4WXCA

Crystal structure of mycobacterium tuberculosis ogt-y139f
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
b'MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGFGGGINRKRALLELEKSRAPADLTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxcA01
2RKHA 4CHUA 2PLYA 1KQ0A 1USTA 3FXRA 1YW9A 1S3JA 3FMRA 4HLXA 2XAHA 2STWA 4LK0F 4M6XA 3KP2A 4HAMA 1LJ9A 4UVAA 1E17A 1P2FA 3DXJF 2HYGD 4G94A 3F6OA 3CO7C 3E6DA 1Z7UA 1CF7B 3GW2A 2VN2A 3ABUA 4Q5SF 4GO1A 2RDPA 1IXRC 3WTUC 2FBHA 1XMAA 5L3EA 4KNYA 2V9VA 3E6BA 3FM5A 3RPUA 1FYLA 1XSDA 3DV8A 4G7HF 4EM2A 2LNBA 3ERED 1HSJA 2EA4A 4ON0A 4EM1A 1DPUA 2VE9A 3HTUA 5FO5A 3WTSC 4KIFA 3FWEA 1WRJA 2FOKA 3ZQ7A 2HFHA 1QNTA 1CGPA 2D2WA 2DPDA 3F21A 5HDGA 3CUOA 5E20A 3NQOA 5JHUA 1Z6RA 1W7PA 4WXCA 1BN5A 2V6CA 1RZ4A 4P5OA 3H3ZA 3BJAA 3HUGA 2P5VA 3FXQA 1LVAA 3HRMA 4ENJA 2GXBA 1ULYA 3EETA 1G3SA 3GYHX 3IRQA 3HSFA 3ECOA 1K78B 1UCRA 4MTEA 3QPTA 2GXGA 4KUMA 4U7BA 3VB2A 3GX4X 2XUBA 5ICFA 3GXOA 1R23A 5D5UB 3WU0A 2OD5A 3GZ5A 6PAXA 1R1TA 3RYPA 1FY7A 4HDVA 4CXFA 2XRNA 2W24A 1K7AA 3ZN1A 2HOEA 3RKYA 4IVNA 3OV8A 5HVQC 4ZH4F 3I59A 4EV0A 5L3DA 2AS5F 3GO5A 3WTTC 4HX8A 2CG4A 1KU9A 5LRSA 3KLOA 1QZYA 3RTRA 2PQ8A 1P4XA 1D3YA 3IC7A 3TGNA 2F2EA 5HDNA 4HYEA 1IAWA 5L3GA 2JZYA 4AD9A 4M71A 2ZXJA 2ZNZA 3SHFA 4UNOA 1ZARA 3MAJA 2PJPA 1KQ9A 4LMYA 2DBBA 4AIHA 3LA2A 2QBYA 3TO7A 4HQEA 4IF4A 1WWXA 5ILUA 2CQKA 4LG0A 1T39A 3J7AO 1SFUA 3RDIA 4NB5A 4HDUA 1PP8F 3LFKA 3LQRA 3M1EA 1R7JA 1ZRDA 3W6KB 2VODA 4YFKF 1T2KA 3F6VA 4ESJA 4WK8F 2YSRA 5CYVA 2FBIA 2JRTA 3LA3A 4RAYA 3WTWC 3D5LA 5FFZA 1FNNA 3QU3A 3IWZA 2HTJA 4TV7A 3KLNA 4P9UA 3FM3A 4Y13A 3T8RA 1Z91A 5D4SA 1ZAOA 4OIOF 1IN5A 5F64A 3K0LA 2QQAA 2ESHA 3MQ0A 4RB1A 4I2OA 3EYYA 2NYXA 4KFCA 3JTHA 2HQNA 1I6XA 2FSWA 4UHTA 1USSA 2CYYA 5H6RA 5BQTA 4WXDA 4KN4X 3WTVC 2OU2A 1BI3A 1BI0A 5E8IA 1ZG3A 1TQPA 2P4WA 3WG9A 2WC2A 5ICGA 3MZHA 1HKSA 2LF8A 3LAPA 4MNUA 3OOPA 5E17F 2EFOA 4KN7X 1XGOA 5A2QZ 4FX4A 1SAXA 2WV0A 2R7DA 4U0VA 4WXHA 2O6GE 2FE3A 2RQPA 4JBAA 3TOBA 4OMYA 3FXUA 2D1HA 2E7WA 1G4DA 3TDZC 3QOPA 2W84A 3LWFA 4HOBA 3EQLF 2FU4A 5HDKA 4ZYGA 2DK8A 1W5TA 4M9ZA 1ZLJA 2YPRA 1REPC 2M1BA 4UV9A 2Y48A 2CW0F 2MC3A 3QRFF 4Y15A 3CUQA 1MJAA 3B02A 4U88A 3HSRA 3KZZA 5ERIA 4BHCA 2HDCA 5DUIA 4EJVA 2XV4S 1R5HA 1W7PD 1H0MA 4KMUX 4XSZF 1A04A 2VONA 1ON2A 2ZMEA 5CJ9A 4KA4A 3DEUA 5DD8A 1O3TA 2A5YB 2DO7A 3L9FA 5BS6A 1QPMA 1XDSA 1G3WA 2EWNA 2E1NA 2F5CA 2DQRA 1FSHA 1TTYA 5A2QK 3PQJA 2XAFA 1HW5A 5HS9A 2FNAA 3FF5A 2VXZA 2V1XA 1YW8A 2Y0MA 2H27A 1D5VA 5EEGA 4H0EA 3N4MA 5HLIA 2E7XA 4DNCA 3NRVA 2VBYA 3BWGA 5L3FA 2DAOA 1MJBA 1Z6TA 1LQ1A 3ECHA 5KK1A 3RKWA 5K5OA 5FD6A 3KP5A 1J9IA 3ELKA 4PGGA 3DF8A 4LD5A 3E5QA 1SFXA 1ZYRF 3HIFA 2ZKZA 1TQMA 3WGIA 2OAZA 2D1VA 1XGSA 1LDKB 4U0WA 3K1PA 3DP7A 1U6GA 3L09A 3WU1B 3MFKA 3L2CA 3BZ6A 2WTEA 5HS8A 2XVCA 4KIBA 5ILSA 1TNTA 2X0LA 4M9SA 2XHKA 5DUKA 2ZBKA 4L5IA 3COAC 4OU0A 4KDPA 3I58A 5IT9Z 1OYYA 2L54A 4I01A 5ICCA 2IRFG 2HZTA 2PN6A 3WODF 4IPAA 1AWCA 2FNPA 3R0AA 4GYGA 3U9GA 1FT9A 5CLSA 2BYVE 2QVOA 1T98A 4LK1F 3M8FA 1P4WA 4I7HA 2DPUA 5EEHA 1T38A 2GIVA 1JHFA 2P8TA 3SXYA 3J81K 2ISYA 4PDKA 1P4AA 3BOQA 3F72A 2P7CB 4KICA 4DQ2A 4BXUA 1O3RA 4GCVA 3G3ZA 2DQLA 3HHGA 3MZYA 1DP7P 4U0YA 4OINF 1ZG5A 5FGMA 2K02A 3P7NA 5LEJA 4OMZA 2L4AA 1BC8C 2VE8A 2EFWA 3Q9VA 1F1ZA 2MBFA 3M7GA 4I02A 1MKMA 2JSCA 1WSUA 1SMYF 1KGSA 1B6AA 4N0BA 3TDUC 1B9NA 2FMLA 1W5SA 5DEQA 1U3EM 2Z3YA 1Q1HA 1FPQA 3KFWX 3WGGA 3VFZA 1P92A 3JAMZ 1O3QA 1I1GA 3N97A 2Q8KA 3SZPA 3WTZA 4AWXB 4FT8A 1WKMA 2CWEA 4BAYA 4LFUA 2HQRA 5LLQA 1STZA 2FMYA 4XLPF 2ZO4A 2UZKA 5IT9K 1FWZA 3LQQA 4PGHA 5JI6A 1PUEE 2W85A 3KP6A 3V7RA 5D5XB 1K79A 1FC3A 1LB2A 1J0RA 1S8NA 1AOYA 4JK1X 5DYMA 1S6LA 1ZHFA 5ILVA 4HZFA 5CVRA 5FB2A 4RGUA 2OZ6A 4CICA 2G7HA 2HGCA 3P9KA 1D8JA 5LGUA 3GLXA 2B0LA 3QPHA 1ZGAA 4GXOA 1I5ZA 2VBZA 1HW1A 1FP1D 3RKXA 1XGMA 1HW2A 5CVJA 3GF2A 2WWYA 4BNCA 4OIQF 4A2UA 2HWVA 4M72A 2Z33A 1MJ9A 3REOA 3M8EA 2CSOA 2L3DA 2BEOA 3GUDA 1J5YA 2R7FA 2JPCA 4L9NA 4FHTA 2L4MA 4E70A 2P6SA 1O57A 4EVIA 2XAJA 1R1VA 5K5RA 2V1DA 2EA2A 4ZYHA 3HRUA 2GZWA 4GGGA 3VODA 3Q5FA 4O6JA 3F3XA 5JVTA 3HOTA 4HQMA 2DT5A 4RB2C 3WE3A 2IA1A 5LHIA 2IA0A 5DCMB 1MDMB 1DPRA 2BBYA 1XN7A 1IXCA 1IF1A 4HX4A 3K9TA 4Q47A 2QUFA 3C7JA 5FD5A 3LAJA 4ETSA 1R36A 1MD0A 5JFRA 2A68F 1BIBA 1I1SA 2IJLA 1TW2A 4EM0B 4YIFA 1BC7C 3JTGA 1C0WA 2PG4A 3QU6A 2IPQX 3IWFA 4LB6B 2QQ9A 2Z99A 3DQVC 3QAHA 5DCFA 2FRHA 1TW3A 4CO8A 3WTYC 4S05A 3TQNA 2O61A 4F7ZA 1FX7A 1CF7A 1U2WA 5BPDA 4BQAA 1OYWA 5KVRA 5D5WB 1JGSA 3HRSA 4ASNA 3KE2A 1ZREA 4RS8A 1ZN2A 2OA4A 1V3FA 2D45A 3R60A 2GA2A 3ZMUA 3TOAA 3DPLC 4HW0A 2K86A 4Z2YA 1LEAA 2HKXA 4LLGF 3DKWA 3HTSB 3I54A 1J59A 2VC0A 5H6QA 1EV7A 4QWQA 1QZZA 1OKRA 2OBPA 3S2WA 2VBWA 1YYVA 5CVIA 5LBQA 1KYZA 2A6HF 3R0JA 2KJCA 4KIGA 3U2RA 3MWMA 2CFXA 4MQ9F 3DFGA 1YIOA 3T0YA 1G3YA 4P96A 4PCQA 3ZPLA 3JSOA 4BH9A 2DU9A 1K78A 3ZN0A 1OMIA 5BMZA 2FF4A 1QO0D 2O8XA 3EDPA 2V1UA 4ESFA 1J75A 3IRRA 1F9NA 4G9YA 4P9FA 3WE2A 4RB0A 2M30A 1YTYA 2GQQA 1RUNA 2PMUA 4YFXF 3KP4A 4R79A 5L3BA 1KQ8A 5FLXZ 2JTVA 4A5MA 1IZ1A 4EQQA 