4ZYEA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
b'PMLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 42
structure length 152
sequence length 152
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyeA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyeA01
5BPIA 2FF4A 5FGMA 3CUQA 2XAJA 3DFGA 5DYMA 2DT5A 3J7AO 5K1YA 3QP6A 2RDPA 3WU1B 1YW8A 4M74A 2GXBA 4WWCA 2K4BA 2ZJ2A 4EJWA 1QBJA 1S6LA 4FX4A 2CG4A 1TTYA 3L00A 2J5PA 3F8FA 2OQRA 2E7WA 1X3UA 4Q4ZF 1XMAA 1BI2A 2VN2A 2ISYA 3W6JB 1S29A 2M45A 1CF7B 2PBIA 3J81K 4M71A 1GXPA 3DEUA 1R1VA 3RKYA 3IWFA 5FO5A 3BJAA 2KJCA 4G6DA 3IHUA 1ZG3A 4F7ZA 3TDZC 3MZYA 4ZYGA 5CLSA 4U0YA 5CJ9A 1FSHA 3KLNA 3K1NA 2VONA 3ULQB 4UVAA 3F8MA 3PQKA 1BC8C 1LNWA 2P6SA 4UVBA 1FOKA 1MKMA 1B6AA 1ZARA 2DFIA 1CGPA 3GUDA 2M30A 4PDKA 2P7CB 1WWXA 3WGHA 4YFKF 4P9UA 4G8XA 2XASA 5HS7A 3GF2A 3F21A 2DPUA 3ABUA 3RIRA 1MJAA 2B0LA 2IW5A 2VC1A 4IXAA 2DQLA 1T98A 3GLXA 2Q2EA 4KIBA 2XAHA 1EH7A 1TQIA 1LDJA 4EM2A 1OMIA 3GFIA 1XSVA 2A61A 2DQRA 3REOA 1JE8A 4L9NA 1OKRA 1P4AA 4RGRA 1P4XA 3ZP5A 3WODF 1XSDA 2JTVA 2EFWA 3H3UA 2V1UA 5E1ZB 1USSA 3MQ0A 1XMKA 2RGVA 1VTNC 2VT2A 5CYVA 2VE8A 3LA2A 1YS6A 1A04A 3IKTA 1I5ZA 3I59B 3C18A 4OOIA 3RPQA 3RPUA 2FOKA 3K1MA 4IRHA 4OINF 4HQEA 2VXZA 4ETSA 1RI7A 4CXFA 5E1WA 2QBYA 3D0SA 3D5LA 2VBZA 2HWVA 2FBHA 1K78A 1HXDA 1O3SA 5HDKA 2HYFA 5D5UB 2ZCWA 3KP3A 2EV6A 2MD5A 1Q1HA 4CGZA 3LA7A 2VODA 1JHHA 5F6FA 1HBXG 2MLGA 2PI0A 4EQQA 1J2XA 3MZHA 2G7HA 1U3EM 1P4WA 4I0BA 2A07F 1WI9A 1W7PA 1JHFA 4M9ZA 3ZQ7A 2HKOA 4Y15A 1RUOA 4L5IA 4P55A 3WE2A 4XRFA 1IRGA 2ETHA 4M72A 1O7LA 2ESNA 2NS0A 5TRDA 4GCVA 4I7HA 3KEQA 4G7HF 3JTHA 2GA2A 1W5TA 3ECHA 1IXCA 5ILVA 5CVVA 5FLXZ 2KIFA 5A2QZ 1I6XA 1Z05A 2K27A 3BJ6A 1GHCA 1FBSA 2JPCA 4NQWA 3C7JA 4BH9A 3COAC 2YX4A 4ZZLA 3GFMA 4WK8F 4A0YA 4MHGA 2DTRA 4ZYEA 5JVTA 5D5WB 5BS6A 3R4KA 1F1ZA 3KP2A 5DD8A 3GFJA 1BBYA 1KA8A 4I02A 2BBYA 2OU2A 1ON1A 5HOOA 3VOEA 3RJPA 5D5VB 2OQGA 2XAFA 1LVAA 1T2KA 1B59A 2MH9A 2FBIA 2R7FA 1XD7A 5DEQA 4EJUA 3ZMTA 4LK0F 4UVCA 1FP2A 2G9WA 5L3CA 2V9VA 3P7NA 3G3ZA 2FNPA 1ZHFA 2BGCA 1U5TB 1U78A 4KICA 1G3SA 2M87A 1QO0D 4OMYA 4ESBA 5LHHA 1OR7A 5E20A 1KU7A 1DPRA 4RGUA 4HZFA 2FBKA 2HTJA 1PP8F 3ZMVA 1IN8A 1LEBA 3TO7A 5LEJA 3E5UA 3V8JA 1XDUA 4EM0B 2P4WA 6PAXA 1D8KA 2E7XA 4JBAA 5K5QA 2EJRA 3GXOA 3O6BB 3LWFA 3RKXA 3T5XA 2BE5F 1MZBA 1H9TA 1SFEA 1HKSA 3W6KB 4IF4A 1F5TA 1ZREA 2VC0A 4BNCA 1L0OC 4BYYA 2OD5A 1W4MA 3HIFA 2FRHA 5DCMA 3MCZA 1FWZA 4LD5A 4GGGA 4ZYDA 4DNCA 4A6EA 4N9HA 4ASNA 5FD5A 3LFKA 2D1HA 2OZ6A 3WG9A 3PFIA 1J5YA 4PGGA 2O8XA 1S7OA 3HTSB 1REPC 4L0YB 3RKWA 4L9VA 1SMYF 3LA3A 1Z6RA 4G94A 3QOPA 2RKHA 1SAXA 1WRJA 2XVCA 2NNYA 2KJBA 4EGZA 2HZTA 3KEOA 4UV9A 3OV8A 1H9GA 3O2PE 5ILUA 2GIVA 3C3WA 4EJOA 3SZPA 1J9IA 4E70A 2EV5A 1IN6A 1D8JA 2V1XA 2DI3A 2FQ3A 1J7KA 4PGHA 3HSFA 2L02A 2GXGA 3HHHA 1QZZA 2QM3A 3V7SA 4A2UA 4KIGA 5LRRA 2XAQA 3HRUA 1YYVA 1OYWA 2M8EA 4IRIA 3DF8A 4P5OA 4ENJA 3I0TA 4M9XA 5CVIA 3F6VA 1UHWA 1I27A 5KK1A 3N97A 1AWCA 3FHZA 2A3SA 4WXDA 5D4SA 4M73A 3SFZA 4I01A 3KP7A 3L09A 1MDMB 4P96A 1KU2A 3R61A 2F5CA 5FFZA 2IA1A 2L4MA 3QPTA 3CO6C 3I54A 4LLNA 4Q48A 3BY6A 3T0YA 4NB5A 1XGSA 1ZRDA 4M6YA 3Q9SA 1YW7A 2FMLA 5L3BA 2K86A 3HYIA 4CICA 3EDPA 4N0BA 3HOSA 3RTRA 3B02A 3KP6A 3WTWC 2KRFA 4ZZDA 1FLIA 4HF0A 2ZKZA 3MEXA 4CYDA 2ELHA 1F9NA 1TW2A 3O3KA 4R8HA 2F5DA 4MEYF 4XBFA 4FX0A 4IHSA 4D0PA 1F4KA 5BPDA 2CFXA 1R00A 4KN4X 2PEXA 4LG0B 5TJJA 1P2FA 5K5RA 1BM9A 3TKYA 1G4DA 4RB0A 3QAHA 4KYWA 3BDDA 1KGSA 2RNJA 3R6SA 2Z9OA 1HKQA 2Q8KA 4U0WA 4B8XA 2O6GE 4KN7X 3S2WA 4RAYA 2KIUA 3R0JA 3CUQB 4U7DA 3G73A 4HOBA 4GYIA 2EFQA 4L9JA 2XUBA 4RB1A 2HQRA 3BP8A 1XN7A 1IXRC 3ERED 2LDUA 3J80Z 1EV7A 5EEGA 1IAWA 5EEHA 2OZUA 4AWXB 2QQAA 3WGGA 3KCCA 1JXSA 1KU9A 1ZG5A 4WF2A 3P9KA 4ESFA 4HW0A 3N4MA 2JRTA 1ZG1A 1EH6A 2VOPA 2QQBA 3R0AA 3WTZA 5DUIA 1I1GA 3SXYA 3ZMSA 5CVRA 2ZO4A 3KLOA 1WKMA 1DDNA 1YTYA 5E8GA 2XAGA 1TQPA 2F5EA 2P7VB 4HV6A 4G9YA 2MA3A 3HRSA 3WTXC 2V6CA 3E6DA 2AXLA 2KIMA 2PFBA 2O03A 3R60A 1XGNA 3E5XA 2W24A 3V4GA 3IWZA 4U88A 1IRFA 3AAFA 2EFOA 1G3WA 1KU3A 4OIPF 3IL2A 1ZGJA 1QQIA 1S3JA 3I59A 1ZLKA 5HLHA 2AS5F 4HLYA 1Z1DA 2DK5A 2GZWA 3Q9VA 2YSRA 1BIAA 1S7AA 3MAJA 2EA4A 1FY7A 4EGYA 1BC7C 1MGTA 2KKOA 1ZN2A 1R5HA 4UXNA 3ISPA 1IXSB 4KMFA 1D5VA 1K79A 4LMYA 5E1XA 4B09A 2IJLA 3WTSC 4MEXF 2ZXJA 2DLLA 3I64A 5F64A 2H6CA 5LGNA 3CUQC 1UHMA 3HRTA 1XGMA 3NEUA 2L4AA 1BOAA 2RQPA 2FMYA 4AIKA 3IKVA 4IHTA 1STZA 5LHIA 1SD5A 2X4HA 2A68F 2UZKA 2IP2A 1UCRA 4A5MA 1QPMA 2STTA 2QYOA 5L3GA 2JZYA 3QRFF 4L5JA 4CZZA 3E6MA 4ESJA 5FD6A 1O3QA 5IT9Z 4K2EA 3V7CA 2DPDA 1OYYA 2D2WA 5JI6A 1IW7F 3H3ZA 3EYIA 4L0ZB 1AOYA 3TDUC 1TNTA 4OIRF 1W7PB 2IPQX 3LQRA 4ENMA 4MGRA 1IN7A 3TGNA 2VBYA 1OYIA 3H92A 2L01A 2EK5A 5E17F 4EVIA 4OMZA 3T1BA 5JR3A 1SD6A 1I1SA 1Y0UA 4G6QA 3ROUA 3BPXA 3QU6A 4XSZF 3MWMA 5F1RA 4EJTA 5DUKA 3FZVA 3WTVC 5D6FA 1ON2A 2J5OA 4HA8A 3QPHA 5E8IA 3K2ZA 2QLZA 2BEOA 3HSEA 5LGTA 1IF1A 2H09A 3GO5A 1U6GA 3GW2A 3M8FA 1U5TA 2YPRA 1H0MA 2K02A 1BN5A 2RV8A 2NAZA 2R7DA 4MQ9F 1ZYRF 2M1BA 2RC4A 5DD4A 4BXUA 5H20A 1SFXA 2HR3A 