4ZYEA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
PMLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 42
structure length 152
sequence length 152
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyeA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyeA01
1L0OC 3WGHA 2PI0A 4HYEA 2O8XA 2FNAA 3EUHA 3Q9VA 5E18F 1BI3A 2EK5A 4G7OF 3GVAA 5JVTA 2HQRA 2VBYA 5FLXK 4HLXA 3F3XA 2CSOA 5ICGA 3QP6A 3C7JA 2Z33A 2Y0MA 4RAZA 1ON2A 3F6VA 1GHCA 2QLZA 4M72A 4U0YA 1W4MA 1QPMA 3BROA 2Z5UA 5DCMA 2Q2EA 2GZWA 4A5MA 5E20A 1W7PB 2YPRA 3I58A 1R5HA 3JAMZ 2KJBA 4EM0B 1FWZA 3ERED 2NYXA 1QO0D 3WTUC 4LLLA 4BH9A 3WTVC 3WTSC 4UV9A 1KA8A 3F21A 3E5UA 3V7SA 3VOEA 1J75A 3F23A 1YW7A 1HW1A 5DUKA 4ZYDA 4I09A 2GA2A 2Z99A 4JBAA 5BPIA 1R58A 4RGSA 5A2QK 1Z9CA 1XMKA 2Q0OA 1TQMA 1D8JA 3HTUA 4RS8A 3I71A 5ICFA 5H6RA 3F8MA 4EQQA 1W5TA 3FHZA 2RC4A 3ML6A 3WODF 3BY6A 3L7WA 2RDPA 3FWEA 2CO5A 1TQIA 2M30A 1XGNA 3F8CA 4P9UA 2HS5A 1B9MA 4MTDA 1ODDA 4N9HA 3J81K 4Q4ZF 2DQRA 4I98B 1BC7C 2VC1A 5ERIA 1RNLA 3BOQA 4ENKA 3VFZA 5TJJA 2A3SA 3DXJF 4GCVA 1Z6RA 1Z7UA 3RKXA 1SD4A 1WKMA 4HA8A 3E6CC 2X4HA 2RVCA 2EV0A 4N9IA 2MD5A 1ZAOA 3ZMVA 3ZP5A 4UUVA 3FF5A 2MA3A 1YS6A 4UVCA 2RKHA 1R1UA 4EMSA 1G3SA 2F5DA 4UVBA 1STZA 3HSEA 2WWYA 4ENMA 5D4RA 3ZMZA 4MTEA 3T8RA 5ILSA 2OU2A 1T6SA 3AAFA 1QZYA 2YX7A 4BHBA 4Y17A 3LA7A 5ILUA 1YS7A 2D1VA 3E6MA 1FYMA 2P5LC 4LB6B 4OIPF 2V79A 5JR3A 1LDDA 2EB7A 4LFUA 2HFHA 3WU1B 1H9TA 1MDMA 2HYGD 2EV6A 2A6EF 2HZTA 4GYIA 1AOYA 2HQNA 5FD6A 1HSTA 4I02A 2EFWA 2IVMA 4WXCA 1D3YA 1XMAA 4IVNA 3GEZA 2P4WA 1TW2A 1DPRA 1IZ1A 3QPTA 4XLPF 1K7AA 4MEXF 2DPUA 1LNWA 1RUOA 2W85A 1YW8A 3CO7C 1K79A 3I53A 3M7GA 1P4XA 3TOAA 2ZNZA 3HOSA 1RZ4A 2AXLA 3D5LA 1DP7P 2VODA 5DUIA 1U78A 2IA2A 3EDPA 1BOAA 1KQ9A 5D5VB 1ZG1A 3FM3A 3QRFF 4EJUA 4IRGA 4KT5C 1KU2A 3KETA 1UB9A 4L5JA 1PP7U 5J8FA 2IT0A 3R6SA 2PBIA 3RKYA 3I64A 2QQAA 1K78A 3HYIA 1FX7A 3FXRA 4HW0A 4LG0B 2LKPA 2HEOA 1R36A 2XIGA 3TDUC 4O3MA 3PQKA 2PEXA 5J8CA 2FOKA 3DF8A 4NHJA 5FFZA 1C0WA 2O0YA 3WTWC 1S3JA 3DPLC 2ZMEB 4EJTA 2P5VA 3B02A 5DD4A 1TBXA 4CO8A 2IJLA 5EEHA 1R7JA 2YU3A 3ZMTA 4E70A 3ECHA 3FZVA 3HOTA 4EM2A 2VE8A 2RNJA 2VONA 2JPBA 2PLYA 2IA1A 1NHAA 5ICEA 2COMA 4KFCA 3ULQB 3EYIA 1YTYA 4DNCA 4U7BA 1XGMA 3LAPA 1CF7A 3WTTC 2A5YB 3U1DA 2M45A 4CHUA 4BHPA 1MZBA 2PMUA 2O61A 2FBKA 1HXDA 5DD8A 3KCCA 4PGHA 2VE9A 1P92A 2NRAC 4HX7A 3V7RA 3LFKA 1REPC 2STTA 2VT2A 2L54A 5D6FA 5D8LB 5HS9A 3I4PA 2Z9OA 4TV7A 3WE2A 1ON1A 4PDKA 4ZH4F 2R7DA 3V7CA 3WTZA 1KQ0A 2FA5A 3TO7A 1QQIA 1J7KA 4IRHA 3N97A 3LA3A 2XAJA 3P9KA 3GZ6A 1ULYA 4JK1X 2CG4A 2V1DA 2LNBA 5DV5A 3LSTA 1Z1DA 3IWZA 5D5UB 1ZH5A 3I0TA 1HKQA 2XHKA 3DEUA 1UHMA 4KDPA 1J2XA 3Q9SA 1G3YA 4KIBA 5BOXA 2P6TA 3GLXA 5DDGA 4YIIA 1OMIA 3BJ6A 5HLGA 5LHGA 4RB0A 3KEQA 3KEOA 1WI9A 3C1DA 5DCMB 3R4KA 1LEAA 1MKMA 2P8TA 2ETHA 1I1GA 3E5XA 2JTVA 5HDNA 1T98A 5LRSA 4RB1A 4A0YA 3W6JB 2VT3A 4KNYA 1G4DA 1IXSB 1PDNC 5E1ZB 3KZYA 1BJAA 2ZBKA 2M87A 1O57A 4IPAA 3FMQA 4AIJA 2MH9A 3IHUA 4IHSA 1SFUA 5D5XB 4XBFA 4IXAA 3V8LA 1F5TA 4OMZA 3B73A 2STWA 4D0PA 3LAJA 1IW7F 1O7FA 5HLHA 2ZXJA 1IAWA 4RAYA 2EFNA 2VOOA 5KK1A 2O3FA 5LEJA 2VC0A 3IC7A 3KP7A 3K1NA 4RGRA 2G9WA 3QPHA 2UXXA 3HRMA 1J5YA 1MJBA 3VODA 3L2CA 3T8TA 2UXNA 2OBPA 3WTXC 1HW2A 3SHFA 2VBXA 2JZYA 4EJVA 1XCVA 2P7VB 4R79A 3TO9A 1IXRC 2HKOA 4IJAA 4M9ZA 3M1EA 1A04A 5LRRA 1ZN2A 1ZG5A 1SD5A 3K0LA 1ONVA 1FNNA 4AD9A 1KU3A 3TDZC 5CVIA 3GYHX 1JHFA 3LWFA 3CLOA 1MGTA 2PFBA 4OU0A 5FGMA 3FXUA 2EFQA 5BPDA 2JPCA 1UFMA 3REOA 1YG2A 2ISYA 4M9SA 4MHGA 2UZKA 1BI2A 2DBBA 5F64A 5K1YA 1FC3A 4BXUA 4NB5A 5CLSA 2F2EA 1JGSA 3E6DA 1FLIA 2XAQA 2WC2A 4ZYHA 1J0RA 2R3SA 1FBUA 1XGOA 4HOBA 3DP7A 3MWMA 1MDMB 1BBYA 5ILVA 2M8EA 1J59A 5FFXA 4CXFA 3F8BA 2FF4A 3C18A 5CJ9A 5LBQA 1SMYF 4HF2A 3CDHA 1U2WA 4UV8A 3HUGA 6PAXA 3V8KA 1XN7A 4N0BA 1LJ9A 4ESFA 2J5OA 1USSA 3LQRA 1IN6A 3L00A 4LK1F 4P5OA 1FBSA 2XVCA 2OZUA 1U8RA 2YSRA 5JFRA 1RIOH 2EFOA 4HF1A 1U5TC 2EFPA 2XAFA 2DI3A 2XASA 2FBIA 2Q8KA 3KZZA 5E8IA 4A0ZA 1BN5A 4LB5A 1D5VA 3ZMSA 3KP5A 1XD7A 3U2RA 2ZKZA 1F9NA 2P6SA 1K78B 5KVRA 2W24A 2L02A 4ZZDA 1TNTA 1I27A 2FBHA 3OV8A 1G3WA 4EVIA 4A0XA 3BPVA 4K2EA 2JSCA 5FLXZ 1YLFA 1R23A 3IKVA 4OOIA 3VB2A 3QP5A 4FT8A 1YW9A 3MCZA 3KP3A 1PUEE 2RGVA 4BQAA 2K4BA 3ELKA 5HVQC 3TOBA 4F7ZA 2XAGA 4GXOA 2F5CA 4RB3C 1OPCA 2FNPA 3ZMDA 1S29A 2FEZA 4KICA 3MEXA 1U6GA 4EGYA 2GWRA 1U3EM 1CF7B 4HF0A 3DKWA 1IN4A 5A2QZ 5D4SA 3J80K 4B8XA 1LVAA 3MZYA 4CDGA 2AS5F 4B09A 2QBYA 3EYYA 2XROA 1HKTA 1EV7A 4A6DA 2DK8A 4M74A 1W5SA 4LK0F 3SZPA 2A61A 5DEQA 4YG2F 3T0YA 1BI1A 4A2UA 1P4AA 4YFNF 1O3TA 4G7ZF 1KU7A 3E3VA 3J81Z 2PG4A 2G7HA 1BIAA 4WK8F 4BHCA 2V1UA 3P9IA 2R7FA 1B9NA 1BIBA 1KYWA 2FSWA 4AIKA 3SFZA 3RPQA 1B59A 1Y0UA 4U0VA 3K9TA 3KLNA 2PJPA 2ADUA 1T39A 2DLLA 4G6DA 1WRJA 3M8EA 5HLIA 3DFGA 2GAUA 2HOEA 2ZJ2A 5LGTA 1XB4A 4HDUA 1KQ8A 1R1VA 1PP8F 4CZZA 3JSPA 1XSDA 1SFEA 4UXNA 3K1PA 2ISZA 2V1XA 2M5WA 1FZPB 2HR3A 5FD5A 4LD5A 2C6YA 4OMYA 3WGIA 4HDVA 3NQOA 4UHTA 2F5EA 1U5TA 1XGSA 3MFKA 4HBLA 1OKRA 3Q5FA 3TQNA 1Z6TA 1F1ZA 5HDGA 3RTRA 4MQ9F 3WTYC 1FP1D 5LHHA 3I59B 