3CUQC 3F23A 2IA2A 3ZMDA 1YS6A 5J8CA 1R1UA 4IXAA 1B4AA 2DFIA 5D6EA 2VOPA 1U78A 4IHSA 4RGSA 1GHCA 3HHHA 4G6DA 5D6FA 3V8LA 1YW7A 1O7LA 3HRTA 5F1RA 1HBXG 2FQ3A 1I27A 2EFNA 3IKVA 4MEXF 2J5PA 1RUOA 1U8RA 4M74A 2OZUA 2H6CA 2QM3A 4HA8A 1PP7U 4I98B 4A0XA 3P9CA 3FMQA 3W6JB 5J6XA 1KU3A 2EFPA 5TRDA 1JHHA 1DUXC 5LRRA 1W7PB 1YS7A 1FBQA 1V4RA 2ESNA 3T8TA 4I0BA 2EV0A 4L18B 4HF2A 3LSTA 1RNLA 2V79A 3GFJA 2Q0OA 5F6FA 1T6SA 2ACJA 3PFIA 4LJZF 3BPXA 4ZYEA 1OPCA 2PEXA 3F8BA 3KEOA 1K6OA 1XCBA 4A12A 2A3SA 1XGNA 3GFMA 2FA5A 1KA8A 1U5TC 1FBUA 1LEBA 2MA3A 4ZYDA 3HSEA 1Y0UA 3CO6C 4Q48A 3RI4A 3R6SA 2K4BA 3VEPA 1OYIA 5FLXK 2YR2A 4BHPA 3C18A 1R22A 3E6MA 5AONA 1FYMA 1QGPA 2NNNA 3K69A 3ZMSA 1Z9CA 2P5LC 2H09A 1GXQA 1S7AA 4LGWA 1SD5A 2W57A 1QQIA 1WI9A 4ENNA 3QP5A 3I59B 4S04A 3I0TA 3KCCA 5AIQA 4A6EA 2EB7A 3I53A 1B1BA 2P7VB 2J5OA 3I71A 3P9IA 3GWZA 1ZLKA 4HLYA 4XSXF 3KP7A 2KIUA 1L3LA 1XDUA 2Z9OA 1LDJA 2IW5A 3D0SA 3BP8A 4I09A 4XRFA 2IVMA 3BPVA 1YG2A 4L0YB 1SMTA 2EFQA 2M5WA 5E18F 3H92A 1IN6A 1IN4A 1MGTA 2Z5UA 2O0YA 3DPTA 3BROA 5D4RA 4Q4ZF 1JXSA 1OR7A 1IN8A 4FX0A 2QBYB 1L0OC 2ZJ2A 1T0FA 2XKPA 4IRHA 3K1NA 1WQ2A 5E1WA 3ROUA 1SD7A 4XLNF 1TLHB 1R5GA 3IKTA 4LG0B 3SQNA 2KKOA 2A07F 2Y75A 2Q2EA 4ZZDA 4PZJA 2VT3A 3WGHA 1ONVA 1GXPA 2YX4A 3RPQA 2STTA 3FX3A 3O3KA 1UHMA 4MEYF 4QLCU 2K27A 4EGYA 1YQAA 2UXXA 2PFBA 3T1BA 3FMSA 1IN7A 3R61A 1JE8A 1DDNA 2M45A 1YO5C 2EK5A 2XGXA 5BPIA 3E97A 2VC1A 4WWCA 4UVCA 3J80Z 4YG2F 3FZVA 1FBSA 2HR3A 2RGVA 3RYRA 5HOOA 2DK5A 2VT2A 5BOXA 3L00A 3O6BB 3Q9SA 2M87A 2VOOA 3E5UA 5K5QA 3ZP5A 2NS0A 1KYWA 3BDDA 2ZCWA 2LDUA 4A0YA 3C1DA 3TO6A 5L3CA 2GA1A 4L5JA 4EJOA 2FEZA 3KETA 4G7OF 1RIOH 4U7DA 3V7CA 2KRFA 3V4GA 1R00A 4UXNA 3BJ6A 4OIRF 4MGRA 4HF1A 4BHBA 1ZRCA 2MLGA 1KU7A 1Z05A 3IHUA 2OQGA 2PMHA 4A0ZA 2G7UA 1ODDA 1J7KA 2DTRA 1BBYA 1XD7A 5CVVA 1HKQA 4IHTA 1FSEA 3FHZA 3ULQB 3JAMK 4YIIA 2LSOA 4M9XA 2ETHA 4G6QA 3GEZA 4G7ZF 2H94A 3CUQB 3J80K 2P6TA 4IJAA 1S7OA 1ZG1A 3NEUA 2RN7A 3MEXA 4WCGA 1IRGA 1XMKA 2UWMA 4MQVA 4UV8A 4G8XA 3EYIA 2NRAC 3HYIA 1QBJA 2MH9A 1EH7A 3RIRA 4KMFA 1HQCA 2ADUA 2ZMEB 1UFMA 4OOIA 2CGPA 2RV8A 2QLZA 5LGNA 1IXSB 4EGZA 2XKOA 5D8KB 3F8CA 1EH8A 2ELHA 4ENKA 4A5NA 3JW4A 2A69F 4KYWA 3K2ZA 4B09A 3V7SA 2O03A 1BI1A 4L9VA 3ZMTA 2NNYA 3I5UA 2A61A 4UVBA 4LLNA 2MD5A 5AIPA 4K2EA 3JSPA 1ZRFA 1O7FA 5DDGA 3GZ6A 2DW4A 3SZTA 2R3SA 1HSTA 2CO5A 2EV5A 5E1XA 5E1ZB 1HKTA 1U5TB 2FBKA 4HX7A 3QP6A 2UXNA 2RNJA 2X4HA 3MCZA 1XSVA 2JPBA 1BJAA 1TBXA 1FOKA 4IRIA 2MH2A 4ESBA 1FLIA 3KEQA 4IRGA 5HLGA 3ML6A 1G3TA 2W25A 3VOEA 2JT1A 1SD4A 4L9TA 3C3WA 3E5XA 3GFLA 3R4KA 4MTDA 4RGXA 1BIAA 4EJWA 2DI3A 3TO9A 1NHAA 5ICEA 2ZNYA 5JR3A 1O3SA 5CVUA 2LKPA 4RGRA 3LA7A 4EJUA 3CDHA 1LDDA 1FZPB 3O2PE 3TKYA 1GVJA 2XASA 1J2XA 5E8GA 1R58A 2XROA 2L02A 1LNWA 1B9MA 1UB9A 2BGCA 2F5EA 4RB3C 4R1HA 2K7LA 4JQFA 1YLFA 3L7WA 2MLKA 5LHHA 2AXLA 5LGTA 1TNSA 4HV5A 1FP2A 1UHWA 4EJTA 4N9HA 4CZZA 2QWWA 1ON1A 3ABTA 4A6DA 1H9TA 4NQWA 1S29A 4D0PA 1VTNC 2DLLA 4WF2A 2G9WA 3AAFA 4R8HA 3ZMVA 3PQKA 4P55A 1BOAA 1SD6A 5FFXA 3WTXC 2XIGA 5HLHA 1IW7F 4L9JA 4O3MA 2RC4A 2K4JA 3E3VA 4N9IA 2F5FA 5D5VB 4ZZLA 1EH6A 3SFZA 3CTAA 1XB4A 2IT0A 1BM9A 2KIMA 3V8KA 2KIFA 3KP3A 4O5VA 1ZGJA 3B73A 3GVAA 3IL2A 4CYDA 4YFNF 4AIKA 2BV6A 3U1DA 4CGZA 3V8JA 2QENA 2GWRA 3GFIA 2BE5F 2P5KA 3CLOA 4NHJA 2HKOA 4M6YA 2YU3A 3E6CC 5HS7A 1MDMA 5DCMA 2E1CA 5K1YA 4KT5C 5H20A 1D8KA 3I4PA 1FYKA 1HXDA 1BI2A 4B8XA 3HOSA 2HEOA 1E2XA 2H6BA 2M8EA 3EUHA 3KZYA 3I64A 3F8MA 3J81Z 3BJOA 2FXAA 2NAZA 4BYYA 1G6NA 2O3FA 1IRFA 1YFHA 3BY6A 2PBIA 1XCVA 2QQBA 5DD4A 4LLLA 1TQIA 2EV6A 2PI0A 1PDNC 1XSXA 1IUYA 4RAZA 4CDGA 1U5TA 4MHGA 3ISPA 2XAGA 5DV5A 1H9GA 4HV6A 2F5DA 4AVPA 4ENMA 2C6YA 1ZH5A 1W4MA 2YX7A 3M9AA 1MZBA 5ED4A 5TJJA 2HTSA 3K1MA 4AIJA 4OIPF 2TDXA 1Z1DA 3CJNA 4Y17A 1KU2A 2KJBA 2HS5A 2A6EF 5LHGA 2COMA 5LEKA 4HBLA 3H3UA 2GAUA 2VBXA 3RJPA 2RVCA 4GYIA 2QYOA 3G73A 4EMSA 4HF0A 1F5TA 5IT3A 1X3UA 2ZFWA 4I0AA 1SFEA 4WX9A 3T5XA 5J8FA 2EJRA 3F8NA 1B59A 1P6RA 2OQRA 4XBFA 2L01A 4UUVA 5D8LB 4M73A 2XAQA 2IP2A 2ISZA 3ZMZA 4LB5A 3F8FA 2LF7A 2QZ8A 2HYFA 3F22A 1F4KA 4L0ZB 1RI7A
chains in the Genus database with same CATH superfamily
2RKHA 4ZJZA 1ZR4A 4BACA 1SEUA 2PLYA 4CHUA 3PNVA 1KQ0A 1USTA 3FXRA 1YW9A 4BE1A 3K4JA 2LRSA 2GHFA 1S3JA 1BOBA 3FMRA 4XRMA 4HLXA 2XAHA 3OS2A 4LK0F 4M6XA 2STWA 3KP2A 4HAMA 3S17J 1LJ9A 2IGNA 3BTJA 4UVAA 3HOZJ 2EP3A 1E17A 2EBIA 5KAIC 1P2FA 2WA0A 2N3HA 2XF6A 2V7FA 2LMDA 4UB6C 3VPRA 4Z6YA 3DXJF 2HYGD 4IHVA 1S72I 4G94A 3F6OA 4W97A 4O4KA 1UELB 3CO7C 3ZGKA 3E6DA 3GTJJ 2EOSA 1Z7UA 3JCUC 4LG3A 4NC6A 3L1PA 1Y1WJ 1DP3A 2DLKA 4J8ZA 1CF7B 2O5RA 5EF6A 1L4SA 1IG7A 2LBFB 2ZXWH 3GW2A 2KOUA 2VN2A 3SEQA 2LKXA 3ABUA 2DJNA 3IAM2 4Q5SF 1WXRA 1WCMJ 1JTXA 4GO1A 3IV5A 2KPMA 2RDPA 2XSDC 5A6JA 2RAEA 1N34E 2KHMA 3AFHA 1IXRC 3WTUC 4HG2A 5FLXC 2FBHA 1XMAA 5L3EA 1X58A 4KNYA 2IS6A 3BBGA 2V9VA 3CCMI 2MD0A 3E6BA 3FM5A 1ACIA 3A01B 2XF5A 3E0JB 3ASOH 3RPUA 1FYLA 1XSDA 2JXPA 4DV3E 4IOCF 3DV8A 4G7HF 4EM2A 2PJRA 2LVHA 2LNBA 5IYBJ 1Q1VA 3ERED 2IS4A 1U9NA 1HSJA 4WSGA 2EA4A 2YTJA 1WJDA 4ON0A 