2CWEA 2LSOA 2STWA 2IT0A 3DKWA 3CDHA 4Q5SF 5LRSA 4HF1A 2ESHA 3C1DA 2CYYA 1K6OA 4QWQA 5LLQA 5ERIA 5CVJA 3KZYA 1Z9CA 3E6BA 1J0RA 5HLIA 2PQ8A 2EB7A 3Q5FA 1QNTA 3FMRA 5HDGA 3EYYA 5DCFA 1BI3A 5JFRA 2K7LA 1Z91A 2P5VA 5IT9K 4LB5A 5FLXK 5A2QK 5L3FA 4S05A 4U7BA 2LF7A 3V7RA 3FXUA 1O7FA 4HAMA 1G6NA 5D8KB 2MC3A 1BIBA 3BOQA 1KQ8A 1C0WA 3ELKA 2P8TA 3E6CC 4M9SA 5LHGA 4LFUA 4A0XA 2HTSA 3F6OA 1ULYA 3OOPA 2O0YA 5D4RA 1MJ9A 1DP7P 4KDPA 1ZAOA 3DQVC 4Q47A 4HV5A 2V1DA 2EWNA 2VE9A 2OBPA 3LSTA 2OA4A 2XHKA 4WCGA 3CUOA 4BHCA 4RB3C 3L2CA 2HGCA 4EM1A 3HSRA 5ED4A 3EUHA 4N9IA 1HSJA 3RI4A 4HQMA 3E5QA 1PDNC 2GWRA 2IA2A 4FT8A 3GZ6A 3DPLC 3F23A 4MNUA 4O3MA 5L3EA 1DPUA 2DBBA 1YQAA 4JQFA 2H6BA 2HQNA 3WTUC 5LGUA 3M1EA 2NYXA 2L3DA 1WQ2A 2UXXA 4I2OA 1GVJA 4AVPA 1HW5A 1T0FA 2OAZA 1FYLA 3F8NA 3L9FA 2YU3A 1KYWA 3FXQA 1RNLA 3WGIA 4BHBA 2ZMEB 3FWEA 3ML6A 3F22A 1W5SA 2EFPA 2HYGD 1L3LA 1LEAA 4ENKA 2TDXA 1FX7A 2FA5A 3U9GA 4LG0A 1FSEA 1P92A 1FBQA 2DO7A 5ICEA 4GXOA 2E1NA 3JAMZ 3I4PA 3CJNA 2XV4S 1B4AA 3FX3A 2XKOA 4CHUA 4Y17A 5J8CA 4A5NA 5DV5A 2XIGA 1FZPB 2CQKA 2WWYA 2HFHA 5BOXA 2MBFA 1BJAA 1NHAA 3KZZA 2A69F 4A6DA 4AIJA 3ZPLA 4AD9A 1R23A 4O5VA 1R22A 4PCQA 1FNNA 3ZMDA 4EV0A 2MH2A 4IVNA 4XLNF 3BROA 1UB9A 4R1HA 4HDVA 3E3VA 1V3FA 2BYVE 5AIPA 4LLGF 1CF7A 2Z99A 1YFHA 1ZRFA 3I5UA 4TV7A 3TO9A 1GXQA 2YR2A 4RGXA 1J59A 4BQAA 4NHJA 3T8TA 2PN6A 5HLGA 3HHGA 5LBQA 2EFNA 2RVCA 1TW3A 3DPTA 4IPAA 4YIIA 4PZJA 2D45A 3WE3A 4ON0A 2Z33A 3F3XA 2DAOA 1SD4A 4LB6B 4HX7A 4DQ2A 5J8FA 3WTTC 3FXRA 3MFKA 2VBWA 4KNYA 2CW0F 3ZMUA 5HS8A 2PMUA 3V8KA 5FB2A 2F5FA 3IRRA 2C6YA 4HLXA 3F72A 3VFZA 3CO7C 4HDUA 2JSCA 4EJVA 4HF2A 4OIQF 2G7UA 4KIFA 3GVAA 2QWWA 1QZYA 4I98B 3EQLF 5BQTA 2A5YB 2R3SA 1ONVA 1R7JA 2FE3A 5AONA 3T8RA 2BV6A 4QLCU 3LAJA 4BAYA 1B9NA 2JPBA 3TOBA 3LQQA 1XB4A 2HOEA 4BHPA 1G3YA 3M9AA 1HW2A 3GZ5A 1PUEE 3HRMA 3FM3A 4I0AA 1IN5A 4JK1X 5ICGA 3JAMK 2PLYA 4MTEA 1LDDA 4ENNA 2O3FA 1ODDA 3ZMZA 4I09A 5D5XB 5LEKA 1FPQA 5J6XA 4RGSA 4U0VA 3RYPA 1MD0A 1U2WA 2ZBKA 1YO5C 2DK8A 2W85A 4ZH4F 2V79A 3VEPA 5AIQA 2PG4A 2GAUA 2M5WA 3U1DA 1O3RA 2UWMA 1O57A 1Z7UA 1B1BA 3ZN0A 5ICCA 2A6EF 5FFXA 3BZ6A 2EA2A 3J80K 1R1UA 3WU0A 2ISZA 3HTUA 1XCBA 1RIOH 1TNSA 2HEOA 1ZGAA 2XROA 1R36A 4MQVA 5H6QA 1J75A 2O61A 4IRGA 2H27A 4P9FA 1OPCA 2FNAA 2W84A 2MLKA 2QUFA 1FC3A 4YIFA 2GQQA 1T6SA 4KMUX 2WV0A 2QBYB 3EETA 4FHTA 5D8LB 3K1PA 4UNOA 4XLPF 3FMSA 1K78B 2IA0A 3V8LA 3GYHX 4HBLA 2H94A 3QU3A 4R79A 1EH8A 4A12A 4Y13A 3PQJA 4YFXF 5KVRA 5BMZA 1FT9A 2ADUA 1HSTA 2QENA 3KP4A 1KYZA 3U2RA 3GEZA 4KFCA 1BI0A 4A0ZA 2RN7A 2ACJA 1PP7U 2XRNA 2Z5UA 4AIHA 1K7AA 3GX4X 4UV8A 1HKTA 4KT5C 3I53A 1YLFA 1TBXA 2IRFG 3NRVA 2CO5A 4LJZF 1E17A 5ILSA 2HS5A 4UHTA 2JT1A 2EV0A 2Q0OA 3TOAA 3NQOA 1XGOA 3KETA 1D3YA 1LQ1A 1LDKB 3JTGA 2QZ8A 2GA1A 1SFUA 3M8EA 5HVQC 2CSOA 2VOOA 3E97A 2VT3A 4LGWA 3ZN1A 1YW9A 2FU4A 4HX4A 4O6JA 5HS9A 1R1TA 1Z6TA 3P9CA 1UFMA 2FSWA 1SD7A 4HX8A 4H0EA 2IVMA 5IT3A 4WX9A 4CO8A 2HKXA 2DW4A 3SQNA 1BI1A 2P5KA 3CTAA 3LAPA 2LNBA 4OU0A 4L18B 3P9IA 4UUVA 3KFWX 4RS8A 2QVOA 4RB2C 2W25A 4HYEA 2DU9A 5ICFA 3VB2A 3F8CA 1TLHB 1WSUA 3QP5A 2A6HF 3FMQA 5H6RA 2YX7A 3FM5A 4KA4A 1MJBA 3JSPA 1IUYA 2UXNA 1IZ1A 1TQMA 3I58A 1FBUA 3K9TA 4LK1F 1USTA 2X0LA 3KP5A 2PMHA 2XKPA 3BJOA 3WTYC 3BWGA 1YS7A 3ECOA 4IJAA 1LJ9A 5D6EA 1KQ0A 1T38A 2Y48A 2P6TA 5K5OA 5DCMB 3K69A 1T39A 1IN4A 3HOTA 3HUGA 2ZFWA 2ZNZA 3I71A 5JHUA 3GFLA 1B9MA 2FXAA 4KUMA 4L9TA 3TO6A 2LKPA 2CGPA 1XDSA 3IRQA 2FEZA 1P6RA 2QQ9A 4CDGA 3GWZA 1DUXC 1V4RA 2COMA 1ZH5A 1YIOA 2ZNYA 2K4JA 3TQNA 1KQ9A 1E2XA 4M6XA 4RAZA 1FYKA 4WXCA 4XSXF 5HDNA 1SMTA 4YG2F 2PJPA 1LB2A 3B73A 3DV8A 2P5LC 3BPVA 2L54A 4LLLA 1RZ4A 3SZTA 1FYMA 4OIOF 4G7OF 2XGXA 3JSOA 1JGSA 4ZYHA 4MTDA 3DP7A 1MDMA 1G3TA 3J81Z 3DXJF 5CVUA 1HW1A 2NNNA 1YG2A 3KE2A 4YFNF 2WTEA 3IC7A 3RDIA 2VBXA 1XCVA 3JW4A 1XSXA 1QGPA 5DDGA 2E1CA 4GYGA 2WC2A 1ZLJA 3ABTA 2ZMEA 4GO1A 4S04A 4G7ZF 4WXHA 3SHFA 2NRAC 1R58A 2F2EA 1RUNA 3K0LA 1O3TA 1ZRCA 2Y0MA 1HQCA 1U5TC 3RYRA 4EMSA 3F8BA 3FF5A 1R5GA 2W57A 4Z2YA 3L7WA 1FP1D 2HDCA 2D1VA 1U8RA 3CLOA 2LF8A 2Y75A 3VODA 5L3DA 2Z3YA 3M7GA 5E18F 1S8NA 1W7PD
chains in the Genus database with same CATH superfamily
2LREA 5BPIA 2FF4A 3I3LA 2EN1A 5LMNE 5FGMA 3CUQA 1T56A 1HNZE 2H1LA 4JX6A 2XAJA 3DFGA 3BG9A 2MKDA 2ZSIB 5J1UA 5DYMA 2DT5A 3J7AO 5C4XJ 2OV7A 1QA6A 1ZU1A 2V86A 3SFIA 5K1YA 3QP6A 2RDPA 4NXME 1MNDA 2LOOA 3WU1B 4C3JJ 4ABZA 1YW8A 4TUGA 4M74A 4PSXA 3L2WA 4GDFA 2GXBA 3HBLA 2XF6A 4WWCA 4V19K 3QQAA 2K4BA 2Z16A 5E3OA 1XC5A 3M4OJ 4KT6A 2ZJ2A 2OPTA 4EJWA 1I94E 1GTKA 5KL3A 1M1EB 4EEFG 3WHBA 2LY1A 4J8ZA 1XX5A 2CSHA 3GLLA 2R92J 1WJAA 4O43A 2GOXB 1QBJA 1S6LA 1QHGA 4FX4A 2HVQA 1ETKA 1WPKA 5C3EJ 1IMUA 4WSPA 1RC7A 2EIMH 1WHUA 2EMAA 3ZQCA 4LFCE 2R5ZA 1L4SA 2CG4A 2VI6A 1TTYA 1X3ZB 3A2KA 3L00A 2EOQA 2DRPA 2Y30A 4F3QA 1OCTC 2J5PA 2DFEA 3BTCA 5EG0B 1SFKA 3F8FA 2OQRA 2E7WA 4JP0A 3BQZA 1X3UA 2ZSHB 3KX2A 4BBRJ 3VYXA 4J01A 4FQGA 4B3AA 3BCAA 1TN9A 2EMCA 4Q4ZF 1XMAA 4DIQA 2LE2A 3ERMA 3A4CA 1BI2A 2NABA 2VN2A 3PNYA 2ZM6E 4PK4A 1YPNA 3LOCA 4BY7J 2MC5A 2LJUA 3CF5F 2ISYA 