1KGSA 5LGNA 4YFXF 2HKXA 1Q1HA 2OAZA 5CVRA 4EJWA 1FT9A 2XKPA 3FM5A 3J80Z 3T5XA 1MJ9A 3CUQC 4L0ZB 3IL2A 3GZ5A 1MD0A 2L4MA 1GXPA 2DW4A 5E8GA 1GVJA 5D5WB 3KFWX 1XSVA 4OIOF 4PZJA 3DQVC 3VEPA 4AVPA 4MNUA 5DCFA 2EA2A 2MLGA 4RGXA 4KMFA 3K2ZA 2E1NA 3CJNA 3GFJA 2PN6A 5J6XA 3E5QA 1ZG3A 5IT3A 3KLOA 3ZN1A 1FYKA 3FMRA 4L9TA 5FB2A 2LDUA 4M73A 3SXYA 2RN7A 5LEKA 3TO6A 4R8HA 5HS8A 1QNTA 4L9VA 2G7UA 4MEYF 1D8KA 4HLYA 2E7XA 3P7NA 4OINF 4HV6A 2A68F 3R0JA 2A07F 3WU0A 1KYZA 1P6RA 2K27A 2YR2A 3D0SA 3IRRA 2L01A 1JXSA 2VBZA 3ABTA 1P4WA 4PCQA 1S7OA 2D1HA 2CYYA 1V4RA 3RJPA 4RGUA 2EWNA 2NAZA 4S05A 2QYOA 4Y13A 2BYVE 4EGZA 2L3DA 3L9FA 1VTNC 1TTYA 3ZN0A 3CUOA 1B4AA 2OQRA 1H9GA 3FMSA 5L3CA 4XSZF 3S2WA 4QLCU 3RI4A 2DAOA 2YX4A 3QU6A 5JHUA 2V6CA 5L3DA 3E97A 4HX8A 3SZTA 3BJOA 4KA4A 1QBJA 2JRTA 4I2OA 4KYWA 2NNYA 3HRTA 1EH7A 4G8XA 4A5NA 2CW0F 1SFXA 2QZ8A 1WWXA 3ECOA 1YO5C 2MC3A 4ESBA 1FOKA 2XV4S 4M9XA 3E6BA 1R22A 3BWGA 4GGGA 2OD5A 2DPDA 1SD6A 2DK5A 2DT5A 2KIFA 2KIMA 1FYLA 1IXCA 3V4GA 5AONA 2BGCA 2RV8A 4MGRA 1DPUA 3WE3A 5BQTA 3HHGA 5EEGA 2QQBA 3DV8A 1GXQA 1B1BA 4ETSA 3CUQA 2NNNA 1IF1A 3BPXA 4BAYA 2BEOA 3G3ZA 4ENNA 4ZYEA 1JHHA 2E1CA 2F5FA 2ZNYA 3LA2A 4ZZLA 3O2PE 3GFMA 2FRHA 2Y75A 1T2KA 1FPQA 2E7WA 1OYWA 2J5PA 5D8KB 4UNOA 4KIFA 2M1BA 5F1RA 2DFIA 2O03A 1IRGA 3ZPLA 1O3SA 2P7CB 5JI6A 1T38A 2FU4A 5E17F 1BI0A 3WGGA 2QBYB 1AWCA 4KN4X 4ASNA 2XRNA 5DYMA 2MH2A 4FX4A 3RIRA 2KRFA 4CICA 3P9CA 3F22A 4LLNA 1LDJA 1TNSA 4CYDA 3JW4A 1O7LA 4BNCA 4OIQF 1HQCA 3GXOA 1W7PD 2FMYA 1I5ZA 4WX9A 4A6EA 2XAHA 3F6OA 3R0AA 4U0WA 2VBWA 3NEUA 1P2FA 4WCGA 2D2WA 4M6YA 3V8JA 5IT9K 1SD7A 3MZHA 2FMLA 5F6FA 4G9YA 3M8FA 2K7LA 3I54A 1G6NA 1OYIA 1JE8A 1R1TA 5CVJA 3KP2A 3M9AA 5K5OA 3H3ZA 1BM9A 4WF2A 2VOPA 2HYFA 3KE2A 2RQPA 2XUBA 4IF4A 1BC8C 4HAMA 5ICCA 4HZFA 4Q48A 3GF2A 4EV0A 2K02A 4Y15A 2NS0A 4FX0A 5E1XA 2DO7A 4L9NA 1B6AA 3R61A 3IWFA 2TDXA 4BYYA 4EM1A 2ZCWA 5H6QA 1U5TB 4FHTA 4I0BA 2XGXA 3COAC 3GW2A 1ZHFA 1SAXA 3CTAA 2H6BA 1DDNA 4KMUX 4G6QA 5D6EA 2LF8A 2ACJA 3FXQA 2ZFWA 5L3BA 5LHIA 2LSOA 3WG9A 1USTA 1SMTA 4LLGF 5CVVA 3BJAA 1TLHB 1W7PA 3RKWA 4ON0A 1ZRFA 1OR7A 2L4AA 2HGCA 2QENA 1UHWA 3IKTA 1LB2A 2KIUA 2GA1A 3EETA 3JTGA 3F8FA 2DTRA 3BDDA 2BE5F 3HTSB 1ZGJA 4QWQA 2EA4A 2CFXA 4L9JA 3QAHA 4PGGA 1IN5A 3TKYA 2JT1A 5LLQA 1ZLJA 4U88A 3OOPA 1YFHA 3FX3A 4G7HF 2HDCA 2H94A 4U7DA 1YIOA 2IW5A 2HTJA 4XSXF 3ISPA 2QVOA 1FSEA 3I5UA 5IT9Z 5BS6A 1YYVA 5AIPA 1S6LA 3HIFA 3BZ6A 2HTSA 2QM3A 2O6GE 4L0YB 2H09A 4NQWA 3F8NA 1RUNA 4LMYA 1F4KA 3GFLA 5H20A 3O3KA 3ROUA 2FE3A 2FXAA 3L09A 3JSOA 4UVAA 2B0LA 3HRUA 3GWZA 4ZYGA 2A6HF 4P55A 4AIHA 4I01A 3PQJA 4YFKF 3SQNA 2GXBA 3TGNA 1KU9A 4RB2C 1IN8A 1R00A 2OZ6A 4Q5SF 2ESHA 5K5QA 1I1SA 2QQ9A 1Z05A 2CGPA 4GO1A 2H27A 2Y48A 1I6XA 4KUMA 4ESJA 4YIFA 5L3FA 1XCBA 5BMZA 2GIVA 3HSRA 4ENJA 2X0LA 4DQ2A 2PMHA 1HW5A 1UCRA 3QOPA 2XKOA 5L3GA 2FQ3A 5E1WA 1LDKB 1ZARA 3U9GA 2EV5A 2WV0A 3H3UA 1E2XA 2DQLA 3GX4X 1ZRCA 3KP4A 5FO5A 4GYGA 5CVUA 1E17A 2GQQA 4O6JA 2DU9A 4M6XA 4H0EA 1O3RA 2MBFA 3ZQ7A 1FY7A 2IPQX 4I7HA 2K4JA 2IRFG 2P5KA 4S04A 1J9IA 5CYVA 4IRIA 2QWWA 3DPTA 1FBQA 5LGUA 4R1HA 4LJZF 2OQGA 1DUXC 4HQEA 2BV6A 3MAJA 1Z91A 5TRDA 1ZRDA 3GO5A 3RYRA 2VXZA 2K86A 4Z2YA 3K69A 3J7AO 1MJAA 2KKOA 5HDKA 1IN7A 4AWXB 5ED4A 4G94A 1RI7A 3HHHA 3C3WA 2ELHA 1HBXG 3CUQB 3NRVA 5L3EA 4P9FA 1G3TA 3W6KB 2HWVA 3GUDA 4XRFA 4CGZA 3IRQA 1YQAA 1EH6A 2VN2A 4OIRF 2MLKA 3BP8A 2Z3YA 3KP6A 2W57A 4EJOA 1S7AA 2ZO4A 4L18B 1QZZA 3K1MA 2IP2A 2KJCA 3MQ0A 1O3QA 1HSJA 2D45A 1FSHA 1R5GA 3R60A 4LG0A 5K5RA 3EQLF 1OYYA 4M71A 2BBYA 3GFIA 1XDUA 4XLNF 3H92A 2W25A 1TW3A 1K6OA 1XDSA 1ZREA 4P96A 3RYPA 3F72A 4HQMA 5AIQA 4O5VA 1ZGAA 3JAMK 2W84A 2ZMEA 3N4MA 2OA4A 1ZLKA 4WWCA 2H6CA 4KN7X 2GXGA 3QU3A 5HOOA 1LQ1A 1EH8A 1WSUA 4KIGA 1IRFA 3I59A 1CGPA 4WXHA 4HX4A 4A12A 2LF7A 1S8NA 1XSXA 2IA0A 4I0AA 3JTHA 2UWMA 4JQFA 1TQPA 1ZYRF 3O6BB 4IHTA 1HKSA 3HRSA 4MQVA 1X3UA 1QGPA 3PFIA 2QUFA 1T0FA 3T1BA 2EJRA 2PQ8A 4LGWA 4WXDA 3ABUA 2WTEA 1WQ2A 3G73A 1H0MA 3CO6C 3HSFA 2ESNA 2CWEA 2A69F 4Q47A 3RDIA 4L5IA 3RPUA 1IUYA 3LQQA 1FP2A 4HV5A 2V9VA 1V3FA 2CQKA 5HS7A 1L3LA 3ZMUA 1LEBA
chains in the Genus database with same CATH superfamily
2Y9ZA 1L0OC 3WGHA 2PI0A 4V2FA 4HYEA 2O8XA 3M99B 1UMQA 4B44A 2FNAA 4GFBA 1I39A 2JWOA 3EUHA 1S9HA 3Q9VA 1A1KA 5E18F 4DUZE 2R5ZB 4DV3E 2EM6A 1BI3A 2EK5A 3BR5A 4G7OF 3A03A 4DIQA 3GVAA 2HVRA 5JVTA 2HQRA 2VBYA 2RTXA 1JK2A 3IH3A 2R0QC 3A0BC 5FLXK 4F93B 3HOYJ 2VASA 4C2MJ 4R03A 4HLXA 3W6VA 3F3XA 2EN4A 3IAM2 3SEZA 2CSOA 5ICGA 3BR6A 5J1UA 3QP6A 3C7JA 2Z33A 4UUSA 2Y0MA 2IGMA 4Y52J 1ETVA 4A3GJ 4RAZA 1ON2A 3K4BA 3F6VA 1GHCA 2QLZA 4M72A 4PSWA 3JRHA 2V83A 3ASOH 4U0YA 4O24A 4B3RE 1W4MA 1QPMA 2VJ4A 3BROA 2R93J 3M4OJ 3ZQLA 2Z5UA 5DCMA 4BMJA 2H36X 2BVLA 2Q2EA 1YYWA 2GZWA 1WZ2A 3H9JA 4A5MA 3A02A 5E20A 2LP0A 1W7PB 2YPRA 3I58A 5B5EC 1R5HA 3JAMZ 2KJBA 4EM0B 1FWZA 3ERED 1IRXA 1QO0D 2NYXA 3WTUC 4LLLA 4BEHB 2WA0A 4BH9A 1A5JA 1STUA 3OIPA 3QYEA 1QZEA 2HVSA 3WTVC 4LIVA 2K4VA 3WTSC 4UV9A 1KA8A 1MBKA 1X1PA 1XMXA 3F21A 2L2NA 4DR3E 1JTXA 3E5UA 2DMYA 2WCC3 3PIOF 3V7SA 3A2KA 