA 4ZDLA 2FOKA 2JOBA 2V4JC 1L0OC 2QUFA 1SVMA 1ODDA 2BOLA 3C6MA 2ZBKA 2YU8A 2RSIA 2NAZA 1W7PA 3WU0A 2QQ8A 4LK0F 1U9NA 3CMEI 3OYGA 1BW6A 3I59B 3HOZJ 3BY6A 5CKTA 1ZTRA 2LT7A 4Y15A 3CDHA 2W1OA 4PJ0C 4U0YA 1SMYF 2ISYA 3DLLF 1AWCA 2L54A 1B8IA 2GOXB 1WI9A 1H9TA 4CHUA 2XIGA 4R2AA 5ICGA 4E7ZA 2XHKA 3FDYA 3CCYA 1JI8A 5EZGA 1JK1A 1LFUP 3TOBA 2KRCA 1YYOA 3ABUA 2GIVA 2HGHA 4A3FJ 3I58A 3M7GA 1MNMC 3BG3A 4JQFA 2YTFA 4NHJA 1L3LA 3TP0A 4NC6A 1XSDA 2MDGA 1YIOA 4HDVA 2WBUA 4M9VC 4G9YA 3DCFA 2DOEA 4LITA 3J7AO 4U0VA 4L0ZB 3J7AY 1J09A 1W1WE 3DTKA 5LFAA 4K0KE 4IHSA 3V7RA 2X6XA 3IUOA 4P9FA 3OYMA 3FX3A 3N4MA 1R00A 2EWNA 3JSOA 3CMMA 1X1AA 5BPDA 3HBLA 2LD5A 1ON2A 5E20A 4JI5E 1QU3A 3GEZA 5KCMA 3CCJI 1WJEA 4B3TE 3ABMH 2CT1A 3M4OJ 2F8BA 2HYJA 1W5SA 4GDFA 2UXNA 1T4LB 3OYAA 4BMJA 2WB1N 1OKRA 2A5YB 2W84A 5JR3A 3LSPA 2K9QA 2K27A 3WG9A 5IT9Z 2XASA 3LA3A 4G94A 4YG2F 1N78A 2JK3A 1YRNA 1I3QJ 2Z5UA 1A1IA 4ZTJA 2PMZN 1X1DA 3I0TA 3D5LA 4CXFA 4RB3C 2EMIA 2WBMA 3WTYC 3HOYJ 2DT5A 4PFOA 2GBYA 4HX7A 2DJNA 2XUBA 4MIMA 4F7ZA 2DA4A 4OIRF 3GYHX 1E17A 4I99C 2MG4A 1I1SA 3MKYB 1A1LA 4U87A 4TUGA 4IPAA 4BEHA 1ETXA 3EUHC 4B43A 2VXZA 5JVTA 2L3CA 2X1DA 3DF6A 2VBWA 1IUFA 4G7OF 5KL4A 2EBIA 2QBYB 2M45A 5HS7A 3I56I 1BM9A 4EJWA 2D9HA 3QWLA 4GXOA 5DUKA 4Y33A 2KT0A 5JI6A 4CCMA 1HKTA 3IRRA 1SVLA 3S8PA 1SFKA 1JHHA 3UK3C 4A3JJ 5FKMA 2F4OB 3VWBA 2EV6A 3CUQA 1TT5B 1S72I 2O6GE 4F9BB 5J3LA 3BZCA 1IN6A 2ME0A 2V26A 3LSGA 4MO7A 5LGUA 1C0WA 2UXXA 4QSHA 1IRXA 3ADGA 1R5GA 3IV5A 3IH4A 1A1KA 2DA3A 2VJ4A 2K9LA 2VOOA 2KIQA 1IRFA 3BCAA 3L1PA 4XRSA 2E36A 4JX5A 1TQIA 4LU9A 2LR8A 2OA4A 1D8JA 2ZJQF 2V87A 2VE7C 1ZHFA 2F5VA 2JYAA 2CUZA 2WAEA 2EMGA 