4WXCA

Crystal structure of mycobacterium tuberculosis ogt-y139f
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGFGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxcA01
2A69F 4ENKA 1FWZA 1S3JA 1BIBA 2FSWA 2Q2EA 1T39A 3BZ6A 1T0FA 4L5JA 3D0SA 2MBFA 5J6XA 4CXFA 2UWMA 4A0YA 1XSVA 3SXYA 1PDNC 5LLQA 4EQQA 5JFRA 1FYLA 5ERIA 3EYYA 3HOSA 3HHHA 2Z5UA 1I1GA 1U2WA 3HIFA 4G7HF 3V4GA 3DV8A 4LJZF 1HXDA 2ZCWA 3S2WA 2PFBA 2M45A 3K1MA 4WWCA 1U78A 4S05A 4I7HA 5FO5A 1NHAA 2KJCA 3ECHA 1QQIA 3FM3A 1IXSB 3EUHA 3KLOA 4XSZF 1W5TA 1C0WA 4HV6A 2OQRA 1YFHA 3GXOA 2HQNA 4QWQA 4YIIA 4GYIA 3TQNA 1OYIA 4HF2A 1HQCA 4L0YB 2RGVA 2QBYB 2M8EA 4UV8A 1BI0A 2HOEA 3I71A 2ESNA 2J5OA 2FNAA 3HHGA 4M73A 4RGUA 5HDNA 3FF5A 4GCVA 1R00A 4P5OA 4EJWA 4E70A 1TNTA 1W7PD 4KUMA 5DCMA 4H0EA 4KA4A 1F1ZA 3B02A 5IT3A 2ZKZA 1SMTA 4A0ZA 5K5QA 1HKQA 4LLNA 1LNWA 3DPTA 3C7JA 3L09A 4WCGA 3RJPA 2Z33A 2P6SA 3WU1B 2QM3A 1FP2A 3K1PA 1YLFA 1JHFA 2EA4A 1ZG3A 3KZZA 1ZGJA 3N4MA 2HZTA 1KYWA 4MNUA 1XCVA 1K78B 2A68F 4KIFA 1IN5A 5HDKA 4QLCU 3BJ6A 2P5LC 4R79A 3QAHA 2MC3A 2V9VA 3V7RA 1XN7A 2XRNA 3IL2A 3KP2A 3GZ5A 4EJUA 5E8GA 3RIRA 3LAPA 3FXUA 1DPUA 4AIJA 4IXAA 3NQOA 1FC3A 2B0LA 1KA8A 3WE3A 3Q9SA 2EFPA 4CZZA 2COMA 4AD9A 3IRQA 4L9TA 2XASA 4A12A 5DDGA 1ZAOA 3JW4A 4UHTA 3W6KB 3LAJA 2EK5A 1IN6A 2VOOA 1XCBA 4HW0A 3WGIA 3RPQA 5CVUA 3COAC 1I6XA 4AVPA 1W4MA 3LSTA 4PGGA 4EVIA 1G4DA 1FX7A 3HYIA 1S7OA 2IP2A 3KZYA 2QVOA 2F5DA 3JAMZ 1R23A 1TNSA 3K0LA 2IJLA 4FX4A 1OYWA 3C1DA 1BN5A 4YIFA 1QBJA 2IW5A 3QU3A 3FXRA 3K69A 2YU3A 1IXCA 2GIVA 5HS7A 2CFXA 4HQMA 2ESHA 1ON1A 5LEKA 3WTXC 4ZYHA 1T38A 4UVCA 3QRFF 1ZLJA 3LQRA 4RS8A 3R0JA 5D4RA 3WTWC 4XSXF 1EH8A 3IWZA 5CVVA 1B1BA 1XGOA 5HS9A 3F6VA 5CYVA 1P6RA 1HKSA 4OU0A 3E6CC 3ERED 1XSDA 3M8EA 2HTJA 2ZXJA 5ILVA 5E1ZB 5D5VB 2WV0A 1FLIA 4JQFA 4I01A 4EGYA 2V1XA 2D1HA 4RGSA 1ZG5A 4AWXB 2NAZA 5L3DA 3RDIA 4HZFA 2IA2A 3PFIA 5FB2A 4LG0B 2ADUA 4ZYEA 1QZYA 3T5XA 4P55A 4KIGA 3DFGA 4O6JA 1FPQA 4KNYA 2P8TA 3O6BB 4EM2A 4XLNF 2NNNA 3ZN1A 3I53A 1MJ9A 3SZPA 2ZMEA 3LQQA 3TKYA 3HTUA 3V8LA 1CF7B 3KEOA 2MH2A 4M9SA 2D2WA 4RB0A 2W57A 2MA3A 4WXCA 3KEQA 2A3SA 2KIUA 1LVAA 1O3QA 3V8KA 2FNPA 3HRMA 1I27A 3F3XA 3WE2A 4M6XA 3GFMA 2LF7A 3FMRA 1YW9A 5DYMA 1U6GA 1ZG1A 4BAYA 1LEBA 2DO7A 2XVCA 1I1SA 1S29A 1P92A 1Y0UA 5LBQA 3HRSA 5L3EA 3TDUC 1HW5A 3JAMK 1R58A 1R5GA 3CO6C 1SD4A 3FX3A 4ON0A 3CUQB 4DQ2A 4U0YA 3DKWA 1RI7A 4N9IA 2HS5A 4G9YA 1HSTA 2H27A 5LGTA 1LQ1A 2HQRA 3K9TA 4WXHA 2DQLA 3F72A 4U7DA 4RB1A 1FP1D 4PZJA 1MD0A 2NNYA 2FU4A 4FHTA 1KU9A 4MQ9F 1KYZA 2Y75A 4ESBA 2JRTA 1J7KA 3GF2A 2HTSA 1USTA 4UXNA 2P6TA 3MCZA 3TGNA 3L00A 3MQ0A 1MKMA 5JHUA 1TQPA 3GVAA 4B09A 3Q5FA 1KQ9A 1FY7A 3CTAA 2OZ6A 3RYRA 1BI1A 4G6DA 2A5YB 2BYVE 3WTUC 2DAOA 3WODF 1QZZA 2E7XA 1YO5C 1LEAA 3R61A 2QWWA 5LEJA 4A0XA 2Z9OA 2DQRA 1Z6RA 4R8HA 1J0RA 3DQVC 4UUVA 5HOOA 3IKTA 4BQAA 3BWGA 5CVJA 3ZMTA 5JR3A 2F5CA 3TOBA 1ZARA 1ZRFA 2Z3YA 4EM1A 3IHUA 1WKMA 1FBSA 1LDDA 2CWEA 3V7SA 3OV8A 5CVRA 2IPQX 4Q5SF 1B4AA 1O7FA 3HRUA 4ASNA 4LLGF 1YW8A 2YX7A 3GFIA 5BOXA 3BOQA 2VBWA 3ZQ7A 3ML6A 3GEZA 1ZREA 