1GUUA 2IEKA 3VOEA 1J75A 3F23A 2L2OA 1YW7A 1HW1A 4DZJA 2M0CA 2J7JA 1TT0A 3BG9A 2EM3A 2BBGA 5DUKA 4ZYDA 2BHZA 3BQYA 2GA2A 4I09A 2Z99A 3BZCA 4JBAA 3MKYB 3S1NJ 5BPIA 3ERMA 4M3FA 5GADJ 1R58A 4RGSA 5A2QK 2DOEA 4B3ME 2HU9A 3SEQA 2LH9A 2JR1A 2JYAA 1Z9CA 4LF9E 1W0TA 3PO3J 1IJWC 1Z3YA 1XMKA 2Q0OA 1OJLA 2R7WA 2ENHA 5J40A 1TQMA 1D8JA 2YTGA 1GLNA 2VQGA 3HTUA 4RS8A 2NOGA 4MO7A 3I71A 5ICFA 2G0EA 5H6RA 3F8MA 1MMSA 2B7VA 3HOXJ 3W2VA 1NG6A 4EQQA 1W5TA 2F4IA 3BLYA 3LSKA 4ITVA 3F6HA 5HLTA 3MKWB 3DTEA 4R2DA 2WZOA 4NQWB 1Y1WJ 5F0FA 2CTDA 3FHZA 2RC4A 3ML6A 3WODF 3BY6A 3L7WA 2HYJA 2EM0A 2RDPA 2DSYA 3FWEA 1X1DA 2CO5A 4IKFA 4ANJA 2F8BA 4M30A 2IAIA 1TQIA 2DLKA 2EMHA 1XS9A 4O5GA 2Z2SB 2M30A 1XGNA 3J7YJ 1VNDA 2M4GA 3F8CA 4P9UA 2HS5A 3JAMC 3FIGA 4P1WA 2A25A 1XNQE 1B9MA 2KPMA 4MTDA 1ODDA 1MW7A 4W97A 4N9HA 2L9RA 4S0HB 3OYGA 5E3LA 2Y0SN 3J81K 2VQFE 4Q4ZF 2DQRA 4FE4A 3D5SC 2LR8A 3DPUA 4I98B 2WY7Q 1BC7C 4LTYA 2VC1A 5BNGA 2DODA 2DB2A 5M5XJ 4MFDA 2ELYA 2ZFUA 2LC2A 5ERIA 2JXPA 1RNLA 1SVMA 1T33A 1I50J 3MN2A 4XN3A 3AKZA 3BOQA 4ENKA 1R4NB 1X2NA 3VFZA 5TJJA 2A3SA 3DXJF 4QPOA 2ENAA 4GCVA 2LY2A 2LE2A 1GTKA 3M07A 1Z6RA 1Z7UA 3RKXA 2WBSA 3V42A 1SD4A 3BQZA 3K4MA 3SYTA 1WKMA 4HA8A 3E6CC 2R1FA 2X4HA 1HF0A 2RVCA 2M3AA 2EV0A 2GIZA 4N9IA 2K7IA 2MD5A 1I6HJ 3H5AA 1ZAOA 3ZMVA 2RPCA 3ZP5A 1ETWA 5KAFC 4UUVA 4V19K 4A3LJ 4WPYA 2VJJA 3FF5A 4L5NC 2Y31A 2LFBA 2YTPA 2VQLA 2JJ7A 1U9OA 2MA3A 1YS6A 3HPGA 2KOUA 1XC5A 4UVCA 5IP7J 1MBHA 5GPCA 2RKHA 1R1UA 2M1SA 2W7NA 4EMSA 1G3SA 2F5DA 2M8GX 3MMYB 4UVBA 4BGDA 1STZA 3HSEA 2WWYA 4ENMA 2UXDE 4RH8A 2JPAA 1IG7A 2BXZA 4KISA 2EPAA 4NXNE 5D4RA 2EH3A 3EPLA 3ZMZA 4MTEA 3HPHA 1DGRM 3T8RA 5ILSA 2IS4A 2K9QA 1T08B 2OU2A 5JHFA 1T6SA 2MC4A 3AAFA 1TF6A 2X85A 1QZYA 2L7MP 1V55H 2YX7A 4DJAA 4BHBA 4R2SA 4Y17A 3LA7A 5B66C 5ILUA 1YS7A 2D1VA 3E6MA 1FYMA 2CFOA 4J19A 1WXRA 2DGCA 2HJJA 2LYCA 2P5LC 4LB6B 4OIPF 2V79A 5JR3A 5KL6A 1LDDA 2EB7A 4LFUA 2HFHA 3WU1B 1H9TA 1R9TJ 1G8XA 1MDMA 2HYGD 4X66E 2EV6A 3IH4A 2A6EF 2HZTA 2CW8A 3CCYA 3ZR8X 5GTHC 4GYIA 1PUFB 1AOYA 2HQNA 5FD6A 5CFFE 2LO3A 1D1BA 2WAEA 1HSTA 4BXFA 3ZQHA 4I02A 3ABMH 3L1PA 2EFWA 2AQFA 5ADZA 3CCUI 2ICWG 2IVMA 4WXCA 3D5RC 4B1RA 4BKXA 2EZ6A 1KZHA 2LK2A 3BT9A 4XKCA 1D3YA 1XMAA 3OYAA 3CCSI 4IVNA 3GEZA 1TWAJ 3GTQJ 2P4WA 1T4OA 2EQ0A 1TW2A 2EPZA 3IWDA 5FLXC 1DPRA 5KL2A 2HQAA 5AE1A 1IZ1A 3QPTA 3NWTA 4D1QA 3E1SA 4XLPF 1K7AA 4MEXF 2DPUA 4DGWB 1LNWA 3PM1A 2V6EA 1RUOA 2W85A 1YW8A 5IV8B 3ZOQB 3LSHA 1X6EA 3CO7C 2F4OB 1K79A 3I53A 1EF4A 3M7GA 3E7LA 1P4XA 3K6GA 3TOAA 2ZNZA 3HOSA 5K7HA 1RZ4A 2HQ5A 1ZKGA 2AXLA 3FXLA 3D5LA 4F3QA 3CDIA 2LJUA 1XNRE 1DP7P 3T1YE 2VODA 1EA3A 5DUIA 2I5UA 2M0MA 4DV7E 2UUCE 1VQKI 1U78A 4ZJZA 2IA2A 2XAUA 3EDPA 1ZBQA 2MKNA 1BOAA 1A1LA 1G2HA 1KQ9A 1OFCX 5D5VB 3NARA 3FM3A 3QRFF 2HXOA 4EJUA 1ORKA 1ZG1A 4IRGA 4KT5C 2L0KA 2DYSH 2NS8A 1KU2A 3W3CA 3FHNA 3PFYA 3OYDA 3KETA 1UB9A 3LL7A 4L5JA 5J8FA 1PP7U 2VL8A 2IT0A 3R6SA 5HNFA 2PBIA 3RKYA 3I64A 3I3LA 1IV6A 1ETYA 2H8WA 2ENCA 3HQ1A 2CW7A 4NNJA 3QYBA 2QA4I 3CJTB 1Z0XA 2QQAA 1K78A 4NZVA 2L9VA 1LFBA 1FX7A 3HYIA 2DT6A 4GKKE 3FXRA 4HW0A 4LG0B 2LKPA 1JKPC 4UY8I 2UUZA 2MC6A 1F2IG 3FK7A 2HEOA 4R2CA 4DOZA 1D0YA 2R76A 3DBHB 1R36A 1QVTA 3A01B 2XIGA 3TDUC 1BA5A 2XGDA 1XMQE 4JI8E 4O3MA 3H5RA 3PQKA 2HPMA 3JCUC 1SANA 2PEXA 2WV1A 4M3EA 1A6QA 5J8CA 2FOKA 2A05A 1VQ7I 3DF8A 2WY8Q 4NHJA 4LFAE 1PJTA 2N8GA 5KHDA 5FFZA 4BXXJ 1C0WA 3K4KA 2ZJRF 2O0YA 3LSMA 5GAHJ 3WTWC 1I3QJ 1S3JA 4B48A 3DPLC 2MSYA 2M7QA 2OJED 2KDOA 1KJKA 2ZMEB 3PNVA 4XRSG 4EJTA 1A36A 2P5VA 5H2FC 3UK3C 2DLQA 3B02A 5DD4A 4DR2E 1TBXA 4CO8A 3IUOA 3QPSA 2LRSA 3S15J 4YY3E 1RC9A 3AL0C 2IJLA 5EEHA 1R7JA 2YU3A 3ZMTA 2R7OA 4E70A 3GLLA 4A3BJ 3ECHA 1K83J 3FZVA 4B47A 3HOTA 2V4JC 4EM2A 3BBGA 2VE8A 3BTLA 2RNJA 2VONA 2JPBA 3M3YJ 2DMNA 2A6TA 1VF9A 2PLYA 1VFCA 2ODRC 2DA1A 4JX6A 2IA1A 3OYIA 4QPQA 3KZIC 1NHAA 3EUAA 4B3XA 5ICEA 2IS1A 2COMA 4BL0B 4CCNA 1ETOA 2EBIA 3ULQB 4KFCA 3H9GA 2L2MA 5A6BA 1F43A 4E7LA 3EYIA 3KYCB 2B7TA 3EUHC 2YTNA 2EIMH 1YTYA 2E1MA 4DNCA 4U7BA 1XGMA 4FETA 3QQAA 3LAPA 1VQLI 1CF7A 2P0WA 3WTTC 3MKZA 1N32E 2A5YB 4AYBN 3U1DA 4RBOA 5LL6R 1ZGWA 2M45A 1DQUA 4CHUA 4BHPA 2KL4A 1MZBA 2DOFA 4DBQA 4DYRA 3H09A 4HNUA 2PMUA 2OTJI 1QHGA 5CPRB 3HOVJ 2O61A 2FBKA 2K3FA 1HXDA 5DD8A 3DBRB 3KCCA 4PGHA 3CC7I 2VE9A 1V54H 1P92A 2NRAC 3BC8A 4HX7A 3V7RA 4FTHA 4NXME 3LFKA 1REPC 3AUZA 2STTA 2VT2A 1VQMI 2L54A 1G2DC 2EN7A 1IGNA 1YJNI 2ECBA 5D6FA 3THOB 1SR9A 5D8LB 3DLAA 1GT0C 2E72A 5HS9A 4C3HJ 3I4PA 2Z9OA 1X19A 2HOTA 3SDGA 3P1XA 1FJGE 2NVTJ 4TV7A 1V5GA 1K4SA 3IWBA 2D9HA 3TP3A 2LBFA 2YTFA 3WE2A 1ON1A 2IS2A 4PDKA 4ZH4F 3H36A 1IRZA 3HZJA 3ZQGA 2R7DA 3V7CA 3WTZA 3BG7A 2UXCE 2ZXIA 1KQ0A 2FA5A 2F48A 2VKVA 1QQIA 3TO7A 1J7KA 1WJ5A 4IRHA 3BZKA 1TWCJ 3HB9A 3N97A 3LA3A 2DRPA 4JI4E 2XAJA 1GVDA 3P9KA 4LIUA 3GZ6A 1ULYA 3EPZA 4JK1X 4NC7A 2CG4A 2V1DA 2LNBA 4PFPA 5DV5A 3LSTA 4PSXA 3VYUB 1Z1DA 2R7VA 1A1JA 2QCOA 3IWZA 1TC3C 4M0VA 5F04A 5D5UB 1ZH5A 3I0TA 1HKQA 2KDZA 2TCTA 4BY7J 2XPUA 1RQ0A 3OYHA 2XHKA 3DEUA 2FOWA 4CCLA 1UHMA 1QPIA 2L3CA 1A35A 2BHYA 4GEQB 