3VK6A 1IQOA 3W6JB 3ZR8X 1N77A 1S29A 2M45A 4PFOA 4DV7E 1CF7B 2PBIA 3IH3A 3J81K 3HQ1A 4M71A 2NS7A 1W5CC 1GXPA 2NOJB 4MLVA 3DEUA 2R0QC 2J7JA 1BR1A 2JA7J 1R1VA 3RKYA 5A69A 3IWFA 5FO5A 2KISA 2VQGA 4BL0B 3BJAA 2CUFA 4HRIA 1EF4A 2KJCA 4G6DA 2R7SA 2BY3A 2OF7A 4GRIA 3IHUA 1ZG3A 2EBIA 4F7ZA 2LH9A 4J19A 2EMHA 3TDZC 4CYCA 3MZYA 2V8QB 1Y39A 1JUSA 3F6GA 2DT6A 4R2AA 4ZYGA 5CLSA 4U0YA 3HOUJ 5CJ9A 1FSHA 3KLNA 4RBOA 4LF4E 2KFDA 3K1NA 2VONA 3G71I 3ULQB 3DTIA 4UVAA 3F8MA 3PQKA 1A1LA 1BC8C 3VWBA 1LNWA 2P6SA 4UVBA 4A3KJ 2K3PA 4WSGA 1FOKA 1MKMA 4F55A 1B6AA 3RQIA 1ZARA 3IP4B 2DFIA 3J7Yp 1CGPA 1X4OA 2E36A 2IBDA 3IH2A 1VQOI 3EUHC 3VHTB 3IAS2 3GUDA 4XKVA 2M30A 3NWSA 4PDKA 2P7CB 1WWXA 3WGHA 4YFKF 3MKWB 4RMNA 2LRDA 4P9UA 4G8XA 5TISC 4M3GA 2VL8A 2DMIA 2VPLA 2XASA 3GTGJ 4E6KG 4G6TB 5HS7A 3GF2A 5B5EC 3F21A 2DPUA 2P0WA 3S3NA 5C4JJ 4Y4RA 4X64E 4BDZA 3ABUA 3FHNA 3RIRA 2V9PA 2K40A 4BU2A 1MJAA 2CW8A 2IGOA 2L7FP 2B0LA 3CDIA 1K61A 2IW5A 2VC1A 2NUGA 5KL5A 2VKDA 4IXAA 3EPLA 2EM5A 2VJJA 2DQLA 1T98A 5J47A 4DYCA 1JI8A 1KYQA 3GLXA 2Q2EA 4KIBA 2XAHA 2E34A 1EH7A 2VKEA 4L8NA 1TQIA 2QKMB 4A3JJ 4GKKE 4NC8A 3AKZA 4A3EJ 4X6AJ 1LDJA 1RQ0A 4EM2A 1OMIA 2NVTJ 3GFIA 1XSVA 2A61A 2DA2A 2DOFA 2DQRA 4OX9E 3REOA 1JE8A 1W36C 4L9NA 2E5LE 2MKNA 1HNWE 1OKRA 1P4AA 4N4NB 4RGRA 1UAAA 1N75A 4UUSB 1P4XA 4BQQA 3ZP5A 1N78A 3WODF 1XSDA 2JTVA 2EFWA 5DTDA 3EQ1A 3DKXA 1T33A 4E7JA 3H3UA 5K7ZA 1LE8A 2V1UA 5E1ZB 4R2CA 2E60A 2QCOA 1USSA 3AL0C 4XORA 2EM2A 2DFFA 2VPRA 2PMZA 3MQ0A 4U87A 4HEIA 3KYLA 1XMKA 3KIOA 4DV6E 2RGVA 1VTNC 2VT2A 5CYVA 2VE8A 3LA2A 4M3BA 1YS6A 1A04A 4B47A 3IKTA 1SVOA 1I5ZA 3I59B 3C18A 4OOIA 3RPQA 2EM0A 3MKYB 3RPUA 1XTAA 2HYJA 2M0CA 2FOKA 3K1MA 4IRHA 4OINF 4A3DJ 4HQEA 2VXZA 1FEXA 4ETSA 4DV5E 2VRDA 2DGCA 3AG3H 1RI7A 1T8IA 2EM4A 1YUJA 4CXFA 5E1WA 2QBYA 3D0SA 4PFPA 4ZDOA 3D5LA 2ECCA 4DR4E 1UHSA 2VBZA 2V87A 3OYLA 2HWVA 2FBHA 2R7OA 2X1DA 5E3LA 1K78A 1HXDA 1E0EA 1O3SA 4A3MJ 5HDKA 2HYFA 2DMQA 5D5UB 2ZCWA 3KP3A 2L7MP 2EV6A 2MD5A 1T4OA 3E7LA 1XS9A 1Q1HA 2CMPA 4LOCA 4E7LA 4CGZA 3LA7A 1U8BA 4BMJA 2VODA 4XKWA 3RKQA 1NH3A 4LF5E 2EQ3A 1JHHA 5F6FA 1HBXG 2MLGA 2PI0A 4EQQA 1J2XA 3MZHA 2G7HA 2YU8A 3OWTA 4B43A 2LBSB 1U3EM 1FOXA 1P4WA 4I0BA 2A07F 2RTXA 1HDPA 1WI9A 1W7PA 3JRAA 1JHFA 4FASD 4LF7E 3K7AJ 2DJNA 4M9ZA 2GIZA 3ZQ7A 2HKOA 3BC8A 4ZDPA 4JI8E 1MW7A 1RRJA 4Y15A 2EMGA 3Q0UA 2UUZA 4XOTA 4EATA 1RUOA 2W4SA 4L5IA 3DBHB 3K4NA 4P55A 4XK4A 3E1SA 1YYKA 4IO9F 1VQ8I 3A1YA 2OTLI 5HNFA 3WE2A 5EDNA 4XRFA 2LMDA 3TEDA 1IRGA 5B66C 2ETHA 4M72A 3ZQQA 1O7LA 3JRDA 1K6YA 2YTDA 2ESNA 4MFDA 5EGOB 2NS0A 5TRDA 3LMLA 4ZDLA 4R03A 4GCVA 4I7HA 4BE1A 1X5WA 3KEQA 5M5WJ 4G7HF 3JTHA 1TWFJ 2L3CA 2GA2A 3H5RA 2ECBA 2ZB9A 1W5TA 3MHHC 3ECHA 1IXCA 3MMYB 5ILVA 2YWQA 5CVVA 5FLXZ 3H5AA 4O5GA 2KIFA 5A2QZ 2PJRA 1I6XA 1Z05A 2K27A 3BJ6A 1AKHA 1GHCA 2LC2A 1ETXA 1FBSA 2EILH 3CCEI 2JPCA 1GV2A 4NQWA 1IDYA 5AE3A 3C7JA 4BH9A 1MMGA 2Z1DA 3COAC 2EZHA 2L9RA 3W2WA 2YX4A 4ITVA 2DXIA 2EMFA 1N25A 3LSRA 1MMDA 2X48A 2QA4I 1MMSA 2IEKA 4ZZLA 3GFMA 4WK8F 1ZR2A 1MNMC 1Y56A 1B69A 2KDOA 3L2VA 3RCOA 4A0YA 3PM1A 1D1BA 4MHGA 3J7AY 2EM7A 2DTRA 2E35A 4ZYEA 1UZCA 5JVTA 5D5WB 1W36D 5BS6A 3R4KA 3W2AA 1ZBTA 3ZOQB 4ZTFA 1F1ZA 3S15J 2ZJQF 3W2VA 3KP2A 4XKCA 3GFJA 5DD8A 2HC5A 1BBYA 1KA8A 4I02A 1JTYA 2JYAA 2BBYA 4CUGA 4P7DA 2OU2A 1ON1A 5HOOA 3JAMC 2WAEA 2XB0X 2QF7A 1DU0A 1HR0E 1BJZA 3VOEA 4UB6C 2VQHA 2LVHA 4BEHB 3RJPA 1MBHA 4CSWA 5D5VB 2IGKA 2OQGA 5IYBJ 1OCZH 5F27A 1FTTA 2K9QA 2XAFA 1LVAA 1T2KA 2AQEA 3CCVI 1B59A 3L1PA 3OYIA 2LV2A 2MH9A 2DFHA 1ETYA 4JI0E 2FBIA 2R7FA 1XD7A 5DEQA 4R2EA 4EJUA 3ZMTA 3FXJA 2O9LA 1FIPA 1Y8QB 4LK0F 4UVCA 2LVSA 4W97A 3IH4A 4BXXJ 1FP2A 1JKRC 2G9WA 5L3CA 1D5YA 2IHR1 2E5ZA 1P7IA 3RZDJ 1IO2A 4IHXA 2V9VA 3P7NA 3SEQA 2CTDA 4JOMA 3A0BC 3G3ZA 1ETWA 4XRSA 4LF6E 5FKLA 1U0JA 5IY5H 1JT6A 1YJWI 2FNPA 1Y6IA 3HGYA 1ZHFA 2BGCA 1U5TB 3K10A 5JLXA 2M3AA 4KICA 1U78A 5KL7A 1G3SA 2M87A 4R2QA 1QO0D 2X6YA 2HNHA 1WHNA 1A1KA 2BY0A 4OMYA 4ESBA 5LHHA 1VQKI 3BIDA 4YY3E 1OR7A 5E20A 1KU7A 1DPRA 1A31A 1X19A 5B3SH 1ETVA 1XMOE 4RGUA 4PJJA 4DV1E 3S32A 4HZFA 2JA5J 2EMXA 2VJ4A 2FBKA 4NC6A 1SVMA 2HTJA 1YI2I 1PP8F 1PVEA 3ZMVA 2I9IA 1IN8A 2WA0A 1T08B 1LEBA 4C30A 3LSGA 3UK3C 3TO7A 3ABMH 1BL0A 4BBYA 5M3MJ 5LEJA 2EJ4A 5GP9A 1N36E 3E5UA 3V8JA 1XDUA 3OYCA 3QOEA 2F4VE 5FKOA 4EM0B 2P4WA 1PKPA 3TP0A 4C3IJ 6PAXA 3HG9A 1D8KA 2E7XA 3OMYA 4JBAA 5IP6A 5K5QA 2EJRA 3GXOA 3O6BB 3LWFA 1NK2P 1NTCA 3RKXA 2LO3A 3T5XA 4RAGA 2BE5F 3BR3A 2W82A 2XDVA 1MZBA 1FIAA 1H9TA 1W1WE 2E2JJ 1SFEA 1HKSA 2VQCA 3W6KB 4IF4A 1F5TA 1ZREA 2KONA 2VC0A 1QU3A 1K83J 4BNCA 2BZTA 1L0OC 4BYYA 4LTYA 4XONA 2OD5A 1W4MA 2WBMA 3OMLA 3HIFA 5F3WA 2FRHA 5DCMA 2NUEA 3MCZA 3PSIA 1FWZA 4LD5A 4GGGA 4ZYDA 1J09A 1QPIA 4A6EA 4OWRB 4DNCA 4N9HA 4ASNA 4R8OA 2X1EA 2DN0A 3LFKA 5FD5A 2KZVA 1X1PA 2D1HA 2OZ6A 2RQQA 1Y8RB 2JXPA 3WG9A 3PFIA 2H36X 1J5YA 4PGGA 1EA3A 2O8XA 1S7OA 3K4BA 3OS0A 3HTSB 1REPC 1WH7A 3TQMA 1VFCA 4L0YB 3RKWA 1FOYA 5F08A 3H9GA 3HKZN 3CMAI 4L9VA 1AAYA 5KL6A 1X6EA 1SMYF 1N3GA 2R7TA 3LA3A 1Z6RA 2WCC3 4G94A 4C2MJ 3JRBA 2JSPA 3EUAA 