3F22A 4UVBA 4JBAA 2P7CB 2QBYA 3PQKA 3E6BA 1DP7P 2STTA 2ETHA 3KP7A 2EV0A 2JPBA 3TO7A 5ICFA 2P7VB 1HKTA 3WTTC 5ICGA 1B9MA 2QLZA 5F6FA 3E97A 4YFXF 4IF4A 5FD5A 2CSOA 3RKYA 3I58A 1GXPA 1RUOA 1STZA 4O3MA 4M74A 1T6SA 1LB2A 2CQKA 3H3ZA 1Z7UA 4I0BA 3GO5A 4HX7A 3LA2A 1BM9A 3SHFA 2HKXA 4M6YA 4Q48A 3CO7C 4HLYA 1RIOH 2A6EF 4CHUA 1YTYA 3RYPA 1XMAA 3HRTA 3ROUA 1XB4A 2DBBA 4CO8A 1BI3A 3TOAA 5LRSA 5ILUA 1K78A 4ETSA 1FSEA 1MDMA 4MTEA 4UVAA 5ICCA 3MZYA 3TDZC 3M8FA 2O61A 1B59A 4YFNF 3BY6A 2W84A 2D45A 3SQNA 4LLLA 4M9ZA 2FBKA 1UCRA 3T8TA 5LHHA 3WU0A 3KE2A 1Z91A 1S6LA 3KFWX 4YFKF 1D3YA 3ELKA 5D5XB 2CYYA 1R1TA 4GGGA 4IVNA 1FOKA 1KQ8A 2W24A 4LB5A 3ZMZA 2PLYA 2ISYA 3WG9A 3I64A 4WK8F 1ZGAA 1BC8C 2JPCA 4S04A 5DCFA 3EYIA 4EV0A 1BOAA 5KK1A 2EB7A 3J80Z 1IN7A 2RN7A 4M72A 3IC7A 2LNBA 2YSRA 3TO9A 4HDUA 5FFXA 4EJOA 2VBYA 2GXGA 3I4PA 1IN8A 4M71A 4G94A 4UV9A 2PQ8A 2LSOA 1OPCA 1YW7A 4WX9A 3WTZA 3AAFA 2DFIA 2H94A 3QOPA 3F23A 2OZUA 2P4WA 4CDGA 1KU7A 2FEZA 1U5TB 2M5WA 1JXSA 3G73A 1TTYA 2O0YA 4BHCA 4HOBA 4P9FA 3O2PE 3CJNA 2JSCA 2EV5A 3BPXA 5EEGA 1WI9A 5DCMB 2QYOA 4IRHA 1OMIA 2HFHA 2GAUA 1R1UA 2XV4S 3ABTA 1OKRA 1Z9CA 3LWFA 5A2QZ 1XDUA 1ONVA 2WC2A 3P7NA 4U7BA 2VE9A 2NS0A 4GXOA 4IRGA 3IKVA 5E1XA 4KT5C 4BNCA 4OIRF 2UZKA 3F8FA 2OD5A 3F8MA 5CJ9A 1GVJA 1G3YA 1FYMA 5IT9Z 1E2XA 5AIQA 1J5YA 4HDVA 1E17A 1W7PB 1TW3A 2ISZA 3CUQC 3E6MA 3ABUA 5J8FA 3T0YA 4NHJA 2XKOA 1CF7A 5AIPA 4JK1X 1XGNA 4G8XA 2HEOA 2VE8A 4P9UA 2W85A 2DTRA 2GQQA 3N97A 5FLXZ 3GW2A 5H6RA 4PCQA 2D1VA 4PDKA 4EJVA 4EGZA 1FZPB 1LDJA 3GWZA 5TJJA 4UNOA 4OINF 2QQ9A 1ZHFA 5E18F 3M9AA 2EA2A 2FMLA 5D6EA 1SAXA 4I02A 5EEHA 3J80K 3E3VA 3E6DA 1D5VA 4HX8A 1G3SA 4I0AA 2GA2A 4N0BA 3CUQA 1DPRA 2Y48A 1HBXG 2IA1A 4LGWA 2E1NA 4LB6B 1HSJA 4L9NA 4KYWA 3BROA 1JE8A 1S7AA 1SD7A 2DW4A 1HW2A 2RC4A 1XGSA 4ZYDA 3HSEA 5LHIA 4RAYA 1O7LA 2FF4A 3QU6A 5DEQA 2XGXA 5D5WB 1KGSA 3KP3A 1VTNC 4EJTA 2BV6A 3JSPA 1KU2A 2FBIA 4RGXA 2YX4A 5L3CA 2KIFA 2HGCA 2L02A 2YPRA 2K02A 3HUGA 3GLXA 2R7DA 3F8BA 4YG2F 5A2QK 1K79A 2V79A 3GFLA 1J9IA 4AIHA 2IA0A 2FMYA 3CUOA 3K1NA 4HF1A 3ZMVA 1F9NA 4BH9A 1CGPA 2XAGA 1PP7U 4MHGA 2RV8A 5L3BA 5D4SA 4G6QA 3G3ZA 1B6AA 1BC7C 5IT9K 2HDCA 3FMSA 5BPIA 5HDGA 5K5RA 3J81Z 1GHCA 3PQJA 4A5NA 1IUYA 4MTDA 1ON2A 1MZBA 2PEXA 4GO1A 1QO0D 2XKPA 2RQPA 2BEOA 4BXUA 2H6CA 3I59B 3LA3A 2DI3A 1QPMA 2JTVA 3EETA 4OMZA 4EM0B 2IRFG 4K2EA 5FLXK 1XMKA 4G7ZF 4AIKA 3F21A 1YIOA 2TDXA 4RB3C 3KP4A 4MEXF 4KN7X 2PN6A 1H9TA 2M1BA 3T1BA 1WRJA 3DXJF 4IRIA 2QENA 2IT0A 2M30A 5FD6A 2FA5A 5E1WA 3MEXA 2XAJA 3D5LA 1IXRC 3HOTA 4U0WA 1XD7A 3E5XA 2XAHA 2F5FA 1TLHB 5K1YA 2VC0A 4OOIA 2MLGA 3VEPA 5HLIA 1SD6A 5CVIA 3F8CA 4MGRA 1U3EM 4LK1F 2VC1A 4HAMA 1PUEE 1D8KA 3CDHA 3U9GA 3WTSC 2XAQA 4OIQF 3V7CA 1TQIA 1IRFA 2ZO4A 4L18B 4LMYA 3RI4A 2L54A 2UXXA 3GUDA 1FNNA 1SFXA 3RTRA 2MD5A 2VBZA 2A6HF 2Q0OA 2VXZA 5FFZA 2DPUA 4MQVA 4ENNA 4HA8A 3DF8A 2ZJ2A 2JT1A 1G3WA 4EMSA 4LK0F 6PAXA 1PP8F 5JI6A 5E8IA 2FOKA 3FMQA 1RUNA 3MFKA 2L4MA 4HQEA 2K4BA 2FBHA 3KLNA 1R1VA 2K86A 4LD5A 4RAZA 1BJAA 2PMUA 3FHZA 5FGMA 3JTGA 1YQAA 3RKWA 2E1CA 4ZH4F 