4ZYEA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
PMLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
total genus 42
structure length 152
sequence length 152
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyeA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyeA01
3ECHA 1KU3A 3NRVA 5L3FA 4IVNA 3GZ6A 3GYHX 5HDGA 2OZUA 3K1PA 2H6BA 4RB2C 4S05A 2DT5A 3E3VA 5CLSA 4A5MA 4L0ZB 4PZJA 5FLXZ 1G3YA 1EH6A 2OQRA 1USSA 3VFZA 2LF7A 2YU3A 1YO5C 4RAYA 2XGXA 1YW7A 4A0YA 5ED4A 2H27A 1G3TA 3EUHA 3H3UA 3J7AO 5LLQA 4CYDA 4HLYA 1Z9CA 1BC8C 1SFXA 2A68F 3HUGA 5LHHA 3EETA 2G9WA 3MEXA 2IA1A 3EQLF 1XMAA 4U7BA 2A69F 4IPAA 3QP6A 5LGTA 3LA2A 3BP8A 3ZMDA 3IHUA 1TLHB 3O2PE 3EYYA 3WTYC 3CJNA 2NS0A 2P4WA 4IRGA 4IRIA 3VB2A 1PP7U 1IN4A 4OMZA 2G7HA 3RYRA 1I1GA 5L3BA 2WV0A 4ETSA 2KIMA 1R5HA 4A0ZA 3QU6A 2JSCA 4LLGF 3LAPA 3GLXA 4BXUA 5ILSA 4FX0A 1P2FA 4OIPF 1IAWA 4GYIA 2GAUA 4WXCA 1IN5A 2KJCA 1R00A 4FHTA 4IXAA 2GXGA 3HSRA 2JZYA 2DO7A 2R3SA 5DEQA 2YR2A 3C1DA 1TW3A 2GWRA 1FT9A 1J75A 4LLNA 3L2CA 3E97A 4B09A 1FP1D 1KU2A 1MDMA 4MTEA 3MFKA 4YFNF 4RGSA 4IRHA 3R4KA 1ZARA 4ZZDA 5ILVA 4M74A 4RB0A 3RI4A 3K9TA 2WC2A 3U9GA 5LRSA 3MCZA 5D6EA 2Q0OA 1OR7A 3BJ6A 1XGNA 1BIBA 5AIQA 3IL2A 3Q5FA 4HZFA 2K7LA 1SD4A 2A3SA 3K1MA 3WTXC 4WX9A 2EFOA 1XGOA 4OIRF 2ZKZA 2FA5A 4G6QA 5F6FA 3CTAA 4EJUA 1BIAA 3P7NA 1I1SA 2DK5A 5J8CA 1SD6A 1WRJA 2FNAA 2EA2A 1U6GA 3RJPA 5KK1A 2MBFA 2HQRA 2XAQA 3KFWX 2CWEA 3WODF 1I5ZA 1KYZA 1HKTA 3RKYA 4EJWA 2Z9OA 2EFQA 2QUFA 3MAJA 5L3CA 2VBWA 3DXJF 3MZHA 4P5OA 4PGGA 1KGSA 3CDHA 1S7AA 3DPLC 3OOPA 3KP6A 3R61A 2CYYA 3WE3A 1YLFA 1R36A 2QQBA 4KN4X 4M6XA 3K0LA 4O6JA 2QBYA 2W57A 4M9SA 4XSZF 2IT0A 2AS5F 2J5OA 3WE2A 2E1CA 3PQKA 1MJAA 2VBXA 2PMHA 3WTTC 1D5VA 1HXDA 1ZREA 3R0JA 5FD5A 5DCMB 2W25A 1HW1A 1E2XA 2DBBA 2LSOA 4KNYA 1ZGJA 2EV6A 4HW0A 4UUVA 3CO6C 1IRFA 2CG4A 1I6XA 2HOEA 1XB4A 2IRFG 5K5RA 4MQ9F 1B59A 1XMKA 4KIFA 3I0TA 2FE3A 1RIOH 3HHHA 3QPHA 2UZKA 4ESJA 3WG9A 1QNTA 1BI1A 1S6LA 2VXZA 5ICFA 3BWGA 4HYEA 3KLNA 1ZRFA 3SZTA 4EJOA 3SZPA 5F64A 2IA2A 2V6CA 1BBYA 2M5WA 4E70A 4U0WA 1ULYA 1K7AA 2FMLA 3HTUA 3BY6A 1S8NA 2HKOA 4OIOF 4RGUA 1UFMA 4F7ZA 4LB6B 2HR3A 1Z05A 4BHCA 3P9KA 1KQ0A 2W85A 4L0YB 4QLCU 1BJAA 1ZG3A 3F8MA 4EGYA 1MD0A 4IHTA 2LNBA 5IT9K 3JAMZ 2UXXA 2Z3YA 3REOA 5DD8A 3I58A 1OPCA 1FOKA 3TDUC 2VONA 1BI2A 5ILUA 4EV0A 1SD5A 5D5UB 2BBYA 2RKHA 1LQ1A 1LDJA 4L5JA 1STZA 5KVRA 2EWNA 5E1WA 3D5LA 1MKMA 1HSJA 4KN7X 2UWMA 3FXUA 4EQQA 3LA3A 5HDKA 4HF2A 2MLKA 3ISPA 3HSEA 3N97A 4HF1A 2A6EF 4A12A 4OIQF 2H09A 4CZZA 3BROA 1LNWA 2V1XA 3KEOA 3F8BA 3FMSA 4KDPA 3RKWA 1HW2A 3BOQA 5D6FA 4HF0A 4LK1F 1YG2A 2PN6A 1XGMA 4KA4A 4HV6A 2OAZA 1S3JA 3MZYA 2ZJ2A 3RYPA 2HWVA 2A61A 1FYKA 3T8TA 2EFWA 3HTSB 2KIFA 2W84A 3I4PA 1BN5A 1BOAA 3M8FA 5BMZA 4KUMA 1TQPA 1YIOA 3HYIA 4JQFA 5K5QA 2MA3A 2V1DA 2O03A 2PMUA 5EEGA 4XLNF 1W4MA 2NRAC 5FB2A 1B6AA 4UVCA 5LHGA 3KZYA 4RB1A 2RC4A 4NHJA 2Q2EA 4LK0F 2X4HA 3L7WA 2A6HF 3WGHA 3LFKA 4G7OF 3L00A 3T0YA 4BH9A 1A04A 2EJRA 2DTRA 5AONA 3WTSC 1XN7A 3HRTA 2CQKA 3BJAA 1W7PB 3KETA 2F5CA 3RPQA 1ZGAA 3IWFA 3DF8A 5CYVA 4L18B 3O3KA 4G7HF 5DYMA 2VOOA 1OKRA 5H6RA 4ENNA 4YIFA 3IRRA 3COAC 4M71A 4EJTA 3WGGA 1FSEA 3VODA 4G94A 3WTVC 4PCQA 2D1VA 2O61A 2MH2A 1C0WA 3DFGA 5LHIA 4U0YA 1YS7A 4AIHA 3E5XA 5D4SA 2EFNA 2ZMEB 4B8XA 5D8KB 3RIRA 5AIPA 1MGTA 1S7OA 3IC7A 2P6SA 2P5LC 3GFIA 3ZN1A 1WSUA 4M9ZA 3HHGA 2DLLA 1B1BA 3WGIA 4XSXF 1Y0UA 5H6QA 4I09A 4WXHA 3CLOA 1OYIA 2GQQA 2CSOA 4LJZF 1P6RA 4HX7A 1UHMA 4GGGA 4WCGA 3DV8A 4G9YA 1RUNA 3ZMSA 4ENJA 3CUQA 4KYWA 1X3UA 3B02A 2XKPA 4JK1X 2H94A 1BC7C 1R1UA 4HQEA 5HOOA 4GYGA 1FBQA 2FBIA 2FQ3A 5BQTA 2IP2A 4FT8A 4OU0A 2ZFWA 1K79A 4UVBA 2G7UA 3HRMA 2ETHA 5EEHA 5LGUA 2NNYA 4LG0B 4L9JA 3KE2A 1WKMA 4ESBA 2ELHA 4HV5A 5J6XA 2MD5A 1LJ9A 5CVIA 1K78A 5TRDA 3DPTA 1ON2A 3G3ZA 1HKQA 3FHZA 3JW4A 2QQAA 3PFIA 3LQQA 2VE9A 2PFBA 3T8RA 2PBIA 4NQWA 2GZWA 1H0MA 1GVJA 2BYVE 4I2OA 3NEUA 3E6BA 1SFUA 3FMQA 3Q9VA 5BOXA 2L02A 3DEUA 3TO6A 2GA2A 5FFXA 3KP4A 2MH9A 3HRUA 5CJ9A 4KMFA 3F8NA 3PQJA 1Z6TA 2KKOA 1JHFA 2L01A 4U7DA 1EH7A 1T98A 2QWWA 5HVQC 2VC1A 2QLZA 3LAJA 1R5GA 2UXNA 3C7JA 2VOPA 1LDKB 2LDUA 4BAYA 1O3RA 2VBYA 5L3EA 2XV4S 2A5YB 5K5OA 1UB9A 4KMUX 1DDNA 2FOKA 2ISYA 2QVOA 2RV8A 4Y15A 3D0SA 4LLLA 1J7KA 2IVMA 1KQ8A 1VTNC 1NHAA 4ZYDA 3ZMTA 3L09A 2AXLA 3ERED 5JVTA 5K1YA 2BV6A 3LA7A 3RTRA 1P4WA 4EM2A 4R8HA 3BPXA 3QPTA 2D2WA 1TTYA 5D5XB 2HKXA 3SQNA 1QZZA 1RNLA 2VBZA 2QYOA 4OINF 2HTSA 2CGPA 5D5VB 1ZHFA 3ECOA 3GFLA 3H3ZA 1QGPA 4UV9A 2V1UA 3JTHA 1SD7A 1FBUA 5BS6A 5E8IA 2GIVA 4MQVA 1GXQA 2YPRA 2ACJA 2IJLA 3C18A 2DW4A 2L4AA 4L9VA 1KU7A 1RZ4A 1L3LA 4HLXA 1YQAA 3FM5A 3GZ5A 4Y17A 1UCRA 3KP5A 1O7FA 2XRNA 1RUOA 3FXRA 1Z6RA 1FPQA 3SXYA 3V8KA 1FZPB 2IA0A 3F22A 2F5DA 3GX4X 4CO8A 2M45A 3TOBA 2BGCA 4Q48A 5L3DA 2W24A 3QP5A 4Q47A 4CGZA 1ZRDA 4ESFA 2FEZA 2HGCA 4KIGA 5A2QZ 3BJOA 2O3FA 1ONVA 4TV7A 3J80Z 5H20A 4IF4A 2OU2A 1LVAA 2B0LA 1U3EM 2P5KA 3DP7A 2K02A 4XRFA 1T38A 1U2WA 3GF2A 2C6YA 3V4GA 3FM3A 3P9CA 2E1NA 1OMIA 1MDMB 4AVPA 2CO5A 4I0BA 3GVAA 1R1VA 4CICA 5E17F 3E6CC 2EV5A 