4LU9A 1H8AC 4EM1A 2VQLA 1DPUA 3BQZA 2EN4A 2VE9A 1G8XA 1YJWI 1X5WA 4B3RE 3HTUA 2CS3A 5FO5A 4C30A 3AL0C 3WTSC 4KIFA 3FWEA 2B7TA 1WRJA 2HU9A 1X1PA 3MMYB 1NK3P 3MKWB 1YSAC 3OR1C 2EMKA 2FOKA 1K61A 3DTIA 3FKJA 2EOOA 2L2MA 4BY7J 3ZQ7A 1I94E 4IHXA 4K0KE 2HFHA 3CCYA 1IQOA 1U0JA 1QNTA 1CGPA 2DLQA 4RDUA 3PL8A 2D2WA 4KZSA 2K9QA 2DPDA 2YTEA 1S5LC 3F21A 5HDGA 5HODA 2K7IA 1MMGA 2XPVA 3CUOA 5E20A 2UUAE 3NQOA 2L33A 5JHUA 1Z6RA 5EGOA 1XMXA 1W7PA 1W1WE 1BN5A 2V6CA 3P5JA 4WXCA 4HSTA 1RZ4A 1BBGA 1IRXA 3TP3A 2VRDA 2MABA 4P5OA 5IYCJ 2EM4A 2EQ0A 3LSHA 3H3ZA 2JQ7A 2CT1A 1XPXA 3BJAA 2V6EA 2ME0A 3DU5A 3HUGA 4C9YA 3AG2H 1D0XA 3HJEA 3G2BA 3M4OJ 2P5VA 3FXQA 1LVAA 3HRMA 4ENJA 2GXBA 2LTSA 2XB5A 1LE8A 1X3ZB 2RPCA 1ULYA 2DT6A 3EETA 2LBSB 1G3SA 2CRGA 4BUPA 2Y31A 3GYHX 3IRQA 3VYTB 3HSFA 4P7DA 4NHRA 5KL7A 3BCAA 3ECOA 4E7ZA 1K78B 1UCRA 2L9VA 4MTEA 2VE7C 3QPTA 3HZJA 2LKSA 2GXGA 2DA3A 4KUMA 4U7BA 1AA7A 3K7AJ 3VB2A 3K2AA 2ELJA 3KWRA 3GX4X 2VJJA 2XUBA 2EMBA 3QYEA 5ICFA 1TWCJ 1X1CA 2K5CA 1R23A 3GXOA 4F93B 5D5UB 4CCNA 3WU0A 2R7RA 2OD5A 2EL4A 3GZ5A 6PAXA 4ZDOA 1R1TA 2E36A 2IS2A 3BGHA 3RYPA 5KL2A 3S1MJ 3A02A 1FY7A 4OX9E 4HDVA 4CXFA 2BW3B 4A3JJ 5B5EC 1GV5A 2YS9A 2XRNA 3I3LA 3OTOE 2W24A 1K7AA 3ZN1A 2HOEA 4B3AA 3RKYA 4IVNA 2DOAA 3H9GA 1N33E 3OV8A 5HVQC 1GUUA 4ZH4F 2KHXA 4KHPE 3I59A 4E6KG 2TRTA 3LMLA 4EV0A 1VI0A 1VQ7I 4RHBB 2KT0A 4X8WA 3IH2A 3ZQCA 2BY1A 5L3DA 5IWAE 2AS5F 3GO5A 5B3SH 1RRJA 4DR7E 2W48A 3BR1A 3WTTC 4Q28A 2EN1A 2DTZA 4HX8A 2CG4A 1LLMC 4BEHB 4LF8E 1VQ6I 2LREA 1LFPA 4NC7A 2A25A 2A5WA 1KU9A 1QVUA 1ORKA 1V55H 3KLOA 4OWRB 5LRSA 1HNXE 1GDTA 5C4XJ 3KZIC 1QZYA 3RTRA 2PQ8A 3OIOA 2DA7A 1P4XA 5AASA 1D3YA 3SFIA 3MKYB 2IXSA 3IC7A 5E3NA 3TGNA 2F2EA 5IT9C 5HDNA 4WSPA 4MFEA 1A1FA 5K7HA 4HYEA 3S1QJ 2JA8J 1UG0A 1IAWA 4XLAA 1TT0A 2H8RA 5L3GA 2JZYA 4Y3OA 4AD9A 4GKKE 4M71A 4QIWN 2ZXJA 2HOTA 4L5NC 2ZNZA 1R71A 3SHFA 4UNOA 3OS0A 3SZGA 1ZARA 3MAJA 2PJPA 3DPUA 4R2EA 4BE2A 4DR3E 1N25A 4PJJA 1KQ9A 4XICA 4FK5C 1MBJA 2PX9A 3G1OA 4LMYA 3Q3SA 2DBBA 4AIHA 2CQ7A 2DXIA 3LA2A 3C4BA 1HOMA 2QBYA 4B48A 1SC7A 1QU3A 1MNEA 3TO7A 2HHHE 4XOPA 4HQEA 2VJIA 3GMEA 4IF4A 2E5ZA 2DMUA 1WWXA 2LLKA 2ENCA 5ILUA 2O7OA 2OJED 2CQKA 3D5SC 4LG0A 2ELZA 1T39A 3M1CA 3J7AO 1JUPA 1SFUA 3JU0A 3DCFA 3RDIA 4NB5A 4HDUA 2WY8Q 1PP8F 3LFKA 3H0GJ 4B4CA 2YRMA 3LQRA 3M1EA 1R7JA 2EWLA 1ZRDA 3W6KB 2L3CA 4D9JA 1QZEA 4AVZA 2VODA 4YFKF 1T2KA 4JX6A 2YT4A 1U8BA 3F6VA 2YSOA 3VSKA 3CCUI 4FETA 4ESJA 2V9KA 4A3EJ 2GOMA 4WK8F 4MLVA 5KNLA 2D5VA 1UAAA 3OYBA 1ERDA 2YSRA 1JGGA 5CYVA 1JUMA 4A3MJ 2FBIA 2H1LA 2JRTA 3LA3A 4RAYA 3WTWC 3D5LA 2EPOA 2XDVA 2JN6A 2RNGA 2YTQA 5FFZA 3KYDB 4PSXA 2X85A 2R7TA 3DBLB 1FNNA 4ZC3A 1VQMI 3QU3A 3IWZA 4XLEA 4F9CB 4IO9F 1V54H 1JTYA 4DOZA 2HTJA 4TV7A 1G59A 3JAMC 2LT7A 3KLNA 3A01A 4P9UA 1D1BA 2WADA 3FM3A 4Y13A 3T8RA 1Z91A 5D4SA 1ZAOA 4OIOF 1QA6A 2EZIA 1IN5A 3B6CA 4R8OA 5F64A 3FXKA 3K0LA 2QQAA 2ESHA 4I8OA 3I4MJ 2AQEA 3MQ0A 4RB1A 4I2OA 3EYYA 3DBHB 2NYXA 4KFCA 1DGRM 1OFCX 4X66E 3JTHA 2HQNA 1I6XA 2ZFUA 4IOAF 2FSWA 3ADJA 1Y56A 5HNFA 3ECRA 2KZVA 1O0WA 1BBOA 4UHTA 2W1OA 1USSA 2CYYA 5H6RA 1B72A 5BQTA 1HLVA 2L0KA 4WXDA 5LL6R 1X1DA 3DEEA 4MLOA 3OS1A 1RKWA 4KN4X 3WTVC 2OU2A 1BI3A 3QPSA 3A4CA 1BI0A 2CQXA 5E8IA 1ZG3A 3OL3A 4V19K 1TQPA 2DA1A 2P4WA 2WC2A 3WG9A 1MMAA 2CJJA 5ICGA 1N3GA 4II3A 3MZHA 1VQOI 4X1EA 1X6EA 2EMXA 2R7WA 2K9NA 1HKSA 2JSPA 4UUSB 1VQ5I 2LF8A 4BDYA 4CYCB 3LAPA 2AO9A 3OOPA 4MNUA 4AM3A 1ZKGA 3UR3C 5F0CA 1SANA 2LO3A 3B6AA 1X6FA 3MHSC 5E17F 2EFOA 3HQ1A 4KN7X 1XGOA 2KRCA 5A2QZ 4FX4A 1SAXA 2X9DA 1FTTA 2WBSA 2WV0A 2R7DA 2HOAA 1W36D 2FGGA 4MIMA 4U0VA 2JY9A 2VPRA 4WXHA 1A1KA 1EKEA 2FE3A 2O6GE 2RQPA 2QEXI 3MVPA 2V88A 4JBAA 3GTQJ 2M8GX 2K4VA 5TSEA 3TOBA 4OMYA 1R4NB 4BC9A 3FXUA 2D1HA 2EMHA 2EORA 2E7WA 1GQEA 3S15J 1G4DA 3TDZC 4XQFA 3QOPA 3RPUD 2W84A 2R93J 2Q2EB 1GLNA 1YYWA 4DJAA 3LWFA 4DZJA 2JA7J 4HOBA 3EQLF 2FU4A 5HDKA 2Z16A 4ZYGA 2DK8A 3NAUA 1W5TA 4M9ZA 4R2CA 1ZLJA 2YPRA 3BR0A 5TISC 2BW3A 3T1HE 5ADZA 2KONA 1AKHB 4GDFA 2V86A 1REPC 2M1BA 1XMQE 4UV9A 2Y48A 2DB2A 3C4TA 2CW0F 3KEYA 1YYKA 1ITYA 4N4OB 5KL6A 2MC3A 3QRFF 1BR1A 4OAYA 4Y15A 4HNTA 5GTIC 3CUQA 5JVGF 4LITA 4PFPA 3S16J 1MJAA 2LRDA 1ZK8A 5F3WA 1JK1A 3B02A 1FIPA 4U88A 3HSRA 1B69A 2VI6A 2RQQA 3KZZA 2V8QB 1U9OA 4LTYA 5ERIA 2E5LE 4A3BJ 4BHCA 4BC7A 2V85A 4B3SE 2HDCA 5DUIA 3W2VA 2EINH 2EPFA 2NS8A 3LSMA 4EJVA 1A1JA 1EA3A 2XV4S 1R5HA 1HDPA 2DDBA 2DMPA 2IEKA 3K10A 4UB8C 3BR3A 1W7PD 4OAZA 1YYOA 4M9VC 2M7AA 1H0MA 4KMUX 4XSZF 1UN6B 2WBMA 1A04A 2VONA 3ZRGA 4IKFA 1ON2A 3PO3J 2ZMEA 2HOSA 5CJ9A 2HQ5A 4KA4A 4BDZA 3DEUA 5DD8A 4E7SA 1J26A 4XK4A 1O3TA 2M0MA 2A5YB 2DO7A 3AL0B 3L9FA 1WGXA 3H1CA 1IDYA 1XDSA 2PMZN 1QPMA 1Y1VJ 5BS6A 3C2GA 1G3WA 2EWNA 2VQEE 1X4PA 5FKNA 2E1NA 1ZELA 2F5CA 2DQRA 3BTCA 1FSHA 2M4GA 3UKGA 3ADGA 3K4BA 1TTYA 1JKPC 5A2QK 3PQJA 4D1QA 2XAFA 1HW5A 5HS9A 2EZLA 2FNAA 3FF5A 1DQ3A 2EMIA 5AE1A 2VXZA 2MFZA 4D7MA 3HPGA 4NXNE 2V1XA 4YY3E 4LFBE 4XKCA 2R7XA 1YW8A 4HPQA 2Y0MA 2H27A 1D5VA 5EEGA 4H0EA 3N4MA 4ABZA 5GP9A 5HLIA 3MZ8A 2E7XA 4DNCA 3NRVA 4BJTA 3VDXA 1BL0A 