3LFKA 2O03A 2C6YA 2WWYA 4BYYA 4BHBA 2FRHA 3BDDA 5TRDA 2STWA 1U5TC 4IPAA 3VFZA 3H3UA 1IAWA 2GZWA 2G9WA 3QPHA 3BPVA 3VODA 4ESFA 3Q9VA 3J81K 3K2ZA 2J5PA 3R0AA 3M1EA 2GWRA 2OQGA 1QNTA 2XAFA 3RKXA 2IVMA 2CO5A 1ZLKA 1WSUA 1J59A 2KJBA 2Z99A 5DD8A 1HW1A 2FE3A 1G3TA 3WGGA 2AXLA 2HYGD 3RPUA 3KP6A 4WXDA 1FSHA 2KIMA 1IW7F 3KP5A 3GZ6A 1K6OA 3ZP5A 4KFCA 1T2KA 1R7JA 1DUXC 1IN4A 2KKOA 1B9NA 1ULYA 1MJBA 1K7AA 1ZYRF 4ESJA 1T98A 5BQTA 4RB2C 1U5TA 2X4HA 4Q4ZF 3ISPA 4OIOF 1R5HA 1F5TA 1ZRDA 2OAZA 1YS7A 4RGRA 1DDNA 1Q1HA 3M7GA 3OOPA 4A2UA 1TQMA 2LDUA 2DLLA 3SFZA 4BHPA 1WQ2A 1AOYA 2K7LA 2XUBA 5J8CA 5JVTA 3P9CA 1R36A 2DK5A 3JTHA 3GYHX 2VN2A 4KMFA 3EQLF 2EWNA 4XBFA 4GYGA 4WF2A 1EH6A 1LDKB 4HLXA 2ZNZA 1MDMB 1YYVA 2UXNA 2XROA 2WTEA 2EJRA 1W7PA 4P96A 5LGNA 1A04A 4HBLA 1TW2A 3IWFA 1O3RA 1TBXA 3U1DA 4NB5A 5E17F 5KVRA 1Z6TA 3ECOA 3ZN0A 2VONA 5LRRA 2ZFWA 5BMZA 5AONA 2RVCA 4CICA 2FXAA 2M87A 2VT3A 3NRVA 3FM5A 3F6OA 2NRAC 1MJAA 2HR3A 3R6SA 3ULQB 2PBIA 1L0OC 3P9KA 5D8LB 4R1HA 4N9HA 2DPDA 2X0LA 4KMUX 2HWVA 1OYYA 2QQBA 3MAJA 2QUFA 4LG0A 1MGTA 3R60A 3C18A 2HKOA 2V6CA 1OR7A 2RDPA 2RNJA 3O3KA 1UB9A 4XRFA 5CLSA 1X3UA 1LJ9A 4ZZDA 4M9XA 1P4XA 2G7HA 1W5SA 2VODA 1UFMA 4XLPF 3H92A 2OU2A 2BE5F 4FT8A 5F64A 1R22A 2A07F 1KQ0A 1F4KA 1BI2A 3ZMDA 3SZTA 4A5MA 3DPLC 1SMYF 3B73A 5LHGA 1J75A 2O8XA 3MZHA 2R7FA 2AS5F 4I09A 1O57A 4MEYF 1UHMA 5DUKA 5HS8A 4DNCA 2PMHA 4ENJA 2Y0MA 3FXQA 1WWXA 2DU9A 2E7WA 1IF1A 2EFWA 2EFNA 1IRGA 2ELHA 3ZPLA 1U8RA 3BJAA 1AWCA 4Z2YA 1FYKA 3E5QA 4Q47A 4TV7A 2BBYA 5L3GA 2K27A 4Y17A 4IHSA 2ZNYA 3JSOA 1YG2A 2GXBA 3L2CA 3VB2A 1REPC 2EFOA 1XGMA 3DP7A 3BJOA 2O3FA 2MLKA 4KIBA 4I98B 2BGCA 4CYDA 1SFEA 1ODDA 2H09A 3REOA 5H6QA 2LF8A 4L9VA 1JHHA 5BS6A 5H20A 1D8JA 2FQ3A 3I59A 4IJAA 3U2RA 4NQWA 5D6FA 4HF0A 2GA1A 5ICEA 4LFUA 3L7WA 3CLOA 3E5UA 4G7OF 2KRFA 1EH7A 2MH9A 4A6EA 3I5UA 2XHKA 5DD4A 1FBQA 1RZ4A 3J7AO 1FT9A 3ZMUA 3F8NA 3HSFA 4ZYGA 3IRRA 5HLGA 1ZRCA 4I2OA 4KICA 3C3WA 2V1UA 4F7ZA 4KDPA 4OIPF 3WGHA 1G6NA 3I54A 4B8XA 2O6GE 2A61A 5BPDA 2DK8A 1USSA 1H0MA 1Z1DA 3V8JA 2DT5A 4L9JA 3WTVC 2P5VA 2PJPA 5ED4A 2LKPA 3EDPA 4IHTA 3QP6A 1XSXA 3WTYC 3ZMSA 3HSRA 2NYXA 5HLHA 2JZYA 2F2EA 4PGHA 3LA7A 2VBXA 4CGZA 2ZMEB 2EFQA 1EV7A 2Q8KA 3HTSB 3NEUA 4HV5A 1V4RA 3DEUA 1UHWA 3MWMA 3GFJA 2K4JA 2CW0F 4Y13A 1SD5A 3W6JB 2L4AA 1KU3A 3P9IA 2ZBKA 1S8NA 4A6DA 1ZH5A 3GX4X 4L5IA 1FBUA 2W25A 2QZ8A 3FZVA 5E20A 5D8KB 4ZZLA 5L3FA 3KETA 1BIAA 4HYEA 4D0PA 1V3FA 4L0ZB 4Y15A 1XDSA 3L9FA 3T8RA 5DUIA 2PI0A 1BBYA 2OA4A 4FX0A 4U88A 2V1DA 1QGPA 1Z05A 2ACJA 2VOPA 5HVQC 1O3SA 1SFUA 3VOEA 2RKHA 3KCCA 1O3TA 1P2FA 5ILSA 4KN4X 1JGSA 2G7UA 2L01A 4U0VA 2CG4A 4OMYA 5DV5A 1I5ZA 1YS6A 1P4AA 3FWEA 5D5UB 2VT2A 2EV6A 1ZN2A 3R4KA 1P4WA 1IZ1A 3I0TA 2HYFA 2L3DA 1RNLA 5LGUA 3TO6A 5F1RA 1J2XA 2P5KA 3QPTA 1L3LA 2CGPA 2OBPA 2PG4A 4O5VA 2H6BA 4ENMA 2F5EA 1GXQA 4HX4A 1H9GA 5K5OA 2XIGA 2YR2A 2QQAA 3QP5A 3BP8A 2R3SA
chains in the Genus database with same CATH superfamily