3U2RA 3E6DA 5HDNA 3TO9A 5ICGA 1WWXA 4MHGA 2ZNZA 3WTZA 3ZMZA 2OBPA 4WXDA 3SHFA 2HTJA 3IKTA 1T0FA 2NNNA 2STWA 5ERIA 3KP7A 2H6CA 1V4RA 4AIJA 5TJJA 1FYLA 4I0AA 3DKWA 3F3XA 2P8TA 4LGWA 4U0VA 3QRFF 1FP2A 1W7PA 2YSRA 1EH8A 1R22A 2RGVA 4RGXA 4S04A 1T39A 1LEBA 5E8GA 1D3YA 1W5SA 3GWZA 3RKXA 3CO7C 4A5NA 4BQAA 3ELKA 4R79A 2KJBA 3J81Z 2VE8A 1SAXA 1T6SA 4I01A 3S2WA 2Z33A 3I5UA 2V79A 3LWFA 4A6DA 1XSDA 1W5TA 3KLOA 4HX8A 3FXQA 1GXPA 3I64A 2K4JA 4YIIA 3K2ZA 3FF5A 1F5TA 3E5QA 1G4DA 1QPMA 2FBKA 4KIBA 3G73A 2ESHA 2ZNYA 1KQ9A 4WK8F 2XAHA 4D0PA 4IHSA 1XGSA 2HYFA 1F1ZA 3KP2A 3ABTA 3F8CA 1U5TC 2FU4A 3R6SA 1CF7B 3EDPA 4RB3C 4N9HA 1BI0A 4K2EA 2HEOA 5E1XA 2KIUA 5CVRA 3R60A 2OA4A 3B73A 2XVCA 3JAMK 2OZ6A 5ICEA 4P9FA 5HS9A 1HSTA 5D4RA 1D8JA 1MJ9A 2EB7A 2DPDA 2CW0F 4BNCA 1SMYF 1Q1HA 4OMYA 4ZYEA 2ADUA 3HRSA 2WWYA 5F1RA 2A07F 5J8FA 4O5VA 2R7FA 3JSPA 3GEZA 4L9TA 1PDNC 3KP3A 4EM1A 1XD7A 3I71A 3ULQB 2JPBA 2EV0A 5LRRA 4I7HA 5CVUA 1DPUA 2GA1A 2K27A 3JTGA 3LSTA 2F2EA 3N4MA 3P9IA 3WTWC 2E7XA 2HQNA 1TQMA 2XAGA 3QOPA 4BHPA 2HDCA 5HLGA 3I59B 1R58A 4RGRA 2QZ8A 2STTA 2M1BA 1FWZA 3ABUA 3MQ0A 6PAXA 1JGSA 3E6MA 3M7GA 4U88A 4EMSA 2L54A 1S29A 1ZH5A 2DK8A 4A2UA 1R7JA 4A0XA 1P4XA 3WTUC 1P92A 3TKYA 4BHBA 4EGZA 5E1ZB 1FNNA 1FBSA 1AOYA 2XUBA 1P4AA 1IXRC 5JHUA 4ENMA 2GXBA 2D1HA 3E5UA 1HQCA 2Y48A 3CUQC 2PG4A 1IW7F 3ROUA 1CGPA 5JI6A 1YW8A 3V7CA 5FFZA 1FX7A 2HS5A 2VN2A 1TNTA 1U5TB 1Z7UA 2K86A 3QU3A 2O6GE 2E7WA 1JHHA 4Q4ZF 4GO1A 2BEOA 2PLYA 3F21A 1JXSA 1U78A 2FSWA 4AWXB 2QM3A 3HOSA 3F72A 3IWZA 2RDPA 2JTVA 4AIKA 4LD5A 2DAOA 3IRQA 1FYMA 5HS7A 4L9NA 1USTA 2P7CB 5FD6A 5DV5A 1OYWA 2F5EA 4P96A 1YTYA 3EYIA 4ZZLA 1QO0D 2RQPA 5CVVA 5FLXK 1B9NA 2ZXJA 5ICCA 4Y13A 4KICA 1IN6A 1G3WA 2FMYA 5D5WB 4OOIA 5DUIA 5DCMA 4MNUA 1T2KA 4CDGA 1GHCA 3ZMVA 1KA8A 4R1HA 1O3QA 4G6DA 2JPCA 3V8JA 2XAJA 2LF8A 3TGNA 3FX3A 3M1EA 2RVCA 1YW9A 1E17A 1FLIA 4KFCA 2DU9A 2LKPA 4MTDA 2Z5UA 2HFHA 1J59A 4Q5SF 1DPRA 3GFMA 1HW5A 1XCBA 4I98B 1V3FA 4ZYHA 2P7VB 4G7ZF 1DUXC 4HBLA 3KZZA 3R0AA 4M9XA 4N0BA 1WI9A 2FF4A 1TBXA 4CXFA 2FNPA 1IF1A 1AWCA 3ZMUA 2EFPA 1F4KA 4A6EA 1YYVA 2M8EA 3KCCA 1KU9A 3GUDA 2JT1A 2NAZA 3V8LA 3M9AA 1LB2A 2ZCWA 3TQNA 1MZBA 3TOAA 4L5IA 4UXNA 2FBHA 3HSFA 4MGRA 3CUQB 5HLHA 3C3WA 4RAZA 3GO5A 2IW5A 5LEKA 1JE8A 4WWCA 1IRGA 3VOEA 1B4AA 5DUKA 4NB5A 4AD9A 5FO5A 2IPQX 3ZP5A 2F5FA 1O3SA 1TQIA 1TW2A 1ZLKA 1K78B 1J0RA 4M73A 1O3TA 4JBAA 3Q9SA 5E18F 1Z91A 5D8LB 3DQVC 3GW2A 2Z99A 3BDDA 2P5VA 1XSXA 3FWEA 1H9TA 5BPIA 2DI3A 2HZTA 1FSHA 2CFXA 4UHTA 3W6JB 1B9MA 1WQ2A 1IN7A 3OV8A 1ZG5A 2Y0MA 1XDSA 5IT9Z 1ZYRF 1RI7A 4QWQA 1L0OC 1J9IA 1PP8F 2DFIA 4H0EA 1CF7A 1PUEE 2YX4A 1EV7A 1J2XA 4GXOA 1LEAA 3QAHA 4LMYA 4YFXF 4LFUA 5L3GA 4DNCA 1UHWA 1QQIA 4UNOA 3U1DA 5JFRA 2DQRA 1XSVA 2MC3A 4HAMA 1HKSA 2JRTA 2EA4A 3CUOA 2TDXA 3FMRA 2XIGA 3ML6A 5DDGA 4EVIA 3FZVA 3TO7A 1OYYA 3NQOA 4LB5A 3KEQA 3W6KB 4P9UA 1ZAOA 2VODA 1LDDA 4DQ2A 3I53A 4IJAA 1G6NA 5LGNA 3T5XA 1ZN2A 2ISZA 1HBXG 5A2QK 2X0LA 2PJPA 4BYYA 2KRFA 2L4MA 3J80K 1U8RA 4HOBA 3ZPLA 2COMA 4EJVA 2RN7A 3JSOA 4ENKA 4YG2F 2XKOA 1J5YA 3GFJA 3HOTA 2OQGA 2EK5A 4P55A 3GXOA 4ASNA 1TNSA 3I59A 5LEJA 2XAFA 4HDUA 2PEXA 4YFKF 2PI0A 2QBYB 2DPUA 4HA8A 2J5PA 1BI3A 2K4BA 2M30A 2VT3A 2ZMEA 4CHUA 2M87A 4FX4A 3RPUA 5BPDA 3AAFA 4UVAA 2XASA 3BPVA 1O57A 5HLIA 2PQ8A 1QZYA 4N9IA 4PDKA 4PGHA 3K1NA 3I54A 3ZN0A 5DD4A 2VT2A 2QQ9A 4HQMA 2ZBKA 5DCFA 1IUYA 3SFZA 2BE5F 1IXCA 1ODDA 4GCVA 2XHKA 3F8FA 4O3MA 2NYXA 1ZRCA 1IN8A 3V7SA 4ZYGA 5JR3A 2XROA 5HS8A 2P6TA 1U5TA 5E20A 5FGMA 5LBQA 1QBJA 1O7LA 4WF2A 1R1TA 4LG0A 2WTEA 3K69A 3J81K 2L3DA 1FY7A 4HX4A 4M72A 1H9GA 1K6OA 2R7DA 1SFEA 4ZH4F 1XCVA 1YS6A 1XDUA 2ESNA 4RS8A 4G8XA 5CVJA 1SMTA 4I02A 1F9NA 3LQRA 4UV8A 3IKVA 2MLGA 3F23A 2Q8KA 1REPC 1I27A 3O6BB 4MEXF 2V9VA 3TDZC 3VEPA 1W7PD 2D45A 3WU1B 1R23A 1KYWA 1Z1DA 4HDVA 4KT5C 2VC0A 3WU0A 4Z2YA 2O8XA 2DQLA 4XLPF 1DP7P 3M8EA 1FC3A 1BM9A 1IXSB 2OD5A 3MWMA 1YFHA 3H92A 3V7RA 2Y75A 2O0YA 3RDIA 1D8KA 3HIFA 2ZO4A 2RNJA 3L9FA 4MEYF 2QENA 3F6VA 4M6YA 1ZLJA 1G3SA 3F6OA 3T1BA 3ZQ7A 4ON0A 3BZ6A 2FXAA 2FRHA 1ZG1A 5IT3A 2YX7A 1MJBA 1ON1A 1IZ1A 4XBFA 2HYGD 4EM0B
chains in the Genus database with same CATH superfamily
3G1LA 3ECHA 1KU3A 4BU2A 4ZJZA 3NRVA 5L3FA 4IVNA 3MVPA 3GZ6A 3GYHX 1JT0A 1PJQA 5HDGA 2OZUA 1YHQI 3K1PA 4B43A 2H6BA 3CZ6A 4RB2C 4S05A 3LL7A 4Q28A 1IBME 1ZK8A 2DT5A 2QSGX 3E3VA 5CLSA 4I6ZA 4A5MA 2KZGA 3TQMA 2M0CA 4EATA 4L0ZB 2Z16A 1MBJA 4PZJA 4FE4A 5FLXZ 4JI1E 5AC4A 3ADIA 1G3YA 1EH6A 2OQRA 1USSA 3VFZA 2BVMA 2LF7A 4M3FA 2CT1A 2YU3A 1XNRE 4RMNA 2L7KA 1YO5C 4RAYA 3BTCA 2XGXA 2M7AA 1B69A 1IJWC 2EM8A 3DBRB 1YW7A 4OWRB 2LTPA 4E7SA 4A0YA 5ED4A 4BE2A 2H27A 2ODRC 1G3TA 3EUHA 2DYRH 3H3UA 3J7AO 5LLQA 4CYDA 4RM3A 4C3JJ 4HLYA 4BDYA 4XQFA 1Z9CA 4BMJA 3HEFA 3OYAA 1BC8C 2O5RA 1SFXA 2A68F 3CMMA 3HUGA 5LHHA 3EETA 2G9WA 3MEXA 2DFFA 2IA1A 2XGCA 3EQLF 1WH7A 1XMAA 4U7BA 2A69F 4II2A 1N32E 4IPAA 3QP6A 2OJED 2EMGA 5J3LA 5LGTA 3BG6A 4JI0E 3LA2A 2PMZN 1QPIA 1TZLA 3BP8A 3BG5A 3ZMDA 3IHUA 1TLHB 1QHGA 3A4CA 3O2PE 3EYYA 3WTYC 3CJNA 1JJ6C 2NS0A 4DZPA 2P4WA 4RA2A 