5IXMB 2VBYA 3SDGA 3BWGA 5L3FA 2DOFA 2HDDA 3BTIA 2DAOA 4R2QA 1MJBA 1Z6TA 4JV5E 2DN0A 1LQ1A 5EZHA 1VQKI 2MC4A 2KRHA 1BR2A 4P1WA 1TC3C 1SAUA 3ECHA 5KK1A 3RKWA 1FIAA 1Z0XA 5FD6A 5K5OA 3KP5A 1J9IA 2YTGA 2V26A 3EPZA 4ANJA 3ELKA 5FLVA 4A3GJ 4PGGA 3DF8A 4LD5A 3E5QA 1SFXA 1ZYRF 3HIFA 2ZKZA 1TQMA 3WGIA 1B8IB 1SVLA 2OAZA 2QSGX 2XF7A 4A3KJ 2PMZA 2GIZA 4AIDA 2LJUA 2D1VA 4L8NA 1N36E 1XGSA 3OYDA 1LDKB 3ZR8X 4U0WA 4DV1E 3K1PA 1JT6A 1A1LA 3DP7A 1U6GA 3L09A 4H4KC 1D0YA 3WU1B 3MFKA 4DKKA 1GV2A 1FOXA 1WJPA 3BR6A 2M7QA 3L2CA 3BZ6A 2CUJA 2HVQA 3S93A 2EH3A 2BY0A 2WTEA 5HS8A 2QQ8A 2VKHA 2XVCA 4KIBA 5ILSA 1PKPA 1TNTA 2X0LA 2QSHX 4V2FA 2COBA 4M9SA 2XHKA 1X1AA 5DUKA 1OLTA 2ZBKA 4CSWA 3J7Yp 1OJLA 4L5IA 3COAC 3E7LA 1MNDA 4OU0A 1YRNB 2ICWG 2ZC2A 4KDPA 3I58A 2CQNA 4R2AA 5IT9Z 1OYYA 2L54A 3QODA 4I01A 1A5JA 5ICCA 2IRFG 2DSYA 3EUKL 2HZTA 1PVEA 3AG4H 4BMJA 2PN6A 4W1UA 3IAS2 3CCRI 1JJ6C 3WODF 4IPAA 4ZTJA 2FNPA 1AWCA 3R0AA 2XB0X 4A3CJ 4GYGA 3U9GA 3CP8A 4JYKA 1Z3XA 3JRGA 2H8WA 1FT9A 5CLSA 2BYVE 1WH5A 1OR7C 1X3WB 1D0ZA 2HNHA 4BU2A 4BBSJ 2QVOA 1R5ID 1T98A 4LK1F 1JT0A 3EPKA 4F92B 2WAQN 3M8FA 1P4WA 4I7HA 1T0FC 4UUSA 1MW7A 2K9LA 5EEHA 4E7JA 4CYCA 2HZDA 5EEAA 1T38A 2GIVA 4IQJA 2EN2A 1JHFA 3I9V2 2WCC3 3IUOA 5FJ8J 3PIOF 2P8TA 4MLQA 3CMEI 5IP7J 3SXYA 3J81K 4BY1J 2ISYA 1R49A 2EIKH 4PDKA 3W2WA 4DIQA 1P4AA 2LFBA 4LOCA 1STUA 3BOQA 3F72A 1D1CA 2OTJI 3BR5A 3DWLE 3NARA 2P7CB 4KICA 4DQ2A 4BXUA 1O3RA 4BXXJ 4GCVA 3G3ZA 2X1DA 2DQLA 3HHGA 3MZYA 1DP7P 4U0YA 4OINF 1MBFA 1ZG5A 2JVAA 5FGMA 5F1JA 2K02A 2XGEA 5EG0A 1VQ8I 1H89C 3P7NA 4PUSA 4DMIA 4IQ4A 5LEJA 3QOEA 4OMZA 1T4OA 2K9MA 2L4AA 3OYGA 1ZGWA 2IGMA 1BC8C 2EN8A 2VE8A 2EFWA 3G1LA 1GZ6A 3Q9VA 3OSFA 1X4OA 3X2QH 5GAHJ 3OMLA 1F1ZA 2MBFA 3M7GA 1PUFB 1W36C 4I02A 3OSGA 2ECCA 2JOBA 3GBGA 2ENHA 4XKWA 1MKMA 2ENAA 1YI2I 2JSCA 1WSUA 1SMYF 1HDDC 1KGSA 4N4NB 3LMMA 2JVGA 1B6AA 2L7MP 2WAQA 4N0BA 3SDBA 4DR1E 3TDUC 1B9NA 1AKHA 2MYSA 2FMLA 1W5SA 5DEQA 1U3EM 2EPKX 4LFAE 2LK2A 2W82A 2Z3YA 1Q1HA 1FPQA 3A2KA 2AHQA 2KZGA 2ELYA 2EL6A 3KFWX 3WGGA 3DLLF 3FBNB 1P92A 3VFZA 3JAMZ 2MDRA 1O3QA 3ESWB 3L2QA 1I1GA 3N97A 2M4KA 4FE7A 2Q8KA 2ZXHA 2R92J 2EZ6A 1V5EA 3SZPA 3WTZA 4AWXB 4D5FA 4FT8A 5KHDA 5JHFA 2JK3A 1WKMA 2CWEA 1P7IA 4BAYA 4PK4A 3BLYA 2HQRA 4LFUA 2L7KA 3FKIJ 5LLQA 3RQIA 1F2IG 1MBHA 4BL0B 1STZA 1NG7A 2FMYA 2LC2A 3GTOJ 1E3OC 4XLPF 2MGQA 2ZO4A 2ZSIB 2UZKA 5IT9K 1APLC 1QRYA 1TWAJ 2DYSH 1FWZA 2EPZA 2DFHA 4RH8A 3LQQA 5KAFC 4PGHA 2NOGA 2EPLX 5JI6A 3BCBA 2FTXB 2E2IJ 4WPYA 1PUEE 2VPLA 3CF2A 3G71I 4FE4A 2I10A 2DOEA 3ABMH 2W85A 4C3HJ 3KP6A 1SFOJ 3V7RA 3RCOA 3O8HA 5D5XB 1K79A 1FC3A 1LB2A 1J0RA 3JRFA 1S8NA 1AOYA 1IGNA 1QHGA 3J7YJ 2DMTA 4JK1X 4BXFA 2JRMA 5DYMA 1S6LA 1W0TA 1ZHFA 5ILVA 3EPHA 2KISA 2JA2A 4CCJA 4HZFA 5CVRA 5FB2A 4RGUA 2OZ6A 4CICA 5M5XJ 4FQGA 2X48A 2X6OA 5A6BA 2CPNA 5FKKA 2G7HA 2HGCA 4C2TA 4O24A 3P9KA 1D8JA 5LGUA 3GLXA 4JP0A 3ABLH 1NH3A 3G4SI 2YU9J 1Z3YA 2Y30A 2BB8A 3QYFA 1HF0A 3MD2A 2B0LA 3AV0A 3QPHA 1ZGAA 1E3HA 2DMQA 2BVLA 4GXOA 1I5ZA 3H0DA 2VBZA 1HW1A 3JRIA 1FP1D 2X6WA 4P78A 1OCPA 3RKXA 2N3GA 1FEXA 1XGMA 4D5CA 4DBQA 3FXLA 3HTXA 2QCOA 1HW2A 5CVJA 4DBRA 2VQFE 3GF2A 2WWYA 4BNCA 3RKQA 4F91B 2BY3A 1ZU1A 4OIQF 2E60A 4A2UA 2HWVA 3OIQA 2J7JA 2DDAA 3CZ6A 1YE9A 2YU5A 1BB8A 2CUEA 4M72A 4C2MJ 1ETXA 2EM6A 2Z33A 4KWYA 3QPLA 1MJ9A 4IS1C 2L5QA 4FASD 3REOA 4X65E 3G6EI 2JJ7A 3LFUA 3A0HC 1WHUA 3M8EA 2CSOA 2L3DA 2BEOA 2Y69H 3MKLA 1A31A 3GUDA 4HNVA 4CZCA 1J5YA 2R7FA 3DKYA 2JPCA 1R4MB 3FK7A 4L9NA 5IPAA 2R5YA 2BVMA 2R5ZA 4FHTA 2CSHA 2L4MA 2NVXJ 4B1RA 1F43A 3EPJA 3BC8A 4XONA 4E70A 2HVSA 2P6SA 1CQTA 1O57A 3HOYJ 2MSYA 3ABKH 4EVIA 3JTZA 3KPHA 3SEZA 2VKVA 2XPWA 2QKMB 2XAJA 2Z2SB 1R1VA 1KYQA 5K5RA 1Z77A 2V1DA 2A05A 1YRNA 1IV6A 2EA2A 3C2HA 4ZYHA 1EJ9A 3HRUA 2GZWA 4GGGA 1XNRE 1MNMC 3VODA 4LF7E 1NEIA 2DGCA 1ETOA 3HPHA 3Q5FA 2EILH 2HDWA 1PJTA 4O6JA 3F3XA 2MDGA 5JVTA 3HOTA 4HQMA 1XNQE 2L92A 1FJGE 1JJ8C 4HRIA 1UHSA 2DT5A 4RB2C 4S0HB 3WE3A 4LF6E 2IA1A 5LHIA 4Y33A 2IA0A 5DCMB 1MDMB 4N4RB 1IRZA 1DPRA 2BBYA 2ELKA 3KX2A 1OCZH 3JRHA 3FHNA 4TUGA 3LSRA 1XN7A 3EPLA 4I6ZA 4F6NA 1DGCA 2KMUA 1IXCA 1IF1A 4HX4A 1Y6IA 3K9TA 1WJFA 2HXIA 2EOFA 4Q47A 4DV5E 3HOXJ 3HPSA 1YUJA 2QUFA 3C7JA 2YTNA 4E7IA 1MBEA 3IP4B 2EPPA 4RA2A 1LUJB 4IHYA 2LG4A 5FD5A 1VQ9I 3LAJA 4UUTA 2RSMA 4ETSA 5DS9A 1R36A 1MD0A 5JFRA 3ZQIA 2A68F 2NUGA 2DFFA 5GPCA 5JLXA 1BIBA 1I1SA 2IJLA 2KLOA 3AUZA 1TW2A 4EM0B 4YIFA 1BC7C 3I4NJ 2R7OA 3JTGA 3JRDA 1MH3A 1C0WA 2PG4A 2VXDA 3QU6A 2IPQX 2ZJRF 3TP0A 2LR8A 3LSPA 3IWFA 4LB6B 4M2ZA 3AG1H 2QQ9A 1WZ2A 2CV2A 2NUEA 2L9SA 2Z99A 3DQVC 3QAHA 4ITVA 5DCFA 2CTDA 2FRHA 3TMOA 3CQZJ 1TW3A 5F27A 4CO8A 3WTYC 5K7FA 4S05A 3DU6A 3TQNA 2O61A 2A6TA 4F7ZA 1FX7A 1PUFA 1CF7A 3PJRA 3BG9A 2LBFA 2F4VE 1U2WA 2IAIA 5BPDA 5C44J 4BQAA 1OYWA 5KVRA 4F52A 2OPTA 5D5WB 1JGSA 2GBYA 3HRSA 3AKZA 4ASNA 1XX5A 3KE2A 1ZREA 2HXOA 4LF9E 2M9HA 4Q35B 4XL9A 2LP0A 2LY2A 4RS8A 2AXTC 1ZN2A 3PFYA 4LFCE 2MC6A 2OA4A 1V3FA 2D45A 3CCEI 3TW6A 4RM3A 2XSJC 3CP2A 2ODRD 3R60A 3KIOA 2GA2A 4BE0A 3ZMUA 2K3PA 3TOAA 1YITI 3DPLC 1Z21A 2N8GA 3J80C 