2DA4A 3QOPA 4M3EA 2RKHA 4XN0A 1SAXA 2DMTA 5EEAA 1Z3YA 5AC4A 1WRJA 2XVCA 2NNYA 2KJBA 3L2UA 2HZTA 4EGZA 2EPLX 4DV4E 2RS7A 2XF5A 3AG2H 2KT0A 1EKZA 2L2OA 3IUOA 3KEOA 2ZJRF 4IS1C 2G0EA 4UV9A 2YRMA 2YU9J 3OV8A 1H9GA 2XAUA 3O2PE 1AH5A 4E7IA 2RSIA 5ILUA 2IS2A 2GIVA 4YIRX 1JJ6C 2O7OA 3C3WA 4EJOA 5F0FA 3BG6A 3SZPA 3GZNB 2V9KA 1J9IA 3F6HA 4E70A 4X8WA 1R4NB 2EV5A 4RM3A 4AUXA 3ONQA 4A3BJ 2OTJI 2HJJA 2M9AA 1IN6A 3HUGB 1POGA 4Z6YA 2LR8A 5J1YA 2KDZA 3HOYJ 1D8JA 2V1XA 2DI3A 2LKXA 2FQ3A 2HOAA 2LD5A 2N8XA 1WI3A 3G1MA 4NBQA 4GKJE 1J7KA 3HOZJ 2DMUA 4PGHA 1Z0XA 3ADGA 3HSFA 1LUJB 2L02A 2GXGA 4F9AB 2K7IA 1QHHD 3FXLA 1B8IA 2HQAA 1VF9A 3HHHA 4CA0A 1HNXE 1QZZA 2B63J 1PUFB 2QM3A 3V7SA 4A2UA 4KIGA 5LRRA 2XAQA 3HRUA 1YYVA 2JA8J 1OYWA 2M8EA 3BLYA 4IRIA 2N8GA 3DF8A 4P5OA 2JMWA 4L5EA 4BJTA 4ENJA 3I0TA 3IV5A 4F9CB 4M9XA 1SEUA 2OCCH 5CVIA 3F6VA 1UHWA 3OIQA 1ZK8A 3H9QA 1MEYC 1XMXA 1ZGWA 1TT0A 2FOWA 3ECRA 2R7QA 2DCEA 1DQ3A 1I27A 5KK1A 1Y1WJ 3N97A 1AWCA 2NXNB 3KYDB 1PDAA 4P78A 4RH8A 2VIXA 2HDWA 4JI1E 3HPHA 3HZJA 3FHZA 2YTFA 2Y9ZA 2ENCA 1RKWA 2A3SA 2OJED 4WXDA 4XOPA 5D4SA 2EL6A 4M73A 3SFZA 3OYEA 4I01A 2YTIA 1B72A 3KP7A 3L09A 4XL9A 1LFPA 3JRFA 1MDMB 3VSLA 1JUMA 4P96A 3TW6A 1KU2A 3R61A 2F5CA 5FFZA 4IOCF 2HPMA 2RS6A 3FIGA 2IA1A 1YJNI 4XLCA 2L4MA 3QPTA 3CO6C 1PJTA 3I54A 4LLNA 4Q48A 3BY6A 3T0YA 4NB5A 1XGSA 3BR1A 1UN6B 1ZRDA 3GBGA 4BGDA 4Q35B 2OCEA 4M6YA 3Q9SA 1YW7A 2FMLA 5L3BA 3DBRB 3JR9A 2BXYA 3CESA 5AC5A 4V2GA 2K86A 3HYIA 4CICA 5C44J 3CCJI 5A6AA 1YJ9I 1WGXA 4XRMA 4FK5C 3EDPA 4N0BA 3PIOF 2EE8A 3D5SC 4A3CJ 3HOSA 2ENAA 2MC6A 2BVLA 3RTRA 3B02A 3FK6A 3KP6A 3BTLA 3WTWC 2VUMJ 1JGGA 2LRSA 2KRFA 5FRNA 4ZZDA 1FLIA 3PJRA 4LFBE 2Z2SB 5IOZA 4YRVA 4HF0A 2ZKZA 3MEXA 2YRHA 4JI5E 3C2HA 4CYDA 2BBGA 2ELHA 1F9NA 3GTKJ 1TW2A 3H36A 3O3KA 2MGQA 4R8HA 3G1OA 2V1NA 2EOJA 4LF9E 1OCRH 2EOMA 2F5DA 4MEYF 3TL4X 4XBFA 1VNDA 4FX0A 4IHSA 1Z21A 2M0MA 4D0PA 1F4KA 1CQTA 4BE0A 5BPDA 3CCYA 2CFXA 3F9KA 1R00A 2BY1A 4KN4X 2PEXA 1HF0A 3P5JA 4LG0B 3LMMA 2IS6A 5TJJA 2E1MA 3OYDA 4X65E 1P2FA 2JWTA 5K5RA 1BM9A 3TKYA 1G4DA 2M1SA 2YPNA 4RB0A 3PUBA 3QAHA 4KYWA 3BDDA 1KGSA 5EZHA 3HXLA 4E7SA 2O8KA 2RNJA 3OR1C 3R6SA 3Q3SA 1WHQA 2Z9OA 2LTPA 2LMZA 2HPIA 1HKQA 2Q8KA 3S2DJ 1V5GA 5IXMB 3CZ6A 4U0WA 4B8XA 4PJ0C 2O6GE 4KN7X 3S2WA 2GOMA 4RAYA 4XLFA 2KIUA 5EG0A 1X1DA 3R0JA 3CUQB 4U7DA 3DBLB 3G73A 4HOBA 4GYIA 2EH3A 2LBFB 2EFQA 1VQ7I 1IRXA 4L9JA 5KL4A 3U21A 3CP8A 2XUBA 4RB1A 2HQRA 3BP8A 2UXCE 2M4KA 5TGTA 2ZC2A 1JT0A 2VF1A 1U9NA 1XN7A 1MBGA 2JJ7A 1UG2A 2DA3A 1IXRC 3LLHA 1Z77A 3ERED 4HNTA 2TRTA 2LDUA 4DZJA 1PJSA 3J80Z 2CUJA 5GAHJ 2B7EA 4KISA 1EV7A 5EEGA 3K4LA 1IAWA 1JK2A 2NOGA 2A6TA 5EEHA 4HEA2 4NUBA 2OZUA 1YYWA 4DR1E 4B1RA 2I8DA 4AWXB 2YTQA 2V83A 3AG1H 2QQAA 1PJQA 3WGGA 2RPCA 3KPHA 3KCCA 1JXSA 2XPUA 4JI2E 1KU9A 2EINH 2DT7B 1ZG5A 3BR6A 2EOZA 4RM2A 4WF2A 5M3FJ 1Z7LA 2F4OB 3OYAA 3ZQHA 3P9KA 4ESFA 4HW0A 2PMZN 3N4MA 2VQLA 4DR6E 4B3XA 4DW6A 2A25A 2EPCA 1OQYA 2V89A 3ASNH 5A6BD 3RZOJ 2ZFUA 2JRTA 1WJFA 3HC7A 1UJ8A 1EH6A 1ZG1A 2VOPA 1X1AA 1YE9A 3AG4H 2LUPB 4LITA 3CDLA 2BY2A 4JYKA 1FJLA 2QQBA 3R0AA 3WTZA 3FKJA 5DUIA 1I1GA 3SYTA 4M9VC 2R7UA 2EN8A 2VKVA 3X2QH 3SXYA 3ZGKA 3U1KA 3ZMSA 2M7QA 5CVRA 2DYSH 3S16J 2ZO4A 2EOOA 3KLOA 3G4SI 1WKMA 1DDNA 2FX0A 1YTYA 4WPYA 4XM3A 4YHHE 1A1IA 2HVSA 2EPOA 4F6NA 1F36A 3Q0WA 5E8GA 2XAGA 1TQPA 2F5EA 4CYCB 2P7VB 4HV6A 4G9YA 1OJLA 2MA3A 2HDDA 3HRSA 3KZIC 3WTXC 1IC8A 2QSGX 3UKGA 3T1YE 2V6CA 3E6DA 1X6HA 1R71A 2AXLA 2KIMA 2UV1A 1O0WA 2HXOA 1ITYA 2L33A 4DUYE 4F2JC 4DR2E 5J3LA 2BVMA 2KZGA 2V26A 2XF7A 2DLKA 2PFBA 2O03A 3R60A 4MO7A 1XGNA 4ANJA 2EMLA 3E5XA 1J26A 2QGUA 2JWOA 2W24A 3V4GA 4FISA 2RSMA 4BJ6C 5FKNA 2ODRC 2EOIA 4QPOA 3IWZA 2EMKA 4U88A 1IRFA 3EPHA 3AAFA 5DS9A 2EFOA 3OIPA 3BZCA 3T1HE 2FQ4A 1T0FC 4B3ME 1G3WA 1KU3A 4OIPF 2XPWA 3IL2A 5H2FC 2VKHA 4M3DA 2DA1A 4XNFA 2CPNA 1NK3P 3H1CA 4PSWA 2R1FA 5K7FA 1ZGJA 3RMPA 1RETA 1QQIA 1FJGE 1S3JA 2Q2EB 3I59A 4DOZA 4C2TA 4OAYA 1ZLKA 2HOTA 5HLHA 2AS5F 1T4NA 4HLYA 1Z1DA 2DK5A 3EPKA 1RR8C 2GZWA 4IHYA 3Q9VA 2YSRA 4GFBA 3GTOJ 3PNTA 5FROA 1BIAA 3K4MA 1S7AA 1MSFC 3IAM2 3MAJA 2F48A 2EA4A 1FY7A 2ELKA 4EGYA 2K9LA 3HB9A 1BC7C 1MGTA 2EM9A 2KKOA 1ZN2A 1R5HA 2DODA 4UXNA 3ISPA 1IXSB 4KMFA 2VLAA 2LK2A 4LMYA 5E1XA 1K79A 1QRYA 4B09A 1D5VA 2IJLA 3WTSC 2B7TA 3HTXA 4MEXF 2ZXJA 2DLLA 2ZXIA 4O24A 4OOGC 4DR7E 1H8AC 4Y7NJ 3I64A 3ADLA 4B48A 1ETOA 5F64A 2EM3A 2H6CA 1O4XA 2EMWA 1IBME 2E72A 2L6MA 1XNRE 5LGNA 1G2DC 3CUQC 2L2NA 3CCLI 2EL4A 1UHMA 3HRTA 5DM6F 1XGMA 3JREA 3NEUA 2D9HA 2FGGA 1KZHA 3HL2A 3SJMA 2L4AA 4BE2A 2EMYA 1BOAA 2JY9A 3OL4A 2LUQA 2RQPA 3JRIA 3A01A 3J81C 1X1BA 2FMYA 1HC8A 2UUCE 4AIKA 1HLVA 2P81A 1XNQE 3IKVA 2WAFA 3O8GA 1YX3A 1STZA 5LHIA 4IHTA 1VQ6I 1OISA 1BW6A 3MZ8A 3UR3C 1SD5A 2X4HA 2A68F 1SC7A 2B9DA 3HOWJ 1MNEA 2WB1N 2R7XA 2UZKA 2IP2A 1LLMC 4JI7E 1UCRA 1JKPC 2JK3A 3KEYA 4A5MA 5EGOA 1YZ9A 1QPMA 5E79C 2EPNA 2STTA 3OYHA 5JHFA 2QYOA 3THNA 4FE4A 5L3GA 2JZYA 3QRFF 4L5JA 4CZZA 4IOAF 4X66E 3E6MA 4DV3E 3CMYA 4ESJA 3OYJA 5FD6A 2AXTC 1O3QA 3KWRA 5IT9Z 3THOB 4K2EA 3V7CA 3ZQFA 3J7ZI 