4IRGA 3DU6A 1CQTA 4IRIA 1BW6A 3VB2A 4L5NC 1PP7U 1E3PA 1IN4A 3S93A 2RREA 2ELZA 1I50J 1D1AA 4OMZA 2G7HA 3RYRA 5EEAA 2OPTA 4LIVA 2L9NA 2IGNA 1I1GA 5L3BA 3P1XA 1HNZE 2KOUA 3GTPJ 2HDDA 3HXLA 3NARA 2WV0A 3LSRA 4ETSA 5J47A 2OCEA 2KIMA 4AU7A 1EJ9A 1R5HA 3H35A 3M8JA 4ABZA 4A0ZA 4DMIA 3QU6A 2MKDA 4XMYA 2JSCA 4LLGF 3A1YA 3LAPA 4JI8E 3GLXA 5FKOA 1MEYC 4BXUA 5ILSA 3BQYA 4FX0A 1P2FA 4OIPF 1IAWA 2VKDA 2DA5A 4GYIA 2GAUA 4WXCA 4X62E 1IN5A 1PUFB 2KJCA 2L7ZA 4F54A 3FXLA 1R00A 2B3TB 3K6GA 4FHTA 3HTXA 4IXAA 3DEEA 2ZC2A 1OQYA 2GXGA 3HSRA 2MC5A 2JZYA 2DO7A 3PNVA 3RQ4A 3RSNA 4BQNA 1OISA 2R3SA 2YTNA 2WY8Q 3IAM2 5DEQA 2LJUA 2YR2A 3RCOA 3C1DA 3S32A 2G0EA 1TW3A 2GWRA 2NVUB 1FT9A 5CQGA 2CFOA 1Y1WJ 1J75A 3OYKA 4LLNA 2DMQA 9ANTA 1UAAA 5J4YA 2EOEA 3HPZA 4LTYA 1YZ9A 2YT4A 2KIQA 4JI6E 3L2CA 1VZ0A 3E97A 1R9TJ 4B09A 2LUQA 1FP1D 1KU2A 2EINH 1WFXA 1JK1A 2LY2A 2JWOA 1MDMA 4MTEA 2R7TA 3DBHB 4LFAE 1HNWE 1ETYA 4NXNE 2EH3A 3MFKA 3AG1H 4PJJA 4YFNF 3MD2A 4RGSA 4IOAF 1WH5A 4IRHA 3R4KA 1ZARA 4ZZDA 3ZOBA 1DU6A 5ILVA 1NCSA 4E7IA 2HVSA 4M3BA 3RKQA 2LKXA 1IBKE 4M74A 4RB0A 4GFBA 4B3AA 1V5FA 2KDOA 2M7BA 2WC2A 3K9TA 3RI4A 4BJTA 3U9GA 1FIAA 3DEWA 5LRSA 1TWGJ 3MCZA 3K4BA 5AASA 2DA6A 4BQQA 3GZNB 5D6EA 2EM7A 3CMEI 4HEA2 2YS9A 3BR3A 2Q0OA 2HGHA 5EDNA 1OR7A 4PSXA 4X6AJ 3KYDB 1N75A 2RAEA 2K3PA 2DMYA 4DUYE 1G2FC 2PJRA 4IHWA 5AE1A 4PJLA 3BJ6A 1YPNA 3BLYA 1XGNA 3QODA 4XRMA 3IP4B 2XPUA 1BIBA 5AIQA 2WAQN 3IL2A 1ZKGA 3Q5FA 2JA6J 2EOFA 2IGOA 4HZFA 2K7LA 1SD4A 1ENHA 2A3SA 2WBSA 3K1MA 3WTXC 1B72B 4WX9A 2EFOA 1XGOA 3DTKA 4OIRF 3LSPA 2ZKZA 2FA5A 4G6QA 5F6FA 3CTAA 4A3EJ 4EJUA 5KNLA 1BIAA 3P7NA 1ETKA 1I1SA 1BR1A 4OAYA 2V6EA 2ODRD 4G12A 2KRHA 1RR8C 2DK5A 3HKZA 5J8CA 2BZTA 1SD6A 1WJPA 1R49A 1LUJB 1VQ7I 4CSWA 2JXPA 2LUPB 1WRJA 4R2RA 2FNAA 2EA2A 5TISC 1U6GA 1RETA 3RJPA 2ZJRF 2VIXA 2E19A 5KK1A 5KL6A 3I4MJ 2MBFA 2HQRA 3BC8A 4XKBA 5IOZA 2XSDC 1FMVA 2JN6A 2BVLA 2CWEA 2XAQA 2W4SA 3KFWX 3WODF 3G6EI 1I5ZA 1G2DC 1KYZA 2KISA 1HKTA 3B6AA 2UUZA 2HU9A 3RKYA 4EJWA 3GCMA 2Z9OA 2EFQA 2V88A 2LK2A 3OL4A 3O8GA 2QUFA 5GPAA 1IC8A 1BL0A 3MAJA 5L3CA 2Y31A 3W2AA 2VBWA 2V87A 3DXJF 1F43A 1Y0NA 3MZHA 4ZTJA 4WFTA 4P5OA 4AC0A 2UU9E 5KL2A 4PGGA 1IG7A 1KGSA 3CDHA 4KISA 1S7AA 3DPLC 1O4XA 3OOPA 1VI0A 4ITVA 3KP6A 5DNYA 4DV7E 2CS3A 4MLQA 3R61A 5GAEJ 3Q3SA 2CYYA 3K6QA 2LR8A 2VJIA 3WE3A 2CMPA 1P7JA 2JMWA 4XLCA 3CCSI 1YLFA 2DXIA 1R36A 3ESWB 2R76A 2QQBA 4KN4X 3J7AG 4M6XA 1VF9A 3K0LA 1X19A 4HTGA 4O6JA 2QBYA 2WZOA 5KAIC 1WJDA 4RLFA 2W57A 4YHHE 4M9SA 4PFOA 3H0DA 1K61A 4QTRA 5F0CA 4XSZF 2D5VA 2IT0A 4IS1C 2AS5F 2ID3A 3VYRB 3P5JA 2J5OA 2TRTA 3WE2A 2CSHA 1ACIA 2E1CA 1WHUA 2EOMA 2JOXA 3DJWA 3IH2A 2YTFA 3PQKA 3THOB 4E6KG 1MJAA 4DV1E 2VBXA 3PM1A 3PO2J 2PMHA 2AO9A 2X6YA 2FTXB 2JVAA 3AKZA 4JI2E 3WTTC 4G6TB 2JVHA 1T56A 3LSIA 1D5VA 1HXDA 1ZREA 3R0JA 5FD5A 2MABA 5DCMB 2W25A 1HW1A 3M1CA 2EMWA 2MG4A 2B9DA 2NABA 1E2XA 2VJ5A 2DBBA 2LSOA 2QCOA 4KNYA 2JR1A 1ZGJA 1Z7LA 2LRSA 2EV6A 2KRCA 4CCKA 1JJ8C 1RQ0A 1RKWA 4HW0A 2H1KA 5FKLA 4F92B 1IDYA 4UUVA 4C3IJ 3CO6C 1IRFA 2CG4A 5F1JA 2E1MA 1X3ZB 4O5GA 1I6XA 2HOEA 1XB4A 2X1EA 2DSYA 4XN0A 2DB2A 1HNXE 2IRFG 5K5RA 1LVKA 4MQ9F 1B59A 5C4JJ 4FK5C 1XMKA 4F9AB 4KIFA 3I0TA 2L2NA 4IQJA 2YTIA 2LY9A 2WB1A 2EMHA 2FE3A 1NK2P 1RIOH 3HHHA 1ZR9A 3IAS2 3QPHA 5J4VA 3OYIA 2UZKA 4ESJA 3OYNA 2ZSIB 4LF9E 4PSWA 2EPCA 3TW6A 5BNGA 3WG9A 1QNTA 1BI1A 1MBFA 1S6LA 4W1UA 2UUBE 4JYAE 1MW7A 2L6MA 2VXZA 4DR5E 3ZR8X 5ICFA 3BWGA 5IWAE 2EOJA 4HYEA 3KLNA 2EMAA 1ZRFA 3F9KA 3SZTA 4EJOA 1SR9A 2EQ3A 3SZPA 4GZNC 3VYTB 2ZXWH 5F64A 2IA2A 4XKCA 5DM6F 2V6CA 1BBYA 2M5WA 4JYKA 5FRMA 1A36A 3CLQA 3Q0UA 2EPOA 2EIKH 2LRDA 4CCLA 1ZBQA 4E70A 4U0WA 5E3NA 1ULYA 2L2OA 3M07A 1K7AA 2FMLA 3HTUA 2ECCA 1YIJI 3BY6A 2LCEA 4F6NA 1S8NA 2YTPA 2HKOA 1RC9A 3HM5A 1X49A 5AE3A 1U9OA 4OIOF 2XGDA 1MH4A 3NWSA 1Y1VJ 4WSGA 4RGUA 2WAFA 4XR6A 1UFMA 3GMEA 2DMPA 4F7ZA 4LB6B 2HR3A 1Z05A 3KPHA 2XSJC 4BHCA 3P9KA 2JPAA 1EA3A 1KQ0A 2W85A 4JV5E 4L0YB 4QLCU 2GM4A 1DU0A 1BJAA 2QA4I 2EM4A 1ZG3A 3W6VA 3F8MA 4EGYA 2LOOA 1MD0A 4IHTA 2LNBA 5IT9K 3JAMZ 2GBYA 2UXXA 2Z3YA 3REOA 4HNUA 3PSFA 2KFDA 3OWTA 3DWLE 5DD8A 1X1PA 3U1KA 1MH3A 5KL5A 1IRZA 4BCAA 3I58A 4IHYA 1OPCA 1FOKA 3TDUC 2R7UA 1TF6A 2VONA 2RNGA 3FKIJ 1BI2A 4DV6E 2K4VA 5ILUA 4BUPA 4EV0A 1SD5A 2CQNA 2R4GA 4DYCA 3H5NA 5B1BH 2QQ8A 5D5UB 2BBYA 3CP8A 4BJ5C 2RKHA 4YRVA 1LQ1A 1LDJA 2ME6A 3UR3C 4L5JA 4FQGA 4UY8I 3S8PA 2JWTA 4LITA 1ZGWA 1STZA 2L2KB 3MN2A 2ZMEC 3IV5A 3ADJA 5KVRA 2EWNA 5E1WA 1DGRM 1TN9A 5IT9C 3D5LA 4V2FA 1MKMA 2EN4A 1HSJA 1AAYA 1X6HA 4KN7X 2B63J 2UWMA 2L33A 2M4GA 3DTEA 3FXUA 4ZTFA 1A1LA 4EQQA 3LA3A 5HDKA 4HF2A 2DN0A 2EPUA 2MLKA 3M99B 3ISPA 2EMLA 3HSEA 3BG7A 3N97A 4HF1A 2F48A 2EP3A 3A01B 2MFZA 4CYCB 1EF4A 2J7JA 4XLAA 2A6EF 2DDAA 2VUMJ 2CPNA 4C9YA 4A12A 4OIQF 2H09A 4CZZA 3BROA 4F3QA 4D7NA 2JOBA 1LNWA 4A3BJ 2V1XA 2W00A 3KEOA 5JLWA 3LLHA 3F8BA 5EZGA 4F9CB 3FMSA 2LFBA 5CPRB 1QA6A 1UELB 4KDPA 3DU5A 3RKWA 2ZJPF 2DOAA 1HW2A 2LMZA 2HJJA 2WAEA 4LF5E 3BOQA 5D6FA 4HF0A 4LK1F 2EPZA 1YG2A 1YJWI 2LT7A 3U21A 3G4SI 2VRDA 2EL4A 4B48A 2PN6A 3IWBA 