3JRBA 2M4IA 1D5VA 2HVSA 2DRPA 3BG6A 2I8DA 1O4XA 3LNQA 5K1YA 3S3OA 3MWMA 3ZMZA 1YTYA 1E3HA 1JKQC 2LUQA 4HA8A 2ID6A 1G2FC 1FBUA 5DM7F 1OCRH 4H4KC 2VPLA 2LJUA 1ZG5A 4EGYA 2L2KB 3IAS2 5CVRA 4CYCA 2H1KA 5ADZA 2OV7A 1WFXA 3OMYA 2QKLB 3GF2A 5D4SA 1T2KA 1TL8A 3W6VA 2V85A 2P5VA 1VI0A 4YIFA 1XMOE 3L2QA 4L18B 4EJUA 5KK1A 3VK6A 3HL2A 3OS2A 4DKKA 1OQYA 3RTRA 3K70D 1BL0A 2W24A 4LMYA 1TLHB 1V55H 4DYQA 3B73A 1G8XA 4MTDA 3W3CA 5HLGA 3J7YJ 3L9FA 3BOQA 2Z9OA 1F2IG 2EPNA 3ZQ7A 2OCCH 4AVPA 1KYWA 5L3EA 3E6DA 5FRMA 2EORA 2O9LA 2W85A 1E3PA 1WH7A 3DXJF 3FM5A 2ODRC 2ZJPF 1LEAA 1JT0A 4IO9F 3L2WA 3I54A 5KVRA 4OIOF 1N3GA 4M0VA 2LLKA 2BHYA 4ETSA 2XC7A 4LF6E 3JRCA 3K6GA 4UUTA 5FKOA 1V4RA 2KPMA 3EETA 5K7FA 4GKKE 2VBYA 2EPZA 3G2BA 1XMQE 1LKXA 1DQUA 2YRKA 1RI7A 3FXMA 3BT9A 3TO7A 3BCBA 4YFXF 4YIIA 1D1AA 1MNEA 2CQXA 4WWCA 4OMZA 3ZMSA 2WTEA 1GHCA 1YG2A 4KJZA 1T95A 2E1MC 1R71A 4ENMA 2EOQA 2F48A 4DR1E 4IHWA 1IDYA 2A5WA 1BI0A 1TQMA 5H6RA 1SFUA 2HTJA 5BQTA 2EQRA 5J8FA 3DU5A 5HNHA 4BBYA 5AE1A 1ZYRF 2EOFA 2IGOA 1GV5A 1QBJA 4IOCF 1ZARA 4QIWN 1MGTA 4P96A 2BEOA 1O3TA 3IKTA 1BC8C 4GFBA 1YUJA 1I6HJ 2ESNA 3BPXA 1K78A 1HDDC 2P7VB 4WXHA 2W48A 1JUMA 1QU6A 4I6ZA 1B6AA 4RH8A 2JSCA 3OYKA 5K7HA 3G73A 4YELA 2EMAA 2E2JJ 2EA2A 1ZQ3P 2KDOA 2IGMA 1FMVA 3A01B 1PKPA 5A6BA 4KIGA 4EVIA 3RZOJ 5KL2A 1Z91A 5F3WA 2Y30A 3MEXA 4DUZE 2Y0SA 2P6TA 5FLVA 3K1MA 5E1WA 2HOEA 1UG0A 4Z2YA 4UV9A 3FXRA 3LFUA 1ZG1A 2XAFA 5IOZA 2JQ7A 1OR7A 3M1CA 4O5VA 1QHHD 3R60A 4JI3E 1WVRA 3JAMZ 2QQBA 1CF7B 3A1YA 3WE3A 2B63J 5IP9J 2MFZA 3BJAA 4DIQA 5JHUA 2XDVA 3E97A 2ZC2A 1D0ZA 4M6YA 2Z33A 4F93B 1Z3XA 4CCJA 3GFJA 1FBSA 2A6EF 1JHFA 3JTZA 3J81Z 2O8KA 3PNVA 4CDGA 