3ZOBA 4HW0A 2W00A 2K86A 3PNYA 4Z2YA 1LEAA 2HKXA 4LLGF 5KCMA 3DKWA 3HTSB 2KDZA 4CCKA 3I54A 1J59A 2VC0A 5FKOA 5H6QA 1EV7A 1S9HA 3LSIA 3RZDJ 4QWQA 2RTXA 5KL5A 1QZZA 3OR2C 1NTCA 2IHR1 1OKRA 4KITB 5GAGJ 2OBPA 3S2WA 4XR6A 3S8PA 1P9QC 3GLLA 3GTKJ 2JUCA 1HC8A 2YTIA 2OTLI 3ADLA 2BHYA 2I13A 2VBWA 1YYVA 5F04A 4R2DA 2WBUA 3C2BA 4HTGA 2VJ4A 5CVIA 2DRPA 4NNJA 5EZGA 2QF7A 4CCMA 2DIXA 2E1OA 5LBQA 1KYZA 2A6HF 3R0JA 4GFBA 2KJCA 4KIGA 3BTLA 2XAUA 4M3DA 4XIDA 3U2RA 2FV4B 2K3FA 3MWMA 2RREA 2CFXA 4MQ9F 4HEIA 1YX5A 3DFGA 2L3JA 1YIOA 2I9IA 3T0YA 1G3YA 2V83A 4E7KA 2YTFA 4P96A 4PCQA 3ZPLA 2E72A 2EPRA 2JPAA 2QKLB 3PSIA 2CU7A 5J1YA 2EOJA 1LFUP 5GPAA 3OYIA 3JSOA 2CV1A 4BS9A 4BH9A 3VK6A 2DU9A 5KL4A 2DA2A 1K78A 3Q0UA 2EMCA 1IQSA 3ZN0A 5GAEJ 1OMIA 5BMZA 2FF4A 2IGKA 3OWTA 1ZBQA 1QO0D 3P1XA 2DFEA 2O8XA 3EDPA 2V1UA 3JRAA 3CCVI 4X62E 2LCEA 4ESFA 1J75A 3ZCOA 1SVMA 5J1RA 3IRRA 1F9NA 2FOWA 3DJWA 4G9YA 3VYSB 1P47A 2UXCE 1ETWA 2MC5A 4P9FA 3WE2A 2R7QA 1T4NA 4RB0A 1RPWA 2LUQA 3QQAA 3GTPJ 2X1CA 2M30A 1YTYA 4AYBA 4XN3A 4EATA 1YPNA 2GQQA 1RUNA 2QGUA 1WJCA 2BXYA 2PMUA 4YFXF 2LOOA 2RQLA 3KP4A 4R79A 3HEFA 5L3BA 1KQ8A 1VF9A 5FLXZ 5A6KA 2JTVA 4A5MA 1IZ1A 3CJTB 4EQQA 2LVSA 3D5RC 3ERMA 3CUQC 3F23A 2IA2A 3ZMDA 1YS6A 5J8CA 4I76A 4M3GA 2VLAA 1R1UA 4IXAA 2WZOA 2WY7Q 4WFTA 4JYAE 1B4AA 2CUZA 4BEHA 3CMAI 2DFIA 5D6EA 2VOPA 1U78A 5AC4A 3F6HA 4IHSA 5BR8E 4RGSA 1VQPI 3FBIB 3HHHA 1GHCA 3ONQA 2EOHA 2HC5A 2YTPA 3RQ4A 4G6DA 3CLQA 5M5WJ 3CDIA 5F0FA 1W0UA 4DV2E 5D6FA 3V8LA 5AE2A 1YUIA 1YW7A 3K4MA 2PJRB 2W7NA 2ID3A 1O7LA 3HRTA 5F1RA 1RETA 1HBXG 3IWDA 3CD6I 2YTDA 2FQ3A 2L7ZA 1I27A 2EFNA 3IKVA 4MEXF 2ZMEC 4X9JA 3GTMJ 2J5PA 2CMPA 3FISA 2K40A 2WAEA 4ZDLA 1RUOA 1U8RA 4M74A 1I6HJ 2OZUA 2H6CA 2QM3A 3D1NI 2L9RA 4A3FJ 4C3IJ 1EF4A 4HA8A 1PP7U 4I98B 4A0XA 1FOYA 2LE2A 3P9CA 3FMQA 3W6JB 1IMUA 4B44A 3CMYA 2OCCH 4A3LJ 1WPKA 5J6XA 1KU3A 2EFPA 3M8JA 4YHHE 4BQOA 2E71A 3TBIA 5TRDA 3EUHC 4JI3E 1YZ9A 3L2WA 4DV0E 1WHNA 1RMDA 1JUSA 1JHHA 2ECBA 5DM6F 1DUXC 3VSLA 2EPMX 2VASA 4BJ5C 2Y0SN 2JWOA 5LRRA 5EGOB 3OYEA 1W7PB 1XTAA 1YS7A 1FBQA 1V4RA 2ESNA 3T8TA 4I0BA 1HCRA 2EV0A 4YEJA 4L18B 2M1SA 4V2GA 3LSTA 4HF2A 2EMZA 1RNLA 3BIDA 2V79A 3GFJA 2Q0OA 5F6FA 1KJKA 5J1UA 1T6SA 2B63J 2ACJA 2EJ4A 3PFIA 4LJZF 4Y4RA 3BPXA 2EZKA 4MO7A 4ZYEA 4X0GA 1LE8B 1X49A 3ZOQB 1OPCA 4RLFA 2PEXA 3G1MA 3F8BA 3KEOA 1K6OA 1XCBA 4A12A 2A3SA 2DJIA 1HNZE 4IL6C 3BT9A 1XGNA 3GFMA 3VYUB 2FA5A 1IBKE 3CCJI 3HOUJ 1KA8A 1U5TC 1FBUA 3OIPA 4CCOA 2MA3A 4XLHA 4ZYDA 1LEBA 1AAYA 3HSEA 2UXDE 1PJQA 1HA8A 3K4CA 2NVQJ 4BJ6C 1A1HA 3SJMA 1YHQI 2F4MB 1G2FC 2X6YA 1Y0UA 3CO6C 4Q48A 3RI4A 1XMOE 5DM7F 1Z67A 2L9NA 2DA5A 3R6SA 1RR8C 4JX4A 4NDLA 1PJRA 2K4BA 3VEPA 1OYIA 1UZCA 4MFDA 5FLXK 2YR2A 4BHPA 3C18A 1UMQA 1R22A 3E6MA 5AONA 2X6XA 1FYMA 1QGPA 2CW8A 2L7FP 2NNNA 3K69A 5BNGA 3ZMSA 1Z9CA 2P5LC 3C6MA 2H09A 1GXQA 4M30A 1S7AA 2ZB9A 2WAFA 4LGWA 1I39A 1SD5A 3SYTA 2XGCA 2Y0SA 2W57A 1QQIA 4BQNA 1WI9A 1WJ5A 3OOUA 2KFDA 4ENNA 2B9DA 4JI6E 3QP5A 3I59B 4S04A 3DF6A 3I0TA 2W4SA 1JI8A 5DNYA 3KCCA 4IHWA 5AIQA 2V87A 2FX0A 4A6EA 1XC5A 2EB7A 3I53A 1B1BA 4GEQB 2P7VB 2J5OA 2BXZA 3OYAA 1K4SA 2Q8UA 3I71A 3P9IA 3GWZA 2E19A 2R4GA 4NZVA 2MKNA 4M0VA 3WU2C 5GTHC 4HLYA 1ZLKA 4XMYA 4XSXF 3KP7A 2KIUA 3JRCA 1XDUA 1RESA 1L3LA 3BR2A 5J4YA 2X1EA 2Z9OA 2EZHA 1QVTA 1R6RA 1LDJA 2IW5A 2ODRC 3D0SA 3BP8A 4I09A 3WHBA 4XRFA 2Y2ZA 2IVMA 4OOGC 3BPVA 2E1MC 1YG2A 2R7UA 3ZXSA 2JVHA 2BBGA 5CFFE 4DYRA 4L0YB 1SMTA 3HKZN 2EFQA 2N8XA 1IV8A 2M5WA 3K6GA 2ZJQF 4F54A 5E18F 2L2KB 2GLIA 3H92A 1O4XA 1IN6A 1IN4A 2EQ1A 5LMUE 1MGTA 2TCTA 2O0YA 1GVDA 2Z5UA 4QPQA 1TF6A 2VQCA 3DPTA 3BROA 5D4RA 3K4KA 5IOZA 1BW5A 1POGA 4Q4ZF 1T8IA 1JXSA 1OR7A 1IN8A 2YUSA 4FX0A 4XORA 2QBYB 1L0OC 1KONA 2ZJ2A 3L2RA 1T0FA 2XKPA 3UK3C 5J4VA 4IRHA 3K1NA 1WQ2A 5E1WA 3ROUA 4AU7A 1SD7A 4XRSA 4XLNF 1TLHB 4F9AB 2MW8A 1R5GA 3IKTA 4LF5E 1WHQA 4QTRA 2P0WA 4LG0B 1BA5A 2YZTA 3IH3A 2EQRA 3SQNA 2KKOA 1TP4A 2A07F 2Y75A 3HOVJ 1TF3A 1FMVA 3M3YJ 2Q2EA 4ZZDA 2VJ5A 4C2UA 4CH7A 5CQEA 4PZJA 2JOXA 4O5GA 3CF5F 2VT3A 5IYDJ 1PYVA 2M3AA 3WGHA 2NXNB 2YRHA 2HYJA 1ONVA 1GXPA 4IJDA 2YX4A 3MN2A 4DYQA 1RKTA 3RPQA 3CC4I 5J40A 2STTA 3FX3A 3HKZA 3O3KA 1UHMA 2O9LA 1LVKA 2F5VA 3DKXA 4MEYF 4QLCU 2K27A 4EGYA 1YQAA 1G2DC 5DTDA 2UXXA 1PJSA 2EMFA 2PFBA 3T1BA 2RS7A 3J7ZI 3FMSA 2RSIA 1IN7A 3R61A 1JE8A 1DDNA 2M45A 2PRTA 3S1RJ 4R2PA 3HPZA 1YO5C 1A1IA 5IP9J 2LJHA 4DR5E 1T4LB 2YRKA 4RAGA 2EK5A 2XGXA 4CCLA 5FKLA 5BPIA 3THOB 3GTLJ 2EOYA 2VF1A 3E97A 1E0EA 1WJEA 4FISA 2L2OA 3OYFA 3K6QA 2VC1A 4WWCA 1BR4A 3ADIA 4UVCA 3HG9A 1TWFJ 3J80Z 4YG2F 3FZVA 4F55A 3S1NJ 2EN7A 4JI2E 1FBSA 2EPXA 5M3MJ 2HR3A 3DTKA 3PO2J 5LFAA 1RQ0A 4LF4E 5CQGA 1F36A 2CQQA 2RGVA 3RYRA 3I55I 2YWQA 1RC7A 5J3LA 5HOOA 3EUAA 5E79C 2DK5A 2VT2A 2F4IA 2HPMA 5BOXA 2NA2A 3TL4X 4HNUA 1KZHA 2I5UA 2KDOA 1WVRA 2FJ1A 3QWLA 3L00A 3O6BB 4PSWA 3H36A 4J00A 2XRLA 3Q9SA 2M87A 4RAFA 3H5AA 4E7LA 2EMGA 2VOOA 4B3XA 4GKJE 3E5UA 3H3VK 1B72B 5K5QA 2JR1A 1MIJA 2EOIA 4DZPA 1SR9A 4I99C 3ZP5A 2NS0A 1KYWA 3VYXA 4NXME 3BDDA 5E3MA 2EMAA 2B3TB 2ZCWA 2XC7A 4XKVA 