4KDPA 4XM3A 1J2XA 3Q9SA 2M7BA 1G3YA 4BS9A 3OYFA 2NUFA 4KIBA 3HDDA 3I4MJ 5BOXA 2GM4A 4F2JC 2P6TA 3CZ6A 2FTXB 3RKQA 2GLOA 3GLXA 5DDGA 4YIIA 2KHMA 1S7EA 1OMIA 4UUSB 4X65E 4AC0A 3OYLA 2V26A 1DQ3A 3BJ6A 5HLGA 2EMLA 2COBA 2NXNB 5LHGA 4TUGA 4RB0A 3IH2A 2EOXA 5J3LA 3MHHC 3KEQA 1Y56A 3CF2A 2ODRD 3BTIA 3KEOA 2XRLA 1WI9A 3MVPA 3S1RJ 5IP6A 1X6HA 3C1DA 5IXMB 2ELJA 3QYFA 3R4KA 5DCMB 4A3EJ 2EQ3A 3BF2A 4Q35B 2Q2EB 1LEAA 3LOCA 1MKMA 5EDNA 2P8TA 4NDLA 2ETHA 1I1GA 2N3GA 1FOYA 2HI3A 4QSHA 2WADA 2MDRA 1YOVB 3AG3H 3BR2A 4DR4E 1WJAA 5M5WJ 5FKOA 2BOLA 3E5XA 2JTVA 3OL3A 5JLXA 2WAQA 5HDNA 1T98A 1BR1A 4M2ZA 1NTCA 5LRSA 1GZ6A 2LMZA 2V1NA 1VQOI 2E1OA 2I10A 4RB1A 2KMUA 4A0YA 2B7EA 3W6JB 1YRNA 2VT3A 4KNYA 4KJZA 2MW8A 1OCCH 1G4DA 2PX9A 1XPXA 3NWSA 1UZCA 1IXSB 1B8IB 3DKYA 1PDNC 5E1ZB 3KZYA 1BJAA 2DMTA 4M9VC 2ZBKA 2M87A 1O57A 1X1BA 3QWLA 3H0GJ 1B72B 4IPAA 3FMQA 5IYDJ 4AIJA 4JI6E 2YTQA 3FDYA 5LD2C 2MH9A 3IHUA 5J1RA 4MFEA 4IHSA 1SFUA 1DP3A 5D5XB 4XBFA 1VQ9I 1JJ8C 1WHUA 4IXAA 3V8LA 1F5TA 2YRHA 4LF4E 2L6MA 4OMZA 1V5EA 2GOMA 2QEXI 3B73A 4JYKA 2STWA 3CLQA 2BW3A 4D0PA 3LAJA 1FEXA 4PK4A 1IW7F 1O7FA 3CP2A 2ZXJA 5HLHA 3OR2C 1IAWA 4RAYA 2VPRA 2WBTA 2EFNA 3C2BA 3VYRB 1G59A 1D5YA 2VOOA 4C9YA 1BBOA 3BCAA 1KYQA 5KK1A 4R8OA 2FD5A 2WBMA 3C2GA 2GPIA 2O3FA 5LEJA 2VC0A 1E3HA 1ZR2A 3L2RA 2E2IJ 1YUIA 2LUQA 3IC7A 4V2GA 4DMIA 3KP7A 3B6CA 3K1NA 4RGRA 3CD6I 2L7KA 2GXAA 2G9WA 2AHQA 2IGKA 3QPHA 3TQMA 2UXXA 3HRMA 3JRBA 1J5YA 1MJBA 4RMNA 2WAFA 2EP3A 2NA2A 2VQEE 3ZOBA 4XICA 2ELKA 5F1JA 3K6QA 2KZVA 3VODA 2EM2A 3OWTA 3L2CA 1N25A 3C4TA 3T8TA 4JYAE 2UXNA 3AG4H 2PRTA 2OBPA 3WTXC 1HW2A 3SHFA 2BY2A 2VBXA 2VJ5A 2JZYA 4EJVA 1FTZA 2EN3A 1XCVA 4BJ5C 4FK5C 2L92A 1WCMJ 3HPSA 3M8JA 3A0HC 5FKKA 1JK1A 2P7VB 4R79A 2XB5A 3IWCA 3TO9A 1VQ6I 1IXRC 2HKOA 3GTPJ 4IJAA 4BBSJ 1MBJA 3JRIA 4OOGC 2EOZA 2UV1A 4X6AJ 4M9ZA 2GLIA 3S1MJ 2JOXA 3M1EA 1A04A 5LRRA 1ZN2A 1ZG5A 5EZGA 1SD5A 3K0LA 1ONVA 1FNNA 2E5ZA 2DN0A 3EPJA 4AD9A 2NABA 2Y69H 2YRMA 1KU3A 3TDZC 2E60A 5CVIA 3GYHX 1JHFA 3LWFA 2CUEA 5E79C 4AVZA 1W0UA 4E6KG 3CLOA 1MGTA 1Y6IA 2PFBA 2YS9A 4OU0A 4JI7E 5FGMA 3FXUA 3DTKA 2EFQA 5BPDA 4NHRA 3ZQCA 2JPCA 1UFMA 3REOA 1YG2A 1QHHD 3OMYA 1IQOA 2ZXWH 4PUSA 2ISYA 4M9SA 4MHGA 2UZKA 1X49A 3HOWJ 1BI2A 4YEJA 3W2WA 2KP6A 2DBBA 4XLEA 5F64A 5K1YA 1IC8A 1N3GA 1FC3A 3SDBA 2RAEA 4MLVA 4KZSA 1UILA 1V5FA 4BXUA 4NB5A 5CLSA 5LMNE 2F2EA 2OUMA 1IMUA 1JGSA 3E6DA 3VSKA 2XAQA 4BJ6C 4QTRA 2R7RA 3GTOJ 1FLIA 2WC2A 2DIXA 1TP4A 2IBDA 1J0RA 4ZYHA 1RETA 2R3SA 3TMOA 2R7UA 1FBUA 4HTGA 1XGOA 3I56I 2L8TA 4HOBA 3DP7A 4B3SE 3A4CA 3MWMA 5C3EJ 1MDMB 3OSFA 1BBYA 4P7DA 2HXIA 4R2QA 1X2MA 4DV2E 3VDXA 4DBRA 3G4SI 1HDPA 2VI6A 5ILVA 3CC4I 2M8EA 3G71I 4IJDA 1J59A 3FISA 5A6JA 5FFXA 3DLLF 1A31A 4IHVA 4CXFA 3F8BA 2DFEA 2DXIA 3UNGC 3J7ZI 2FF4A 3C18A 2JN6A 5CJ9A 5LBQA 5K7ZA 2EOOA 3C6KA 3S2DJ 3VHTB 1SMYF 5K7FA 2FX0A 2PJRB 4AQYE 3LLHA 4HF2A 4LF5E 1UG0A 3Q0VA 3WU2C 3CDHA 1U2WA 4UV8A 2LRDA 4D9JA 2UUAE 3HUGA 6PAXA 3VYSB 3V8KA 3GTGJ 1XN7A 2DA6A 4N0BA 2JY9A 3G2BA 1LJ9A 4ESFA 3JRFA 2J5OA 3VYXA 5M3MJ 1USSA 2BY3A 3LQRA 3BR1A 1U8BA 1HR0E 2EZHA 1PDAA 2M9HA 1MSFC 3J7Yp 2EE8A 1IN6A 5FKLA 1WHQA 5CKTA 5AC5A 1MMGA 3L00A 1YI2I 2HZDA 4LK1F 2NVUB 4P5OA 1FBSA 4IHYA 3LFUA 3S8PA 4BACA 2DT7B 2XVCA 2OZUA 1U8RA 2EL4A 3PSIA 2YSRA 2R5YA 4RHBB 5JFRA 2EZLA 1RIOH 2EFOA 4HF1A 2JVHA 4DV1E 2EPMX 5KCMA 4X9JA 2W00A 2DOAA 2EIKH 3FBNB 1U5TC 4XKVA 1EJ9A 3HKZA 2EFPA 2XAFA 3DJWA 2DI3A 4XLAA 5IYCJ 2XASA 2FBIA 2Q8KA 3ASNH 2Y30A 5A69A 2A5WA 3FIWA 4F9BB 3KZZA 1A1HA 5E8IA 4A0ZA 1BN5A 4LB5A 2XSDC 5EG0A 3K10A 1FMWA 2EPCA 1D5VA 3ZMSA 3KP5A 1XD7A 3U2RA 2ZKZA 3MZ8A 2XGCA 1F9NA 2EMXA 2P6SA 1K78B 2DJNA 1LFPA 5KVRA 2W24A 2L02A 4ZZDA 4X1EA 4YRVA 2E1MC 3G1OA 1TNTA 1I27A 2RQQA 4M3DA 5DTDA 2FBHA 4EATA 3OV8A 3S3NA 1LVKA 1G3WA 4EVIA 1VQ4I 4A3KJ 3LNQA 4A0XA 3BPVA 1IBKE 4K2EA 2JSCA 4Y4RA 2EMZA 5FLXZ 1YLFA 1R23A 3IKVA 4OOIA 3CCLI 3VB2A 2L33A 3AV0A 3TL4X 2EMYA 3GCMA 2CUJA 4NC6A 1X5WA 1YE9A 2EOIA 3QP5A 4FT8A 3ABLH 5EGOA 4LITA 2CPNA 1YW9A 1P47A 2FUG2 1FIPA 3MCZA 1X3ZB 3KP3A 1PUEE 5GAEJ 2RGVA 5TISC 4BQAA 2K4BA 3ELKA 5HVQC 1WJDA 1H88C 3TOBA 2LT7A 4F7ZA 4Z6YA 3PJRA 4IX7A 4CCKA 2XAGA 2ZJPF 3LSPA 3HOZJ 2WB1A 4GXOA 2F5CA 3U1KA 2ME6A 4RB3C 2K9LA 5DS9A 1OPCA 3LSIA 4PJ0C 4DUYE 2FNPA 1DU6A 4ZYAA 2K5CA 2VIXA 3ZRGA 3ZMDA 1S29A 5TGTA 3K70C 2FEZA 3JRCA 2ZB9A 3K2AA 4KICA 4HPQA 3MEXA 4A3IJ 1AU7A 1U6GA 1X3WB 2JMWA 2E1MB 4EGYA 2GWRA 1U3EM 2MD0A 1CF7B 3DWLE 4HF0A 4L8NA 2JRMA 3DKWA 1IN4A 1X4OA 5GPAA 5FJ8J 5A2QZ 3VYYA 2X51A 4RA2A 5D4SA 3J80K 4B8XA 1LVAA 1UHSA 5A6AA 1PVEA 3MZYA 4CDGA 3QG5C 2AS5F 4B09A 1Z67A 4LF6E 2QBYA 3EYYA 4JP0A 1F36A 3FK6A 2XROA 1HKTA 2CUZA 1EV7A 2M34A 1L3LA 4M3GA 5B1AH 4B3AA 4A6DA 2VRDA 2MKDA 2VXDA 2DK8A 4M74A 1YIJI 1W5SA 4LK0F 3TP0A 3KYLA 3SZPA 4C3IJ 2JA8J 2A61A 2V85A 5A6BD 2AO9A 4JI3E 3WHCA 1Z77A 2Z1DA 5DEQA 2QSHX 1AAYA 4YG2F 4MIMA 3T0YA 3WHBA 5JLWA 1MIJA 2V86A 2VUMJ 1BI1A 4A2UA 3CCJI 3C4BA 1P4AA 4C3JJ 4YFNF 1O3TA 3BG5A 3N05A 4G7ZF 3OMLA 3JR9A 4E7HA 2QSGX 1ENHA 9ANTA 4OAZA 2EN8A 2EPUA 2DDAA 1JUSA 5F08A 1KU7A 2MG4A 