1OYYA 2YUSA 4FTHA 2DPDA 4O4KA 4B3TE 2D2WA 5JI6A 1D0XA 1IW7F 3H3ZA 4LFAE 3EYIA 3I55I 4DYRA 2PX9A 1AA7A 4L0ZB 3TDUC 1AOYA 2YTOA 3P1XA 1TNTA 1A1JA 1E3PA 4OIRF 2YZTA 1W7PB 2GXAA 1R5ID 2IPQX 2R93J 4LU9A 3O8HA 4HSTA 4IHWA 3LQRA 2JP9A 3VYRB 2YSPA 4ENMA 1HA8A 1BR4A 3SEZA 4MGRA 3VPRA 1IN7A 3TBIA 2ODRD 3TGNA 2NVYJ 2VBYA 3EPZA 1A1GA 4MLOA 1OYIA 3H92A 2L01A 3TW7A 2EK5A 2XB5A 5E17F 4EVIA 3W6VA 4AIDA 2Y31A 3PUFA 4OMZA 2EOXA 4NZVA 1T4LB 3T1BA 5JR3A 1GLNA 2V7FA 1SD6A 2WBSA 2CUEA 5CQEA 4BC7A 1WJEA 2V88A 1I1SA 1Y0UA 4G6QA 3ROUA 3BPXA 4LIUA 3NWTA 3QU6A 4C2UA 3OR2C 4CCNA 4XSZF 2JA6J 1ZTRA 3MWMA 4NQWB 4DBRA 5A6KA 1IQSA 5KAIC 3VSKA 1KONA 5BR8E 5F1RA 4XICA 4EJTA 3JTZA 1MBJA 4I8OA 2M7BA 5DUKA 2F5VA 3AUZA 3FZVA 3WTVC 5D6FA 1ON2A 4CCLA 5DM7F 2CH0A 2CQ7A 2J5OA 4HA8A 3QPHA 4UB8C 4IHVA 1OCCH 5E8IA 1I50J 1WJBA 3K2ZA 2R5YB 2JVAA 2QLZA 2BEOA 2WB1A 3HSEA 1QVTA 5LGTA 3JCUC 1IF1A 2H09A 3GO5A 2MYSA 5A6BA 1U6GA 3GW2A 1IBKE 3M8FA 4Y33A 3K4JA 1U5TA 2YPRA 2K9SA 1H0MA 2K02A 1BN5A 2RV8A 1R49A 2BW3B 1WH5A 1G59A 3A03A 2NAZA 2CQNA 2R7DA 4MQ9F 1ZYRF 2M1BA 1R4MB 1BR2A 2RC4A 3FBIB 5DD4A 1BA5A 1SFOJ 4BXUA 4II3A 5H20A 1SFXA 2HR3A 4BXFA 1ZAAC 2LY2A 2DIXA 2Y0SN 2CWEA 1JJ8C 2LSOA 2NVUB 2STWA 5E3MA 1GV5A 1XPXA 2IT0A 2LTSA 3DKWA 2D5VA 4V2FA 3CMEI 1MH3A 5F1JA 3CDHA 3M1CA 3S93A 4Q5SF 1RC9A 3PO3J 1X3WB 5LRSA 2MG4A 1LFBA 4HF1A 2X6WA 2AO9A 2F8BA 2ESHA 3GTLJ 3C1DA 3BG7A 2CYYA 3WG7H 5DNYA 2L0KA 1K6OA 4QWQA 5LLQA 4RA2A 2ELJA 3LSMA 1ORKA 1VQMI 5ERIA 5CVJA 3KZYA 3WU2C 1D0ZA 1Z9CA 3E6BA 5CQGA 3B6AA 1Y1VJ 1JK1A 3DLAA 4IL6C 3HEFA 1J0RA 1AU7A 5HLIA 1IV8A 2PQ8A 2EB7A 3Q5FA 1F2IG 1QNTA 5AASA 3FMRA 5HDGA 2UU9E 4DBQA 3EYYA 3ESWB 2E2IJ 3BGHA 5DCFA 1BI3A 1TP4A 4BACA 2JVGA 5JFRA 2K7LA 1Z91A 1YRNB 2K3FA 2P5VA 1ZR9A 1ZQ3P 1PYVA 2X6XA 3ADJA 2XSJC 5IT9K 4BS9A 2GPIA 5KHDA 2V4JC 3BTJA 2ADRA 3GMEA 1HDDC 1UBDC 4LB5A 2R7WA 3FKIJ 3MN2A 5FLXK 4DUZE 5A2QK 1RR7A 2EOSA 1FMWA 5L3FA 4S05A 4JI4E 4U7BA 1D1AA 2LF7A 3V7RA 3FXUA 3OIOA 3ZQIA 4HG2A 2A5WA 5GTIC 1O7FA 1OCOH 3ZQLA 2EMIA 4HAMA 1G6NA 1JKOC 5D8KB 2MC3A 1BIBA 3BOQA 1KQ8A 3DKYA 1C0WA 3EPJA 3LSPA 4XLAA 4F9BB 3ELKA 5KL2A 2P8TA 3E6CC 4I99C 4M9SA 2I5UA 5LHGA 4LFUA 4A0XA 3C4BA 2QSHX 2HTSA 2ME0A 3F6OA 4FCYA 2Y0SA 4D7NA 4GEQB 1ULYA 3OOPA 3VYYA 1FKAE 2KP6A 3DWLE 2O0YA 5D4RA 2MDRA 1SVLA 1MJ9A 4AYBA 1I3AA 2W48A 1DP7P 2K85A 4KDPA 2CRGA 1X6FA 1FMVA 1DU6A 1ZAOA 4RAFA 1WXRA 3DQVC 4Q47A 2CFOA 4W1UA 2HVRA 1PUFA 4HV5A 2V1DA 1A1FA 2EWNA 2UUBE 2EWLA 3Q0VA 3G6EI 2VE9A 1NCSA 1OCPA 4F52A 2OBPA 3LSTA 2OA4A 3HGGA 2E19A 2R7VA 1KJKA 2DOAA 2XHKA 4WCGA 3CUOA 4XIDA 2HI3A 1YSAC 2KHXA 5AE2A 4UUTA 2KHMA 4BHCA 4RB3C 3L2CA 2HGCA 2B3TB 2JRMA 3C2BA 3CP2A 4EM1A 3HSRA 5ED4A 3S1MJ 2KLOA 3EUHA 2EN3A 4Y3OA 2K9NA 2FJ1A 3JRCA 3GTPJ 1S9HA 2X9DA 4N9IA 1HSJA 1SANA 1N32E 5F04A 3RI4A 1RKTA 2Y69H 1K4SA 3M8JA 2UXDE 3QG5C 4HQMA 4FETA 2A05A 3E5QA 1PDNC 4NXNE 2AHQA 2GWRA 5F0HA 2IA2A 1AHDP 5LD2C 4FT8A 4RLQA 3GZ6A 2YTGA 2COBA 4YELA 3DPLC 3VYTB 4MFEA 4MNUA 3F23A 4O3MA 1X49A 5L3EA 1B8IB 1DPUA 3SDGA 2VQFE 4BCAA 3DJWA 3LNQA 2DBBA 2EM6A 4QPQA 1YQAA 3OS2A 3ZXSA 2PRTA 2OC6A 4JQFA 4IZZA 2H6BA 2HQNA 1LVKA 3WTUC 5FKMA 3F0CA 5LGUA 2K4VA 3M1EA 2NYXA 4AVZA 4G12A 4E7ZA 1VI0A 3K70C 2ZJPF 2B9SA 2FTXB 2L3DA 2KQRA 1WQ2A 2UXXA 3K4KA 1GVJA 4AVPA 4I2OA 3I4NJ 2CU7A 1HW5A 2Y2ZA 5EJCA 3GTMJ 1Z67A 1T0FA 5EZGA 3BZKA 3CCQI 2OAZA 2Q8UA 2XPVA 4S0HB 1FYLA 2ID6A 3F8NA 3L9FA 1Q1VA 1VQLI 2LG4A 2YU3A 1TC3C 1KYWA 1MIJA 3FXQA 1GZ6A 1RNLA 4HTGA 3WGIA 1LPQA 4BHBA 2MSYA 2ZMEB 3FWEA 3ML6A 3MVPA 3K6GA 3VYUB 2QQ8A 3F22A 1IGNA 5HNHA 1W5SA 1B72B 2EFPA 1YITI 3CJQB 2HYGD 1L3LA 2UUAE 2H1KA 1ETQA 4WFTA 5A6JA 2M2EA 2MFZA 1X58A 2IS1A 5TSEA 4A69C 5J4YA 1LEAA 5B1BH 4ENKA 2AQFA 2EMZA 2TDXA 2X1CA 1FX7A 2DJIA 1IJWC 2CQXA 2IGNA 4BY1J 2FA5A 3QODA 4JI6E 3QWLA 3U9GA 4LG0A 1FSEA 5FRMA 2L92A 1P92A 1FBQA 3OYNA 2EL5A 3HPSA 3K2AA 4DKKA 2DO7A 3CC2I 5ICEA 4GXOA 3KYCB 4A3GJ 2E1NA 4N4OB 1X3CA 4PUSA 5IP7J 3JAMZ 3I4PA 3CJRB 3CJNA 3G2BA 2VJIA 2XV4S 1A1HA 1B4AA 3FX3A 2RREA 2XKOA 1TWCJ 1G2FC 4CHUA 4Y17A 5J8CA 5IOYA 4A5NA 5DV5A 2EZKA 2TCTA 2XIGA 1FZPB 1MSEC 2CQKA 2LBFA 2DA7A 2WWYA 3IWBA 2HFHA 4BC9A 5BOXA 2LLKA 1R6RA 1VQ5I 3QYBA 2KL4A 2R4GA 5B1AH 1IG7A 2MBFA 4IQJA 2EOHA 1BJAA 1NHAA 3KZZA 4AC0A 2A69F 1VQ9I 4A6DA 4AIJA 3ZPLA 4XN3A 4AD9A 1R23A 4O5VA 1R22A 4PCQA 4CH7A 2ELZA 2EPAA 1FNNA 2DDBA 3ZMDA 4EV0A 2MH2A 4LIVA 4IVNA 5T6JA 2JVHA 3BROA 4XLNF 1UB9A 4R1HA 2E1MB 4HDVA 4KITB 3E3VA 2M4IA 1V3FA 2QSFX 2BYVE 5AIPA 4LLGF 4D5FA 1CF7A 3PIPF 1MMAA 2Z99A 3ADIA 4I76A 3ABLH 1YFHA 1ZRFA 3I5UA 1WCMJ 2HZDA 3HPGA 4TV7A 3AV0A 3TO9A 5GPAA 4QIWN 2YU5A 1A35A 2DOEA 2LYCA 1UELB 2BXZA 4P1WA 4HNUA 3CCSI 2X51A 1GXQA 2YR2A 4RGXA 1J59A 1H88C 4Y52J 1W0TA 4BQAA 2EPXA 2R5ZB 3DCFA 3C2GA 3PSFA 4NHJA 3T8TA 2PN6A 5HLGA 3DEWA 2Y9YA 1XG1A 4AU7A 2XSDC 3HHGA 2V85A 5LBQA 3SDBA 4NDLA 2EFNA 3S8PA 2EMBA 2DYRH 4RHBB 2EQRA 5HLTA 2RVCA 1TW3A 3DPTA 4IPAA 3JRHA 3HDDA 4YIIA 1MH4A 3DU6A 4PZJA 2D45A 3RSNA 4KWYA 3WE3A 4F92B 4ON0A 3K70D 2CV1A 2WY8Q 4AM3A 1YUIA 2Z33A 2BB8A 3F3XA 2DAOA 3CC7I 1I39A 1SD4A 4LB6B 3LL7A 4HX7A 