3F6GA 1A6IA 2LDUA 2LTPA 2DCEA 4M6VA 4A0YA 1N78A 2XPUA 3IWBA 4IZZA 1QU6A 3IH4A 1UILA 3C1DA 4PJMA 1MSFC 2GPIA 4LIVA 3TO6A 5AC5A 3UNGC 5L3CA 3BG7A 5T6JA 1T08B 2HPIA 2WBTA 2R1FA 2GA1A 1A35A 4L5JA 3LOCA 2M34A 4EJOA 2VKDA 2FEZA 1OCOH 5C4JJ 3KETA 1RIOH 4G7OF 4U7DA 2UUBE 3V7CA 1VZ0A 2KRFA 3PIPF 3V4GA 1Y39A 4JI4E 2EOZA 2YPNA 1R00A 4UXNA 3BJ6A 1VNDA 4OIRF 1X19A 5M3FJ 4MGRA 4HF1A 3J81C 2JMWA 4KJZA 2K9SA 2EM9A 4BHBA 2DT7B 1ZRCA 2F48A 2JA6J 2MLGA 2UXBE 1KU7A 2F4OB 1Z05A 2EPAA 4Y52J 4ZTFA 3IHUA 3H35A 2R7ZJ 4F3QA 2JA5J 1V5GA 1J5EE 2OQGA 2PMHA 4NQWB 2YTOA 1MMDA 3LL7A 4A0ZA 2G7UA 1ODDA 1J7KA 2DTRA 2M0CA 3LSGA 3Q0VA 3OYCA 1XS9A 1B8IA 1BBYA 3VYRB 1XD7A 2B9SA 1QPIA 1K83J 2FD5A 3CCQI 2R7SA 2IBDA 4GZNC 5CVVA 4A3DJ 1HKQA 1UG2A 4IHTA 3OYKA 1FSEA 2P81A 2H36X 3HOWJ 1FOWA 3FDYA 3HDDA 1MEYC 4JI7E 3FHZA 3ULQB 3JAMK 3S3NA 4YIIA 1ZQ3P 4NC8A 2LSOA 4XRSG 1OQYA 2EMYA 3J7AY 4M9XA 2ETHA 1OISA 4G6QA 3GEZA 3W2AA 1G2HA 5B1AH 1JK2A 2EMLA 1OCTC 4G7ZF 2H94A 4M3BA 1HNWE 2ID6A 1UHZA 3A1YA 1LPQA 2EN6A 2V1NA 1OCRH 3CUQB 3J80K 2DYRH 1T33A 2R0QC 4CA0A 2P6TA 2FQ4A 4IJAA 1S7OA 1ZG1A 1ZR9A 3NEUA 2B7VA 1OCCH 2RN7A 3MEXA 3TEDA 4WCGA 2BY2A 3FXMA 2I8DA 1IRGA 1XMKA 2V9PA 2UWMA 4MQVA 1A6QA 2M2EA 4G8XA 4UV8A 2NRAC 3HYIA 3EYIA 2E2HJ 1QBJA 2RS6A 3K70D 2MH9A 1EH7A 3JRBA 5KL3A 3RIRA 2WB1N 3DEWA 4A3IJ 4RLQA 1A36A 4B3ME 5FLMJ 4KMFA 1PDAA 1HQCA 1IC8A 4KT6A 4DR2E 2ADUA 1SFKA 3HBLA 1YOVB 1ETKA 1N77A 4A93J 2ZMEB 1UFMA 3HGGA 1WH7A 4GRIA 4OOIA 4XM3A 2CGPA 2RV8A 3HGYA 3CCLI 3H5NA 2QLZA 1X3CA 5LGNA 2DA4A 1T56A 3JR9A 2KIQA 3N05A 1IXSB 2VIXA 2OF7A 4EGZA 1FJLA 2Y9YA 2XKOA 5D8KB 2B7EA 3BG3A 3F8CA 1EH8A 3K4LA 2ELHA 3FXJA 4ENKA 1IBLE 4A5NA 3C6KA 3JW4A 2A69F 4KYWA 1R9TJ 4AC0A 3K2ZA 4DUZE 4B09A 2OUMA 5A6AA 4R03A 3V7SA 2O03A 1BI1A 2GM4A 4L9VA 4B3TE 1DQUA 2DMIA 2EQ3A 3ZMTA 1ZAAC 2NNYA 1LKXA 2VB6A 4O43A 3I5UA 3MHHC 3NWTA 1D5YA 2A61A 4UVBA 4BBRJ 1TT5B 4LLNA 2MD5A 3BQYA 5AIPA 1Z1BA 2WB1A 2UU9E 4K2EA 3JSPA 1ZRFA 2EOMA 4X6AJ 1O7FA 5DDGA 1NK2P 2LH9A 3GZ6A 4DR6E 2DW4A 4IX7A 2OCEA 2R3SA 3SZTA 2LD5A 2EPUA 2WV1A 1AH5A 2GXAA 1HSTA 4AUXA 1VQNI 3MSWA 1MH4A 2CO5A 2ZXIA 3CC2I 2EL5A 1ENHA 2LY9A 2EV5A 5E1XA 5E1ZB 4B47A 5FRMA 2NUFA 1HKTA 3OMYA 4DUYE 1U5TB 2QSFX 4BKXA 1YJNI 3ZQFA 2FBKA 4JI8E 4HX7A 3QP6A 3S32A 1YJ9I 3CC7I 4JI5E 2UXNA 5EYRA 1X2NA 2RNJA 3BZKA 2X4HA 2E2JJ 3MCZA 5IOYA 1XSVA 2JPBA 1BJAA 1X6HA 3ASNH 1TBXA 3QG5C 3TW7A 4FTHA 5J47A 1FOKA 3CJQB 4CUGA 2EM3A 3VWBA 1YIJI 4IRIA 2MH2A 4ESBA 3KYLA 1FLIA 3THNA 1TZLA 1J09A 3KEQA 4IRGA 5HLGA 3TQMA 3ML6A 4X64E 5TGTA 2LV2A 2HGHA 4DR4E 1G3TA 2DMYA 2W25A 2ADRA 3VOEA 1ETVA 3OL4A 2JT1A 2EMWA 5HLTA 1I3AA 1SD4A 2BZTA 4L9TA 2L8TA 1WJBA 2VQHA 3C3WA 3GCMA 3E5XA 3GFLA 3QYBA 2OV7A 2JYAA 3R4KA 4MTDA 1JKOC 1MMNA 1MSEC 4RGXA 1E3PA 3CCSI 1BIAA 2QA4I 1VFCA 5CPRB 4EJWA 2ZSHB 3H5RA 2DI3A 3TO9A 1DGWY 1NHAA 2NOJB 3CJRB 4XN0A 5JLWA 5ICEA 4R2SA 2ZJPF 2ZNYA 5JR3A 4KISA 1I3QJ 2Z1DA 1O3SA 4AYBN 3LLHA 5CVUA 2X51A 5HNHA 4UY8I 2LKPA 2VUMJ 4PJLA 4RGRA 3S2HJ 2FUG2 2EOXA 2UV1A 4DYCA 3LA7A 4J19A 2KP6A 1Y0NA 4EJUA 2V89A 1MBGA 3CDHA 2K85A 2LUPB 1LDDA 2R7VA 2EM5A 1FZPB 2E1MB 3O2PE 3TKYA 1FMWA 1X47A 2M4IA 3L2VA 1GVJA 3GTGJ 4XKBA 2XASA 4JX5A 2EN3A 3A03A 1J2XA 5E8GA 4ZYAA 5LD2C 1R58A 2G0EA 4QPOA 2V4JC 2XROA 2L02A 1LNWA 1B9MA 1UB9A 2BGCA 2F5EA 3CESA 3L2UA 4RB3C 4R1HA 1M1EB 2GOXB 2K7LA 3S3OA 5E3LA 4JQFA 3OYJA 4EEFG 1YLFA 3L7WA 1ZTRA 4YELA 3M07A 2MLKA 5LHHA 4RM2A 2AXLA 5LGTA 2EIMH 1TWGJ 2BHZA 5B1BH 1TNSA 1UJ8A 4HV5A 3U21A 2BOLA 1FP2A 1UHWA 4PJNA 4BBYA 1X1BA 3OYHA 4EJTA 3FIWA 4N9HA 5EG0B 4CZZA 3W3CA 2QWWA 1ON1A 3ABTA 3HL2A 2CV0A 4A6DA 2XGDA 5C3EJ 1H9TA 4NQWA 1S29A 5EJCA 4D0PA 1VTNC 2DLLA 3HXLA 1X48A 4JI0E 2E35A 1LFBA 4F9BB 4WF2A 3M99B 2G9WA 3AAFA 1ZBTA 4F6MA 3BZCA 1IDZA 4R8HA 4HEA2 3ZMVA 3PQKA 4P55A 1BOAA 1BJZA 1P7JA 1Z7LA 1SD6A 5FFXA 3WTXC 2XIGA 5HLHA 1IW7F 2OC6A 4L9JA 4PJ0C 4O3MA 1NCSA 1NG6A 2RC4A 2K4JA 1V5FA 3E3VA 1S7EA 1Y8QB 4PFOA 3OYMA 5EDNA 2H1KA 4N9IA 2F5FA 4U87A 4XLCA 5D5VB 1FKAE 3JREA 4ZZLA 3O8GA 1D1AA 5FRNA 3H9JA 1QHHD 2NS7A 3FIGA 2IGOA 3DTEA 1EH6A 3SFZA 4R2RA 2YU8A 3CTAA 1XB4A 2UUCE 2IT0A 1BM9A 3LSJA 2KIMA 3PSFA 3PM1A 4HSRA 1N75A 2VKEA 2JUGA 4IEJA 3V8KA 5M5YJ 2KIFA 3KP3A 5E3OA 4XOTA 2HI3A 3T1YE 4O5VA 1ZGJA 3B73A 3GVAA 3IL2A 4CYDA 4YFNF 2EPCA 4AIKA 1BW6A 1A1GA 2BV6A 3U1DA 4B43A 4CGZA 3V8JA 2JWTA 2QENA 4RMNA 1UBDC 2LMZA 2GWRA 4M3EA 5A6BD 3GFIA 2BE5F 2F6CA 2P5KA 3HC7A 4D7NA 3CLOA 4NHJA 4II2A 3K4NA 2HKOA 4M6YA 4C3JJ 4BGDA 2M9AA 2KL4A 2YU3A 3PUBA 3E6CC 3S3MA 2R76A 4NBQA 3E1SA 3CDLA 3RZOJ 5HS7A 1MDMA 5DCMA 1ZR2A 3ZQHA 2NVYJ 2DA6A 1AHDP 4BQQA 2E1CA 5K1YA 5K7ZA 4KT5C 4BCAA 4ZDPA 2LY1A 3S14J 4DV4E 3F0CA 5H20A 3LSKA 3ZQGA 2VL8A 3K70C 2NABA 3RMPA 1D8KA 3Q0WA 4LIUA 3V42A 3I4PA 5B66C 2GLOA 2CFOA 2CW7A 1FYKA 1HR0E 2DMNA 5FROA 1HXDA 1W5CC 1VQLI 3RSNA 3I56I 1BI2A 3F9KA 4JOMA 4B8XA 3HOSA 2HEOA 1E2XA 1IJWC 1H88C 2H6BA 2M8EA 3EUHA 3HUGB 3KZYA 2D9HA 3KYCB 1DI2A 1T95A 3I64A 2JP9A 3F8MA 1I50J 3ZQLA 3FK6A 1RR7A 5IV8B 4Y7NJ 3J81Z 1WI3A 3BJOA 3U1KA 1IO2A 2FXAA 2NAZA 4BYYA 2EM2A 1G6NA 3LNQA 5H2FC 2O3FA 