1OJLA 1XGMA 4KA4A 1AHDP 2EMXA 2K9MA 2NVYJ 2OAZA 4HV6A 4AYBN 4C2MJ 1YX3A 1T08B 1S3JA 2M2EA 2Y0SA 3MZYA 1XMXA 1PJTA 4X1EA 2ZJ2A 2A25A 3T1YE 3RYPA 1X2NA 4R2QA 2HWVA 4BBSJ 2EOZA 3S3NA 2A61A 1FYKA 2R5ZB 1TT0A 3T8TA 2EFWA 3HTSB 2KIFA 2W84A 3I4PA 4XRSG 2UXDE 1BN5A 4XICA 1BOAA 2VXDA 5F08A 4M3GA 3K4MA 3M8FA 5BMZA 4KUMA 1TQPA 5IP9J 3OYDA 1GQEA 2M4IA 1YIOA 3HZJA 3HYIA 4JQFA 5K5QA 1STUA 4M6VA 2MA3A 2V1DA 5KHDA 2O03A 2BXZA 2PMUA 4JX6A 2ZSHB 2VQEE 1A1JA 2IGMA 1VQ6I 4AIDA 5EEGA 1JGGA 4XLNF 2E72A 1W4MA 2I5UA 2DT6A 2NRAC 5FB2A 1B6AA 4UVCA 5LHGA 4IO9F 2HQ5A 3KZYA 4RB1A 3LSJA 2RC4A 4NHJA 1X4OA 2Q2EA 1GUUA 2WCC3 4LK0F 2JRMA 2X4HA 3L7WA 5LD2C 2OCCH 2A6HF 2GXAA 2KHXA 5KL7A 3SFIA 2KZVA 3JTZA 4HRIA 3WGHA 1OFCX 3LFKA 2IAIA 4G7OF 2M1SA 3JAMC 3L00A 3T0YA 4BH9A 1D1CA 1A04A 2K40A 2EJRA 2DTRA 2R7QA 2XRLA 3H1CA 5AONA 3WTSC 4J19A 3LSHA 2KL4A 1PUFA 1HC8A 3BGHA 3OSGA 1OCRH 2EZ6A 5FJ8J 3TP3A 2HQAA 4RAFA 3JRBA 3OS0A 1XN7A 2VQLA 3HRTA 2CQKA 3BJAA 2VPLA 2X9DA 4DR2E 1W7PB 2XF7A 3KETA 4F91B 2F5CA 4GKKE 3RPQA 1ZGAA 3IWFA 5F27A 2Y9ZA 4DR4E 3DF8A 5CYVA 2JVGA 5J1UA 2CQ7A 4R2PA 4L18B 3BBGA 3O3KA 1HF0A 4G7HF 5DYMA 2OTLI 2E35A 2VOOA 2R93J 4D5FA 1BOBA 4A3JJ 1OKRA 2BY0A 2RTXA 3CCEI 5H6RA 3CCLI 2NVTJ 3ADGA 4ENNA 1IO2A 4YIFA 1IMUA 5M3FJ 4QPOA 3IRRA 3COAC 4M71A 5IY5H 5DS9A 4J01A 3WGGA 4EJTA 2WBUA 1FSEA 3OYBA 5A6KA 3VODA 3PIOF 1VQ5I 2JY9A 4J8ZA 1OLTA 1WPKA 4A3IJ 4G94A 4EEFG 2UUCE 3WTVC 3OYFA 4PCQA 2D1VA 2O61A 4B44A 4DV0E 3JU0A 3RPUD 2EORA 2MH2A 4XLHA 1C0WA 2EPMX 3DFGA 4WPYA 4R2SA 5LHIA 3GLLA 4V2GA 4U0YA 3KZIC 1YS7A 4CCNA 4DGWB 1MMSA 4AIHA 3E5XA 5D4SA 4R2EA 1MMGA 2EFNA 4LIUA 1GV2A 1MNDA 2ZMEB 4LG3A 5D8KB 4B8XA 3RIRA 5AIPA 4DBQA 4E7LA 1MGTA 2Y30A 4MO7A 1S7OA 2XAUA 3IC7A 5GADJ 5C44J 5A69A 2HPMA 2P6SA 1S5LC 4XKVA 2P5LC 3LMLA 3GFIA 3ZN1A 1WSUA 4AM3A 4M9ZA 3HHGA 4M0VA 3FIGA 2DLLA 1B1BA 3LMMA 4E7JA 4JI3E 2XC7A 2EQ0A 3WGIA 4BC9A 4XSXF 1Y0UA 2EPFA 5H6QA 1VNDA 4I09A 1LLMC 3L2VA 1MSFC 4WXHA 3CLOA 3BCBA 1FKAE 1OYIA 2GQQA 2CSOA 3VDXA 3EUHC 1B72A 2ICWG 4LJZF 2K85A 1SVOA 2JJ7A 3WHCA 1P6RA 4BS9A 4HX7A 3K4JA 1IUFA 1UHMA 2A6TA 3BCAA 1QRYA 3DV8A 3HGGA 3QPLA 3CDIA 4G9YA 4GGGA 4XNFA 4WCGA 4HG2A 3G2BA 4LFBE 3C2GA 3ZRGA 4Y7NJ 1RUNA 4PJNA 3ZMSA 4DYQA 2EM5A 4ENJA 3CUQA 2FOWA 4KYWA 1X3UA 2L3JA 3B02A 1K4TA 1X1DA 2XKPA 5IV8B 4JK1X 2GPIA 5FKKA 2H94A 4GKJE 5A6BA 2R0QC 1BC7C 4CH7A 1YOVB 2DMIA 3SEQA 1JKRC 4GRIA 4D9JA 2LD5A 1XMOE 1R1UA 2MSYA 5M3MJ 5HOOA 4GYGA 4HQEA 1FBQA 1OCPA 2FBIA 2FQ3A 3FIWA 3PUBA 5BQTA 5LL6R 3OIOA 3UK3C 2IP2A 4FT8A 4OU0A 2ZFWA 2ENHA 1K79A 2QKMB 2E71A 2IGKA 4UVBA 1R5ID 2G7UA 3HRMA 2ETHA 5EEHA 5LGUA 2NNYA 3C6KA 1G59A 4LG0B 1PDAA 2M7QA 2H1LA 3E1SA 4L9JA 4ZYAA 1X2MA 3KE2A 3ASNH 4UUSA 3MKYB 4W97A 3EPLA 3ECRA 2KPMA 2DGCA 1WKMA 4ESBA 3ONQA 1XMQE 2ELHA 3SEZA 4HV5A 4J00A 5J6XA 2MD5A 1LJ9A 2VKEA 1LE8B 5CVIA 4E7ZA 1K78A 5TRDA 1X48A 3DPTA 2EPXA 1ON2A 3CCRI 3G3ZA 1K4SA 3FDYA 1HKQA 3FHZA 4LF7E 2EMYA 3JW4A 3K4NA 2QQAA 3PFIA 3LQQA 3OL3A 3C4TA 2EIMH 1XG1A 3VSLA 2DIXA 3HJEA 1ZBTA 3E7LA 2VE9A 2PFBA 3H5AA 1E0EA 3T8RA 4IHXA 1X58A 1RPWA 4IKFA 2PBIA 4D7MA 4NQWA 1U0JA 2GZWA 2L9RA 2L0KA 1D0YA 4X64E 2HVQA 2L7MP 3QYEA 2NVXJ 4RH8A 1H0MA 2E5LE 4DR7E 4MFEA 1GVJA 2BYVE 3TP0A 2B7EA 1Y8QB 3CC2I 2HZDA 4I2OA 2LBSB 2IS6A 3NEUA 2HYJA 1RRJA 5IPAA 2QSFX 3E6BA 1SFUA 3HOVJ 3FMQA 2LBFB 2VKVA 3Q9VA 2ECBA 3B6CA 4DYRA 5BOXA 1WVRA 2L02A 1DGCA 3DEUA 3TO6A 2GA2A 3FBIB 3T1HE 1T33A 2GIZA 2LY1A 5FFXA 1XS9A 3GBGA 3KP4A 5F0FA 2MH9A 2EQ1A 5GPCA 3HRUA 5CJ9A 4KMFA 3F8NA 2F4VE 2NUFA 4KWYA 1ZQ3P 4F9BB 3PQJA 2ZFUA 1Z6TA 2KKOA 1HLVA 1JHFA 2L01A 2HOTA 4U7DA 3CCVI 2ZXHA 2LO3A 1EH7A 2YZTA 1T98A 2QWWA 1YI2I 5HVQC 3OY9A 5FLXC 5E79C 2VC1A 2QLZA 3LAJA 3CCJI 3SDGA 2E5ZA 3C2BA 2CUEA 1R5GA 4DJAA 1IGNA 4BBYA 3BR2A 1OR7C 1K83J 2KP6A 5B5EC 2UXNA 1UILA 4OX9E 3C7JA 1S9HA 2VOPA 2EMFA 1LDKB 2LDUA 5DTDA 1BW5A 4M9VC 4E4HA 1TP4A 4BAYA 4Z6YA 1O3RA 1BR2A 2VBYA 2JSPA 2CQQA 2DT7B 4IOCF 3LOCA 2X1DA 1UHZA 5L3EA 3VK6A 2M0MA 2XV4S 2A5YB 5K5OA 1TWHJ 3K7AJ 1UB9A 2R7OA 4KMUX 1DDNA 2FOKA 2ISYA 2VQCA 2YTDA 2QVOA 2K3FA 1Z67A 2TCTA 2RV8A 1QU3A 3IWDA 4Y15A 3W2WA 2N8GA 3D0SA 2NS7A 4LLLA 1J7KA 1PKPA 4DV4E 5E3MA 2IVMA 1AH5A 2F4MB 4XIDA 4B1RA 1KQ8A 1V55H 4U87A 1VTNC 3Q0VA 2N3GA 1NHAA 2V1NA 4ZYDA 3HDDA 3KYLA 1OCCH 3THNA 3ZMTA 2LYCA 3L09A 2AXLA 3ABKH 2LLKA 3ERED 5JVTA 3MHHC 2DLQA 3HPGA 1QVTA 1D0ZA 2EZLA 5JHFA 1YRNB 4CUGA 3O8HA 1MNEA 5K1YA 4QSHA 4HEIA 2BV6A 3LA7A 3RTRA 1P4WA 4EM2A 1MSEC 4R8HA 3BPXA 1VQKI 3QPTA 1FTTA 2D2WA 2EBIA 1GVDA 4OOGC 4B3RE 1TTYA 2L3CA 5D5XB 4B3ME 2DMTA 2YTJA 3HUGB 3RZOJ 4DZJA 2HKXA 4NBQA 5HODA 3SQNA 1YX5A 1QZZA 5HNFA 1RNLA 1W0UA 2VBZA 5M5YJ 2QYOA 4FASD 1D0XA 2HTSA 4OINF 3ZQLA 2CGPA 5D5VB 1ZHFA 3ECOA 3GFLA 2CU7A 2XDVA 3H3ZA 5EGOB 4LF4E 2NS8A 3VYYA 1QGPA 4UV9A 3ADLA 2V1UA 3JTHA 4DW6A 1SD7A 3S2HJ 2YUSA 4H4KC 1FBUA 2B7TA 3C6MA 2XPVA 5BS6A 5E8IA 2GIVA 4UB8C 4MQVA 1GXQA 1ZAAC 1VQNI 2YPRA 4CZCA 1I6HJ 2ACJA 3C18A 2IJLA 3QWLA 3H3VK 2DW4A 1IV8A 5GAGJ 5B1AH 2DDBA 2L4AA 1P7IA 4L9VA 1O0WA 1KU7A 1RZ4A 1L3LA 2W1OA 4HLXA 3J7YJ 1YQAA 3FM5A 3GZ5A 3SZGA 4CCOA 