4DQ2A 5J8FA 3WTTC 5IWAE 4K0KE 3FXRA 2GLOA 1IBLE 3MFKA 1S7EA 1ZKGA 2VBWA 3UNGC 4KNYA 2CW0F 3ZMUA 1TT5B 1X47A 2R76A 3JU0A 2RNGA 5HS8A 1UG0A 2PMUA 2EZLA 3V8KA 4NHRA 5FB2A 1PJRA 3PNVA 2F5FA 3IRRA 2C6YA 1I3QJ 4HLXA 5EYRA 1A5JA 3F72A 3OTOE 3VFZA 2EORA 3CO7C 1N34E 4X1EA 4WYQB 4HDUA 2JSCA 4EJVA 4HF2A 4OIQF 4F91B 2G7UA 3FXKA 4JYAE 4KIFA 3GVAA 2QWWA 4X62E 2HGHA 3AFHA 5JVGF 1QZYA 2IXSA 3IWDA 2L9SA 4ZJZA 4I98B 4BBSJ 3EQLF 3BR2A 4JV5E 5BQTA 1UHZA 2A5YB 2KOUA 2DSYA 3QYFA 2R3SA 2H8RA 2ENHA 1ONVA 1R7JA 2FE3A 5AONA 3T8RA 2KRCA 2BV6A 2CT1A 4MIMA 4QLCU 3LAJA 4BAYA 5E3NA 2CS3A 2CJJA 3FXMA 1ACIA 1B9NA 2JOBA 5LMUE 1OFCX 2K5CA 4JX4A 1WJ5A 2JPBA 3TOBA 3LQQA 4CCJA 1XB4A 2HOEA 4UUSA 3BQYA 4BHPA 2BOLA 1G3YA 2IGMA 4DV0E 3M9AA 1W0UA 1HW2A 2EOYA 3GZ5A 1PUEE 4AQYE 3HRMA 3FM3A 2ZMEC 1TWAJ 4I0AA 2EPFA 2DA6A 4RDUA 1IN5A 4XLEA 4R2DA 4JK1X 1TWHJ 3ASOH 1V54H 1MMNA 5ICGA 4DMIA 3JAMK 4ZC3A 2PLYA 2NS8A 3GCMA 4MTEA 4F6MA 2KPMA 2M7AA 1LDDA 2MW8A 4HNVA 2DMPA 3PL8A 2O3FA 1ODDA 2ID3A 4ENNA 3I9V2 3ZMZA 2F6CA 2LP0A 4I09A 4NC7A 5D5XB 5LEKA 1RMDA 2EP3A 1FPQA 5J6XA 4RGSA 1DP3A 3K6QA 3LFUA 2DLQA 2UXBE 4U0VA 2CQQA 2FD5A 3RYPA 2YT4A 1D1CA 1MD0A 2QEXI 5KCMA 1U2WA 2EOFA 2LKSA 3QPSA 4LF8E 3M99B 2ZBKA 1VQNI 1YO5C 2DK8A 4BUPA 2W85A 4ZH4F 4H4KC 2WBUA 2V79A 3VEPA 3ABKH 4M6VA 5AIQA 2PG4A 3L2QA 5IPAA 3CD6I 4J00A 2GAUA 2M5WA 2FUG2 3A02A 3U1DA 3H09A 4KZSA 2WAQN 4BKXA 1O3RA 2UWMA 4M0VA 1TF3A 1O57A 5J4VA 1LE8B 1Z7UA 1YX5A 3FXOA 3I4MJ 4BQOA 2EZ6A 1FOWA 2LY9A 4DZPA 1GDTA 4LG3A 4A3FJ 1MBKA 1VQ4I 1B1BA 3S1QJ 3ZN0A 3DPUA 5ICCA 1YIJI 2A6EF 5FFXA 3BZ6A 2EA2A 3J80K 1R1UA 5CFFE 3WU0A 3OYFA 2ISZA 3HTUA 2YS9A 4D9JA 1XCBA 1UMQA 5F0CA 1RIOH 1V55H 4NNJA 2I13A 1T95A 1VQPI 2M4GA 1UILA 1TNSA 2HEOA 2N3GA 1ZGAA 2XROA 1R36A 2KRHA 3BG3A 4MQVA 3NAUA 3H0GJ 5H6QA 1J75A 2O61A 4IRGA 1K4TA 2R7RA 4B44A 2E1MC 2H27A 4P9FA 2HQ5A 4B3RE 1OPCA 2FNAA 2JQ7A 2W84A 4MLQA 2MLKA 2QUFA 2L3JA 1FC3A 4YIFA 3OOUA 1A6IA 2GQQA 1T6SA 4KMUX 4IQ4A 2KIQA 2WV0A 2QBYB 3EETA 5EF6A 4UY8I 4FHTA 5D8LB 3CC4I 3OY9A 2MD0A 2VQEE 3OL3A 3GTQJ 1TF6A 3K1PA 3NARA 4UNOA 3OYKA 1ENHA 3FMSA 4XLPF 1K78B 2WADA 2IA0A 3B6CA 2E5NA 3BBGA 3BR0A 3V8LA 4CZCA 5K7HA 2HOSA 2DDAA 1NG6A 3S1NJ 3GYHX 3H9JA 5LFAA 2ME6A 1F43A 3MKZA 2VE7C 2NVQJ 3FK7A 2ZXHA 2L7ZA 4HBLA 2H94A 3LSIA 4R2SA 1DI2A 2YTNA 4BDYA 2EM8A 4XMYA 3S1RJ 2H8WA 4DJAA 3A01B 4GZNC 3QU3A 4R79A 1EH8A 4ZYAA 4A12A 4Y13A 2EPRA 1H89C 3PQJA 4YFXF 3C4TA 5KVRA 1V5EA 1XMQE 5BMZA 4JX5A 1FT9A 1A36A 3PO2J 1E3OC 3S14J 2M9HA 3IWCA 2ADUA 1HSTA 1WFXA 3PFYA 3RQ4A 2YTEA 4N4RB 2W00A 2YTJA 2QENA 1DQUA 1EKEA 3KP4A 1KYZA 3DEEA 2HHHE 3U2RA 3GEZA 2E71A 4KFCA 1BI0A 4DR5E 1BB8A 4A0ZA 1TZLA 5J40A 2WAQA 2RN7A 1V5FA 2W1OA 2LT7A 2ACJA 1PP7U 2XRNA 3WHCA 4TUIA 4BEHA 3TP3A 3SZGA 2EPMX 1Z1BA 2Z5UA 4QTRA 5AE1A 4AIHA 3ZQGA 1X4PA 3ZOBA 1K7AA 2EPPA 4FE7A 5J1RA 3GX4X 4UV8A 5GADJ 3L2RA 2PJRB 1HKTA 4KT5C 1YYOA 1GVDA 1AKHB 1Z3XA 1MBFA 1D0YA 3VDXA 3I53A 1YLFA 2HU9A 4D1QA 1TBXA 2JUGA 2IRFG 1IUFA 3NRVA 2DMNA 1APLC 2CO5A 2R5YA 1IRZA 4LJZF 1E17A 1WVRA 3MD2A 5ILSA 2HS5A 4UHTA 2JT1A 5KAFC 3M07A 3CCMI 1SR9A 2EV0A 2DMYA 2BW3A 2Q0OA 3C6MA 2GBYA 3TOAA 3NQOA 1XGOA 1WJCA 3KETA 2M34A 4A3LJ 1GUUA 4QSHA 2GHFA 1D3YA 3HOVJ 3K4CA 3OYBA 1LDKB 3JTGA 1LQ1A 4XLHA 4R2RA 4HSRA 2QZ8A 2GA1A 3OSFA 1SFUA 5LL6R 3M8EA 5HVQC 1IDZA 4CCOA 2CSOA 2VOOA 3E97A 2VT3A 1X48A 4LGWA 5JLWA 3ZN1A 2EN4A 3ZCOA 2L9NA 2MDGA 1YW9A 2FU4A 4HX4A 3DU5A 4O6JA 5HS9A 2O5RA 4M3FA 1R1TA 1Z6TA 3P9CA 1UFMA 2FSWA 1SD7A 4HX8A 1NG7A 1GQEA 3N05A 1ERDA 1N33E 2XGCA 4AYBN 1JKQC 1LFUP 4BJ5C 4H0EA 1GT0C 1JUPA 3FIWA 1WJPA 2IVMA 1BOBA 5FLVA 5IT3A 5ADZA 1J5EE 4A3IJ 4WX9A 1HCRA 2HXIA 1X2NA 4CO8A 3J80C 2N3HA 3ZRGA 2HKXA 2JA2A 2DW4A 3SQNA 1BI1A 1RPWA 4D7MA 2P5KA 3MSWA 4ZTJA 3CTAA 3LAPA 5IYDJ 2B7VA 2VXDA 4XKBA 2LNBA 4OU0A 4L18B 3P9IA 2IS4A 4UUVA 3KFWX 3I56I 4RS8A 2QVOA 2X6OA 4RB2C 2MC4A 1FTZA 2W25A 4PJMA 4HYEA 2KMUA 2LFBA 3S3MA 2DU9A 4CCKA 5ICFA 5M5YJ 3VB2A 3F8CA 3HPZA 1TLHB 1WSUA 3QP5A 1YRNA 2A6HF 2VB6A 5HODA 2JR1A 4E4HA 3M3YJ 1YOVB 1QVUA 1TL8A 3CCUI 3FMQA 5H6RA 2YX7A 1DGWY 4R2PA 3FM5A 4KA4A 1MJBA 9ANTA 3JSPA 1IUYA 2RQLA 2UXNA 1ZR4A 3BTIA 2ELYA 1IZ1A 3DF6A 4PJLA 1TQMA 3S2HJ 3I58A 1FBUA 3K9TA 4LK1F 1USTA 2DA5A 2X0LA 3KP5A 2EPKX 4DV2E 2PMHA 2XKPA 5BNGA 3OYMA 3BJOA 3WTYC 3BWGA 2EQ0A 3J7YJ 1NEIA 1YS7A 3ECOA 4IJAA 1LJ9A 5D6EA 3FISA 2I10A 3W3CA 2MABA 4JI3E 3DLLF 3E0JB 3OYGA 2VJ5A 1KQ0A 1S72I 2EN2A 1T38A 5KNLA 2Y48A 2P6TA 3QYEA 1U9OA 5K5OA 3LSJA 2GM4A 5DCMB 3K69A 1T39A 2QKLB 2X85A 1IN4A 3BCBA 2EN6A 3HOTA 3HUGA 2ZFWA 2ZNZA 3I71A 5JHUA 3GFLA 4KHPE 2EOEA 3OSGA 2CV0A 4A93J 3H3VK 1B9MA 1IV6A 2FXAA 4KUMA 4L9TA 3TO6A 4F93B 2LKPA 4BQNA 2CGPA 1P47A 1XDSA 4X9JA 3IRQA 2EZIA 2F4IA 2FEZA 2EPUA 2FV4B 3HJEA 5IYCJ 1P6RA 2QQ9A 4CDGA 2L7KA 2EIKH 1MBEA 1G2HA 3GWZA 3CJTB 4E7KA 1DUXC 1V4RA 3VYSB 2V6EA 3MKLA 2COMA 1ZH5A 3H35A 4X0GA 1YIOA 4IEJA 2ZNYA 2K4JA 3TQNA 1SAUA 1KQ9A 1E2XA 3H0DA 2ZXWH 2Q1ZB 4RLFA 2NUFA 1P7JA 1R9TJ 1HOMA 1ZBQA 4M6XA 3CMMA 1STUA 1ZELA 4RAZA 3OS1A 4Q28A 4II2A 1FYKA 4WXCA 4XSXF 5HDNA 1SMTA 5FKKA 4YG2F 4B3SE 2PJPA 