1RC9A 1JKQC 1X2MA 4WYQB 1IRFA 4G12A 1YFHA 4QSHA 1IBME 3BY6A 2PBIA 1XCVA 2QQBA 5DD4A 1TN9A 4LLLA 1N32E 1TQIA 3GZNB 2O8KA 2EV6A 1GT0C 1MBKA 2PI0A 1GTKA 3A0BC 1PDNC 1XSXA 5F0HA 1IUYA 3DBRB 3IWCA 3EQ1A 2EE8A 1ETQA 4RAZA 2EM8A 3MKZA 4CDGA 5IP6A 1TL8A 3PNTA 3VYYA 1U5TA 3ZQQA 5IY5H 3AG3H 4AQYE 4MHGA 3S2DJ 2NVUB 5LMNE 1EKZA 3ISPA 2XAGA 5DV5A 1WFXA 2LYCA 4E7HA 4DV6E 1H9GA 3FXOA 4M3FA 2F8BA 3CMMA 3HM5A 4HV6A 2DPUA 2F5DA 4AVPA 4J01A 4FCYA 4ENMA 5GADJ 3J7AG 2CUFA 2C6YA 3H09A 2VQGA 1ZH5A 1W4MA 2EOEA 3PUFA 2L6MA 1K6YA 2YX7A 3M9AA 1TWHJ 4F2JC 2EPNA 3OYLA 1MZBA 2MG4A 2HJJA 5ED4A 4XNFA 2IS1A 2AQFA 5TJJA 2HTSA 1MMSA 2ME6A 3K1MA 1YX3A 2R5ZB 4AIJA 2TDXA 1JKRC 2R5YB 4OIPF 1WJAA 1Z1DA 2KQRA 3VHTB 3CJNA 4Y17A 4DGWB 2DODA 1KU2A 2KJBA 2HS5A 3OYNA 1VQ4I 2A6EF 3BF2A 5LHGA 2COMA 5LEKA 2HVRA 4HBLA 3H3UA 2Y9ZA 2GAUA 5F08A 2VBXA 2EOQA 3RJPA 2RVCA 4GYIA 2UUZA 3WG7H 2QYOA 3G73A 4EMSA 4HF0A 1F5TA 5CKTA 2HQAA 2EM0A 4G6TB 1Y8RB 1X3UA 4E4HA 2ZFWA 5IT3A 4I0AA 2EM7A 1SFEA 4RBOA 4WX9A 3T5XA 4TUIA 5FKMA 2Q1ZB 3NWSA 4A69C 1FTZA 5J8FA 4XLFA 2EJRA 3F8NA 1B59A 1P6RA 2OQRA 3H9QA 4XBFA 3WHCA 1AU7A 9ANTA 2MKDA 2E5NA 4L5EA 1SVOA 2L01A 2L2NA 4DW6A 4UUVA 2CH0A 5D8LB 2E1MA 3BG6A 4M73A 2XAQA 5AE3A 2M7BA 3BG5A 5A69A 2IP2A 2ISZA 1DU0A 2EIJH 4YIRX 3ZMZA 4LB5A 2LTRA 1DU6A 3F8FA 2LF7A 3W6VA 4DV7E 2QZ8A 3DLAA 4YRVA 2ZM6E 5A2QC 3HB9A 2HYFA 1K4TA 1ETYA 3OY9A 1XG1A 2E34A 1IUFA 2YSPA 3F22A 1F4KA 4NUBA 4JI1E 2NVTJ 4L0ZB 1RI7A
chains in the Genus database with same CATH topology
2RKHA 4CHUA 2PLYA 1KQ0A 1USTA 3FXRA 1YW9A 1S3JA 3FMRA 4HLXA 2XAHA 2STWA 4LK0F 4M6XA 3KP2A 4HAMA 1LJ9A 4UVAA 1E17A 1P2FA 3DXJF 2HYGD 4G94A 3F6OA 3CO7C 3E6DA 1Z7UA 1CF7B 3GW2A 2VN2A 3ABUA 4Q5SF 4GO1A 2RDPA 1IXRC 3WTUC 2FBHA 1XMAA 5L3EA 4KNYA 2V9VA 3E6BA 3FM5A 3RPUA 1FYLA 1XSDA 3DV8A 4G7HF 4EM2A 2LNBA 3ERED 1HSJA 2EA4A 4ON0A 4EM1A 1DPUA 2VE9A 3HTUA 5FO5A 3WTSC 4KIFA 3FWEA 1WRJA 2FOKA 3ZQ7A 2HFHA 1QNTA 1CGPA 2D2WA 2DPDA 3F21A 5HDGA 3CUOA 5E20A 3NQOA 5JHUA 1Z6RA 1W7PA 4WXCA 1BN5A 2V6CA 1RZ4A 4P5OA 3H3ZA 3BJAA 3HUGA 2P5VA 3FXQA 1LVAA 3HRMA 4ENJA 2GXBA 1ULYA 3EETA 1G3SA 3GYHX 3IRQA 3HSFA 3ECOA 1K78B 1UCRA 4MTEA 3QPTA 2GXGA 4KUMA 4U7BA 3VB2A 3GX4X 2XUBA 5ICFA 3GXOA 1R23A 5D5UB 3WU0A 2OD5A 3GZ5A 6PAXA 1R1TA 3RYPA 1FY7A 4HDVA 4CXFA 2XRNA 2W24A 1K7AA 3ZN1A 2HOEA 3RKYA 4IVNA 3OV8A 5HVQC 4ZH4F 3I59A 4EV0A 5L3DA 2AS5F 3GO5A 3WTTC 4HX8A 2CG4A 1KU9A 5LRSA 3KLOA 1QZYA 3RTRA 2PQ8A 1P4XA 1D3YA 3IC7A 3TGNA 2F2EA 5HDNA 4HYEA 1IAWA 5L3GA 2JZYA 4AD9A 4M71A 2ZXJA 2ZNZA 3SHFA 4UNOA 1ZARA 3MAJA 2PJPA 1KQ9A 4LMYA 2DBBA 4AIHA 3LA2A 2QBYA 3TO7A 4HQEA 4IF4A 1WWXA 5ILUA 2CQKA 4LG0A 1T39A 3J7AO 1SFUA 3RDIA 4NB5A 4HDUA 1PP8F 3LFKA 3LQRA 3M1EA 1R7JA 1ZRDA 3W6KB 2VODA 4YFKF 1T2KA 3F6VA 4ESJA 4WK8F 2YSRA 5CYVA 2FBIA 2JRTA 3LA3A 4RAYA 3WTWC 3D5LA 5FFZA 1FNNA 3QU3A 3IWZA 2HTJA 4TV7A 3KLNA 4P9UA 3FM3A 4Y13A 3T8RA 1Z91A 5D4SA 1ZAOA 4OIOF 1IN5A 5F64A 3K0LA 2QQAA 2ESHA 3MQ0A 4RB1A 4I2OA 3EYYA 2NYXA 4KFCA 3JTHA 2HQNA 1I6XA 2FSWA 4UHTA 1USSA 2CYYA 5H6RA 5BQTA 4WXDA 4KN4X 3WTVC 2OU2A 1BI3A 1BI0A 5E8IA 1ZG3A 1TQPA 2P4WA 3WG9A 2WC2A 5ICGA 3MZHA 1HKSA 2LF8A 3LAPA 4MNUA 3OOPA 5E17F 2EFOA 4KN7X 1XGOA 5A2QZ 4FX4A 1SAXA 2WV0A 2R7DA 4U0VA 4WXHA 2O6GE 2FE3A 2RQPA 4JBAA 3TOBA 4OMYA 3FXUA 2D1HA 2E7WA 1G4DA 3TDZC 3QOPA 2W84A 3LWFA 4HOBA 3EQLF 2FU4A 5HDKA 4ZYGA 2DK8A 1W5TA 4M9ZA 1ZLJA 2YPRA 1REPC 2M1BA 4UV9A 2Y48A 2CW0F 2MC3A 3QRFF 4Y15A 3CUQA 1MJAA 3B02A 4U88A 3HSRA 3KZZA 5ERIA 4BHCA 2HDCA 5DUIA 4EJVA 2XV4S 1R5HA 1W7PD 1H0MA 4KMUX 4XSZF 1A04A 2VONA 1ON2A 2ZMEA 5CJ9A 4KA4A 3DEUA 5DD8A 1O3TA 2A5YB 2DO7A 3L9FA 5BS6A 1QPMA 1XDSA 1G3WA 2EWNA 2E1NA 2F5CA 2DQRA 1FSHA 1TTYA 5A2QK 3PQJA 2XAFA 1HW5A 5HS9A 2FNAA 3FF5A 2VXZA 2V1XA 1YW8A 2Y0MA 2H27A 1D5VA 5EEGA 4H0EA 3N4MA 5HLIA 2E7XA 4DNCA 3NRVA 2VBYA 3BWGA 5L3FA 2DAOA 1MJBA 1Z6TA 1LQ1A 3ECHA 5KK1A 3RKWA 5K5OA 5FD6A 3KP5A 1J9IA 3ELKA 4PGGA 3DF8A 4LD5A 3E5QA 1SFXA 1ZYRF 3HIFA 2ZKZA 1TQMA 3WGIA 2OAZA 2D1VA 1XGSA 1LDKB 4U0WA 3K1PA 3DP7A 1U6GA 3L09A 3WU1B 3MFKA 3L2CA 3BZ6A 2WTEA 5HS8A 2XVCA 4KIBA 5ILSA 1TNTA 2X0LA 4M9SA 2XHKA 5DUKA 2ZBKA 4L5IA 3COAC 4OU0A 4KDPA 3I58A 5IT9Z 1OYYA 2L54A 4I01A 5ICCA 2IRFG 2HZTA 2PN6A 3WODF 4IPAA 1AWCA 2FNPA 3R0AA 4GYGA 3U9GA 1FT9A 5CLSA 2BYVE 2QVOA 1T98A 4LK1F 3M8FA 1P4WA 4I7HA 2DPUA 5EEHA 1T38A 2GIVA 1JHFA 2P8TA 3SXYA 3J81K 2ISYA 4PDKA 1P4AA 3BOQA 3F72A 2P7CB 4KICA 4DQ2A 4BXUA 1O3RA 4GCVA 3G3ZA 2DQLA 3HHGA 3MZYA 1DP7P 4U0YA 4OINF 1ZG5A 5FGMA 2K02A 3P7NA 5LEJA 4OMZA 2L4AA 1BC8C 2VE8A 2EFWA 3Q9VA 1F1ZA 2MBFA 3M7GA 4I02A 1MKMA 2JSCA 1WSUA 1SMYF 1KGSA 1B6AA 4N0BA 3TDUC 1B9NA 2FMLA 1W5SA 5DEQA 1U3EM 2Z3YA 1Q1HA 1FPQA 3KFWX 3WGGA 3VFZA 1P92A 3JAMZ 1O3QA 1I1GA 3N97A 2Q8KA 3SZPA 3WTZA 4AWXB 4FT8A 1WKMA 2CWEA 4BAYA 4LFUA 2HQRA 5LLQA 1STZA 2FMYA 4XLPF 2ZO4A 2UZKA 5IT9K 1FWZA 3LQQA 4PGHA 5JI6A 1PUEE 2W85A 3KP6A 3V7RA 5D5XB 1K79A 1FC3A 1LB2A 1J0RA 1S8NA 1AOYA 4JK1X 5DYMA 1S6LA 1ZHFA 5ILVA 4HZFA 5CVRA 5FB2A 4RGUA 2OZ6A 4CICA 2G7HA 2HGCA 3P9KA 1D8JA 5LGUA 3GLXA 2B0LA 3QPHA 1ZGAA 4GXOA 1I5ZA 