1WI3A 2YSPA 3E3VA 4E7ZA 3J81Z 4DV4E 2PG4A 2G7HA 1VQPI 1BIAA 4E7SA 2O8KA 4WK8F 2LKXA 3KPHA 4BHCA 3P9IA 3U21A 2V1UA 2EM8A 2K9MA 2R7FA 1B9NA 4HEIA 1BIBA 1KYWA 2FSWA 1NK2P 3L2QA 4AIKA 3SFZA 4F52A 2LKSA 1B59A 3RPQA 4BQQA 1Y0UA 4RAGA 2OTLI 4A93J 4U0VA 4II2A 3K9TA 3KLNA 2PJPA 2ADUA 1T39A 2DLLA 3BGHA 4L5EA 4G6DA 1MMNA 5KNLA 1WRJA 2K9SA 3M8EA 5GP9A 3JTZA 4LU9A 5A2QC 5HLIA 1N78A 4JV5E 4JI1E 5F0HA 3DFGA 2GAUA 2HOEA 2ZJ2A 2E2JJ 5LGTA 1XB4A 4HDUA 2GBYA 4FCYA 2YWQA 2XPVA 4OWRB 3K70D 2ZXHA 2AXTC 3TEDA 4JOMA 2KRHA 4JI0E 3JREA 1KQ8A 1R1VA 1MNEA 1PP8F 4CZZA 4LFCE 4LFBE 3JSPA 1XSDA 2YTEA 4XR6A 3DEEA 1SFEA 1MMAA 4UXNA 1CQTA 4Y7NJ 3K1PA 2ISZA 2V1XA 1A1FA 2M5WA 2YTOA 1FZPB 2HR3A 5FD5A 4LD5A 2C6YA 4OMYA 3WGIA 2LOOA 4HDVA 2E19A 3NQOA 3B6AA 4UHTA 1IDZA 3HL2A 2F5EA 3H1CA 4A69C 1YRNB 3JRDA 1U5TA 1XGSA 2I13A 3MFKA 4HBLA 1X1AA 1OKRA 1WHNA 4ZDLA 3Q5FA 4HSRA 3TQNA 1Z1BA 1Z6TA 2CH0A 3HGYA 2NUGA 5AE2A 4WFTA 1LLMC 2LY1A 3SZGA 3J81C 1JUMA 3OR1C 1BR2A 1F1ZA 5HDGA 3RTRA 3DCFA 1WJFA 2JA7J 3L2WA 4MQ9F 3WTYC 2H8RA 4BC9A 1FP1D 5LHHA 3I59B 2H1KA 1E3PA 1KGSA 2KHXA 5LGNA 4YFXF 1IBLE 3TW7A 3G6EI 2HKXA 2EMIA 4DKKA 3DKXA 1Q1HA 2OAZA 5CVRA 1I3AA 4DV6E 3H0DA 1OCZH 3HJEA 4EJWA 1FT9A 2BW3B 2XKPA 3FM5A 3J80Z 2CV2A 1YX3A 1KONA 4CYCA 3T5XA 1MJ9A 3CUQC 3DF6A 4L0ZB 3IL2A 4LF7E 3GZ5A 4IO9F 2V8QB 1LE8A 2RSMA 1MD0A 2L4MA 3BCBA 3NAUA 3IV5A 1GXPA 3CJRB 2DW4A 5E8GA 4DW6A 1GVJA 4XRMA 1LFUP 3OIOA 2CT1A 3FXMA 3KFWX 4F55A 5D5WB 1XSVA 4OIOF 4PZJA 3DQVC 1MSEC 3VEPA 4AVPA 4MNUA 3I4NJ 5DCFA 2HOSA 2EA2A 2MLGA 2M4IA 3G1LA 4XORA 2HDDA 1Q1VA 4RGXA 4XMYA 4KMFA 1ZAAC 3K2ZA 2E1NA 3CJNA 2Q1ZB 2EMAA 2EMGA 2MDGA 3GFJA 3ONQA 2CQNA 4IEJA 4J01A 5KL5A 2PN6A 4FISA 3FBIB 5J6XA 2Y2ZA 3E5QA 2XF5A 2ID3A 1ZG3A 5IT3A 2EPNA 3KLOA 3ZN1A 5F27A 1FYKA 3FMRA 4L9TA 4LOCA 3AL0B 5FB2A 2LDUA 1HNXE 4M73A 3SXYA 2RN7A 5LEKA 1L4SA 3TO6A 2XF7A 4R8HA 3BIDA 5HS8A 1PJQA 1QNTA 3QOEA 3RSNA 2NS7A 1T4NA 2B9DA 2V88A 4L9VA 2UXBE 2G7UA 1A1IA 3VYTB 4MEYF 1D8KA 1DI2A 4HLYA 2JUCA 2E7XA 4AM3A 3P7NA 4OINF 4HV6A 1BBGA 2A68F 2AQEA 1OCTC 1BOBA 2HNHA 4HEA2 2MGQA 3P5JA 3R0JA 1IDYA 2A07F 3WU0A 1KYZA 1P6RA 2EPXA 2K27A 1PYVA 2B9SA 1R4MB 1TWHJ 2YR2A 2HPIA 3D0SA 4NC8A 3IRRA 1SC7A 2L01A 1JXSA 2VBZA 2JVGA 1N34E 3ABTA 1P4WA 4PCQA 1S7OA 2D1HA 4RLFA 1RESA 2CYYA 3BTCA 3VSLA 3J80C 2EWLA 4BY1J 4FE7A 1NCSA 4B43A 1V4RA 3RJPA 1VQ8I 1JTYA 5FKMA 4RGUA 1QA6A 5B1BH 2E5LE 2M4KA 1PJSA 2ELZA 4XL9A 1GV2A 5C4JJ 3FXKA 2LUPB 2EWNA 2NAZA 4S05A 1RR7A 3Q3SA 2L7FP 2QYOA 5KL4A 4Y13A 2BYVE 2HVQA 3CP8A 4EGZA 3DTIA 4P78A 3RZDJ 1EKEA 1BJZA 2L3DA 4AUXA 3L9FA 3CMEI 4BE2A 1VTNC 2E71A 4Y3OA 1TTYA 1T4LB 1G2FC 3BR3A 4RM2A 3ZN0A 4F54A 1T8IA 1QU3A 2X1DA 3CUOA 1B4AA 2OQRA 2NVQJ 1H9GA 3M1CA 2MC5A 3FMSA 2ME0A 2W4SA 5L3CA 3OY9A 2NOJB 4D5FA 4XSZF 5A6KA 1YPNA 3S2WA 2H1LA 4JI2E 2EJ4A 2BB8A 2V87A 4QLCU 1JKOC 1Z21A 3RI4A 2DAOA 4GZNC 2RNGA 2YX4A 3QU6A 2EMBA 5JHUA 3UKGA 2FGGA 2V6CA 4EEFG 2HOAA 2DDBA 5L3DA 4JX5A 3HTXA 3E97A 3MD2A 4HX8A 2CRGA 3GZNB 3SZTA 3HUGB 2FJ1A 3BJOA 1N77A 4KA4A 1ZQ3P 1QBJA 1FKAE 1ACIA 1YITI 1X3CA 4R2PA 4DR1E 4DV5E 2JRTA 3ADIA 2ZSHB 4I2OA 3SJMA 2JSPA 4KYWA 1FJLA 2NNYA 3K4LA 4OX9E 4O4KA 5FLVA 3HRTA 4R2AA 1AKHA 4DYCA 2EILH 1EH7A 1ZK8A 4G8XA 1HLVA 4A5NA 2CW0F 1SFXA 1BW6A 2EMKA 2QZ8A 1WWXA 2E35A 3CJQB 3KX2A 3CESA 3ECOA 3KEYA 4II3A 2R5YB 1YO5C 2MC3A 4ESBA 1FOKA 2XV4S 3AFHA 4M9XA 1SFKA 1VQ5I 3E6BA 1WH5A 1J09A 1HA8A 3ABKH 2R7QA 1R22A 3BWGA 4GGGA 2YT4A 4RDUA 5EJCA 1FOXA 4XOPA 2R92J 2OD5A 1S72I 3Q0WA 2DPDA 3RZOJ 5CQGA 1SD6A 5HODA 4JI5E 2DK5A 2GHFA 1UAAA 1RRJA 2DT5A 1P7JA 2KIFA 2KIMA 1FYLA 1IXCA 3HKZN 3OSGA 3V4GA 5AONA 2QSFX 2BGCA 2RV8A 2EPKX 5CQEA 4MGRA 1DPUA 4NUBA 1MBGA 1RKTA 3D1NI 2EL6A 3F6GA 1I94E 3WE3A 5BQTA 2QGUA 3H9QA 3HBLA 3HHGA 3JRAA 1DU0A 1WGXA 4CCOA 5EEGA 4HNTA 2EIJH 1GQEA 1Y8QB 3VK6A 2QQBA 1MNMC 3DV8A 3EPKA 3C6MA 4XONA 3HM5A 3LSJA 5AC4A 2MFZA 2E2HJ 2IHR1 1GXQA 3ZXSA 1Y39A 1B1BA 2KQRA 4ETSA 1YSAC 5EF6A 2MYSA 4CH7A 4MLOA 3CUQA 1AH5A 1QRYA 2OF7A 4F6MA 2NNNA 1BR4A 1Z7LA 4ABZA 5EGOB 1IF1A 2W48A 3BPXA 4BAYA 5FRMA 3ZGKA 2VPLA 2BEOA 3G3ZA 3IAS2 4XN0A 1IV8A 5EEAA 4BC7A 2EMWA 4ZDOA 4ENNA 2YTIA 2NUEA 4ZYEA 2OV7A 4F6NA 4BE0A 5IP9J 1WVRA 4XK4A 1JHHA 5AE3A 3JRGA 2E1CA 3GTJJ 2EM5A 2CQXA 2F5FA 2ZNYA 3O8GA 3LA2A 3VWBA 4D7MA 4DYQA 4ZZLA 3O2PE 2LD5A 2BY1A 3GFMA 3J7AY 2FRHA 2Y75A 1T2KA 1W5CC 2R7XA 3HPZA 4ZDPA 1FPQA 2UU9E 2PMZA 3S17J 4DR7E 2GOXB 2E7WA 3OYMA 1OYWA 2J5PA 1XTAA 5D8KB 2WB1N 4E7IA 4UNOA 4KIFA 3OYNA 2M1BA 5F1RA 2DFIA 3HG9A 2ZM6E 1AA7A 2O03A 3CMMA 1IRGA 3PNTA 1GDTA 1K6YA 4D7NA 3ZPLA 1O3SA 2VKHA 3GMEA 4IOCF 5JI6A 3DU6A 1T38A 2P7CB 4KT6A 4GDFA 2FU4A 3GTKJ 1POGA 2FQ4A 5E17F 2N8XA 3ECRA 3FKIJ 3UR3C 4CZCA 1BI0A 2XPWA 2M7AA 1Z3XA 3WGGA 2QBYB 4HNVA 2VE7C 1R49A 1AWCA 4H4KC 1X4PA 4KN4X 4ASNA 2XRNA 1RPWA 2MH2A 5DYMA 4FX4A 4PFOA 2EOQA 3K4JA 2Q8UA 4XQFA 3RIRA 4I8OA 2KRFA 4CICA 2BVMA 3P9CA 2KZGA 5EYRA 3F22A 4DR6E 1R5ID 4LLNA 3DU5A 2R7ZJ 2EM7A 1B8IA 3GTLJ 3F0CA 2EOHA 1ZU1A 1LDJA 1TNSA 4CYDA 1FIAA 3JW4A 1B72A 3OIQA 2CV0A 1O7LA 2XSJC 4IHXA 3CCQI 4BNCA 4OIQF 1RR8C 1HQCA 3GXOA 2EN2A 