4Y17A 1UCRA 3KP5A 3ZQQA 3M3YJ 4WYQB 2QF7A 1JTYA 1O7FA 2XRNA 1RUOA 3FXRA 1RR7A 3VSKA 3J7AY 2DJIA 2EILH 1Z6RA 1MMNA 1FPQA 3CJTB 3SXYA 3V8KA 1JUMA 2HDWA 2IA0A 3DKYA 1FZPB 3JRHA 3F22A 2F5DA 3GX4X 3EPJA 3ZGKA 2M45A 3TOBA 4CO8A 5IP7J 3EPKA 1QVUA 2BGCA 4Q48A 5L3DA 4BC7A 4JI5E 1BB8A 3C2HA 3HKZN 1MBEA 2W24A 1OCZH 3QP5A 4Q47A 3MKWB 4CGZA 3GTQJ 1ZU1A 1ZRDA 4ESFA 2FEZA 4Y52J 2HGCA 1RC7A 4KIGA 5A2QZ 3BJOA 2O3FA 1ONVA 2DOFA 1DGWY 4TV7A 3OR1C 3J80Z 5H20A 3A01A 3EQ1A 2EMIA 2Q8UA 4IF4A 4CYCA 2OU2A 3CJQB 1LVAA 2B0LA 2HOAA 1U3EM 2P5KA 1LFPA 3DP7A 1Y39A 1ETOA 3S17J 2ENAA 2FQ4A 2K02A 1KYQA 2K9NA 4XRFA 1T38A 4OAZA 1U2WA 3GF2A 4D1QA 2E1MC 2C6YA 4IHVA 3L2RA 5A6AA 2Q1ZB 2XF6A 4I99C 3V4GA 1VQMI 3FM3A 2VJJA 2Y69H 4M30A 3P9CA 2E1NA 2GOXB 1OMIA 1X1BA 1MDMB 2NXNB 1LFUP 1BJZA 2X48A 4AVPA 2NVQJ 2CO5A 5LFAA 3BZCA 2R7ZJ 2IS4A 1X47A 2V26A 4I0BA 2NA2A 2MD0A 1YUJA 3DLLF 3GVAA 1R1VA 4CICA 5E17F 3SYTA 3E6CC 2EPRA 2EV5A 2ELKA 2AHQA 3U2RA 2LMDA 3E6DA 1P47A 3ZQGA 3FHNA 5HDNA 2F5VA 2LH9A 2R5YB 1GV5A 2EOHA 2JA2A 2OF7A 3TO9A 5ICGA 4BE1A 4LU9A 1WWXA 2P81A 2Y9YA 1HDPA 3MZ8A 3OS2A 2IS2A 2WBTA 2VASA 3DBLB 1WJ5A 4MHGA 3VYXA 2ZNZA 2W82A 2COBA 3A03A 3FISA 2M9AA 2PJRB 2GOMA 2LE2A 5E3OA 3WTZA 1MIJA 3ZMZA 1IQSA 2OBPA 4UB6C 2BW3A 5GTIC 3HOWJ 3L2WA 2LV2A 2E1OA 4WXDA 3SHFA 3S15J 4IX7A 4M2ZA 2HTJA 2BHYA 2VQGA 2DODA 1FTZA 3IKTA 1T0FA 4X0GA 2NNNA 2FD5A 2STWA 2K7IA 3HOYJ 5ERIA 2MW8A 3KP7A 1SEUA 2Z2SB 4IZZA 4C2UA 3S1MJ 4DKKA 1UHSA 3BZKA 3AV0A 3TBIA 2H6CA 3FXKA 1V4RA 4Y33A 4BE0A 2UUAE 3OS1A 3HGYA 4AIJA 5TJJA 3S3OA 1FYLA 2NOGA 1B8IA 3AUZA 4I0AA 3DKWA 2M34A 2P8TA 3F3XA 4LGWA 5HNHA 1YYKA 1MMDA 2DFEA 1FOWA 4XLFA 5KL3A 1A1KA 1J09A 4U0VA 4L5EA 3QRFF 1FP2A 1W7PA 2WB1N 2YSRA 1EH8A 2QKLB 4GEQB 1IQOA 4MFDA 1R22A 2RGVA 4RGXA 5B66C 2I9IA 2X1CA 3PSIA 4S04A 3NWTA 2VPRA 1T39A 1LEBA 2GLOA 2CW7A 5E8GA 1SFKA 1SANA 2LC2A 1H8AC 4R8OA 1D3YA 1W5SA 3GWZA 3RKXA 3CO7C 1JT6A 4A5NA 4BQAA 2LP0A 3ELKA 2EOIA 5K7FA 4R79A 1FJGE 2KJBA 5FROA 3HOUJ 2EZIA 3CESA 3J81Z 1SFOJ 2FGGA 2N8XA 1ZR2A 2VE8A 1SAXA 3OIPA 1T6SA 4I01A 3S2WA 2Z33A 2NUGA 3I5UA 3QYBA 5E3LA 2V79A 1WCMJ 2L9VA 3LWFA 4A6DA 2CTDA 4RBOA 1XSDA 2VLAA 1H89C 1W5TA 4XLEA 3ERMA 3KLOA 1FEXA 4HX8A 5FRNA 2N3HA 2CW8A 3FXQA 4KT6A 1GXPA 3S3MA 2EOXA 3BG3A 3I64A 4P78A 4JI7E 4BXFA 1JI8A 3EUAA 1DP3A 3LSGA 1MMAA 2K4JA 4QIWN 4II3A 1SVLA 2Z1DA 4YIIA 3A0HC 5A6JA 1Z1BA 3K2ZA 3FF5A 1F5TA 3OYGA 2D9HA 3E5QA 1G4DA 1QPMA 2FJ1A 2YSPA 2FBKA 4KIBA 3G73A 2ESHA 4NZVA 3JR9A 3BR5A 2IEKA 3KX2A 4E7KA 2ZNYA 1KQ9A 5EF6A 1ITYA 1TWAJ 4WK8F 2XAHA 4P1WA 4D0PA 1POGA 4JI4E 4IHSA 1TWCJ 1XGSA 4IQ4A 4AUXA 5IP6A 2HYFA 1JKOC 1F1ZA 3VYUB 3KP2A 3ABTA 3AG2H 3I9V2 1MBKA 3F8CA 3GTJJ 2V8QB 4MLOA 2IS1A 3JCUC 1U5TC 2FU4A 2ZB9A 3R6SA 5EG0B 1CF7B 3EDPA 4ZC3A 4RB3C 4N9HA 1BI0A 4F93B 4K2EA 2E1MB 3PIPF 2HEOA 4YELA 5E1XA 2RQQA 2KIUA 1UMQA 1HOMA 3ZQIA 5CVRA 4CCJA 3R60A 5GTHC 3NAUA 2OA4A 1DQ3A 3QOEA 2EM9A 3B73A 2XVCA 1K6YA 5TGTA 3JAMK 3MKZA 2OZ6A 5ICEA 4X8WA 4P9FA 5HS9A 5IYCJ 2GHFA 1HSTA 2MDRA 2OUMA 1W1WE 3BR6A 5D4RA 2VJ4A 4M3DA 2AXTC 1D8JA 2R92J 1MJ9A 1D5YA 2EB7A 2DPDA 2CW0F 2CV0A 4BNCA 1YYOA 1SMYF 2EE8A 4KZSA 1Q1HA 4OMYA 4XK4A 3V42A 4ZYEA 2ADUA 3HRSA 2IXSA 4PUSA 5AE2A 3JRCA 2WWYA 1BBGA 1NH3A 2AQEA 3HG9A 1N34E 5F1RA 4HNVA 1ERDA 3OYJA 1QU6A 1WJAA 2M9HA 2A07F 5J8FA 2RS7A 5ADZA 4O5VA 2VE7C 2R7FA 3JSPA 3HOZJ 3GEZA 2F4OB 4L9TA 3W3CA 1PDNC 3KP3A 4EM1A 2L2MA 4DIQA 1LE8A 2CH0A 3ZXSA 1XD7A 3F6HA 4E7HA 2RQLA 2RSMA 3I71A 3ULQB 2JPBA 2L92A 4BBRJ 2EV0A 2X6WA 4BY1J 4L8NA 5LRRA 4FCYA 2EL6A 1JUPA 4I7HA 5CVUA 2L8TA 2XB0X 3ASOH 1J26A 2E36A 1DPUA 2GA1A 2K27A 3CC7I 4C2TA 3CD6I 4FE7A 3CMAI 3FK7A 2B7VA 3PJRA 3LSMA 2HHHE 3JTGA 3JRIA 3LSTA 3PO3J 2EOSA 2F2EA 4XL9A 3JREA 2Y0SN 3J81C 1JK2A 4NHRA 1T4LB 1A6IA 3WTWC 3P9IA 3N4MA 1X3WB 2E7XA 2YTOA 2HQNA 2QGUA 3KEYA 1TQMA 4A3GJ 2E5NA 1GZ6A 2XAGA 1KZHA 3QOPA 5IYBJ 4BHPA 2HDCA 2BBGA 1VQ4I 5HLGA 1TC3C 2OTJI 3I59B 1I3QJ 5CKTA 3ZOQB 1GTKA 2YSOA 1I39A 1R58A 4B3TE 4RGRA 2QZ8A 2STTA 2UXBE 4QPQA 2YRKA 2FX0A 3L2UA 4Y3OA 2M1BA 1FWZA 5M5XJ 4A3MJ 1OCOH 1T8IA 3MMYB 2RS6A 3ABUA 3MQ0A 3OYLA 1JGSA 1SC7A 6PAXA 1PJSA 2EN3A 3E6MA 3I3LA 1AKHB 2BOLA 4XORA 2PMZA 4JP0A 2V4JC 1V5EA 3M7GA 4U88A 2F6CA 1JKPC 2Y2ZA 4EMSA 2L54A 1S29A 1ZH5A 2DK8A 4A2UA 1R7JA 1VQ8I 4IEJA 4A0XA 1P4XA 3WTUC 1P92A 5H2FC 3AL0C 2P0WA 2EM6A 3TKYA 4BHBA 3H0GJ 2MGQA 4EGZA 5E1ZB 1FNNA 1FBSA 3BT9A 3PFYA 3KYCB 5J1YA 1F2IG 1AOYA 2XUBA 1P4AA 4N4OB 3G1OA 1BBOA 2KONA 3WG7H 5M5WJ 2RSIA 2BY1A 4HSTA 1IXRC 1R6RA 5JHUA 3BQZA 1UBDC 3QQAA 4ENMA 2GXBA 2D1HA 4K0KE 3E5UA 3S16J 1HQCA 4X66E 2EN1A 2K5CA 2Y48A 3CUQC 2PG4A 2DLKA 1IW7F 2V89A 2YTQA 3ROUA 3MSWA 2ZXIA 4BEHB 1CGPA 4DR6E 5JI6A 1YW8A 3V7CA 1V5GA 2K9QA 2YWQA 1NK3P 1Z77A 4R2AA 1YRNA 2VB6A 1N33E 2CUJA 3HB9A 5FFZA 4F6MA 1FX7A 2HS5A 2VN2A 1YE9A 3MHSC 1TNTA 1U5TB 2CQXA 1Z7UA 2K86A 2DJNA 3OR2C 3QU3A 2O6GE 2L5QA 3TEDA 3BTJA 1X5WA 5KAFC 3LSKA 1E3HA 1YITI 2E7WA 5B3SH 3ZCOA 4DUZE 4NC7A 1JHHA 3FXJA 4Q4ZF 4GO1A 3CF2A 1AU7A 1X6FA 2BEOA 2PLYA 5EGOA 3BG9A 3F21A 2E2IJ 1JXSA 3DCFA 1U78A 1N25A 1EKEA 2R7XA 4O43A 1R4NB 