2VBZA 1HW1A 1FP1D 3RKXA 1XGMA 1HW2A 5CVJA 3GF2A 2WWYA 4BNCA 4OIQF 4A2UA 2HWVA 4M72A 2Z33A 1MJ9A 3REOA 3M8EA 2CSOA 2L3DA 2BEOA 3GUDA 1J5YA 2R7FA 2JPCA 4L9NA 4FHTA 2L4MA 4E70A 2P6SA 1O57A 4EVIA 2XAJA 1R1VA 5K5RA 2V1DA 2EA2A 4ZYHA 3HRUA 2GZWA 4GGGA 3VODA 3Q5FA 4O6JA 3F3XA 5JVTA 3HOTA 4HQMA 2DT5A 4RB2C 3WE3A 2IA1A 5LHIA 2IA0A 5DCMB 1MDMB 1DPRA 2BBYA 1XN7A 1IXCA 1IF1A 4HX4A 3K9TA 4Q47A 2QUFA 3C7JA 5FD5A 3LAJA 4ETSA 1R36A 1MD0A 5JFRA 2A68F 1BIBA 1I1SA 2IJLA 1TW2A 4EM0B 4YIFA 1BC7C 3JTGA 1C0WA 2PG4A 3QU6A 2IPQX 3IWFA 4LB6B 2QQ9A 2Z99A 3DQVC 3QAHA 5DCFA 2FRHA 1TW3A 4CO8A 3WTYC 4S05A 3TQNA 2O61A 4F7ZA 1FX7A 1CF7A 1U2WA 5BPDA 4BQAA 1OYWA 5KVRA 5D5WB 1JGSA 3HRSA 4ASNA 3KE2A 1ZREA 4RS8A 1ZN2A 2OA4A 1V3FA 2D45A 3R60A 2GA2A 3ZMUA 3TOAA 3DPLC 4HW0A 2K86A 4Z2YA 1LEAA 2HKXA 4LLGF 3DKWA 3HTSB 3I54A 1J59A 2VC0A 5H6QA 1EV7A 4QWQA 1QZZA 1OKRA 2OBPA 3S2WA 2VBWA 1YYVA 5CVIA 5LBQA 1KYZA 2A6HF 3R0JA 2KJCA 4KIGA 3U2RA 3MWMA 2CFXA 4MQ9F 3DFGA 1YIOA 3T0YA 1G3YA 4P96A 4PCQA 3ZPLA 3JSOA 4BH9A 2DU9A 1K78A 3ZN0A 1OMIA 5BMZA 2FF4A 1QO0D 2O8XA 3EDPA 2V1UA 4ESFA 1J75A 3IRRA 1F9NA 4G9YA 4P9FA 3WE2A 4RB0A 2M30A 1YTYA 2GQQA 1RUNA 2PMUA 4YFXF 3KP4A 4R79A 5L3BA 1KQ8A 5FLXZ 2JTVA 4A5MA 1IZ1A 4EQQA 3CUQC 3F23A 2IA2A 3ZMDA 1YS6A 5J8CA 1R1UA 4IXAA 1B4AA 2DFIA 5D6EA 2VOPA 1U78A 4IHSA 4RGSA 1GHCA 3HHHA 4G6DA 5D6FA 3V8LA 1YW7A 1O7LA 3HRTA 5F1RA 1HBXG 2FQ3A 1I27A 2EFNA 3IKVA 4MEXF 2J5PA 1RUOA 1U8RA 4M74A 2OZUA 2H6CA 2QM3A 4HA8A 1PP7U 4I98B 4A0XA 3P9CA 3FMQA 3W6JB 5J6XA 1KU3A 2EFPA 5TRDA 1JHHA 1DUXC 5LRRA 1W7PB 1YS7A 1FBQA 1V4RA 2ESNA 3T8TA 4I0BA 2EV0A 4L18B 4HF2A 3LSTA 1RNLA 2V79A 3GFJA 2Q0OA 5F6FA 1T6SA 2ACJA 3PFIA 4LJZF 3BPXA 4ZYEA 1OPCA 2PEXA 3F8BA 3KEOA 1K6OA 1XCBA 4A12A 2A3SA 1XGNA 3GFMA 2FA5A 1KA8A 1U5TC 1FBUA 1LEBA 2MA3A 4ZYDA 3HSEA 1Y0UA 3CO6C 4Q48A 3RI4A 3R6SA 2K4BA 3VEPA 1OYIA 5FLXK 2YR2A 4BHPA 3C18A 1R22A 3E6MA 5AONA 1FYMA 1QGPA 2NNNA 3K69A 3ZMSA 1Z9CA 2P5LC 2H09A 1GXQA 1S7AA 4LGWA 1SD5A 2W57A 1QQIA 1WI9A 4ENNA 3QP5A 3I59B 4S04A 3I0TA 3KCCA 5AIQA 4A6EA 2EB7A 3I53A 1B1BA 2P7VB 2J5OA 3I71A 3P9IA 3GWZA 1ZLKA 4HLYA 4XSXF 3KP7A 2KIUA 1L3LA 1XDUA 2Z9OA 1LDJA 2IW5A 3D0SA 3BP8A 4I09A 4XRFA 2IVMA 3BPVA 1YG2A 4L0YB 1SMTA 2EFQA 2M5WA 5E18F 3H92A 1IN6A 1IN4A 1MGTA 2Z5UA 2O0YA 3DPTA 3BROA 5D4RA 4Q4ZF 1JXSA 1OR7A 1IN8A 4FX0A 2QBYB 1L0OC 2ZJ2A 1T0FA 2XKPA 4IRHA 3K1NA 1WQ2A 5E1WA 3ROUA 1SD7A 4XLNF 1TLHB 1R5GA 3IKTA 4LG0B 3SQNA 2KKOA 2A07F 2Y75A 2Q2EA 4ZZDA 4PZJA 2VT3A 3WGHA 1ONVA 1GXPA 2YX4A 3RPQA 2STTA 3FX3A 3O3KA 1UHMA 4MEYF 4QLCU 2K27A 4EGYA 1YQAA 2UXXA 2PFBA 3T1BA 3FMSA 1IN7A 3R61A 1JE8A 1DDNA 2M45A 1YO5C 2EK5A 2XGXA 5BPIA 3E97A 2VC1A 4WWCA 4UVCA 3J80Z 4YG2F 3FZVA 1FBSA 2HR3A 2RGVA 3RYRA 5HOOA 2DK5A 2VT2A 5BOXA 3L00A 3O6BB 3Q9SA 2M87A 2VOOA 3E5UA 5K5QA 3ZP5A 2NS0A 1KYWA 3BDDA 2ZCWA 2LDUA 4A0YA 3C1DA 3TO6A 5L3CA 2GA1A 4L5JA 4EJOA 2FEZA 3KETA 4G7OF 1RIOH 4U7DA 3V7CA 2KRFA 3V4GA 1R00A 4UXNA 3BJ6A 4OIRF 4MGRA 4HF1A 4BHBA 1ZRCA 2MLGA 1KU7A 1Z05A 3IHUA 2OQGA 2PMHA 4A0ZA 2G7UA 1ODDA 1J7KA 2DTRA 1BBYA 1XD7A 5CVVA 1HKQA 4IHTA 1FSEA 3FHZA 3ULQB 3JAMK 4YIIA 2LSOA 4M9XA 2ETHA 4G6QA 3GEZA 4G7ZF 2H94A 3CUQB 3J80K 2P6TA 4IJAA 1S7OA 1ZG1A 3NEUA 2RN7A 3MEXA 4WCGA 1IRGA 1XMKA 2UWMA 4MQVA 4UV8A 4G8XA 3EYIA 2NRAC 3HYIA 1QBJA 2MH9A 1EH7A 3RIRA 4KMFA 1HQCA 2ADUA 2ZMEB 1UFMA 4OOIA 2CGPA 2RV8A 2QLZA 5LGNA 1IXSB 4EGZA 2XKOA 5D8KB 3F8CA 1EH8A 2ELHA 4ENKA 4A5NA 3JW4A 2A69F 4KYWA 3K2ZA 4B09A 3V7SA 2O03A 1BI1A 4L9VA 3ZMTA 2NNYA 3I5UA 2A61A 4UVBA 4LLNA 2MD5A 5AIPA 4K2EA 3JSPA 1ZRFA 1O7FA 5DDGA 3GZ6A 2DW4A 3SZTA 2R3SA 1HSTA 2CO5A 2EV5A 5E1XA 5E1ZB 1HKTA 1U5TB 2FBKA 4HX7A 3QP6A 2UXNA 2RNJA 2X4HA 3MCZA 1XSVA 2JPBA 1BJAA 1TBXA 1FOKA 4IRIA 2MH2A 4ESBA 1FLIA 3KEQA 4IRGA 5HLGA 3ML6A 1G3TA 2W25A 3VOEA 2JT1A 1SD4A 4L9TA 3C3WA 3E5XA 3GFLA 3R4KA 4MTDA 4RGXA 1BIAA 4EJWA 2DI3A 3TO9A 1NHAA 5ICEA 2ZNYA 5JR3A 1O3SA 5CVUA 2LKPA 4RGRA 3LA7A 4EJUA 3CDHA 1LDDA 1FZPB 3O2PE 3TKYA 1GVJA 2XASA 1J2XA 5E8GA 1R58A 2XROA 2L02A 1LNWA 1B9MA 1UB9A 2BGCA 2F5EA 4RB3C 4R1HA 2K7LA 4JQFA 1YLFA 3L7WA 2MLKA 5LHHA 2AXLA 5LGTA 1TNSA 4HV5A 1FP2A 1UHWA 4EJTA 4N9HA 4CZZA 2QWWA 1ON1A 3ABTA 4A6DA 1H9TA 4NQWA 1S29A 4D0PA 1VTNC 2DLLA 4WF2A 2G9WA 3AAFA 4R8HA 3ZMVA 3PQKA 4P55A 1BOAA 1SD6A 5FFXA 3WTXC 2XIGA 5HLHA 1IW7F 4L9JA 4O3MA 2RC4A 2K4JA 3E3VA 4N9IA 2F5FA 5D5VB 4ZZLA 1EH6A 3SFZA 3CTAA 1XB4A 2IT0A 1BM9A 2KIMA 3V8KA 2KIFA 3KP3A 4O5VA 1ZGJA 3B73A 3GVAA 3IL2A 4CYDA 4YFNF 4AIKA 2BV6A 3U1DA 4CGZA 3V8JA 2QENA 2GWRA 3GFIA 2BE5F 2P5KA 3CLOA 4NHJA 2HKOA 4M6YA 2YU3A 3E6CC 5HS7A 1MDMA 5DCMA 2E1CA 5K1YA 4KT5C 5H20A 1D8KA 3I4PA 1FYKA 1HXDA 1BI2A 4B8XA 3HOSA 2HEOA 1E2XA 2H6BA 2M8EA 3EUHA 3KZYA 3I64A 3F8MA 3J81Z 3BJOA 2FXAA 2NAZA 4BYYA 1G6NA 2O3FA 1IRFA 1YFHA 3BY6A 2PBIA 1XCVA 2QQBA 5DD4A 4LLLA 1TQIA 2EV6A 2PI0A 1PDNC 1XSXA 1IUYA 4RAZA 4CDGA 1U5TA 4MHGA 3ISPA 2XAGA 5DV5A 1H9GA 4HV6A 2F5DA 4AVPA 4ENMA 2C6YA 1ZH5A 1W4MA 2YX7A 3M9AA 1MZBA 5ED4A 5TJJA 2HTSA 3K1MA 4AIJA 4OIPF 2TDXA 1Z1DA 3CJNA 4Y17A 1KU2A 2KJBA 2HS5A 2A6EF 5LHGA 2COMA</