2V9PA 1W7PD 2X6YA 2FMYA 2DMUA 1I5ZA 3EUKL 1OLTA 4A6EA 1UJ8A 4WX9A 2EL5A 3BTJA 2W1OA 2XAHA 2V7FA 2BXYA 3F6OA 2KRCA 1UBDC 2O9LA 3R0AA 4BDZA 4YHHE 2EPOA 4U0WA 3TW6A 2VBWA 3NEUA 1JT6A 1P2FA 3PUFA 3CF5F 4WCGA 1WFXA 2D2WA 4M6YA 3V8JA 4TUIA 3JU0A 1W1WE 2X9DA 5KL7A 3X2QH 3RMPA 2HDWA 5IT9K 1VI0A 4RM3A 2VF1A 1DGWY 1SD7A 3MZHA 2DMQA 2ZJQF 3MKLA 2FMLA 2P81A 4A3MJ 3HGGA 2LJHA 1Y8RB 1TF3A 4KHPE 2DA5A 5F6FA 4XKWA 4G9YA 5IPAA 1WH7A 3CC2I 2LTRA 3M8FA 4BBYA 1TT5B 4CSWA 2K7LA 3I54A 1G6NA 1OYIA 1JE8A 4CCMA 3EPHA 1TZLA 1JJ6C 1R1TA 5CVJA 2DCEA 4X8WA 3S32A 3KP2A 3M9AA 4XLFA 5K5OA 3H3ZA 2LV2A 1BM9A 2L3JA 4WF2A 1JGGA 1YZ9A 3PL8A 5C44J 2VOPA 1NG7A 3ZQQA 2HYFA 3KE2A 2RQPA 2XUBA 4IF4A 4PJLA 3ESWB 3PO2J 3OYKA 1HNZE 1BC8C 4HAMA 5ICCA 2B3TB 1H8AC 5TSEA 2JUGA 4HZFA 4Q48A 3GF2A 3FKJA 1W36C 1YUJA 4EV0A 2K02A 4Y15A 2NS0A 4FX0A 5E1XA 2DO7A 1E0EA 4L9NA 1A1GA 1B6AA 1MBEA 2VJIA 3R61A 3IWFA 3RQIA 5E3MA 4BE1A 2TDXA 4BYYA 3S3OA 2R5ZA 5FROA 3VPRA 4AU7A 4EM1A 4XNFA 2EOSA 2ZCWA 4F91B 3CCRI 5H6QA 2IS6A 1U5TB 4FHTA 2I9IA 1D0XA 3L2UA 3HEFA 4I0BA 2EQ1A 2VQCA 2X6XA 2XGXA 3COAC 2YSOA 2E36A 3RQ4A 4ZTJA 3GW2A 4IS1C 3HOUJ 3LMLA 2EPRA 1ZHFA 4D5CA 1SAXA 4B4CA 4CUGA 3CTAA 2FV4B 5F0CA 2H6BA 1DDNA 1TWFJ 4KMUX 2IGOA 4G6QA 1OCRH 4DR5E 4C30A 5D6EA 2LF8A 2EN1A 4YELA 2ZSIB 2ACJA 3FXQA 2ZFWA 5L3BA 1MEYC 3TBIA 2R4GA 2CSHA 2LMDA 2LSOA 5LHIA 2YZTA 3WG9A 1USTA 2EMFA 1SMTA 4LLGF 5CVVA 2VB6A 1TLHB 3BJAA 4CYCB 1TN9A 2RS7A 2LTPA 3PIPF 1W7PA 2DFFA 3RKWA 1LE8B 1MH4A 4B3TE 3KIOA 4ON0A 2OCEA 1ZRFA 3S1QJ 2W82A 4BEHA 1OR7A 2L4AA 2JA2A 2HGCA 2QENA 1UHWA 3IKTA 1LB2A 2KIUA 2F5VA 1Y0NA 2GA1A 2KFDA 1FTTA 3OL4A 3EETA 2CV1A 3JTGA 4E7KA 5IOYA 4A3JJ 1UHZA 3F8FA 5DNYA 2DTRA 2VLAA 5EZHA 3BDDA 2BE5F 3HTSB 1XG1A 1ZGJA 3OS0A 4QWQA 2BY0A 2EA4A 1Y1VJ 3K4CA 2CFXA 5KAIC 4L9JA 2EORA 1U9NA 3QAHA 4PGGA 2PJRA 1IN5A 3TKYA 2I8DA 4M6VA 2JT1A 2OPTA 4X64E 2LBFB 1U0JA 5LLQA 2EOYA 1LKXA 3S3MA 4G6TB 1ZLJA 5IY5H 3CMYA 2JQ7A 4LF8E 4U88A 3OYJA 3CDLA 3OOPA 3AG1H 1YFHA 1ZR9A 3FX3A 4G7HF 2EOJA 2HDCA 2H94A 4U7DA 2LG4A 1YIOA 3J7AG 2IW5A 4C2UA 1ETXA 1ZELA 1UG2A 1K4TA 2HTJA 3LMMA 2YU9J 4XSXF 2M9AA 3ISPA 2QVOA 4E4HA 3ZQIA 1FSEA 3I5UA 5IT9Z 4BU2A 5BS6A 3QPLA 1YYVA 2LVSA 2QF7A 3PUBA 5AIPA 2HC5A 1W36D 1S6LA 4U87A 3OYEA 4M3BA 3ADGA 3HIFA 4O43A 3BZ6A 2HTSA 2QM3A 4NBQA 2O6GE 1QU6A 4L0YB 2H09A 2VQHA 3ADJA 4NQWA 3CMAI 1WJBA 3F8NA 2M2EA 1RUNA 4DV0E 4LMYA 1F4KA 3GFLA 3I9V2 1HC8A 2Y0SA 2OCCH 2ZMEC 4JX4A 3ZQFA 2EOFA 4WSGA 1VZ0A 5H20A 2RS6A 2QKLB 3O3KA 3ROUA 2DA7A 2FE3A 2FXAA 2RREA 3L09A 3JSOA 4UVAA 2B0LA 1MMDA 4BJTA 3HRUA 3GWZA 4ZYGA 3OTOE 2A6HF 4N4RB 1M1EB 1TWGJ 5T6JA 4P55A 2DA4A 4AIHA 2CU7A 4I01A 3PQJA 4YFKF 3SQNA 3HC7A 2GXBA 3TGNA 1N75A 1OCPA 1A6IA 1KU9A 4RB2C 1IN8A 4UB8C 1MH3A 4BUPA 1R00A 2OZ6A 4Q5SF 2ESHA 5K5QA 1I1SA 1RKWA 2QQ9A 5B3SH 1ERDA 4BCAA 1YX5A 3ADLA 3O8HA 1Z05A 1K61A 1YJWI 3H5NA 2CGPA 4GO1A 1J26A 3Q0UA 2H27A 2Y48A 1I6XA 2DYRH 4KUMA 4XIDA 4ESJA 4F9CB 4YIFA 4KITB 5L3FA 2F4VE 1E3OC 2LLKA 2R7TA 1D1AA 1XCBA 5BMZA 5GTIC 2GIVA 3HSRA 5JVGF 4ENJA 2IGNA 2X0LA 4GRIA 1APLC 1B69A 4GKJE 1S5LC 4IOAF 4DQ2A 2LTSA 1T0FC 1HCRA 2PMHA 1HW5A 2KISA 3DBLB 1UCRA 3QOPA 2WAQN 3IP4B 4PJMA 2XKOA 5L3GA 1YJ9I 4BDYA 4XLHA 5J4VA 2FQ3A 5E1WA 1LDKB 5IT9C 1ZARA 2K9NA 4PJNA 3U9GA 1AHDP 2CQ7A 4UB6C 2L9NA 3K7AJ 2EV5A 2DTZA 2QQ8A 2WV0A 3H3UA 1E2XA 2DQLA 5DM7F 1IUFA 4DZPA 3GX4X 2HGHA 1R6RA 1ZRCA 1P7IA 1YYKA 3KP4A 5FO5A 4GYGA 5CVUA 3WG7H 3OYCA 1JT0A 5LFAA 2EOEA 1SVLA 1E17A 1HOMA 2ECCA 2EZIA 1AKHB 2GQQA 4O6JA 4OAYA 2DU9A 4BQNA 4RLQA 4M6XA 2XC7A 2X1CA 4H0EA 1O3RA 5IYBJ 1X6FA 3W2AA 2MBFA 4ZC3A 3ZQ7A 1FY7A 4N4NB 2IPQX 1PKPA 4AIDA 2RQLA 3F9KA 4Q28A 5F3WA 2JP9A 4I7HA 2K4JA 2IRFG 2P5KA 4G12A 1PUFA 2YUSA 1D1CA 1X47A 1N33E 4S04A 1J9IA 1OISA 4J8ZA 5J47A 5CYVA 4IRIA 2QWWA 3DPTA 3FXOA 4MLQA 5C4XJ 5IWAE 1FBQA 2E34A 4BQOA 2EM4A 2K85A 5LGUA 4R1HA 1NK3P 4A3CJ 4LJZF 2X48A 2OQGA 2XDVA 1DUXC 5FLMJ 3RCOA 4ZTFA 2MABA 4HQEA 3BR0A 2BV6A 2N3HA 4FQGA 2DMIA 3AG2H 3MAJA 1Z91A 2LY9A 4IHWA 5TRDA 2ADRA 3OS1A 1ZRDA 3GO5A 3RYRA 2VXZA 2K86A 4Z2YA 3K69A 2EPFA 1SFOJ 1XX5A 3E0JB 3J7AO 1FMVA 1MJAA 4F9AB 2KKOA 2X6OA 1R71A 3PNYA 2KONA 5HDKA 1IN7A 1IO2A 4XOTA 2BZTA 1T56A 4AWXB 5ED4A 3GBGA 3C2HA 4G94A 1LUJB 1RI7A 3HHHA 3C3WA 2L2KB 2ELHA 3EQ1A 2UUBE 4R2RA 4PJJA 3CUQB 1HBXG 3NRVA 1BB8A 4IZZA 5L3EA 1RC7A 2B63J 4P9FA 1HNWE 1MBFA 1G3TA 2QKMB 1ZBTA 3W6KB 2HWVA 2L7ZA 3GUDA 3DEWA 4CA0A 4XRFA 2YTJA 4Y33A 2CQQA 5M3FJ 1N36E 4CGZA 3A1YA 3IRQA 3S14J 5E3NA 1T95A 2DA2A 5AASA 1SVOA 1YQAA 1H89C 1EH6A 2CMPA 2VN2A 2DMPA 2MLKA 4OIRF 1FOWA 2Z3YA 3BP8A 3KP6A 2X6WA 2F6CA 2W57A 5GAGJ 4EJOA 1S7AA 4LG3A 2R7SA 3QODA 2ZO4A 2O5RA 4HRIA 1ETQA 1MNDA 3MHSC 4RAFA 3CCVI 3HXLA 4L18B 1QZZA 1VQNI 3K1MA 5BR8E 2L5QA 2L9SA 4I99C 4KWYA 2EMCA 1GV5A 1NH3A 2IP2A 2KJCA 3MQ0A 4XRSA 1O3QA 1HSJA 3RPUD 5M5YJ 2D45A 2EPLX 2ID6A 2XF6A 1FSHA 2V89A 1SEUA 1YHQI 1YYOA 2O7OA 1R5GA 1X58A 3R60A 4LG0A 5K5RA 3G1MA 3EQLF 3CCMI 1EKZA 2VKDA 1OYYA 2DFHA 2Z16A 2X1EA 4M71A 2KT0A 2BBYA 5FKNA 4IQ4A 5J1YA 4WYQB 1ETKA 4J00A 3GFIA 1XDUA 4XLNF 3A01A 3GTMJ 3S2HJ 4A3DJ 