1TWHJ 3KEYA 5DCMA 3QOEA 5ICCA 1VF9A 3C7JA 4M9XA 2K7IA 4HF2A 2L6MA 3FXOA 1M1EB 1ZRFA 3HRSA 3S17J 2A61A 3GTPJ 2VKEA 5KL7A 1KYZA 5B66C 1DQ3A 3OL4A 4M3DA 3C18A 2L0KA 4DOZA 5KAFC 3JRGA 5IPAA 4KWYA 4RHBB 4B48A 4HEA2 4I76A 1Y8RB 1BW5A 2EL6A 4BGDA 3E5QA 3QPLA 3RKWA 1U78A 1RPWA 2ID3A 2W57A 3HPZA 1MMAA 2GXAA 2CFXA 3RSNA 4QWQA 2PMUA 2P81A 2QZ8A 4N9HA 2RAEA 2E19A 5CVJA 2YWQA 4R8OA 3P1XA 3CUQC 1HKSA 4P55A 4WXCA 2Y48A 4RAYA 1E2XA 2BB8A 1REPC 2GM4A 1R58A 2EV0A 2QSHX 3PNTA 1FTZA 3GMEA 1IQOA 2NNNA 4E7LA 2R7SA 1X58A 5FLMJ 3CCSI 2G7HA 2NABA 1JK2A 4DV4E 2KRHA 3PUBA 2MD5A 2PBIA 3DU6A 3E6MA 5D8KB 4J01A 2EM9A 4HF1A 3I5UA 4ZH4F 2VE9A 4KT5C 2O7OA 3F8MA 1S9HA 1EJ9A 2CW8A 2KKOA 4ZYEA 2KIMA 5CQGA 2GA1A 1J2XA 4F6NA 4DUYE 5FD6A 4LLLA 3PQKA 4S05A 1QRYA 2FBKA 4Y7NJ 3SFZA 3JU0A 3WTSC 2JY9A 2WAFA 2PMHA 3BG5A 2COBA 2JUGA 3K0LA 1WXRA 3FIWA 2K7LA 2MBFA 2M1SA 2F5DA 1KU3A 2BYVE 4C30A 4NZVA 2BXZA 2DDBA 4DR4E 3HOUJ 2DFFA 2EFPA 2BXYA 2PG4A 2O0YA 3TQMA 2L01A 2JA7J 2ELZA 4Q28A 1SD7A 1ZKGA 1MMDA 3K1PA 3HKZN 2HYFA 1MBJA 2JA5J 3GZNB 2L92A 2VQCA 2OZUA 4UUVA 1ZGWA 1IAWA 4Y13A 1R7JA 1JJ6C 1IF1A 2XRLA 4BE2A 1FSHA 3U21A 2CV0A 2EH3A 4Q35B 3BWGA 1U9OA 2K85A 2DLQA 2Q1ZB 2GPIA 1RC9A 2EJ4A 3VSLA 3MZHA 3VFZA 1STUA 3D1NI 3E5UA 2UZKA 3SZPA 3O3KA 1MMGA 2XGCA 1O3QA 3TOAA 1MSEC 4BXUA 1FBQA 3B6CA 4O3MA 2G7UA 1SC7A 4ON0A 3HOSA 2CGPA 4M30A 4O43A 3V8KA 1PP7U 1P7IA 3I71A 3K2ZA 2NUFA
chains in the Genus database with same CATH topology