2A69F 2VJ5A 4B3ME 4ENKA 1FWZA 3EUHC 3ZQQA 5EDNA 2EH3A 4BE1A 1S3JA 1BIBA 2FSWA 1TP4A 1A1JA 2Q2EA 5IOYA 1T39A 1LFPA 3H9QA 1XX5A 1IDZA 3BZ6A 2JVHA 1YHQI 3RPUD 2L33A 1T0FA 4L5JA 1JJ6C 3TEDA 2VL8A 1WJEA 3D0SA 5FKNA 2MBFA 3BZCA 2H8WA 2LBFA 5J6XA 4BC7A 2V7FA 3NARA 1Z3YA 2DA4A 2KRHA 4CXFA 1G59A 1S7EA 2LJUA 2UWMA 2VKVA 3S15J 2CSHA 5M5WJ 3H9GA 2DA2A 4A0YA 2DLKA 1XSVA 3SXYA 4X6AJ 2FV4B 1PDNC 2XF7A 2EL6A 5LLQA 4EQQA 5JFRA 4NC8A 2QQ8A 3PFYA 2KQRA 1FYLA 3OYAA 3QODA 4JV5E 1X4OA 2BXYA 3EYYA 1RKWA 5ERIA 3HOSA 3HHHA 3CC2I 2RAEA 2Z5UA 1I1GA 2K9MA 1DGRM 2A05A 1U2WA 5CKTA 1BJZA 3HIFA 2M4KA 4G7HF 2VJJA 4J01A 1Y39A 3V4GA 2R7XA 5LD2C 3DV8A 4YHHE 2K9SA 4UUTA 3FK7A 4LJZF 2YTFA 1HXDA 2ZCWA 4XM3A 3S2WA 1ETVA 2PFBA 2M45A 3K1MA 4WWCA 4PSXA 3S16J 1U78A 3OL4A 4ANJA 4S05A 2IGMA 2DYSH 3SDGA 1T4OA 1MBJA 1MSEC 4I7HA 2GPIA 5C4XJ 2M8GX 2V83A 4LTYA 3BF2A 5FO5A 1NHAA 2KJCA 3ECHA 1QQIA 1R4MB 2DLQA 3FM3A 3H3VK 4XN3A 1IXSB 2JWTA 2UUBE 3H1CA 1YE9A 3EUHA 3KLOA 4XSZF 3A01B 1W5TA 1C0WA 2W82A 2WBUA 2HGHA 4HV6A 2OQRA 1AAYA 3BR5A 1YFHA 3GXOA 3PSIA 2KHXA 2HQNA 3KYDB 1PKPA 4QWQA 4YIIA 4GYIA 3TQNA 1EF4A 2YTIA 4D5CA 1OYIA 4HF2A 1HQCA 3W2WA 4L0YB 4DV7E 2RGVA 2QBYB 2V9PA 2XGEA 4ZDOA 1V54H 2NVYJ 2EPCA 3DEWA 2M8EA 4UV8A 1NH3A 3EPZA 1BI0A 2ZB9A 2VI6A 1RMDA 2CV0A 2HOEA 2DDAA 2X6OA 3I71A 2ESNA 4JOMA 3DTKA 3VYRB 2XSJC 4XICA 2J5OA 3S3NA 2FNAA 2IAIA 4BBSJ 1DQ3A 2EPZA 3HHGA 4M73A 2WBTA 1PUFA 2WAFA 4RGUA 5HDNA 3FF5A 4GCVA 4M3GA 1PDAA 1R00A 2BVLA 3W3CA 2YTDA 3G4SI 3B6AA 4P5OA 4EJWA 2K9LA 3RCOA 4E70A 1TNTA 2JA7J 1QHHD 1W7PD 1DGCA 4RDUA 1I50J 2QEXI 4NXNE 3LSHA 4Y52J 5IWAE 4KUMA 5DCMA 2VXDA 4KA4A 4H0EA 1F1ZA 3B02A 2YS9A 5IT3A 2ZKZA 1G2FC 1SMTA 4A0ZA 5K5QA 3GZNB 1HKQA 4LLNA 4R2AA 1LNWA 3DPTA 2KONA 3C7JA 3OTOE 1R49A 3L09A 1MEYC 4WCGA 3RJPA 2Z33A 3MHSC 1HR0E 2P6SA 2OTJI 4JX6A 5F04A 3BTCA 4IKFA 3WU1B 2QM3A 1JJ8C 3CCRI 1FP2A 4DMIA 3K1PA 1YLFA 1GUUA 1PVEA 1JHFA 2E1MC 1ZG3A 2EA4A 3KZZA 2M3AA 4F2JC 4BXXJ 4BU2A 1ZGJA 1FEXA 1W5CC 2JYAA 5J1RA 3N4MA 2J7JA 2HZTA 2ENHA 1G8XA 1KYWA 1IO2A 4MNUA 2ELYA 4R2PA 1UN6B 2DTZA 2KRCA 1XCVA 1K78B 4JX5A 2A68F 1WI3A 3L2WA 2FQ4A 4KIFA 1D0YA 5IYBJ 3ABMH 2E2JJ 2R7VA 2L8TA 2EOIA 3CMAI 1IN5A 5HDKA 1O4XA 4QLCU 3BJ6A 2P5LC 4R79A 3QAHA 4HSTA 2MC3A 2V9VA 3V7RA 3Q0WA 1XN7A 5KL3A 2XRNA 1UJ8A 3IL2A 4LFCE 3KP2A 3JTZA 3CMEI 3GZ5A 3MSWA 4EJUA 2Y30A 5E8GA 3RIRA 3LAPA 2EPUA 2K85A 2ID3A 2EPMX 1YYWA 3FXUA 1N32E 4KJZA 1DPUA 4AIJA 5IYCJ 4IXAA 3NQOA 3ABLH 5M3FJ 1FC3A 4JI2E 2B0LA 1KA8A 3WE3A 2CT1A 3Q9SA 3OYFA 3LSIA 1D0XA 2VPLA 2EFPA 2EZLA 4CZZA 2COMA 4WPYA 4LITA 1JUSA 4AD9A 3IRQA 1A1GA 4L9TA 1Z0XA 2XASA 4A12A 2HI3A 5DDGA 1ZAOA 3JW4A 4UHTA 3W6KB 3LAJA 3LMLA 2EK5A 2JP9A 1POGA 2E2HJ 2EN2A 1DGWY 2DMQA 1IN6A 3H5NA 2VOOA 1XCBA 2LR8A 4HW0A 3JRAA 5AE1A 3HOZJ 3WGIA 4OAZA 3RPQA 2Q1ZB 2E1MA 5CVUA 2NOJB 3FIWA 1XMOE 3COAC 4R2RA 1I6XA 1YX5A 2WB1N 4NUBA 1K61A 2EN3A 2JUGA 4DR1E 4AVPA 2EL4A 1W4MA 3CJRB 3D5SC 3LSTA 1ZKGA 3S3OA 4A3KJ 1LPQA 4JI3E 4PGGA 4EVIA 4XIDA 1YYOA 4FE7A 2NVQJ 1G4DA 1FX7A 3MVPA 3ADGA 5EF6A 4J00A 3HYIA 1S7OA 2PMZA 5KL2A 1UG0A 2IP2A 3KZYA 3FISA 2GXAA 2QVOA 2F5DA 2CQXA 2LRDA 3S3MA 3MN2A 3KZIC 3JAMZ 3AV0A 3HJEA 1ETXA 1R23A 2OPTA 1TNSA 3K0LA 