2NVXJ 1O0WA 2PMZN 3H92A 2W25A 2LCEA 2YTDA 1TW3A 1K6OA 4C2TA 1XDSA 1ZREA 4I76A 2V9KA 3MSWA 2YU5A 4HG2A 3T1HE 1ZTRA 5IOZA 1PJRA 4P96A 4IL6C 3RYPA 2YRKA 2JA6J 2E5NA 2IXSA 3F72A 2D5VA 4HQMA 1LPQA 2OC6A 2JWTA 1JUPA 1OCOH 4O5VA 5AIQA 3KYDB 2ZC2A 1ZGAA 2VKEA 1RMDA 3JAMK 4XKBA 5DM6F 2KIQA 2W84A 3SFIA 2ZMEA 3N4MA 4WSPA 1UN6B 2OA4A 3FXJA 1ZLKA 3S16J 4WWCA 1SAUA 2H6CA 1BW5A 1NEIA 4KN7X 2YU8A 2GXGA 3QU3A 3KWRA 2XB0X 5E3OA 1WJPA 1IBME 4UUTA 1OQYA 5HOOA 4X62E 1LQ1A 1EH8A 1WSUA 4KIGA 1IRFA 1JI8A 4QIWN 3I59A 4A3FJ 3H35A 4AYBA 1X1CA 1CGPA 4WXHA 4IQJA 2LVHA 1DGCA 1XMOE 3BG6A 4BBRJ 2K40A 3OYBA 4HX4A 2HHHE 4A12A 2EM9A 2LF7A 1S8NA 1XSXA 1P9QC 2IA0A 4I0AA 3JTHA 2UWMA 4JQFA 1TQPA 1ZYRF 2CUFA 2K3PA 4XLCA 2XGEA 2EN6A 1ZR4A 4I6ZA 1J5EE 3ZCOA 3O6BB 2EQRA 3LSRA 4IHTA 2DJIA 1HKSA 3HRSA 3L2VA 2CJJA 5FRNA 3S93A 4MQVA 2RSIA 2DA3A 4F92B 1X3UA 1O4XA 2EPPA 1QGPA 4N4OB 2YPNA 5J4YA 4R2EA 3PFIA 5KL3A 2QUFA 1T0FA 5EG0B 1IQSA 2LBSB 3T1BA 4K0KE 4CCJA 2F4MB 4X0GA 1JKQC 2JK3A 1ITYA 2EJRA 1WJCA 2PQ8A 3PSFA 4LGWA 2JOBA 4WXDA 4FASD 5HNHA 2LREA 3OOUA 3ABUA 2WTEA 2EOMA 1WQ2A 3G73A 1WPKA 3OS2A 1H0MA 3CO6C 2TRTA 2NVYJ 1TL8A 4HSTA 3HSFA 2ESNA 3K4NA 1BL0A 2CWEA 2A69F 1D0ZA 2KLOA 3CCEI 3LSGA 4Q47A 3RDIA 1QVUA 2CS3A 2EZKA 4L5IA 5LMUE 1OR7C 3RPUA 4E7JA 1IUYA 1HDDC 3LQQA 2WBUA 1FP2A 3THNA 1X48A 1UELB 4HV5A 3CQZJ 2EINH 2V9VA 1WJEA 4W1UA 1JKRC 1V3FA 2JVAA 2JA5J 2CQKA 3H3VK 4YIRX 3BG3A 5HS7A 3I55I 3ZMUA 2Y9YA 1LEBA
chains in the Genus database with same CATH topology
1L0OC 3WGHA 2PI0A 4HYEA 2O8XA 2FNAA 3EUHA 3Q9VA 5E18F 1BI3A 2EK5A 4G7OF 3GVAA 5JVTA 2HQRA 2VBYA 5FLXK 4HLXA 3F3XA 2CSOA 5ICGA 3QP6A 3C7JA 2Z33A 2Y0MA 4RAZA 1ON2A 3F6VA 1GHCA 2QLZA 4M72A 4U0YA 1W4MA 1QPMA 3BROA 2Z5UA 5DCMA 2Q2EA 2GZWA 4A5MA 5E20A 1W7PB 2YPRA 3I58A 1R5HA 3JAMZ 2KJBA 4EM0B 1FWZA 3ERED 2NYXA 1QO0D 3WTUC 4LLLA 4BH9A 3WTVC 3WTSC 4UV9A 1KA8A 3F21A 3E5UA 3V7SA 3VOEA 1J75A 3F23A 1YW7A 1HW1A 5DUKA 4ZYDA 4I09A 2GA2A 2Z99A 4JBAA 5BPIA 1R58A 4RGSA 5A2QK 1Z9CA 1XMKA 2Q0OA 1TQMA 1D8JA 3HTUA 4RS8A 3I71A 5ICFA 5H6RA 3F8MA 4EQQA 1W5TA 3FHZA 2RC4A 3ML6A 3WODF 3BY6A 3L7WA 2RDPA 3FWEA 2CO5A 1TQIA 2M30A 1XGNA 3F8CA 4P9UA 2HS5A 1B9MA 4MTDA 1ODDA 4N9HA 3J81K 4Q4ZF 2DQRA 4I98B 1BC7C 2VC1A 5ERIA 1RNLA 3BOQA 4ENKA 3VFZA 5TJJA 2A3SA 3DXJF 4GCVA 1Z6RA 1Z7UA 3RKXA 1SD4A 1WKMA 4HA8A 3E6CC 2X4HA 2RVCA 2EV0A 4N9IA 2MD5A 1ZAOA 3ZMVA 3ZP5A 4UUVA 3FF5A 2MA3A 1YS6A 4UVCA 2RKHA 1R1UA 4EMSA 1G3SA 2F5DA 4UVBA 1STZA 3HSEA 2WWYA 4ENMA 5D4RA 3ZMZA 4MTEA 3T8RA 5ILSA 2OU2A 1T6SA 3AAFA 1QZYA 2YX7A 4BHBA 4Y17A 3LA7A 5ILUA 1YS7A 2D1VA 3E6MA 1FYMA 2P5LC 4LB6B 4OIPF 2V79A 5JR3A 1LDDA 2EB7A 4LFUA 2HFHA 3WU1B 1H9TA 1MDMA 2HYGD 2EV6A 2A6EF 2HZTA 4GYIA 1AOYA 2HQNA 5FD6A 1HSTA 4I02A 2EFWA 2IVMA 4WXCA 1D3YA 1XMAA 4IVNA 3GEZA 2P4WA 1TW2A 1DPRA 1IZ1A 3QPTA 4XLPF 1K7AA 4MEXF 2DPUA 1LNWA 1RUOA 2W85A 1YW8A 3CO7C 1K79A 3I53A 3M7GA 1P4XA 3TOAA 2ZNZA 3HOSA 1RZ4A 2AXLA 3D5LA 1DP7P 2VODA 5DUIA 1U78A 2IA2A 3EDPA 1BOAA 1KQ9A 5D5VB 1ZG1A 3FM3A 3QRFF 4EJUA 4IRGA 4KT5C 1KU2A 3KETA 1UB9A 4L5JA 1PP7U 5J8FA 2IT0A 3R6SA 2PBIA 3RKYA 3I64A 2QQAA 1K78A 3HYIA 1FX7A 3FXRA 4HW0A 4LG0B 2LKPA 2HEOA 1R36A 2XIGA 3TDUC 4O3MA 3PQKA 2PEXA 5J8CA 2FOKA 3DF8A 4NHJA 5FFZA 1C0WA 2O0YA 3WTWC 1S3JA 3DPLC 2ZMEB 4EJTA 2P5VA 3B02A 5DD4A 1TBXA 4CO8A 2IJLA 5EEHA 1R7JA 2YU3A 3ZMTA 4E70A 3ECHA 3FZVA 3HOTA 4EM2A 2VE8A 2RNJA 2VONA 2JPBA 2PLYA 2IA1A 1NHAA 5ICEA 2COMA 4KFCA 3ULQB 3EYIA 1YTYA 4DNCA 4U7BA 1XGMA 3LAPA 1CF7A 3WTTC 2A5YB 3U1DA 2M45A 4CHUA 4BHPA 1MZBA 2PMUA 2O61A 2FBKA 1HXDA 5DD8A 3KCCA 4PGHA 2VE9A 1P92A 2NRAC 4HX7A 3V7RA 3LFKA 1REPC 2STTA 2VT2A 2L54A 5D6FA 5D8LB 5HS9A 3I4PA 2Z9OA 4TV7A 3WE2A 1ON1A 4PDKA 4ZH4F 2R7DA 3V7CA 3WTZA 1KQ0A 2FA5A 3TO7A 1QQIA 1J7KA 4IRHA 3N97A 3LA3A 2XAJA 3P9KA 3GZ6A 1ULYA 4JK1X 2CG4A 2V1DA 2LNBA 5DV5A 3LSTA 1Z1DA 3IWZA 5D5UB 1ZH5A 3I0TA 1HKQA 2XHKA 3DEUA 1UHMA 4KDPA 1J2XA 3Q9SA 1G3YA 4KIBA 5BOXA 2P6TA 3GLXA 5DDGA 4YIIA 1OMIA 3BJ6A 5HLGA 5LHGA 4RB0A 3KEQA 3KEOA 1WI9A 3C1DA 5DCMB 3R4KA 1LEAA 1MKMA 2P8TA 2ETHA 1I1GA 3E5XA 2JTVA 5HDNA 1T98A 5LRSA 4RB1A 4A0YA 3W6JB 2VT3A 4KNYA 1G4DA 1IXSB 1PDNC 5E1ZB 3KZYA 1BJAA 2ZBKA 2M87A 1O57A 4IPAA 3FMQA 4AIJA 2MH9A 3IHUA 4IHSA 1SFUA 5D5XB 4XBFA 4IXAA 3V8LA 1F5TA 4OMZA 3B73A 2STWA 4D0PA 3LAJA 1IW7F 1O7FA 5HLHA 2ZXJA 1IAWA 4RAYA 2EFNA 2VOOA 5KK1A 2O3FA 5LEJA 2VC0A 3IC7A 3KP7A 3K1NA 4RGRA 2G9WA 3QPHA 2UXXA 3HRMA 1J5YA 1MJBA 3VODA 3L2CA 3T8TA 2UXNA 2OBPA 3WTXC 1HW2A 3SHFA 2VBXA 2JZYA 4EJVA 1XCVA 2P7VB 4R79A 3TO9A 1IXRC 2HKOA 4IJAA 4M9ZA 3M1EA 1A04A 5LRRA 1ZN2A 1ZG5A 1SD5A 3K0LA 1ONVA 1FNNA 4AD9A 1KU3A 3TDZC 5CVIA 3GYHX 1JHFA 3LWFA 3CLOA 1MGTA 2PFBA 4OU0A 5FGMA 3FXUA 2EFQA 5BPDA 2JPCA 1UFMA 3REOA 1YG2A 2ISYA 4M9SA 4MHGA 2UZKA 1BI2A 2DBBA 5F64A 5K1YA 1FC3A 4BXUA 4NB5A 5CLSA 2F2EA 1JGSA 3E6DA 1FLIA 2XAQA 2WC2A 4ZYHA 1J0RA 2R3SA 1FBUA 1XGOA 4HOBA 3DP7A 3MWMA 1MDMB 1BBYA 5ILVA 2M8EA 1J59A 5FFXA 4CXFA 3F8BA 2FF4A 3C18A 5CJ9A 5LBQA 1SMYF 4HF2A 3CDHA 1U2WA 4UV8A 3HUGA 6PAXA 3V8KA 1XN7A 4N0BA 1LJ9A 4ESFA 2J5OA 1USSA 3LQRA 