2FSWA 4AWXB 2KMUA 1YJNI 1HDDC 2EJ4A 3H09A 2QM3A 3HOSA 4ANJA 3F72A 2DYSH 3IWZA 2RDPA 4A3LJ 2YU5A 2JTVA 4AIKA 2ADRA 4LD5A 2DAOA 1FMWA 4BJ6C 3IRQA 4YIRX 2X51A 3EPZA 2ELJA 1QHHD 1FYMA 5HS7A 3PNYA 4L9NA 2VI6A 1USTA 2EMZA 2BY2A 2Q2EB 2P7CB 5FD6A 4X65E 3PL8A 3ZQFA 1JUSA 1UN6B 1XC5A 5DV5A 2HXIA 2X6XA 1HA8A 4I8OA 3BR0A 1OYWA 2F5EA 4P96A 1YTYA 3EYIA 1XPXA 1A31A 1Y8RB 4ZZLA 1QO0D 2RQPA 2JA8J 5CVVA 5FLXK 1B9NA 2ZXJA 1GLNA 1IV6A 3DLAA 5ICCA 1A1FA 5JVGF 2YRMA 4D5CA 1X3CA 4JOMA 4Y13A 4KICA 4B3XA 2WAQA 1IN6A 4MIMA 2EPAA 1G3WA 2FMYA 5D5WB 3G71I 3S2DJ 2H36X 3RMPA 3IUOA 3BIDA 4OOIA 1Y6IA 5DUIA 5DCMA 1PJRA 3OYCA 3H36A 3CDLA 1TF3A 4MNUA 1UZCA 1T2KA 4DR1E 1I3AA 2KHMA 3S14J 1N3GA 2EQRA 2BXYA 4CDGA 2R7VA 2V7FA 3EUKL 1HCRA 1GHCA 3HBLA 3F0CA 1MBHA 3ABLH 2YTEA 3ZMVA 5IYDJ 4N4NB 3K4KA 1T4NA 1KA8A 4R1HA 1O3QA 4G6DA 2JPCA 4AVZA 3V8JA 2XAJA 2LF8A 3TGNA 2LVHA 3FX3A 1TWFJ 3M1EA 4BL0B 1WJBA 2RVCA 4DV5E 1YW9A 2KDZA 2JQ7A 1A1HA 1E17A 1FLIA 3VPRA 4KFCA 5F04A 2DU9A 2DA2A 2LKPA 4MTDA 3FK6A 3CQZJ 1GT0C 2Z5UA 2HFHA 1J59A 4Q5SF 1DPRA 1A5JA 3GFMA 1HW5A 4A3KJ 2DCEA 3SDBA 1LFBA 1XCBA 4I98B 1V3FA 3K4LA 3HL2A 1W36C 5F0HA 1A35A 1BA5A 2NOJB 5KL4A 1VQLI 2R7WA 2R5YA 2MC4A 4ZYHA 4TUGA 2P7VB 2MDGA 4G7ZF 1PVEA 2DA3A 3BF2A 2LVSA 4KITB 1DUXC 4HBLA 3VYSB 1Z3YA 5HLTA 2JP9A 4XRSA 4UUTA 1JKQC 3WHBA 3KZZA 3UKGA 1KJKA 3R0AA 3CCUI 4DBRA 2ZJQF 2CUFA 4M9XA 4FETA 4N0BA 1WI9A 2FF4A 3AL0B 1TBXA 2PX9A 4JX5A 4CXFA 4RHBB 1WHNA 2FNPA 4A3CJ 1WXRA 3MKLA 2LREA 1T4OA 1IF1A 2VL8A 3LFUA 2YPNA 1AWCA 3ZMUA 1N77A 1A6QA 2EFPA 1F4KA 4GDFA 4A6EA 1YYVA 1YSAC 2GLIA 2M8EA 4XN3A 3KCCA 1KU9A 5DM7F 3GUDA 2JT1A 5A6BD 2NAZA 3CC4I 3GTOJ 3V8LA 3M9AA 2JA5J 1LB2A 2ZCWA 4R2CA 2EOYA 4Q35B 3FBNB 2E2JJ 4PK4A 3TQNA 1MZBA 1L4SA 3TOAA 2M3AA 4L5IA 4UXNA 2FBHA 3HSFA 4MGRA 3CUQB 3A0BC 5HLHA 2CRGA 3C3WA 3AG4H 4RAZA 1IDZA 1TL8A 3AG3H 3GO5A 2KLOA 4A93J 2IW5A 4RDUA 3S1RJ 2XF5A 5LEKA 4B3SE 4PFPA 2W48A 3OYEA 1JE8A 2R1FA 3IH3A 2I10A 3BTLA 4WWCA 1IRGA 4XM3A 2HI3A 3HC7A 1G2HA 2EM0A 4S0HB 3VOEA 1B4AA 3ZQCA 3S1NJ 1WHQA 1ETQA 5DUKA 1DQUA 1MNMC 3KWRA 2H8WA 2DRPA 3CP2A 4NB5A 1R71A 4AD9A 4UUSB 2JK3A 3K10A 5FO5A 2IPQX 3ZP5A 2F5FA 1O3SA 4DR3E 5CQEA 2DTZA 3GTLJ 4BDZA 2AQFA 1TQIA 1TW2A 3GTGJ 1ZLKA 1K78B 2IBDA 1J0RA 3FXMA 3Q0WA 4M73A 4JBAA 1O3TA 1IBLE 3Q9SA 5E18F 2K9SA 3I4NJ 2ELYA 1Z91A 5D8LB 4B47A 1FJLA 4F2JC 4LOCA 4R03A 3DQVC 2LTSA 3GW2A 2Z99A 3BDDA 4Y4RA 2LJHA 3VHTB 1BR4A 2P5VA 1XSXA 2MKNA 1SVMA 3UNGC 3FWEA 1WJFA 4NQWB 2EN8A 4NC6A 1H9TA 2EPKX 5BPIA 2EIJH 2EN6A 4X9JA 2DA1A 2DI3A 4BACA 2HZTA 1FSHA 4RLQA 4HNTA 2CFXA 4R2DA 2OC6A 4UHTA 4LFCE 3W6JB 1B9MA 1WQ2A 1X1AA 1IN7A 4CCMA 2FUG2 3OV8A 2WY7Q 1ETVA 1ZG5A 3GTMJ 2Y0MA 3N05A 1X4PA 1XDSA 4MLVA 5IT9Z 1ZYRF 5C4XJ 1X6EA 1T95A 4A69C 1RI7A 2KQRA 2F4IA 4QWQA 3H9QA 1L0OC 1J9IA 1PP8F 2DFIA 4H0EA 2XPWA 5EG0A 4CA0A 1CF7A 1WJEA 2VQHA 2V9PA 1PUEE 2YX4A 1EV7A 1V54H 3AFHA 3JRGA 1J2XA 3K70C 2EMKA 4GXOA 1LEAA 2CUZA 3QAHA 4YEJA 5K7HA 1UG0A 4LMYA 1RKTA 4YFXF 4LFUA 5L3GA 4DNCA 1W36D 3QG5C 5FKNA 1P9QC 5EZHA 1UHWA 1QQIA 2R5ZA 4UNOA 3U1DA 5JFRA 2HPIA 3FKJA 2DQRA 2I8DA 1R4MB 3DTIA 2HC5A 3OTOE 1WI3A 2HXOA 2MYSA 4F52A 1FOXA 1J5EE 1XSVA 2EMCA 4N4RB 5EYRA 1RMDA 4XOTA 5GP9A 2MC3A 2LG4A 1HKSA 4HAMA 2JRTA 2QEXI 1T0FC 2CV2A 2EA4A 2BHZA 4JX4A 1Q1VA 1LKXA 3CUOA 4TUIA 2TDXA 3BTIA 3FMRA 2XIGA 3ML6A 3OIQA 4NUBA 5DDGA 1ZR4A 3IH4A 4EVIA 2E34A 2ENCA 2L7FP 3FZVA 3TO7A 3JRDA 1OYYA 3NQOA 4LB5A 3CCYA 3KEQA 3W6KB 4FISA 4P9UA 1ZAOA 2V9KA 2HOSA 2V83A 1HR0E 3H5RA 1YYWA 1UJ8A 1LDDA 2VODA 4AQYE 1ZELA 2E60A 1A1IA 2NUEA 4DQ2A 3I53A 4IJAA 1G6NA 5LGNA 1MBGA 2EN7A 3DF6A 3T5XA 1ZN2A 2EWLA 1NTCA 2ISZA 4P7DA 2K9LA 3L1PA 3OYHA 1HBXG 5A2QK 5IXMB 5JLXA 3LNQA 2V86A 2X0LA 3PNTA 2PJPA 4BYYA 2KRFA 2MC6A 4DV3E 2LKSA 1S72I 2L4MA 3J80K 4NNJA 4HPQA 1U8RA 4HOBA 2JUCA 3ZPLA 3OMLA 3QYFA 2COMA 3HPHA 4EJVA 2RN7A 1XTAA 5FLVA 3JSOA 3TMOA 4ENKA 4YG2F 3RQIA 5BR8E 2XKOA 1J5YA 3GFJA 2JYAA 3HOTA 2VKHA 5LMNE 2OQGA 1N78A 2OV7A 1U8BA 4DOZA 2EOOA 2JUGA 2EK5A 1X1CA 2ME0A 4P55A 3GXOA 1FIPA 4ASNA 1YJ9I 1U9NA 2A05A 4IL6C 3HQ1A 1UG2A 2L9SA 4XKWA 1TNSA 2B9SA 3I59A 5K7ZA 1APLC 5LEJA 2O9LA 1VQPI 5A2QC 2XAFA 2KT0A 4AYBA 4HDUA 1OCTC 1M1EB 2PEXA 2WV1A 1I94E 3PUFA 4YFKF 1Z21A 4NDLA 2A5WA 4BXXJ 4A3DJ 1LPQA 3K2AA 3J80C 3EPHA 2LTRA 2PI0A 1RESA 3FXOA 2QBYB 4FTHA 2DPUA 2O8KA 3ABMH 4HA8A 3DPUA 1AKHA 2FV4B 2J5PA 1G8XA 1BI3A 1ETXA 2K4BA 5EJCA 2M30A 5GAHJ 1AA7A 2VT3A 2ZMEA 1Z3XA 3K4CA 1VQOI 2DOEA 3S1QJ 1Z0XA 4CHUA 2M87A 2HNHA 3I56I 1N36E 4FX4A 1YUIA 3RPUA 5BPDA 4RAGA 2HVRA 4NC8A 3AAFA 4UVAA 2XASA 2EN2A 3D5SC 3BPVA 1O57A 1Y56A 5HLIA 4V19K 4I76A 2ID6A 1QZYA 2PQ8A 4N9IA 4PDKA 2EZHA 2EPLX 2EZKA 4PGHA 3K1NA 3I54A 4WSPA 1ETWA 5DD4A 4RM2A 3W2VA 3ZN0A 2VT2A 3OMYA 3CCMI 1NEIA 5AC5A 1ZTRA 2QQ9A 2O7OA 4IJDA 5C3EJ 1EKZA 2DMNA 5FLMJ 2VF1A 3QPSA 2ZM6E 2YRHA 4HQMA 1QZEA 2ZBKA 3E0JB 5DCFA 4F55A 4PJMA 5T6JA 1IUYA 2EL5A 3SFZA 2BE5F 4BGDA 3X2QH 3M4OJ 1IXCA 1ODDA 4GCVA 2XHKA 3F8FA 2DA4A 4O3MA 2NYXA 4BEHA 3K70D 3D1NI 3DKXA 3I55I 1ZRCA 1IN8A 3V7SA 3GTKJ 4ZYGA 5JR3A 2XROA 5HS8A 2P6TA 3OOUA 1U5TA 1VQ9I 