3GTJJ 2IJLA 4FX4A 1OYWA 2AXTC 3BTLA 3C1DA 2L9SA 3H36A 4BJ6C 1BN5A 2LY9A 2EPOA 4DR6E 4YIFA 5FLMJ 2M0CA 2IW5A 1U9OA 1QBJA 2YUSA 3QU3A 3LMMA 3FXRA 3K69A 3ZQGA 1JTYA 1SFKA 2YU3A 1IXCA 4DKKA 3H5RA 2GIVA 1XS9A 4M6VA 5HS7A 1X58A 2CFXA 3BCBA 4HQMA 3K4MA 1QVTA 2X85A 1HA8A 2ESHA 1ON1A 5LEKA 4KITB 4ZYHA 3WTXC 4UVCA 3QRFF 1T38A 3C4BA 4GRIA 4N4NB 1ZLJA 2G0EA 3H9JA 3LQRA 4RS8A 3R0JA 2R7RA 3HDDA 5D4RA 3WTWC 3M99B 1N36E 3J81C 4G6TB 1IBLE 2VE7C 4XSXF 1EH8A 1YI2I 3TBIA 3IWZA 3X2QH 5CVVA 1B1BA 1YSAC 1U9NA 1XGOA 3S32A 2OF7A 5HS9A 3TMOA 3CESA 3F6VA 2EPPA 5CYVA 1W36D 4B3RE 1P6RA 3HC7A 3QOEA 1HKSA 4OU0A 1AA7A 5KAIC 1MH3A 2HZDA 4CYCA 3E6CC 3ERED 1XSDA 1N3GA 2EM9A 3M8EA 2CV2A 2HTJA 2EMIA 3IP4B 1KJKA 2ZMEC 1A1FA 2ZXJA 5ILVA 2EMZA 5M5YJ 3CD6I 2MKDA 1Z21A 5E1ZB 4GDFA 3HPHA 5A6AA 5D5VB 2FUG2 4A3JJ 2WV0A 1FLIA 1Z77A 4JQFA 3GLLA 4I01A 4DUZE 4KT6A 4EGYA 3EPHA 2X9DA 2HOAA 2V1XA 2D1HA 4RGSA 2DMNA 4LIUA 1ZG5A 4AWXB 3HOYJ 1ORKA 2LE2A 2BY3A 2WV1A 4Y3OA 1D5YA 1PJTA 2N3GA 2NAZA 5L3DA 3LOCA 3RDIA 5IP9J 2LTSA 3AKZA 4HZFA 2IA2A 3PFIA 4ZTJA 1T8IA 5FB2A 4LG0B 2EMBA 4O24A 2AO9A 2BHZA 2ADUA 4ZYEA 1QZYA 3T5XA 4P55A 4KIGA 4ABZA 3DFGA 4O6JA 5C44J 1IQSA 4IZZA 1RESA 1FPQA 3OYLA 4DYQA 1HNZE 4GFBA 4KNYA 5KL6A 1X6EA 2P8TA 2B7VA 3O6BB 4EM2A 2W4SA 1QZEA 4BQOA 4S0HB 5GTHC 4DR5E 3F9KA 4XLNF 5F0HA 9ANTA 4DUYE 2UUAE 2NNNA 1P47A 3ZN1A 5DNYA 1MMGA 2O5RA 1J26A 3I53A 1MJ9A 3SZPA 2ZMEA 3LQQA 2EMWA 3TKYA 1X49A 3HQ1A 4MFEA 3HTUA 3RZOJ 3EPLA 3V8LA 1JUMA 1CF7B 3OS1A 2F8BA 3KEOA 3HKZA 2MH2A 4M9SA 2D2WA 5AC5A 4DV0E 1HOMA 4RB0A 3K4JA 2HVRA 4C2TA 2W57A 2MA3A 3OS0A 4WXCA 3KEQA 4M3BA 2NVTJ 2A3SA 2KP6A 2OJED 5F3WA 2KIUA 3TW6A 1LVAA 1O3QA 3V8KA 1P9QC 1X2MA 4D9JA 2EZHA 3S17J 2FNPA 5FJ8J 2VQLA 3ZCOA 1IBME 1YOVB 4A3BJ 4NDLA 4ZJZA 2EMHA 3OMLA 1XPXA 4RHBB 1JK2A 3HRMA 1I27A 3F3XA 3FXJA 3WE2A 4LFAE 4M6XA 3GFMA 3H09A 2F4IA 2LF7A 5AASA 4N4OB 3FMRA 3CQZJ 1LE8A 1YW9A 3DWLE 5DYMA 5FKOA 1U6GA 4KHPE 1R4NB 2F6CA 1ZG1A 2EPLX 4BAYA 1LEBA 2DO7A 4LOCA 2XVCA 1F43A 2EPRA 4NZVA 1K6YA 2W1OA 1I1SA 1SANA 1S29A 2QGUA 1P92A 1Y0UA 2XF6A 3FDYA 3O8GA 5B5EC 5LBQA 3BR1A 3HRSA 4A69C 1PJQA 1Y56A 1QRYA 5L3EA 3TDUC 1HW5A 3JAMK 1R58A 1R5GA 1SVLA 2K5CA 2GOXB 1SD4A 1SVMA 3E1SA 1ENHA 3CO6C 1HC8A 3FX3A 4ON0A 3AG3H 4E7KA 1FIPA 4WSPA 5F0FA 2LJHA 3FHNA 2FGGA 2RNGA 2VB6A 1HLVA 2VIXA 4L5EA 2HXOA 3CUQB 4DQ2A 3ONQA 1ZBTA 4U0YA 3DKWA 1RI7A 2UV1A 4N9IA 4DV5E 2LVSA 5GPAA 2HS5A 4OWRB 1VQNI 4G9YA 4TUIA 1Z67A 3CP2A 1FTZA 1HSTA 2H27A 5LGTA 1GV2A 3L1PA 1LQ1A 2YTGA 2HPIA 4D7NA 4JI1E 2HQRA 2EOEA 3K9TA 4WXHA 2DQLA 3F72A 4U7DA 4XKBA 4RB1A 1JKPC 2VKDA 3MZ8A 1FP1D 4PZJA 4R2DA 2V6EA 3PUFA 1MD0A 1SEUA 4P78A 2NNYA 2FU4A 4XKCA 1EKZA 4FHTA 1KU9A 2PX9A 1KYZA 2E5ZA 2Y75A 3HGGA 4MQ9F 4ESBA 2JRTA 1X48A 2EWLA 1J7KA 2UU9E 4BMJA 3GF2A 3U21A 5LL6R 3V42A 2HTSA 1USTA 4UXNA 1Y8QB 2P6TA 3MCZA 3TGNA 3L00A 4QSHA 3MQ0A 1A35A 1MKMA 5JHUA 1OQYA 4MFDA 2NVXJ 1X47A 1PJSA 1TQPA 2R92J 3J7ZI 4XL9A 2N8GA 1OJLA 3GVAA 1TZLA 4QTRA 1WHQA 4DW6A 2EMFA 2JK3A 4B09A 1GVDA 3M3YJ 4CUGA 3Q5FA 2LG4A 1KQ9A 1FY7A 1N77A 1B8IB 3GTLJ 3P1XA 3CTAA 