4YEJA 1X1CA 1LB2A 3B73A 5IV8B 1DGCA 3DV8A 2P5LC 2YRKA 3BF2A 3BPVA 2LTRA 3JRGA 2L54A 3LSHA 4C3HJ 2JUCA 4LLLA 1RZ4A 4F54A 3SZTA 4C9YA 1FYMA 4OIOF 2IAIA 1QU6A 4DYQA 3CCRI 3G1LA 2L2MA 4G7OF 4XRSG 2XGXA 5CPRB 2RAEA 1JGSA 2L5QA 3TMOA 4ZYHA 3JSOA 4MTDA 3DP7A 4IX7A 1MDMA 2LJHA 1G3TA 3HOXJ 3J81Z 3DXJF 2YTPA 2XGDA 2M8GX 4XR6A 1HW1A 5CVUA 3A0HC 2NNNA 1BW5A 1YG2A 3EUKL 3HM5A 1EJ9A 2JPAA 4OAZA 3D5RC 2EN7A 2L8TA 3S17J 2DB2A 3KE2A 2EQ1A 4YFNF 2F4MB 2WTEA 3IC7A 3CF2A 2NA2A 3RDIA 2VBXA 1XCVA 2ICWG 1A6QA 3QPLA 1DGRM 3JW4A 1G8XA 1XSXA 3LSKA 1OLTA 1E3HA 1QGPA 2XGEA 3S3OA 1I6HJ 3V42A 4DR3E 5DDGA 3CQZJ 5CKTA 3DTEA 2JN6A 2E1CA 4GYGA 2WC2A 4KJZA 1ZLJA 3ABTA 1S5LC 2XC7A 2ZMEA 3FBNB 2OUMA 2L2KB 2R7ZJ 2E1OA 2L9VA 4GO1A 5M5XJ 3BT9A 4DGWB 4S04A 4I6ZA 4G7ZF 1LKXA 4WXHA 3SHFA 3HKZA 3H5NA 1QZEA 5GPCA 2CV2A 2W7NA 2NRAC 1R58A 2F2EA 1RUNA 3RPUD 2EPZA 2JOXA 3K0LA 2VASA 4L5NC 3BR5A 3J7AG 1O3TA 1VZ0A 4PJNA 1ZRCA 2NVXJ 2Y0MA 2E2HJ 1HQCA 4HPQA 1WJDA 3FDYA 1U5TC 4IJDA 5GAGJ 3CLQA 4M30A 3RYRA 5GAEJ 4EMSA 3DTKA 3F8BA 2EIJH 3FF5A 1R5GA 2LCEA 1YHQI 2W57A 2XRLA 3BG5A 1Y0NA 5FJ8J 4Z2YA 3L7WA 4M2ZA 5FLMJ 4CCMA 2WZOA 1FP1D 2CUZA 2HDCA 5GTHC 2YSOA 3MHSC 2BHYA 2D1VA 4E7HA 2WV1A 1U8RA 2WBTA 1WZ2A 5IT9C 3D1NI 1TWGJ 1BBOA 1JTXA 1P9QC 4XQFA 3CLOA 2LF8A 2GLIA 2CW7A 1OR7C 3GTJJ 2Y75A 1X2MA 5IP9J 5FLXC 4B4CA 3VODA 3AL0B 4IKFA 3C6KA 1BBGA 5A2QC 5L3DA 2Z3YA 3M7GA 1RESA 5E18F 2BHZA 1S8NA 2K9MA 2DTZA 1W7PD 2WY7Q 4D5CA
chains in the Genus database with same CATH topology
5BPIA 2FF4A 5FGMA 3CUQA 2XAJA 3DFGA 5DYMA 2DT5A 3J7AO 5K1YA 3QP6A 2RDPA 3WU1B 1YW8A 4M74A 2GXBA 4WWCA 2K4BA 2ZJ2A 4EJWA 1QBJA 1S6LA 4FX4A 2CG4A 1TTYA 3L00A 2J5PA 3F8FA 2OQRA 2E7WA 1X3UA 4Q4ZF 1XMAA 1BI2A 2VN2A 2ISYA 3W6JB 1S29A 2M45A 1CF7B 2PBIA 3J81K 4M71A 1GXPA 3DEUA 1R1VA 3RKYA 3IWFA 5FO5A 3BJAA 2KJCA 4G6DA 3IHUA 1ZG3A 4F7ZA 3TDZC 3MZYA 4ZYGA 5CLSA 4U0YA 5CJ9A 1FSHA 3KLNA 3K1NA 2VONA 3ULQB 4UVAA 3F8MA 3PQKA 1BC8C 1LNWA 2P6SA 4UVBA 1FOKA 1MKMA 1B6AA 1ZARA 2DFIA 1CGPA 3GUDA 2M30A 4PDKA 2P7CB 1WWXA 3WGHA 4YFKF 4P9UA 4G8XA 2XASA 5HS7A 3GF2A 3F21A 2DPUA 3ABUA 3RIRA 1MJAA 2B0LA 2IW5A 2VC1A 4IXAA 2DQLA 1T98A 3GLXA 2Q2EA 4KIBA 2XAHA 1EH7A 1TQIA 1LDJA 4EM2A 1OMIA 3GFIA 1XSVA 2A61A 2DQRA 3REOA 1JE8A 4L9NA 1OKRA 1P4AA 4RGRA 1P4XA 3ZP5A 3WODF 1XSDA 2JTVA 2EFWA 3H3UA 2V1UA 5E1ZB 1USSA 3MQ0A 1XMKA 2RGVA 1VTNC 2VT2A 5CYVA 2VE8A 3LA2A 1YS6A 1A04A 3IKTA 1I5ZA 3I59B 3C18A 4OOIA 3RPQA 3RPUA 2FOKA 3K1MA 4IRHA 4OINF 4HQEA 2VXZA 4ETSA 1RI7A 4CXFA 5E1WA 2QBYA 3D0SA 3D5LA 2VBZA 2HWVA 2FBHA 1K78A 1HXDA 1O3SA 5HDKA 2HYFA 5D5UB 2ZCWA 3KP3A 2EV6A 2MD5A 1Q1HA 4CGZA 3LA7A 2VODA 1JHHA 5F6FA 1HBXG 2MLGA 2PI0A 4EQQA 1J2XA 3MZHA 2G7HA 1U3EM 1P4WA 4I0BA 2A07F 1WI9A 1W7PA 1JHFA 4M9ZA 3ZQ7A 2HKOA 4Y15A 1RUOA 4L5IA 4P55A 3WE2A 4XRFA 1IRGA 2ETHA 4M72A 1O7LA 2ESNA 2NS0A 5TRDA 4GCVA 4I7HA 3KEQA 4G7HF 3JTHA 2GA2A 1W5TA 3ECHA 1IXCA 5ILVA 5CVVA 5FLXZ 2KIFA 5A2QZ 1I6XA 1Z05A 2K27A 3BJ6A 1GHCA 1FBSA 2JPCA 4NQWA 3C7JA 4BH9A 3COAC 2YX4A 4ZZLA 3GFMA 4WK8F 4A0YA 4MHGA 2DTRA 4ZYEA 5JVTA 5D5WB 5BS6A 3R4KA 1F1ZA 3KP2A 5DD8A 3GFJA 1BBYA 1KA8A 4I02A 2BBYA 2OU2A 1ON1A 5HOOA 3VOEA 3RJPA 5D5VB 2OQGA 2XAFA 1LVAA 1T2KA 1B59A 2MH9A 2FBIA 2R7FA 1XD7A 5DEQA 4EJUA 3ZMTA 4LK0F 4UVCA 1FP2A 2G9WA 5L3CA 2V9VA 3P7NA 3G3ZA 2FNPA 1ZHFA 2BGCA 1U5TB 1U78A 4KICA 1G3SA 2M87A 1QO0D 4OMYA 4ESBA 5LHHA 1OR7A 5E20A 1KU7A 1DPRA 4RGUA 4HZFA 2FBKA 2HTJA 1PP8F 3ZMVA 1IN8A 1LEBA 3TO7A 5LEJA 3E5UA 3V8JA 1XDUA 4EM0B 2P4WA 6PAXA 1D8KA 2E7XA 4JBAA 5K5QA 2EJRA 3GXOA 3O6BB 3LWFA 3RKXA 3T5XA 2BE5F 1MZBA 1H9TA 1SFEA 1HKSA 3W6KB 4IF4A 1F5TA 1ZREA 2VC0A 4BNCA 1L0OC 4BYYA 2OD5A 1W4MA 3HIFA 2FRHA 5DCMA 3MCZA 1FWZA 4LD5A 4GGGA 4ZYDA 4DNCA 4A6EA 4N9HA 4ASNA 5FD5A 3LFKA 2D1HA 2OZ6A 3WG9A 3PFIA 1J5YA 4PGGA 2O8XA 1S7OA 3HTSB 1REPC 4L0YB 3RKWA 4L9VA 1SMYF 3LA3A 1Z6RA 4G94A 3QOPA 2RKHA 1SAXA 1WRJA 2XVCA 2NNYA 2KJBA 4EGZA 2HZTA 3KEOA 4UV9A 3OV8A 1H9GA 3O2PE 5ILUA 2GIVA 3C3WA 4EJOA 3SZPA 1J9IA 4E70A 2EV5A 1IN6A 1D8JA 2V1XA 2DI3A 2FQ3A 1J7KA 4PGHA 3HSFA 2L02A 2GXGA 3HHHA 1QZZA 2QM3A 3V7SA 4A2UA 4KIGA 5LRRA 2XAQA 3HRUA 1YYVA 1OYWA 2M8EA 4IRIA 3DF8A 4P5OA 4ENJA 3I0TA 4M9XA 5CVIA 3F6VA 1UHWA 1I27A 5KK1A 3N97A 1AWCA 3FHZA 2A3SA 4WXDA 5D4SA 4M73A 3SFZA 4I01A 3KP7A 3L09A 1MDMB 4P96A 1KU2A 3R61A 2F5CA 5FFZA 2IA1A 2L4MA 3QPTA 3CO6C 3I54A 4LLNA 4Q48A 3BY6A 3T0YA 4NB5A 1XGSA 1ZRDA 4M6YA 3Q9SA 1YW7A 2FMLA 5L3BA 2K86A 3HYIA 4CICA 3EDPA 4N0BA 3HOSA 3RTRA 3B02A 3KP6A 3WTWC 2KRFA 4ZZDA 1FLIA 4HF0A 2ZKZA 3MEXA 4CYDA 2ELHA 1F9NA 1TW2A 3O3KA 4R8HA 2F5DA 4MEYF 4XBFA 4FX0A 4IHSA 4D0PA 1F4KA 5BPDA 2CFXA 1R00A 4KN4X 2PEXA 4LG0B 5TJJA 1P2FA 5K5RA 1BM9A 3TKYA 1G4DA 4RB0A 3QAHA 4KYWA 3BDDA 1KGSA 2RNJA 3R6SA 2Z9OA 1HKQA 2Q8KA 4U0WA 4B8XA 2O6GE 4KN7X 3S2WA 4RAYA 2KIUA 3R0JA 3CUQB 4U7DA 3G73A 4HOBA 4GYIA 2EFQA 4L9JA 2XUBA 4RB1A 2HQRA 3BP8A 1XN7A 1IXRC 3ERED 2LDUA 3J80Z 1EV7A 5EEGA 1IAWA 5EEHA 2OZUA 4AWXB 2QQAA 3WGGA 3KCCA 1JXSA 1KU9A 1ZG5A 4WF2A 3P9KA 4ESFA 4HW0A 3N4MA 2JRTA 1ZG1A 1EH6A 2VOPA 2QQBA 3R0AA 3WTZA 5DUIA 1I1GA 