2R7RA 4ZDOA 1WGXA 2BY3A 1F36A 5E20A 5FGMA 3HPSA 5LBQA 1IRXA 4ZDPA 2V85A 1QBJA 1O7LA 5TSEA 3CMYA 1D1BA 4WF2A 1R1TA 1DI2A 3JRAA 4M3EA 1NG6A 4LG0A 3TL4X 2WTEA 3K69A 5FKMA 3WU2C 2EPNA 5KCMA 3OYMA 3J81K 1S7EA 2L3DA 2EM3A 2UXCE 2H8RA 3BR1A 2R7SA 2F8BA 1FY7A 2YU8A 2E2HJ 2W7NA 3L2QA 1H88C 2X6OA 4HX4A 4M72A 2WBMA 2WADA 4B4CA 1H9GA 1PYVA 2BW3B 2X85A 2R7DA 2CJJA 1K6OA 4O24A 1SFEA 4XOPA 1W0TA 4ZH4F 2M8GX 1XCVA 1YS6A 3SJMA 5CFFE 1XDUA 2ESNA 4RS8A 4G8XA 4KHPE 5J1RA 2XB5A 1W5CC 3CJRB 2PRTA 5CVJA 5F3WA 1SMTA 4I02A 3OSFA 1F9NA 3LQRA 4UV8A 1VFCA 3IKVA 2MLGA 3F23A 2Q8KA 4HSRA 3JRFA 1REPC 3VWBA 2RPCA 4KJZA 1I27A 3O6BB 4BKXA 4MEXF 4BY7J 4DV2E 2V9VA 5J40A 3C4BA 1XX5A 1KONA 3TDZC 3ZQHA 5IOYA 3VEPA 1W7PD 3HOXJ 2I13A 2D45A 3WU1B 1R23A 3H9GA 2YU9J 1KYWA 1WZ2A 1Z1DA 3A02A 4HDVA 4NXME 2YTGA 4KT5C 3CF5F 4LF8E 2UV1A 2VC0A 1B8IB 3WU0A 1TT5B 4Z2YA 2O8XA 1ORKA 1XNQE 2DQLA 1GDTA 1E3OC 4XLPF 1FOYA 1DP7P 2IHR1 3M8EA 2QSHX 2LBFA 3J7Yp 2CV1A 1FC3A 4O4KA 1A1GA 4LF6E 1BM9A 1IXSB 2OD5A 3MWMA 2EMBA 2DFHA 1YFHA 3H92A 2DMUA 3V7RA 2DA7A 2Y75A 2O0YA 3RDIA 1D8KA 4A3FJ 3IWCA 2EOQA 3HIFA 1JTXA 3RZDJ 2ZO4A 2RNJA 3L9FA 3TW7A 3F6GA 3A2KA 2EM2A 4MEYF 2QENA 3F6VA 3D5RC 2JA7J 2M4KA 4M6YA 4C3HJ 1G3SA 1ZLJA 3F6OA 3T1BA 3H9JA 4ZDLA 3ZQ7A 3KIOA 3J7ZI 4ON0A 1NG7A 1WJCA 4C30A 4BQOA 2XGEA 3BZ6A 2VQFE 3CCQI 2FXAA 2FRHA 2BB8A 4YY3E 1ZG1A 5IT3A 4PJ0C 2YX7A 1MJBA 1ON1A 4XONA 2WA0A 1IZ1A 4XBFA 2HYGD 2EPPA 1SAUA 5LMUE 3G1MA 4EM0B
chains in the Genus database with same CATH topology
3ECHA 1KU3A 3NRVA 5L3FA 4IVNA 3GZ6A 3GYHX 5HDGA 2OZUA 3K1PA 2H6BA 4RB2C 4S05A 2DT5A 3E3VA 5CLSA 4A5MA 4L0ZB 4PZJA 5FLXZ 1G3YA 1EH6A 2OQRA 1USSA 3VFZA 2LF7A 2YU3A 1YO5C 4RAYA 2XGXA 1YW7A 4A0YA 5ED4A 2H27A 1G3TA 3EUHA 3H3UA 3J7AO 5LLQA 4CYDA 4HLYA 1Z9CA 1BC8C 1SFXA 2A68F 3HUGA 5LHHA 3EETA 2G9WA 3MEXA 2IA1A 3EQLF 1XMAA 4U7BA 2A69F 4IPAA 3QP6A 5LGTA 3LA2A 3BP8A 3ZMDA 3IHUA 1TLHB 3O2PE 3EYYA 3WTYC 3CJNA 2NS0A 2P4WA 4IRGA 4IRIA 3VB2A 1PP7U 1IN4A 4OMZA 2G7HA 3RYRA 1I1GA 5L3BA 2WV0A 4ETSA 2KIMA 1R5HA 4A0ZA 3QU6A 2JSCA 4LLGF 3LAPA 3GLXA 4BXUA 5ILSA 4FX0A 1P2FA 4OIPF 1IAWA 4GYIA 2GAUA 4WXCA 1IN5A 2KJCA 1R00A 4FHTA 4IXAA 2GXGA 3HSRA 2JZYA 2DO7A 2R3SA 5DEQA 2YR2A 3C1DA 1TW3A 2GWRA 1FT9A 1J75A 4LLNA 3L2CA 3E97A 4B09A 1FP1D 1KU2A 1MDMA 4MTEA 3MFKA 4YFNF 4RGSA 4IRHA 3R4KA 1ZARA 4ZZDA 5ILVA 4M74A 4RB0A 3RI4A 3K9TA 2WC2A 3U9GA 5LRSA 3MCZA 5D6EA 2Q0OA 1OR7A 3BJ6A 1XGNA 1BIBA 5AIQA 3IL2A 3Q5FA 4HZFA 2K7LA 1SD4A 2A3SA 3K1MA 3WTXC 4WX9A 2EFOA 1XGOA 4OIRF 2ZKZA 2FA5A 4G6QA 5F6FA 3CTAA 4EJUA 1BIAA 3P7NA 1I1SA 2DK5A 5J8CA 1SD6A 1WRJA 2FNAA 2EA2A 1U6GA 3RJPA 5KK1A 2MBFA 2HQRA 2XAQA 3KFWX 2CWEA 3WODF 1I5ZA 1KYZA 1HKTA 3RKYA 4EJWA 2Z9OA 2EFQA 2QUFA 3MAJA 5L3CA 2VBWA 3DXJF 3MZHA 4P5OA 4PGGA 1KGSA 3CDHA 1S7AA 3DPLC 3OOPA 3KP6A 3R61A 2CYYA 3WE3A 1YLFA 1R36A 2QQBA 4KN4X 4M6XA 3K0LA 4O6JA 2QBYA 2W57A 4M9SA 4XSZF 2IT0A 2AS5F 2J5OA 3WE2A 2E1CA 3PQKA 1MJAA 2VBXA 2PMHA 3WTTC 1D5VA 1HXDA 1ZREA 3R0JA 5FD5A 5DCMB 2W25A 1HW1A 1E2XA 2DBBA 2LSOA 4KNYA 1ZGJA 2EV6A 4HW0A 4UUVA 3CO6C 1IRFA 2CG4A 1I6XA 2HOEA 1XB4A 2IRFG 5K5RA 4MQ9F 1B59A 1XMKA 4KIFA 3I0TA 2FE3A 1RIOH 3HHHA 3QPHA 2UZKA 4ESJA 3WG9A 1QNTA 1BI1A 1S6LA 2VXZA 5ICFA 3BWGA 4HYEA 3KLNA 1ZRFA 3SZTA 4EJOA 3SZPA 5F64A 2IA2A 2V6CA 1BBYA 2M5WA 4E70A 4U0WA 1ULYA 1K7AA 2FMLA 3HTUA 3BY6A 1S8NA 2HKOA 4OIOF 4RGUA 1UFMA 4F7ZA 4LB6B 2HR3A 1Z05A 4BHCA 3P9KA 1KQ0A 2W85A 4L0YB 4QLCU 1BJAA 1ZG3A 3F8MA 4EGYA 1MD0A 4IHTA 2LNBA 5IT9K 3JAMZ 2UXXA 2Z3YA 3REOA 5DD8A 3I58A 1OPCA 1FOKA 3TDUC 2VONA 1BI2A 5ILUA 4EV0A 1SD5A 5D5UB 2BBYA 2RKHA 1LQ1A 1LDJA 4L5JA 1STZA 5KVRA 2EWNA 5E1WA 3D5LA 1MKMA 1HSJA 4KN7X 2UWMA 3FXUA 4EQQA 3LA3A 5HDKA 4HF2A 2MLKA 3ISPA 3HSEA 3N97A 4HF1A 2A6EF 4A12A 4OIQF 2H09A 4CZZA 3BROA 1LNWA 2V1XA 3KEOA 3F8BA 3FMSA 4KDPA 3RKWA 1HW2A 3BOQA 5D6FA 4HF0A 4LK1F 1YG2A 2PN6A 1XGMA 4KA4A 4HV6A 2OAZA 1S3JA 3MZYA 2ZJ2A 3RYPA 2HWVA 2A61A 1FYKA 3T8TA 2EFWA 3HTSB 2KIFA 2W84A 3I4PA 1BN5A 1BOAA 3M8FA 5BMZA 4KUMA 1TQPA 1YIOA 3HYIA 4JQFA 5K5QA 2MA3A 2V1DA 2O03A 2PMUA 5EEGA 4XLNF 1W4MA 2NRAC 5FB2A 1B6AA 4UVCA 5LHGA 3KZYA 4RB1A 2RC4A 4NHJA 2Q2EA 4LK0F 2X4HA 3L7WA 2A6HF 3WGHA 3LFKA 4G7OF 3L00A 3T0YA 4BH9A 1A04A 2EJRA 2DTRA 5AONA 3WTSC 1XN7A 3HRTA 2CQKA 3BJAA 1W7PB 3KETA 2F5CA 3RPQA 1ZGAA 3IWFA 3DF8A 5CYVA 4L18B 3O3KA 4G7HF 5DYMA 2VOOA 1OKRA 5H6RA 4ENNA 4YIFA 3IRRA 3COAC 4M71A 4EJTA 3WGGA 1FSEA 3VODA 4G94A 3WTVC 4PCQA 2D1VA 2O61A 2MH2A 1C0WA 3DFGA 5LHIA 4U0YA 1YS7A 4AIHA 3E5XA 5D4SA 2EFNA 2ZMEB 4B8XA 5D8KB 3RIRA 5AIPA 1MGTA 1S7OA 3IC7A 2P6SA 2P5LC 3GFIA 3ZN1A 1WSUA 4M9ZA 3HHGA 2DLLA 1B1BA 3WGIA 4XSXF 1Y0UA 5H6QA 4I09A 4WXHA 3CLOA 1OYIA 2GQQA 2CSOA 4LJZF 1P6RA 4HX7A 1UHMA 4GGGA 4WCGA 3DV8A 4G9YA 1RUNA 3ZMSA 4ENJA 3CUQA 4KYWA 1X3UA 3B02A 2XKPA 4JK1X 2H94A 1BC7C 1R1UA 4HQEA 5HOOA 4GYGA 1FBQA 2FBIA 2FQ3A 5BQTA 2IP2A 4FT8A 4OU0A 2ZFWA 1K79A 4UVBA 2G7UA 3HRMA 2ETHA 5EEHA 5LGUA 2NNYA 4LG0B 4L9JA 3KE2A 1WKMA 4ESBA 2ELHA 4HV5A 5J6XA 2MD5A 1LJ9A 5CVIA 1K78A 5TRDA 3DPTA 1ON2A 3G3ZA 1HKQA 3FHZA 3JW4A 2QQAA 3PFIA 3LQQA 