1XCBA 2HR3A 3RKXA 1SFEA 2VE8A 3I53A 3Q9VA 1FZPB 2J5OA 2L3DA 3QPHA 4CZZA 3F8CA 2FSWA 2E1CA 4DQ2A 4G8XA 2XKOA 2L4MA 1QPMA 4HF0A 4KIFA 3BPVA 1R1TA 1ON1A 1FY7A 3N97A 4M74A 1BC7C 1P2FA 2XVCA 5BPIA 3J80K 3WGIA 1ZLKA 2VBXA 5ILSA 2HEOA 5CYVA 1RNLA 1WQ2A 2LDUA 4KMUX 1P4WA 2Q2EA 1SD4A 2IW5A 1LDJA 2A3SA 4Q5SF 4ENKA 2ZO4A 2ELHA 4EGZA 3ZMUA 1ZRCA 2HZTA 1D3YA 2F5EA 2KJCA 3H3ZA 3ABTA 5EEHA 5L3DA 3WE2A 1FYLA 3CLOA 2FMLA 3EQLF 4AD9A 4KMFA 2M1BA 4L5JA 2WV0A 2WC2A 4ESJA 5FLXK 2GZWA 3IKVA 2NYXA 1WWXA 1STZA 3MCZA 4HQMA 1SD6A 6PAXA 2XAGA 2QLZA 3RKYA 2ZMEA 3AAFA 2XRNA 3FZVA 5BMZA 2XAQA 1CF7A 1X3UA 1W4MA 3KP6A 4MHGA 3JTHA 3VB2A 1OYIA 4Q4ZF 2JPCA 5F1RA 1IUYA 4GCVA 3IWZA 2NRAC 4CGZA 2PN6A 4EM2A 2M87A 1H9GA 2L4AA 1XGMA 3HIFA 2V9VA 5D6EA 1QGPA 4NB5A 4A0XA 3F72A 3M8FA 2IP2A 4A2UA 2LF7A 2OD5A 3KEQA 1UFMA 3KP2A 2O3FA 4Q48A 4IRIA 1W5TA 3DQVC 1KGSA 2ZXJA 3TDZC 1XD7A 4BAYA 2D1HA 4UXNA 3KP3A 1S29A 4ESFA 2QVOA 3EYYA 5HS9A 4MQVA 1HBXG 1DPUA 3F6VA 4KIBA 5DCMB 1TW2A 3F8BA 2P4WA 4R79A 2XV4S 1K7AA 2ZMEB 3E6BA 4MGRA 1I5ZA 1QQIA 2DK5A 1XB4A 4B8XA 2LKPA 3DPTA 1S7AA 3K1NA 3IRQA 5ICEA 1QO0D 1T98A 1PDNC 3T5XA 3E5XA 1G3TA 3GXOA 2FNPA 2XROA 1FX7A 3P9KA 2K4JA 3KZYA 1QNTA 4XSXF 3P9CA 4A12A 4BHPA 4KUMA 3WU1B 2YX4A 4O6JA 1IXCA 4XSZF 2ISZA 2K4BA 3JTGA 3DV8A 1T0FA 3DKWA 4GGGA 3GZ6A 3ECOA 1IZ1A 4LG0A 1IN4A 1ZG3A 2WWYA 1FLIA 3M9AA 1XMKA 2LSOA 2TDXA 1KQ9A 4EQQA 3RIRA 2CQKA 1U8RA 2FA5A 3IWFA 1MDMA 2QYOA 3L2CA 2GQQA 4I02A 1HW2A 3WTWC 1YW7A 1B9MA 2VC0A 1KU9A 3R61A 4UHTA 2H6BA 3LQRA 5AIQA 1F1ZA 4MEXF 2EFOA 1MJBA 2R7DA 3R0JA 5ERIA 1XSVA 2F2EA 2F5FA 4LFUA 4XRFA 1H0MA 2Y0MA 3FXQA 4N9IA 4LB6B 5K5QA 1S6LA 3ZN0A 5D5UB 2DLLA 3KETA 4A6EA 5E1ZB 4KN4X 1U5TA 1SD5A 5ICFA 1UHWA 1LJ9A 5D5WB 1TNTA 1Z6RA 2OQRA 2HQNA 3GO5A 4LG0B 3IL2A 2COMA 3DFGA 2IVMA 4H0EA 1Z1DA 4HQEA 1HKQA 3V7CA 2H6CA 2DPDA 5CVVA 3TQNA 3ULQB 3BDDA 2YR2A 1LQ1A 3TDUC 