2M4GA 2OZ6A 3OYEA 1UBDC 3RYRA 1BI1A 2ZM6E 4G6DA 2A5YB 2BYVE 3HUGB 4PJ0C 3WTUC 2XRLA 5AE3A 4HNVA 2DAOA 3DBLB 2DA3A 3WODF 1QZZA 2E7XA 2IEKA 1YO5C 1LEAA 1V5FA 2ELKA 3R61A 2QWWA 1EJ9A 5LEJA 3THNA 2HU9A 3LSRA 4A0XA 3PO3J 4PUSA 2Z9OA 2DQRA 3F0CA 1Z6RA 3HG9A 2EM7A 4J19A 3DF6A 4A3LJ 1W1WE 1J0RA 4R8HA 1UHZA 3OYBA 4PJMA 2BXZA 3DQVC 1ZK8A 4UUVA 5HOOA 2AHQA 3IKTA 1Y0NA 1MMNA 4BQAA 1ZBQA 1GTKA 1VI0A 3BWGA 5CVJA 3ZMTA 1KONA 5JR3A 4MIMA 1NG6A 2F5CA 1QHGA 3BIDA 3TOBA 1ZARA 1JUPA 3OIOA 2HPMA 1JGGA 3HXLA 1ZRFA 5FLVA 5CQGA 3OYIA 5AE2A 1NK3P 2Z3YA 4EM1A 2XGCA 3IHUA 1N75A 1WKMA 1WJPA 2EM4A 2L7ZA 2H8RA 5F0CA 1FBSA 1LDDA 3VYXA 3ZQCA 3VYTB 4BS9A 4HRIA 2KL4A 2CWEA 3V7SA 2LVHA 2NS7A 2Y0SA 3OV8A 3F6GA 2KHMA 5CVRA 4BL0B 3GMEA 2IPQX 2L3JA 4Q5SF 2LUQA 4IJDA 1ZQ3P 1B4AA 1O7FA 3AG4H 3HRUA 4ASNA 1LKXA 1Z7LA 4LLGF 3J7AY 1YW8A 3CCVI 2YX7A 3GFIA 5BOXA 3BOQA 3OYCA 2VBWA 3CF2A 2QCOA 1AKHB 3ZQ7A 3ML6A 3CCUI 1VQPI 2CTDA 1IC8A 4RM2A 1B72B 2JOBA 1VF9A 3GEZA 2A25A 3A01A 1LFBA 2MKNA 3E7LA 3OMYA 1K4TA 2YTJA 5A69A 4JI6E 2YTQA 3MKZA 3K70C 1RQ0A 1ZREA 2V89A 3F22A 4UVBA 2MC6A 1YJWI 4JBAA 3S1MJ 1X19A 2P7CB 2LY2A 2QBYA 3PQKA 3E6BA 4QPOA 4XORA 1FIAA 4HEA2 2RS6A 1DP7P 2R93J 2VUMJ 2STTA 2ETHA 3KP7A 2EV0A 2JPBA 4XRMA 3TO7A 5ICFA 3GTMJ 2P7VB 3JRGA 3I4NJ 2XB0X 2HXIA 1HKTA 4BY7J 3S1QJ 5EJCA 1YRNB 4R2CA 3GTGJ 3WTTC 5ICGA 1B9MA 2CRGA 1XNRE 4FASD 2QLZA 2LH9A 3E97A 5F6FA 4YFXF 1H88C 4IF4A 1P7IA 2KOUA 5FD5A 2CSOA 4YEJA 2DA7A 5IXMB 3GTOJ 1WZ2A 3RKYA 4R2SA 3I58A 1GXPA 1IV6A 1RUOA 2HJJA 3MHHC 2DOAA 3KIOA 1STZA 2EE8A 3CJQB 4O3MA 4M30A 3G1LA 4M74A 1ERDA 2DA6A 3CCQI 1T6SA 5FROA 1WH5A 2EOXA 1LB2A 4BKXA 4F6NA 2CQNA 2LC2A 2Y2ZA 4B1RA 4L5NC 2CQKA 2DGCA 3H3ZA 2DFEA 3MKWB 2H1LA 1Z7UA 4I0BA 1X3CA 3GO5A 4HX7A 1A1KA 2HVQA 2NUEA 2IGKA 2CQ7A 3LA2A 1BM9A 2W7NA 5GAHJ 3SHFA 2HKXA 4BGDA 3DKXA 2OCEA 4CCNA 4DR3E 1D1BA 1XG1A 4M6YA 4PFOA 5EZGA 1Y8RB 1ZTRA 3K2AA 4Q48A 3CO7C 4HLYA 1RIOH 4B3TE 2A6EF 4CHUA 4AYBA 2XPUA 3RYPA 1YTYA 4M3EA 1XMAA 3BLYA 2VLAA 3HRTA 3ROUA 1IBKE 1XB4A 1WH7A 2DBBA 2R5ZB 3ZRGA 4CO8A 1BI3A 3TOAA 4IHWA 5LRSA 1RKTA 5ILUA 4X8WA 1K78A 4ETSA 4JP0A 4UY8I 1ETWA 2DRPA 2XDVA 1R9TJ 1FSEA 1ZR9A 2QF7A 1MDMA 4MTEA 4KZSA 5AC4A 2GM4A 1E3OC 4J8ZA 2GBYA 2W00A 4C30A 2YU5A 2K4VA 3ESWB 2Y69H 4UVAA 3G6EI 3A02A 2BVMA 2EBIA 1D1CA 5ICCA 3MZYA 5J4VA 3TDZC 3RMPA 2EQ0A 4X0GA 3M8FA 4A93J 1TL8A 1RETA 2JUCA 3CC7I 2O61A 2HC5A 1B59A 4YFNF 3ZOBA 3BY6A 2W84A 3KX2A 2L6MA 2D45A 3SQNA 4LLLA 4R2EA 4M9ZA 2FBKA 1UCRA 4BDYA 3T8TA 5LHHA 3WU0A 2BHYA 1X1BA 4RA2A 3ADLA 2JSPA 3KE2A 1Z91A 4RM3A 3MMYB 1S6LA 5M3MJ 5GPCA 4IHXA 2WADA 4IHYA 2EM6A 1FMWA 3OR1C 3KFWX 4YFKF 1D3YA 2E71A 3H0GJ 3ELKA 4DBQA 1T56A 5D5XB 4LF4E 3CP8A 2CYYA 3DU5A 1R1TA 4BACA 5LMNE 4GGGA 2W48A 5HNFA 4IVNA 1GQEA 2MSYA 3BG7A 3LSMA 4BCAA 2LBFB 1FOKA 1KQ8A 1VQ7I 2DA5A 2W24A 3NWSA 4LB5A 3ABKH 2KDZA 4K0KE 3ZMZA 2PLYA 2FOWA 3BCAA 3F6HA 2ISYA 2ENAA 4DOZA 3WG9A 5HNHA 3I64A 4WK8F 3C2GA 1I94E 1VQ6I 1ZGAA 1RR7A 1XTAA 1BC8C 1G2DC 2QSGX 3AG2H 2JPCA 4S04A 2CUJA 5DCFA 3EYIA 2VQFE 2WBMA 1XMQE 4EV0A 4I76A 3ADIA 1BOAA 2ICWG 