2VE9A 2PFBA 3T8RA 2PBIA 4NQWA 2GZWA 1H0MA 1GVJA 2BYVE 4I2OA 3NEUA 3E6BA 1SFUA 3FMQA 3Q9VA 5BOXA 2L02A 3DEUA 3TO6A 2GA2A 5FFXA 3KP4A 2MH9A 3HRUA 5CJ9A 4KMFA 3F8NA 3PQJA 1Z6TA 2KKOA 1JHFA 2L01A 4U7DA 1EH7A 1T98A 2QWWA 5HVQC 2VC1A 2QLZA 3LAJA 1R5GA 2UXNA 3C7JA 2VOPA 1LDKB 2LDUA 4BAYA 1O3RA 2VBYA 5L3EA 2XV4S 2A5YB 5K5OA 1UB9A 4KMUX 1DDNA 2FOKA 2ISYA 2QVOA 2RV8A 4Y15A 3D0SA 4LLLA 1J7KA 2IVMA 1KQ8A 1VTNC 1NHAA 4ZYDA 3ZMTA 3L09A 2AXLA 3ERED 5JVTA 5K1YA 2BV6A 3LA7A 3RTRA 1P4WA 4EM2A 4R8HA 3BPXA 3QPTA 2D2WA 1TTYA 5D5XB 2HKXA 3SQNA 1QZZA 1RNLA 2VBZA 2QYOA 4OINF 2HTSA 2CGPA 5D5VB 1ZHFA 3ECOA 3GFLA 3H3ZA 1QGPA 4UV9A 2V1UA 3JTHA 1SD7A 1FBUA 5BS6A 5E8IA 2GIVA 4MQVA 1GXQA 2YPRA 2ACJA 2IJLA 3C18A 2DW4A 2L4AA 4L9VA 1KU7A 1RZ4A 1L3LA 4HLXA 1YQAA 3FM5A 3GZ5A 4Y17A 1UCRA 3KP5A 1O7FA 2XRNA 1RUOA 3FXRA 1Z6RA 1FPQA 3SXYA 3V8KA 1FZPB 2IA0A 3F22A 2F5DA 3GX4X 4CO8A 2M45A 3TOBA 2BGCA 4Q48A 5L3DA 2W24A 3QP5A 4Q47A 4CGZA 1ZRDA 4ESFA 2FEZA 2HGCA 4KIGA 5A2QZ 3BJOA 2O3FA 1ONVA 4TV7A 3J80Z 5H20A 4IF4A 2OU2A 1LVAA 2B0LA 1U3EM 2P5KA 3DP7A 2K02A 4XRFA 1T38A 1U2WA 3GF2A 2C6YA 3V4GA 3FM3A 3P9CA 2E1NA 1OMIA 1MDMB 4AVPA 2CO5A 4I0BA 3GVAA 1R1VA 4CICA 5E17F 3E6CC 2EV5A 3U2RA 3E6DA 5HDNA 3TO9A 5ICGA 1WWXA 4MHGA 2ZNZA 3WTZA 3ZMZA 2OBPA 4WXDA 3SHFA 2HTJA 3IKTA 1T0FA 2NNNA 2STWA 5ERIA 3KP7A 2H6CA 1V4RA 4AIJA 5TJJA 1FYLA 4I0AA 3DKWA 3F3XA 2P8TA 4LGWA 4U0VA 3QRFF 1FP2A 1W7PA 2YSRA 1EH8A 1R22A 2RGVA 4RGXA 4S04A 1T39A 1LEBA 5E8GA 1D3YA 1W5SA 3GWZA 3RKXA 3CO7C 4A5NA 4BQAA 3ELKA 4R79A 2KJBA 3J81Z 2VE8A 1SAXA 1T6SA 4I01A 3S2WA 2Z33A 3I5UA 2V79A 3LWFA 4A6DA 1XSDA 1W5TA 3KLOA 4HX8A 3FXQA 1GXPA 3I64A 2K4JA 4YIIA 3K2ZA 3FF5A 1F5TA 3E5QA 1G4DA 1QPMA 2FBKA 4KIBA 3G73A 2ESHA 2ZNYA 1KQ9A 4WK8F 2XAHA 4D0PA 4IHSA 1XGSA 2HYFA 1F1ZA 3KP2A 3ABTA 3F8CA 1U5TC 2FU4A 3R6SA 1CF7B 3EDPA 4RB3C 4N9HA 1BI0A 4K2EA 2HEOA 5E1XA 2KIUA 5CVRA 3R60A 2OA4A 3B73A 2XVCA 3JAMK 2OZ6A 5ICEA 4P9FA 5HS9A 1HSTA 5D4RA 1D8JA 1MJ9A 2EB7A 2DPDA 2CW0F 4BNCA 1SMYF 1Q1HA 4OMYA 4ZYEA 2ADUA 3HRSA 2WWYA 5F1RA 2A07F 5J8FA 4O5VA 2R7FA 3JSPA 3GEZA 4L9TA 1PDNC 3KP3A 4EM1A 1XD7A 3I71A 3ULQB 2JPBA 2EV0A 5LRRA 4I7HA 5CVUA 1DPUA 2GA1A 2K27A 3JTGA 3LSTA 2F2EA 3N4MA 3P9IA 3WTWC 2E7XA 2HQNA 1TQMA 2XAGA 3QOPA 4BHPA 2HDCA 5HLGA 3I59B 1R58A 4RGRA 2QZ8A 2STTA 2M1BA 1FWZA 3ABUA 3MQ0A 6PAXA 1JGSA 3E6MA 3M7GA 4U88A 4EMSA 2L54A 1S29A 1ZH5A 2DK8A 4A2UA 1R7JA 4A0XA 1P4XA 3WTUC 1P92A 3TKYA 4BHBA 4EGZA 5E1ZB 1FNNA 1FBSA 1AOYA 2XUBA 1P4AA 1IXRC 5JHUA 4ENMA 2GXBA 2D1HA 3E5UA 1HQCA 2Y48A 3CUQC 2PG4A 1IW7F 3ROUA 1CGPA 5JI6A 1YW8A 3V7CA 5FFZA 1FX7A 2HS5A 2VN2A 1TNTA 1U5TB 1Z7UA 2K86A 3QU3A 2O6GE 2E7WA 1JHHA 4Q4ZF 4GO1A 2BEOA 2PLYA 3F21A 1JXSA 1U78A 2FSWA 4AWXB 2QM3A 3HOSA 3F72A 3IWZA 2RDPA 2JTVA 4AIKA 4LD5A 2DAOA 3IRQA 1FYMA 5HS7A 4L9NA 1USTA 2P7CB 5FD6A 5DV5A 1OYWA 2F5EA 4P96A 1YTYA 3EYIA 4ZZLA 1QO0D 2RQPA 5CVVA 5FLXK 1B9NA 2ZXJA 5ICCA 4Y13A 4KICA 1IN6A 1G3WA 2FMYA 5D5WB 4OOIA 5DUIA 5DCMA 4MNUA 1T2KA 4CDGA 1GHCA 3ZMVA 1KA8A 4R1HA 1O3QA 4G6DA 2JPCA 3V8JA 2XAJA 2LF8A 3TGNA 3FX3A 3M1EA 2RVCA 1YW9A 1E17A 1FLIA 4KFCA 2DU9A 2LKPA 4MTDA 2Z5UA 2HFHA 1J59A 4Q5SF 1DPRA 3GFMA 1HW5A 1XCBA 4I98B 1V3FA 4ZYHA 2P7VB 4G7ZF 1DUXC 4HBLA 3KZZA 3R0AA 4M9XA 4N0BA 1WI9A 2FF4A 1TBXA 4CXFA 2FNPA 1IF1A 1AWCA 3ZMUA 2EFPA 1F4KA 4A6EA 1YYVA 2M8EA 3KCCA 1KU9A 3GUDA 2JT1A 2NAZA 3V8LA 3M9AA 1LB2A 2ZCWA 3TQNA 1MZBA 3TOAA 4L5IA 4UXNA 2FBHA 3HSFA 4MGRA 3CUQB 5HLHA 3C3WA 4RAZA 3GO5A 2IW5A 5LEKA 1JE8A 4WWCA 1IRGA 3VOEA 1B4AA 5DUKA 4NB5A 4AD9A 5FO5A 2IPQX 3ZP5A 2F5FA 1O3SA 1TQIA 1TW2A 1ZLKA 1K78B 1J0RA 4M73A 1O3TA 4JBAA 3Q9SA 5E18F 1Z91A 5D8LB 3DQVC 3GW2A 2Z99A 3BDDA 2P5VA 1XSXA 3FWEA 1H9TA 5BPIA 2DI3A 2HZTA 1FSHA 2CFXA 4UHTA 3W6JB 1B9MA 1WQ2A 1IN7A 3OV8A 1ZG5A 2Y0MA 1XDSA 5IT9Z 1ZYRF 1RI7A 4QWQA 1L0OC 1J9IA 1PP8F 2DFIA 4H0EA 1CF7A 1PUEE 2YX4A 1EV7A 1J2XA 4GXOA 1LEAA 3QAHA 4LMYA 4YFXF 4LFUA 5L3GA 4DNCA 1UHWA 1QQIA 4UNOA 3U1DA 5JFRA 2DQRA 1XSVA 2MC3A 4HAMA 1HKSA 2JRTA 2EA4A 3CUOA 2TDXA 3FMRA 2XIGA 3ML6A 5DDGA 4EVIA 3FZVA 3TO7A 1OYYA 3NQOA 4LB5A 3KEQA 3W6KB 4P9UA 1ZAOA 2VODA 1LDDA 4DQ2A 3I53A 4IJAA 1G6NA 5LGNA 3T5XA 1ZN2A 2ISZA 1HBXG 5A2QK 2X0LA 2PJPA 4BYYA 2KRFA 2L4MA 3J80K 1U8RA 4HOBA 3ZPLA 2COMA 4EJVA 2RN7A 3JSOA 4ENKA 4YG2F 2XKOA 1J5YA 3GFJA 3HOTA 2OQGA 2EK5A 4P55A 3GXOA 4ASNA 1TNSA 3I59A 5LEJA 2XAFA 4HDUA 2PEXA 4YFKF 2PI0A 2QBYB 2DPUA 4HA8A 2J5PA 1BI3A 2K4BA 2M30A 2VT3A 2ZMEA 4CHUA 2M87A 4FX4A 3RPUA 5BPDA 3AAFA 4UVAA 2XASA 3BPVA 1O57A 5HLIA 2PQ8A 1QZYA 4N9IA 4PDKA 4PGHA 3K1NA 3I54A 3ZN0A 5DD4A 2VT2A 2QQ9A 4HQMA 2ZBKA 5DCFA 1IUYA 3SFZA 2BE5F 1IXCA 1ODDA 4GCVA 2XHKA 3F8FA 4O3MA 2NYXA 1ZRCA 1IN8A 3V7SA 4ZYGA 5JR3A 2XROA 5HS8A 2P6TA 1U5TA 5E20A 5FGMA 5LBQA 1QBJA 1O7LA 4WF2A 1R1TA 4LG0A 2WTEA 3K69A 3J81K 2L3DA 1FY7A 4HX4A 4M72A 1H9GA 1K6OA 2R7DA 1SFEA 4ZH4F 1XCVA 1YS6A 1XDUA 2ESNA 4RS8A 4G8XA 5CVJA 1SMTA 4I02A 1F9NA 3LQRA 4UV8A 3IKVA 2MLGA 3F23A 2Q8KA 1REPC 1I27A 3O6BB 4MEXF 2V9VA 3TDZC 3VEPA 1W7PD 2D45A 3WU1B 1R23A 1KYWA 1Z1DA 4HDVA 4KT5C 2VC0A 3WU0A 4Z2YA 2O8XA