1LDKB 2X0LA 2DI3A 1USTA 2V79A 2ADUA 1NHAA 2MH9A 1XDSA 1IN8A 4FT8A 1OMIA 1R5HA 3M8EA 3KZZA 3LQQA 4WK8F 3GX4X 2EA4A 4IJAA 1LNWA 5CVUA 3HHGA 3FHZA 3I4PA 4OU0A 1EH7A 2ZNZA 3MAJA 1FWZA 3BP8A 3GWZA 4ASNA 3H3UA 1P6RA 4HLXA 3P9IA 5D6FA 2HTSA 1FC3A 4I98B 2STWA 2Q0OA 3Q5FA 1KU7A 5LLQA 3QP6A 3ZMTA 1RUOA 2MC3A 2CO5A 1FNNA 1R1UA 4CYDA 4ZZDA 5DUIA 4HW0A 5D5XB 1WRJA 1DP7P 1XGSA 4XLNF 5EEGA 2ACJA 1UB9A 1B9NA 3DPLC 4M73A 3QPTA 3OV8A 5HOOA 4HZFA 1G3YA 2Z99A 3GW2A 1U5TC 3BROA 4BH9A 3KLOA 4FHTA 1USSA 1PUEE 5AONA 2Y75A 4HV5A 5LEKA 3PQJA 4FX0A 2VODA 4CICA 1P4XA 2CWEA 4A5MA 1ZH5A 5L3CA 2DU9A 1J59A 1Z9CA 4M6XA 3R4KA 4HDUA 4TV7A 2KRFA 1HW5A 1S7OA 4LD5A 5LRRA 4L9JA 4Q47A 4LLNA 4UV8A 5LHIA 4IF4A 4ENJA 2A69F 2BV6A 1QZYA 1OYWA 2V1UA 1CGPA 2IPQX 2V1XA 3FWEA 2D1VA 1BOAA 3HTSB 2DQLA 3QP5A 3LFKA 1ZN2A 4HX4A 3HRTA 4BQAA 3O2PE 3TGNA 1R22A 2EFWA 4Y17A 1KQ0A 2ESHA 2DPUA 4I09A 2YU3A 3KEOA 5DEQA 2FXAA 2P8TA 2RNJA 4A5NA 1BI1A 4U88A 2YPRA 4B09A 4I7HA 2QQAA 5L3FA 3QU6A 1EH6A 3ZPLA 1V3FA 2XAJA 4FX4A 2O03A 1R36A 4LK1F 1OYYA 4RGXA 1DUXC 3HSEA 3HYIA 1DDNA 2R3SA 4E70A 2RVCA 1GXPA 4KYWA 4HV6A 4MEYF 4PCQA 3MZYA 3SHFA 3I64A 4RGUA 4G6QA 3I59A 5FLXZ 1LEBA 1O3RA 3TO9A 5F6FA 5J6XA 4AIHA 3W6KB 3C3WA 2QWWA 3WTXC 2F5CA 4N0BA 3HOTA 2CG4A 2PFBA 3ELKA 1ONVA 1BI2A 1FP1D 2FE3A 5FO5A 1UCRA 2LF8A 1F4KA 1XN7A 4LJZF 1TNSA 3T1BA 5LBQA 1MKMA 1I6XA 2DBBA 2DK8A 5E17F 4P9UA 3J81K 3R6SA 2C6YA 2DFIA 1O7FA 4KDPA 2BGCA 1G6NA 2J5PA 4MNUA 3EUHA 1XGNA 4WXDA 3MQ0A 5LGTA 1XDUA 2HWVA 4OINF 3KP4A 5LRSA 1VTNC 2OZ6A 3JSPA 5ED4A 2HKXA 4M9ZA 1Z7UA 4ZYDA 1S3JA 4U7DA 1G3WA 4ZZLA 2EV5A 3F8FA 4HBLA 5ILVA 1I27A 1KQ8A 3LSTA 1MZBA 1TTYA 4HOBA 4IVNA 3V8JA 