1IN6A 3L00A 4LK1F 4P5OA 1FBSA 2XVCA 2OZUA 1U8RA 2YSRA 5JFRA 1RIOH 2EFOA 4HF1A 1U5TC 2EFPA 2XAFA 2DI3A 2XASA 2FBIA 2Q8KA 3KZZA 5E8IA 4A0ZA 1BN5A 4LB5A 1D5VA 3ZMSA 3KP5A 1XD7A 3U2RA 2ZKZA 1F9NA 2P6SA 1K78B 5KVRA 2W24A 2L02A 4ZZDA 1TNTA 1I27A 2FBHA 3OV8A 1G3WA 4EVIA 4A0XA 3BPVA 4K2EA 2JSCA 5FLXZ 1YLFA 1R23A 3IKVA 4OOIA 3VB2A 3QP5A 4FT8A 1YW9A 3MCZA 3KP3A 1PUEE 2RGVA 4BQAA 2K4BA 3ELKA 5HVQC 3TOBA 4F7ZA 2XAGA 4GXOA 2F5CA 4RB3C 1OPCA 2FNPA 3ZMDA 1S29A 2FEZA 4KICA 3MEXA 1U6GA 4EGYA 2GWRA 1U3EM 1CF7B 4HF0A 3DKWA 1IN4A 5A2QZ 5D4SA 3J80K 4B8XA 1LVAA 3MZYA 4CDGA 2AS5F 4B09A 2QBYA 3EYYA 2XROA 1HKTA 1EV7A 4A6DA 2DK8A 4M74A 1W5SA 4LK0F 3SZPA 2A61A 5DEQA 4YG2F 3T0YA 1BI1A 4A2UA 1P4AA 4YFNF 1O3TA 4G7ZF 1KU7A 3E3VA 3J81Z 2PG4A 2G7HA 1BIAA 4WK8F 4BHCA 2V1UA 3P9IA 2R7FA 1B9NA 1BIBA 1KYWA 2FSWA 4AIKA 3SFZA 3RPQA 1B59A 1Y0UA 4U0VA 3K9TA 3KLNA 2PJPA 2ADUA 1T39A 2DLLA 4G6DA 1WRJA 3M8EA 5HLIA 3DFGA 2GAUA 2HOEA 2ZJ2A 5LGTA 1XB4A 4HDUA 1KQ8A 1R1VA 1PP8F 4CZZA 3JSPA 1XSDA 1SFEA 4UXNA 3K1PA 2ISZA 2V1XA 2M5WA 1FZPB 2HR3A 5FD5A 4LD5A 2C6YA 4OMYA 3WGIA 4HDVA 3NQOA 4UHTA 2F5EA 1U5TA 1XGSA 3MFKA 4HBLA 1OKRA 3Q5FA 3TQNA 1Z6TA 1F1ZA 5HDGA 3RTRA 4MQ9F 3WTYC 1FP1D 5LHHA 3I59B 1KGSA 5LGNA 4YFXF 2HKXA 1Q1HA 2OAZA 5CVRA 4EJWA 1FT9A 2XKPA 3FM5A 3J80Z 3T5XA 1MJ9A 3CUQC 4L0ZB 3IL2A 3GZ5A 1MD0A 2L4MA 1GXPA 2DW4A 5E8GA 1GVJA 5D5WB 3KFWX 1XSVA 4OIOF 4PZJA 3DQVC 3VEPA 4AVPA 4MNUA 5DCFA 2EA2A 2MLGA 4RGXA 4KMFA 3K2ZA 2E1NA 3CJNA 3GFJA 2PN6A 5J6XA 3E5QA 1ZG3A 5IT3A 3KLOA 3ZN1A 1FYKA 3FMRA 4L9TA 5FB2A 2LDUA 4M73A 3SXYA 2RN7A 5LEKA 3TO6A 4R8HA 5HS8A 1QNTA 4L9VA 2G7UA 4MEYF 1D8KA 4HLYA 2E7XA 3P7NA 4OINF 4HV6A 2A68F 3R0JA 2A07F 3WU0A 1KYZA 1P6RA 2K27A 2YR2A 3D0SA 3IRRA 2L01A 1JXSA 2VBZA 3ABTA 1P4WA 4PCQA 1S7OA 2D1HA 2CYYA 1V4RA 3RJPA 4RGUA 2EWNA 2NAZA 4S05A 2QYOA 4Y13A 2BYVE 4EGZA 2L3DA 3L9FA 1VTNC 1TTYA 3ZN0A 3CUOA 1B4AA 2OQRA 1H9GA 3FMSA 5L3CA 4XSZF 3S2WA 4QLCU 3RI4A 2DAOA 2YX4A 3QU6A 5JHUA 2V6CA 5L3DA 3E97A 4HX8A 3SZTA 3BJOA 4KA4A 1QBJA 2JRTA 4I2OA 4KYWA 2NNYA 3HRTA 1EH7A 4G8XA 4A5NA 2CW0F 1SFXA 2QZ8A 1WWXA 3ECOA 1YO5C 2MC3A 4ESBA 1FOKA 2XV4S 4M9XA 3E6BA 1R22A 3BWGA 4GGGA 2OD5A 2DPDA 1SD6A 2DK5A 2DT5A 2KIFA 2KIMA 1FYLA 1IXCA 3V4GA 5AONA 2BGCA 2RV8A 4MGRA 1DPUA 3WE3A 5BQTA 3HHGA 5EEGA 2QQBA 3DV8A 1GXQA 1B1BA 4ETSA 3CUQA 2NNNA 1IF1A 3BPXA 4BAYA 2BEOA 3G3ZA 4ENNA 4ZYEA 1JHHA 2E1CA 2F5FA 2ZNYA 3LA2A 4ZZLA 3O2PE 3GFMA 2FRHA 2Y75A 1T2KA 1FPQA 2E7WA 1OYWA 2J5PA 5D8KB 4UNOA 4KIFA 2M1BA 5F1RA 2DFIA 2O03A 1IRGA 3ZPLA 1O3SA 2P7CB 5JI6A 1T38A 2FU4A 5E17F 1BI0A 3WGGA 2QBYB 1AWCA 4KN4X 4ASNA 2XRNA 5DYMA 2MH2A 4FX4A 3RIRA 2KRFA 4CICA 3P9CA 3F22A 4LLNA 1LDJA 1TNSA 4CYDA 3JW4A 1O7LA 4BNCA 4OIQF 1HQCA 3GXOA 1W7PD 2FMYA 1I5ZA 4WX9A 4A6EA 2XAHA 3F6OA 3R0AA 4U0WA 2VBWA 3NEUA 1P2FA 4WCGA 2D2WA 4M6YA 3V8JA 5IT9K 1SD7A 3MZHA 2FMLA 5F6FA 4G9YA 3M8FA 2K7LA 3I54A 1G6NA 1OYIA 1JE8A 1R1TA 5CVJA 3KP2A 3M9AA 5K5OA 3H3ZA 1BM9A 4WF2A 2VOPA 2HYFA 3KE2A 2RQPA 2XUBA 4IF4A 1BC8C 4HAMA 5ICCA 4HZFA 4Q48A 3GF2A 4EV0A 2K02A 4Y15A 2NS0A 4FX0A 5E1XA 2DO7A 4L9NA 1B6AA 3R61A 3IWFA 2TDXA 4BYYA 4EM1A 2ZCWA 5H6QA 1U5TB 4FHTA 4I0BA 2XGXA 3COAC 3GW2A 1ZHFA 1SAXA 3CTAA 2H6BA 1DDNA 4KMUX 4G6QA 5D6EA 2LF8A 2ACJA 3FXQA 2ZFWA 5L3BA 5LHIA 2LSOA 3WG9A 1USTA 1SMTA 4LLGF 5CVVA 3BJAA 1TLHB 1W7PA 3RKWA 4ON0A 1ZRFA 1OR7A 2L4AA 2HGCA 2QENA 1UHWA 3IKTA 1LB2A 2KIUA 2GA1A 3EETA 3JTGA 3F8FA 2DTRA 3BDDA 2BE5F 3HTSB 1ZGJA 4QWQA 2EA4A 2CFXA 4L9JA 3QAHA 4PGGA 1IN5A 3TKYA 2JT1A 5LLQA 1ZLJA 4U88A 3OOPA 1YFHA 3FX3A 4G7HF 2HDCA 2H94A 4U7DA 1YIOA 2IW5A 2HTJA 4XSXF 3ISPA 2QVOA 1FSEA 3I5UA 5IT9Z 5BS6A 1YYVA 5AIPA 1S6LA 3HIFA 3BZ6A 2HTSA 2QM3A 2O6GE 4L0YB 2H09A 4NQWA 3F8NA 1RUNA 4LMYA 1F4KA 3GFLA 5H20A 3O3KA 3ROUA 2FE3A 2FXAA 3L09A 3JSOA 4UVAA 2B0LA 3HRUA 3GWZA 4ZYGA 2A6HF 4P55A 4AIHA 4I01A 3PQJA 4YFKF 3SQNA 2GXBA 3TGNA 1KU9A 4RB2C 1IN8A 1R00A 2OZ6A 4Q5SF 2ESHA 5K5QA 1I1SA 2QQ9A 1Z05A 2CGPA 4GO1A 2H27A 2Y48A 1I6XA 4KUMA 4ESJA 4YIFA 5L3FA 1XCBA 5BMZA 2GIVA 3HSRA 4ENJA 2X0LA 4DQ2A 2PMHA 1HW5A 1UCRA 3QOPA 2XKOA 5L3GA 2FQ3A 5E1WA 1LDKB 1ZARA 3U9GA 2EV5A 2WV0A 3H3UA 1E2XA 2DQLA 3GX4X 1ZRCA 3KP4A 5FO5A 4GYGA 5CVUA 1E17A 2GQQA 4O6JA 2DU9A 4M6XA 4H0EA 1O3RA 2MBFA 3ZQ7A 1FY7A 2IPQX 4I7HA 2K4JA 2IRFG 2P5KA 4S04A 1J9IA 5CYVA 4IRIA 2QWWA 3DPTA 1FBQA 5LGUA 4R1HA 4LJZF 2OQGA 1DUXC 4HQEA 2BV6A 3MAJA 1Z91A 5TRDA 1ZRDA 3GO5A 3RYRA 2VXZA 2K86A 4Z2YA 3K69A 3J7AO 1MJAA 2KKOA 5HDKA 1IN7A 4AWXB 5ED4A 4G94A 1RI7A 3HHHA 3C3WA 2ELHA 1HBXG 3CUQB 3NRVA 5L3EA 4P9FA 1G3TA 3W6KB 2HWVA 3GUDA 4XRFA 4CGZA 3IRQA 1YQAA 1EH6A 2VN2A 4OIRF 2MLKA 3BP8A 2Z3YA 3KP6A 2W57A 4EJOA 1S7AA 2ZO4A 4L18B 1QZZA 3K1MA 2IP2A 2KJCA 3MQ0A 1O3QA 1HSJA 2D45A 1FSHA 1R5GA 3R60A 4LG0A 5K5RA 3EQLF 1OYYA 4M71A 2BBYA 3GFIA 1XDUA 4XLNF 3H92A 2W25A 1TW3A 1K6OA 1XDSA 1ZREA 4P96A 3RYPA 3F72A 4HQMA 5AIQA 4O5VA 1ZGAA 3JAMK 2W84A 2ZMEA 3N4MA 2OA4A 1ZLKA 4WWCA 2H6CA 4KN7X 2GXGA 3QU3A 5HOOA 1LQ1A 1EH8A 1WSUA 4KIGA 1IRFA 3I59A 1CGPA 4WXHA 4HX4A 4A12A 2LF7A 1S8NA 1XSXA 2IA0A 4I0AA 3JTHA 2UWMA 4JQFA