3VPRA 2BW3A 2XAUA 1ETYA 3FKJA 4F92B 5KK1A 3BR0A 5IV8B 1GLNA 2EB7A 3J80Z 1IN7A 2RN7A 3K4NA 4M72A 2PJRB 3QG5C 3IC7A 3J7AG 2LNBA 2YSRA 3C2HA 4DV4E 3TO9A 4F9CB 4HDUA 5LFAA 5FFXA 4I99C 3JCUC 4EJOA 1BW5A 2EQ3A 5FRMA 2VBYA 2GXGA 3I4PA 1YJ9I 4FQGA 2YSPA 4BUPA 1IN8A 2XPWA 5E3MA 5EGOB 4M71A 3AFHA 4NC6A 4G94A 1VQ8I 4UV9A 2PQ8A 3FXOA 2ZJRF 2Y9YA 4QPQA 5T6JA 2LSOA 4UB8C 2F48A 4XLCA 3LNQA 2VJ4A 1OPCA 4M2ZA 1IQOA 3C2BA 1S9HA 1YW7A 3J7YJ 3JR9A 4WX9A 3WTZA 1UG2A 2ZJQF 2V1NA 2DFIA 2H94A 1WJDA 3AAFA 3QOPA 4XLEA 4H4KC 3F23A 1IV8A 4XNFA 1AH5A 2OZUA 2P4WA 2ZC2A 4CDGA 1KU7A 2FEZA 4WYQB 4YY3E 1U5TB 3DEEA 2LY1A 3IWBA 2LKXA 4TUGA 3RSNA 2HVSA 1M1EB 2M5WA 1JXSA 4O5GA 1XC5A 3G73A 1TTYA 4IL6C 2YZTA 3OYMA 2O0YA 1PUFB 1WCMJ 4BHCA 4LFBE 1ETOA 2LMDA 2M7BA 4FTHA 4HOBA 4B3XA 4P9FA 4XRSG 3FXMA 1JKRC 2I9IA 2H36X 2LLKA 3A4CA 3HPGA 3O2PE 3CJNA 2JSCA 2JJ7A 2EV5A 3BPXA 2V4JC 2HDWA 3CDIA 5EEGA 3PL8A 2P0WA 4BXFA 1IG7A 1WI9A 3HOUJ 2GIZA 2R7TA 2YRMA 5DCMB 4GZNC 2QYOA 4IRHA 1OMIA 2CUZA 2HFHA 3FBNB 2HOSA 2GAUA 4HSRA 5E3LA 1R1UA 2XV4S 3ABTA 1OKRA 4N4RB 1YPNA 1Z9CA 5A6BA 3LWFA 1V5EA 3VYYA 3BG5A 2RS7A 5A2QZ 2HQ5A 5DTDA 2E2IJ 2MG4A 2JA6J 4JI4E 1XDUA 1ONVA 3UK3C 2L2MA 2WC2A 3P7NA 4U7BA 1BR2A 2CPNA 2VE9A 2NS0A 2M9AA 4GXOA 4IRGA 4RLQA 3JRIA 2MDGA 2IBDA 3IKVA 3BTIA 2FTXB 5E1XA 4KT5C 4C3JJ 4BNCA 3SEZA 4OIRF 3A1YA 3F8FA 2UZKA 2OD5A 3AL0B 4LU9A 3F8MA 1PJRA 5CJ9A 2DIXA 1GVJA 4A3GJ 1G3YA 1FYMA 5IT9Z 1E2XA 5AIQA 1J5YA 2V88A 4HDVA 1E17A 1BW6A 5FRNA 1W7PB 1F36A 1TW3A 2ISZA 3CUQC 3E6MA 3ABUA 5J8FA 1MMDA 3T0YA 2RPCA 4NHJA 2XKOA 4XONA 1CF7A 1X3WB 5AIPA 1N33E 3ERMA 4JK1X 1XGNA 4G8XA 5IP6A 4U87A 3KYLA 4HPQA 3CCLI 3FK6A 2HEOA 2VE8A 3OIPA 2W85A 4YELA 2L7MP 4P9UA 1CQTA 2DTRA 2EOJA 2GQQA 3N97A 5DM6F 3LSJA 1G2HA 5J1UA 2QKLB 1X6HA 4Y33A 2CW8A 5FLXZ 3EPJA 2EIMH 2LK2A 4PFPA 4JI0E 2CS3A 1Y1VJ 3GW2A 5H6RA 1WXRA 3I56I 1JI8A 3JRDA 1NG7A 2V86A 4JX4A 2JVGA 3DBRB 4PCQA 1ZAAC 3A0BC 2VASA 4XLFA 3WU2C 2D1VA 4PDKA 3HKZN 4EJVA 4EGZA 1FZPB 1LDJA 4WSGA 1BB8A 3GWZA 5TJJA 2WA0A 4UNOA 2MYSA 4OINF 2QQ9A 1ZHFA 5M5XJ 2PRTA 2VPRA 5E18F 4DR4E 3BC8A 3M9AA 2EA2A 2ELJA 4E7ZA 2CV1A 1X6FA 1MSFC 1ZELA 2EPFA 5F08A 2FMLA 5D6EA 3PSFA 4PSWA 1SAXA 4I02A 5EEHA 3J80K 2R5YB 2R7OA 3E3VA 3E6DA 2MABA 2VRDA 1D5VA 4HX8A 1G3SA 4I0AA 2O7OA 4XOTA 1T33A 2GA2A 4KISA 4N0BA 3T1HE 3CUQA 1DPRA 3OSFA 2Y48A 3J7Yp 1IJWC 5BNGA 1HBXG 3QYEA 4A3MJ 1Z1BA 1RC7A 2IA1A 1MBHA 3S8PA 4C3HJ 4LGWA 2IGOA 5EYRA 3NWTA 4BJTA 1JT0A 1IDYA 2E1NA 4LB6B 1HSJA 1LVKA 2VKHA 2DT6A 2XGDA 1Q1VA 4L9NA 2MC4A 4KYWA 3BROA 1A1HA 1JE8A 1S7AA 3FIGA 1MH4A 4X64E 2X6YA 2M7AA 3ZR8X 2ZFUA 5C4JJ 4PJNA 2E1OA 1SD7A 3LSKA 3CMYA 2DW4A 1GZ6A 1HW2A 2IS2A 2RC4A 3HL2A 1MBFA 2I13A 1XGSA 4ZYDA 2EOOA 1ZGWA 3S14J 2YTEA 3HSEA 2YTOA 1HNWE 3I9V2 1A6IA 2L7KA 5LHIA 3E0JB 4RAYA 1O7LA 2CFOA 2EM5A 1MMAA 5J47A 2YPNA 2F4VE 4BEHB 1IUFA 2FF4A 3QU6A 3HOWJ 4X66E 5A6KA 1BR4A 5DEQA 3HEFA 2XGXA 4ZDPA 2MD0A 5D5WB 1W0TA 3THOB 1KGSA 3HB9A 3KP3A 5TISC 4BBRJ 1FKAE 2R0QC 1VTNC 4EJTA 4CYCB 2DMPA 4X9JA 1D1AA 2BV6A 4MLOA 1KU2A 3JSPA 2FBIA 4RGXA 4IX7A 4V19K 2YX4A 5L3CA 