2E7WA 1TBXA 2CSOA 3WGHA 2VONA 2H09A 2UWMA 4WF2A 2A07F 4M71A 5HDKA 3C1DA 5ILUA 2DAOA 4EJTA 5A2QK 4GO1A 2XKPA 1T6SA 4OOIA 1G3SA 4A0ZA 1JGSA 3KE2A 5CJ9A 1J9IA 2DTRA 2EJRA 4PGGA 3ERED 1ZGAA 4R1HA 2H27A 5FGMA 5DD8A 3VOEA 1HXDA 5DCFA 4AWXB 1IW7F 3CUOA 3F22A 3KP7A 4M9SA 1Z6TA 3GFIA 5HLHA 4I2OA 1KA8A 5LHGA 3VEPA 5E8IA 2O61A 2O8XA 2D45A 3T8RA 3DP7A 5DDGA 1GVJA 1BBYA 2MLGA 2MH2A 1O7LA 2FNAA 4D0PA 3H92A 1P4AA 3Q9SA 2HFHA 2MA3A 3F8NA 3GZ5A 2YX7A 4WX9A 3WTUC 2K02A 2E7XA 3FF5A 5H20A 3E6CC 5AIPA 4JK1X 4UVBA 1J5YA 3L00A 3G3ZA 2P6SA 1YS6A 3NEUA 1PP8F 3U9GA 1U6GA 2OU2A 1ZLJA 4HLYA 4ZYHA 2IT0A 3ZN1A 3P7NA 4G6DA 1KU2A 5E18F 4A0YA 2GXGA 3LAJA 2OAZA 3KP5A 2NNYA 3OOPA 5DYMA 2M5WA 4GYIA 3O6BB 5HLIA 4LGWA 3CTAA 4U7BA 3JAMK 4PGHA 2RV8A 2X4HA 2ZCWA 2HKOA 5K5RA 4KFCA 4PDKA 3HRMA 3PFIA 2P5KA 1FPQA 2EK5A 2FU4A 2RDPA 5K5OA 3FMSA 2KIUA 1W7PB 4MQ9F 4UVCA 5HDGA 3V7SA 4I01A 3K69A 2QENA 5FD5A 4YFKF 1J7KA 1HSTA 5BOXA 2HDCA 2R7FA 3IC7A 3D0SA 4RB2C 5IT3A 3RDIA 3QRFF 2BBYA 3FM3A 2ZKZA 1ULYA 2KIFA 3HSRA 3R0AA 5D4RA 1Y0UA 2M30A 1P92A 4BHCA 3ISPA 1MJAA 2VC1A 1TQPA 5FB2A 4RB1A 3W6JB 5FFZA 4R8HA 2HS5A 1B1BA 1BI3A 3RI4A 2B0LA 5IT9K 2VN2A 2KJBA 2PI0A 1B4AA 3F6OA 4L9TA 4IRGA 3RYRA 1W7PD 2HGCA 2GXBA 3TKYA 3CO7C 2HQRA 4NQWA 3NQOA 2RC4A 4QLCU 5L3GA 4A6DA 1F9NA 1YYVA 3S2WA 5A2QZ 4GYGA 3GVAA 4LLGF 1F5TA 3ZP5A 2XAHA 4PZJA 3HRUA 1O57A 3FMRA 2FF4A 1FSEA 2FQ3A 3QOPA 1O3SA 5HVQC 1HQCA 3WGGA 1ZGJA 3LWFA 2W25A 2PJPA 3V8LA 3KCCA 2ZFWA 4KNYA 1HSJA 4EJOA 2FBHA 1IXRC 1B59A 2HYGD 3E3VA 3U2RA 4I0BA 1A04A 5DV5A 2VBZA 1LDDA 3ROUA 2IJLA 1EH8A 4JBAA 4AIJA 1XGOA 2IA1A 3BZ6A 3L7WA 2M8EA 3HUGA 3LA7A 2GA2A 1I1GA 2IA0A 2QM3A 1J0RA 