3SXYA 3ZMSA 5CVRA 2ZO4A 3KLOA 1WKMA 1DDNA 1YTYA 5E8GA 2XAGA 1TQPA 2F5EA 2P7VB 4HV6A 4G9YA 2MA3A 3HRSA 3WTXC 2V6CA 3E6DA 2AXLA 2KIMA 2PFBA 2O03A 3R60A 1XGNA 3E5XA 2W24A 3V4GA 3IWZA 4U88A 1IRFA 3AAFA 2EFOA 1G3WA 1KU3A 4OIPF 3IL2A 1ZGJA 1QQIA 1S3JA 3I59A 1ZLKA 5HLHA 2AS5F 4HLYA 1Z1DA 2DK5A 2GZWA 3Q9VA 2YSRA 1BIAA 1S7AA 3MAJA 2EA4A 1FY7A 4EGYA 1BC7C 1MGTA 2KKOA 1ZN2A 1R5HA 4UXNA 3ISPA 1IXSB 4KMFA 1D5VA 1K79A 4LMYA 5E1XA 4B09A 2IJLA 3WTSC 4MEXF 2ZXJA 2DLLA 3I64A 5F64A 2H6CA 5LGNA 3CUQC 1UHMA 3HRTA 1XGMA 3NEUA 2L4AA 1BOAA 2RQPA 2FMYA 4AIKA 3IKVA 4IHTA 1STZA 5LHIA 1SD5A 2X4HA 2A68F 2UZKA 2IP2A 1UCRA 4A5MA 1QPMA 2STTA 2QYOA 5L3GA 2JZYA 3QRFF 4L5JA 4CZZA 3E6MA 4ESJA 5FD6A 1O3QA 5IT9Z 4K2EA 3V7CA 2DPDA 1OYYA 2D2WA 5JI6A 1IW7F 3H3ZA 3EYIA 4L0ZB 1AOYA 3TDUC 1TNTA 4OIRF 1W7PB 2IPQX 3LQRA 4ENMA 4MGRA 1IN7A 3TGNA 2VBYA 1OYIA 3H92A 2L01A 2EK5A 5E17F 4EVIA 4OMZA 3T1BA 5JR3A 1SD6A 1I1SA 1Y0UA 4G6QA 3ROUA 3BPXA 3QU6A 4XSZF 3MWMA 5F1RA 4EJTA 5DUKA 3FZVA 3WTVC 5D6FA 1ON2A 2J5OA 4HA8A 3QPHA 5E8IA 3K2ZA 2QLZA 2BEOA 3HSEA 5LGTA 1IF1A 2H09A 3GO5A 1U6GA 3GW2A 3M8FA 1U5TA 2YPRA 1H0MA 2K02A 1BN5A 2RV8A 2NAZA 2R7DA 4MQ9F 1ZYRF 2M1BA 2RC4A 5DD4A 4BXUA 5H20A 1SFXA 2HR3A 2CWEA 2LSOA 2STWA 2IT0A 3DKWA 3CDHA 4Q5SF 5LRSA 4HF1A 2ESHA 3C1DA 2CYYA 1K6OA 4QWQA 5LLQA 5ERIA 5CVJA 3KZYA 1Z9CA 3E6BA 1J0RA 5HLIA 2PQ8A 2EB7A 3Q5FA 1QNTA 3FMRA 5HDGA 3EYYA 5DCFA 1BI3A 5JFRA 2K7LA 1Z91A 2P5VA 5IT9K 4LB5A 5FLXK 5A2QK 5L3FA 4S05A 4U7BA 2LF7A 3V7RA 3FXUA 1O7FA 4HAMA 1G6NA 5D8KB 2MC3A 1BIBA 3BOQA 1KQ8A 1C0WA 3ELKA 2P8TA 3E6CC 4M9SA 5LHGA 4LFUA 4A0XA 2HTSA 3F6OA 1ULYA 3OOPA 2O0YA 5D4RA 1MJ9A 1DP7P 4KDPA 1ZAOA 3DQVC 4Q47A 4HV5A 2V1DA 2EWNA 2VE9A 2OBPA 3LSTA 2OA4A 2XHKA 4WCGA 3CUOA 4BHCA 4RB3C 3L2CA 2HGCA 4EM1A 3HSRA 5ED4A 3EUHA 4N9IA 1HSJA 3RI4A 4HQMA 3E5QA 1PDNC 2GWRA 2IA2A 4FT8A 3GZ6A 3DPLC 3F23A 4MNUA 4O3MA 5L3EA 1DPUA 2DBBA 1YQAA 4JQFA 2H6BA 2HQNA 3WTUC 5LGUA 3M1EA 2NYXA 2L3DA 1WQ2A 2UXXA 4I2OA 1GVJA 4AVPA 1HW5A 1T0FA 2OAZA 1FYLA 3F8NA 3L9FA 2YU3A 1KYWA 3FXQA 1RNLA 3WGIA 4BHBA 2ZMEB 3FWEA 3ML6A 3F22A 1W5SA 2EFPA 2HYGD 1L3LA 1LEAA 4ENKA 2TDXA 1FX7A 2FA5A 3U9GA 4LG0A 1FSEA 1P92A 1FBQA 2DO7A 5ICEA 4GXOA 2E1NA 3JAMZ 3I4PA 3CJNA 2XV4S 1B4AA 3FX3A 2XKOA 4CHUA 4Y17A 5J8CA 4A5NA 5DV5A 2XIGA 1FZPB 2CQKA 2WWYA 2HFHA 5BOXA 2MBFA 1BJAA 1NHAA 3KZZA 2A69F 4A6DA 4AIJA 3ZPLA 4AD9A 1R23A 4O5VA 1R22A 4PCQA 1FNNA 3ZMDA 4EV0A 2MH2A 4IVNA 4XLNF 3BROA 1UB9A 4R1HA 4HDVA 3E3VA 1V3FA 2BYVE 5AIPA 4LLGF 1CF7A 2Z99A 1YFHA 1ZRFA 3I5UA 4TV7A 3TO9A 1GXQA 2YR2A 4RGXA 1J59A 4BQAA 4NHJA 3T8TA 2PN6A 5HLGA 3HHGA 5LBQA 2EFNA 2RVCA 1TW3A 3DPTA 4IPAA 4YIIA 4PZJA 2D45A 3WE3A 4ON0A 2Z33A 3F3XA 2DAOA 1SD4A 4LB6B 4HX7A 4DQ2A 5J8FA 3WTTC 3FXRA 3MFKA 2VBWA 4KNYA 2CW0F 3ZMUA 5HS8A 2PMUA 3V8KA 5FB2A 2F5FA 3IRRA 2C6YA 4HLXA 3F72A 3VFZA 3CO7C 4HDUA 2JSCA 4EJVA 4HF2A 4OIQF 2G7UA 4KIFA 3GVAA 2QWWA 1QZYA 4I98B 3EQLF 5BQTA 2A5YB 2R3SA 1ONVA 1R7JA 2FE3A 5AONA 3T8RA 2BV6A 4QLCU 3LAJA 4BAYA 1B9NA 2JPBA 3TOBA 3LQQA 1XB4A 2HOEA 4BHPA 1G3YA 3M9AA 1HW2A 3GZ5A 1PUEE 3HRMA 3FM3A 4I0AA 1IN5A 4JK1X 5ICGA 3JAMK 2PLYA 4MTEA 1LDDA 4ENNA 2O3FA 1ODDA 3ZMZA 4I09A 5D5XB 5LEKA 1FPQA 5J6XA 4RGSA 4U0VA 3RYPA 1MD0A 1U2WA 2ZBKA 1YO5C 2DK8A 2W85A 4ZH4F 2V79A 3VEPA 5AIQA 2PG4A 2GAUA 2M5WA 3U1DA 1O3RA 2UWMA 1O57A 1Z7UA 1B1BA 3ZN0A 5ICCA 2A6EF 5FFXA 3BZ6A 2EA2A 3J80K 1R1UA 3WU0A 2ISZA 3HTUA 1XCBA 1RIOH 1TNSA 2HEOA 1ZGAA 2XROA 1R36A 4MQVA 5H6QA 1J75A 2O61A 4IRGA 2H27A 4P9FA 1OPCA 2FNAA 2W84A 2MLKA 2QUFA 1FC3A 4YIFA 2GQQA 1T6SA 4KMUX 2WV0A 2QBYB 3EETA 4FHTA 5D8LB 3K1PA 4UNOA 4XLPF 3FMSA 1K78B 2IA0A 3V8LA 3GYHX 4HBLA 2H94A 3QU3A 4R79A 1EH8A 4A12A 4Y13A 3PQJA 4YFXF 5KVRA 5BMZA 1FT9A 2ADUA 1HSTA 2QENA 3KP4A 1KYZA 3U2RA 3GEZA 4KFCA 1BI0A 4A0ZA 2RN7A 2ACJA 1PP7U 2XRNA 2Z5UA 4AIHA 1K7AA 3GX4X 4UV8A 1HKTA 4KT5C 3I53A 1YLFA 1TBXA 2IRFG 3NRVA 2CO5A 4LJZF 1E17A 5ILSA 2HS5A 4UHTA 2JT1A 2EV0A 2Q0OA 3TOAA 3NQOA 1XGOA 3KETA 1D3YA 1LQ1A 1LDKB 3JTGA 2QZ8A 2GA1A 1SFUA 3M8EA 5HVQC 2CSOA 2VOOA 3E97A 2VT3A 4LGWA 3ZN1A 1YW9A 2FU4A 4HX4A 4O6JA 5HS9A 1R1TA 1Z6TA 3P9CA 1UFMA 2FSWA 1SD7A 4HX8A 4H0EA 2IVMA 5IT3A 4WX9A 4CO8A 2HKXA 2DW4A 3SQNA 1BI1A 2P5KA 3CTAA 3LAPA 2LNBA 4OU0A 4L18B 3P9IA 4UUVA 3KFWX 4RS8A 2QVOA 4RB2C 2W25A 4HYEA 2DU9A 5ICFA 3VB2A 3F8CA 1TLHB 1WSUA 3QP5A 2A6HF 3FMQA 5H6RA 2YX7A 3FM5A 4KA4A 1MJBA 3JSPA 1IUYA 2UXNA 1IZ1A 1TQMA 3I58A 1FBUA 3K9TA 4LK1F 1USTA 2X0LA 3KP5A 2PMHA 2XKPA 3BJOA 3WTYC 3BWGA 1YS7A 3ECOA 4IJAA 1LJ9A 5D6EA 1KQ0A 1T38A 2Y48A 2P6TA 5K5OA 5DCMB 3K69A 1T39A 1IN4A 3HOTA 3HUGA 2ZFWA 2ZNZA 3I71A 5JHUA 3GFLA 1B9MA 2FXAA 4KUMA 4L9TA 3TO6A 2LKPA 2CGPA 1XDSA 3IRQA 2FEZA 1P6RA 2QQ9A 4CDGA 3GWZA 1DUXC 1V4RA 2COMA 1ZH5A 1YIOA 2ZNYA 2K4JA 3TQNA 1KQ9A 1E2XA 4M6XA 4RAZA 1FYKA 4WXCA 4XSXF 5HDNA 1SMTA 4YG2F 2PJPA 1LB2A 3B73A 3DV8A 2P5LC 3BPVA 2L54A 4LLLA 1RZ4A 3SZTA 1FYMA 4OIOF 4G7OF 2XGXA 3JSOA 1JGSA 4ZYHA 4MTDA 3DP7A 1MDMA 1G3TA 3J81Z 3DXJF 5CVUA 1HW1A 2NNNA 1YG2A 3KE2A 4YFNF 2WTEA 3IC7A 3RDIA 2VBXA 1XCVA 3JW4A 1XSXA 1QGPA 5DDGA 2E1CA