4ZYGA 2P7CB 1D8KA 4EM1A 1IN7A 3COAC 3BJ6A 4OIPF 2A68F 2BE5F 5D8LB 1YW8A 2G9WA 4IHTA 2ETHA 4OIQF 2GAUA 4XLPF 1BIBA 4DNCA 2OQGA 3L09A 1BN5A 1UHMA 2RN7A 1FYKA 2JPBA 2AXLA 3J80Z 1ZRDA 1TW3A 2IA2A 5F64A 2VT2A 4ENNA 1U5TB 4KN7X 5DD4A 4G7ZF 4RGSA 2VOPA 2XGXA 4KICA 4AIKA 1J75A 3DF8A 2FEZA 3REOA 3TO6A 2P5LC 5E8GA 2GWRA 3HSFA 1U2WA 4BNCA 3WTVC 1WKMA 1JXSA 2ZNYA 3B02A 4ESBA 1LVAA 3JW4A 1YO5C 3CO6C 4BHBA 2AS5F 3M1EA 5JFRA 3QU3A 5BS6A 2DQRA 1FOKA 1XSXA 3ECHA 2FBIA 3V4GA 4UVAA 1YW9A 1G4DA 2RQPA 3F21A 5L3BA 3GFLA 3T8TA 5TJJA 1IXSB 4UNOA 3SZTA 4U0WA 4OMYA 4S04A 2D2WA 2IRFG 4RAZA 2RGVA 5HS8A 3SQNA 4I0AA 4YFNF 2PEXA 3BJOA 1HW1A 2V6CA 2VT3A 1GXQA 4HAMA 2JTVA 1WSUA 1AOYA 2CW0F 2FRHA 3QAHA 1T39A 2E1NA 3LA2A 1JE8A 5LEJA 1SAXA 3F23A 1FYMA 4HYEA 4RGRA 2ZJ2A 5HDNA 1XMAA 4EV0A 5TRDA 4MTEA 2EFNA 4P5OA 5J8CA 4CO8A 3VODA 3HTUA 2PQ8A 1YS7A 5CVIA 2DO7A 1R23A 2NS0A 2V1DA 1DPRA 2JZYA 2LNBA 3MFKA 1Z05A 1K79A 3EDPA 1SMTA 3SXYA 1MJ9A 3GFMA 5LGNA 1SFXA 4L5IA 1K78B 4RB0A 1R1VA 3KFWX 3CJNA 1U3EM 3RPUA 1IN5A 1FT9A 3U1DA 4EM0B 5LHHA 1BIAA 5CLSA 3RPQA 3RJPA 2STTA 1T38A 1EV7A 2PLYA 4RS8A 4EMSA 2A6HF 4HX8A 3WTZA 1BJAA 4L9NA 4G7HF 1MDMB 1K6OA 3GUDA 1FP2A 2L02A 1ZREA 1YFHA 3EYIA 2MLKA 4K2EA 4LB5A 2RKHA 5FFXA 3ML6A 1XCVA 3WTTC 3F3XA 3IHUA 1RIOH 3FXUA 1S8NA 3KLNA 1OPCA 1Q1HA 3K9TA 2JT1A 1YLFA 5E1XA 3ZMVA 3RYPA 1MD0A 4IXAA 4KA4A 2QBYA 2H94A 3T0YA 2CYYA 1IRGA 1RZ4A 4M72A 2FMYA 2OBPA 4L9VA 2EB7A 2K86A 3HHHA 4WCGA 4XBFA 2QQ9A 3NRVA 3LAPA 4BYYA 3GLXA 1ZAOA 3DEUA 2JRTA 3FMQA 3WODF 1YQAA 2Z3YA 5D5VB 4EJVA 1LB2A 1RUNA 2YSRA 3CUQB 2DW4A 5H6QA 3ZMDA 2EFQA 2Q8KA 4L0YB 1QZZA 4IRHA 2FOKA 1L0OC 2QUFA 1ODDA 2ZBKA 2NAZA 1W7PA 3WU0A 4LK0F 3I59B 3BY6A 4Y15A 3CDHA 4U0YA 1SMYF 2ISYA 1AWCA 2L54A 1WI9A 1H9TA 4CHUA 2XIGA 5ICGA 2XHKA 3TOBA 3ABUA 2GIVA 3I58A 3M7GA 4JQFA 4NHJA 1L3LA 1XSDA 1YIOA 4HDVA 4G9YA 3J7AO 4U0VA 4L0ZB 4IHSA 3V7RA 4P9FA 3FX3A 3N4MA 1R00A 2EWNA 3JSOA 5BPDA 1ON2A 5E20A 3GEZA 1W5SA 2UXNA 1OKRA 2A5YB 2W84A 5JR3A 2K27A 3WG9A 5IT9Z 2XASA 3LA3A 4G94A 4YG2F 2Z5UA 3I0TA 3D5LA 4CXFA 4RB3C 3WTYC 2DT5A 4F7ZA 4HX7A 2XUBA 3GYHX 4OIRF 1E17A 1I1SA 4IPAA 5JVTA 2VXZA 2VBWA 4G7OF 2QBYB 2M45A 5HS7A 1BM9A 4EJWA 4GXOA 5DUKA 5JI6A 1HKTA 3IRRA 1JHHA 2EV6A 3CUQA 2O6GE 1IN6A 5LGUA 1C0WA 2UXXA 1R5GA 2VOOA 1IRFA 1TQIA 2OA4A 1D8JA 1ZHFA 1D5VA 5K1YA 1YTYA 3MWMA 3ZMZA 4HA8A 1FBUA 1ZG5A 4EGYA 5CVRA 3GF2A 5D4SA 1T2KA 2P5VA 4YIFA 4L18B 4EJUA 5KK1A 3RTRA 2W24A 4LMYA 1TLHB 3B73A 4MTDA 5HLGA 3L9FA 3BOQA 2Z9OA 3ZQ7A 4AVPA 1KYWA 5L3EA 3E6DA 2W85A 3DXJF 3FM5A 1LEAA 4OIOF 3I54A 5KVRA 4ETSA 1V4RA 3EETA 2VBYA 1RI7A 3TO7A 4YFXF 4YIIA 4WWCA 4OMZA 3ZMSA 2WTEA 1GHCA 1YG2A 4ENMA 1BI0A 1TQMA 5H6RA 1SFUA 2HTJA 5BQTA 5J8FA 1ZYRF 1QBJA 1ZARA 1MGTA 4P96A 2BEOA 1O3TA 3IKTA 1BC8C 2ESNA 3BPXA 1K78A 2P7VB 4WXHA 1B6AA 2JSCA 3G73A 2EA2A 4KIGA 4EVIA 1Z91A 3MEXA 2P6TA 3K1MA 5E1WA 2HOEA 4Z2YA 4UV9A 3FXRA 1ZG1A 2XAFA 1OR7A 4O5VA 3R60A 3JAMZ 2QQBA 1CF7B 3WE3A 3BJAA 5JHUA 3E97A 4M6YA 2Z33A 3GFJA 1FBSA 2A6EF 1JHFA 3J81Z 4CDGA 5DCMA 5ICCA 3C7JA 4M9XA 4HF2A 1ZRFA 3HRSA 2A61A 1KYZA 3C18A 3E5QA 3RKWA 1U78A 2W57A 2CFXA 4QWQA 2PMUA 2QZ8A 4N9HA 5CVJA 3CUQC 1HKSA 4P55A 4WXCA 2Y48A 4RAYA 1E2XA 1REPC 1R58A 2EV0A 2NNNA 2G7HA 2MD5A 2PBIA 3E6MA 5D8KB 4HF1A 2VE9A 3I5UA 4ZH4F 4KT5C 3F8MA 2KKOA 4ZYEA 2KIMA 2GA1A 1J2XA 5FD6A 4LLLA 3PQKA 4S05A 2FBKA 3SFZA