1OCZH 2KIFA 2HGCA 2B3TB 1UELB 2L02A 2NVUB 2YPRA 2LTPA 2K02A 3HUGA 3GLXA 2R7DA 3F8BA 4YG2F 4NNJA 4D5FA 4F93B 2NUGA 2JWOA 1HDPA 4DV2E 5A2QK 1K79A 2P81A 4V2FA 2V79A 1ZR2A 2EL5A 5K7HA 2EZIA 3BQZA 3GFLA 4IOCF 2E5NA 1J9IA 4AIHA 3QPLA 2IA0A 2FMYA 2YRHA 2L2KB 1RR8C 3UR3C 3CUOA 4O43A 2ZXIA 5FKKA 2L2OA 1WJFA 3K1NA 1GDTA 3ZMVA 5K7ZA 4HF1A 1F9NA 3M07A 4BH9A 2UXCE 4JYKA 1CGPA 1HDDC 2XAGA 1PP7U 2EPAA 3HTXA 4MHGA 2CU7A 2RV8A 3BTJA 5L3BA 2DOEA 5D4SA 4G6QA 3G3ZA 3BG3A 1B6AA 1BC7C 2OV7A 3OY9A 2HDCA 5IT9K 1UHSA 3FMSA 3CC4I 2YTNA 5BPIA 5HDGA 5K5RA 1AHDP 2EN4A 2FD5A 3J81Z 3ECRA 4B3AA 1TWHJ 1GHCA 4F9BB 4DR7E 3PQJA 1BOBA 4A5NA 1IUYA 4MTDA 1ON2A 1MZBA 2PEXA 4DYCA 4BQNA 2EPKX 4GO1A 1TF6A 1S72I 3QYBA 1QO0D 2XKPA 2LO3A 2RQPA 4HNTA 2M9HA 5GAEJ 2BEOA 4BXUA 3PIOF 2H6CA 3EUAA 3I59B 3JREA 2ODRC 1AKHA 4NQWB 4PJJA 3SZGA 1VZ0A 3LA3A 2DI3A 4C3IJ 5HLTA 1QPMA 1YJNI 1TF3A 4AUXA 2JTVA 3EETA 5E79C 4OMZA 4EM0B 3S2HJ 3A0HC 2IRFG 4K2EA 2DMIA 2YU9J 5FLXK 3IH2A 1XMKA 2EM3A 4G7ZF 4AIDA 3K6QA 4AIKA 2ENCA 4JI7E 2JA8J 2WBSA 4B44A 3F21A 1YIOA 2TDXA 4RB3C 1VQKI 2R7SA 2Y0SN 3KP4A 4MEXF 4KN7X 2RTXA 2PN6A 4FETA 2K40A 1H9TA 3PUBA 4W97A 3WHBA 2M1BA 3T1BA 4CCJA 2EPNA 4XN0A 2LKSA 1WRJA 3K7AJ 3EQ1A 4DZPA 1NTCA 3HM5A 3DXJF 4LF8E 4IOAF 4BDZA 4IRIA 2QENA 3GCMA 4XMYA 2M30A 2IT0A 3CLQA 2ID6A 5FD6A 3OOUA 2FA5A 3MKLA 2JY9A 5E1WA 3EPKA 5B1BH 3MEXA 5IPAA 4M0VA 4F52A 2XAJA 3D5LA 1IXRC 4E7HA 3HOTA 2X6WA 3FXKA 4U0WA 4XR6A 3TP3A 1X1CA 2EM0A 1XD7A 3E5XA 5EEAA 2XAHA 2F5FA 4QIWN 1TLHB 1TWGJ 5K1YA 2VC0A 2EMCA 4OOIA 2MLGA 3VEPA 4YRVA 2L2NA 4OOGC 2CUEA 5HLIA 2WCC3 2EJ4A 1SD6A 1TWAJ 4HTGA 5CVIA 3DBHB 1V55H 3F8CA 3QPSA 4MGRA 1D0ZA 1YZ9A 4JI5E 2MW8A 1U3EM 3IAS2 4LK1F 2IGNA 2VC1A 4MLQA 2MFZA 4HAMA 1PUEE 1APLC 1D8KA 3CDHA 1YITI 3U9GA 2HQAA 3WTSC 1YX3A 2XAQA 1K83J 5EG0B 2E72A 4OIQF 3RKQA 3V7CA 4NXME 5KNLA 3C4TA 1TQIA 1IRFA 2EOSA 1SVOA 2F5VA 2ZO4A 4L18B 4LMYA 3FKIJ 3N05A 4F91B 2MC5A 3RI4A 4GKKE 4I8OA 4D1QA 2EOYA 3M4OJ 4HNUA 3ZXSA 1DQUA 5KL4A 4RAFA 3T1YE 1NK2P 2L54A 2M1SA 2QSHX 2AQEA 2UXXA 3VYSB 4CCMA 1R6RA 3GUDA 3LSGA 1U0JA 3H0DA 2R5ZA 2IS4A 1WJ5A 2EPXA 4NHRA 2DYRH 2LYCA 2M0MA 1FNNA 1SFXA 1VQLI 2ZJPF 2EMGA 3RTRA 2MD5A 1T4LB 4DJAA 2VBZA 1VQMI 5ADZA 2GLOA 2IXSA 2A6HF 1ITYA 2Q0OA 3K4BA 4PJLA 4E7JA 2VXZA 1J09A 1O0WA 1DI2A 2EINH 5FFZA 4DIQA 1OCCH 2L3CA 2ZXWH 5KAFC 2FJ1A 3AUZA 2EIKH 4R8OA 3VYUB 2VKEA 2V85A 3J80C 2DPUA 1OFCX 4MQVA 4HA8A 2WAQA 4XKWA 4ENNA 1KYQA 1IMUA 3DF8A 3SEQA 4F3QA 5IY5H 2ZJ2A 2JT1A 1G3WA 4CCKA 4EMSA 4LK0F 5JLXA 4AYBN 2X1DA 2F4MB 6PAXA 3K70D 4LF9E 1PP8F 3CCSI 2X1CA 2DOFA 2E35A 5JI6A 5E8IA 2FOKA 3FMQA 1RUNA 2EORA 4Q28A 1VQOI 4XKVA 3MFKA 1T95A 3A03A 2EOQA 3U1KA 3O8HA 4CCOA 3IH3A 2L4MA 1K4SA 2R7UA 4HQEA 2X51A 3HPSA 2GHFA 2K4BA 2FBHA 1UZCA 3KLNA 1XNQE 3WHCA 1R1VA 1NCSA 2K86A 4LD5A 4RAZA 2EP3A 4XOPA 3DLLF 2JMWA 1BJAA 2PMUA 1X1PA 3FHZA 4MO7A 5FGMA 4WFTA 3JTGA 1YQAA 4IO9F 3DPUA 2YTPA 3RKWA 1TN9A 3Q0UA 4DBRA 2E1CA 2CUFA 1WJCA 4F6MA 4ZH4F 3LFKA 1RC9A 2O03A 3ZQLA 2K3PA 4HG2A 2C6YA 2WWYA 2ECBA 4BYYA 4BHBA 1T08B 2FRHA 1DU0A 2VF1A 1JT6A 3I4MJ 3BDDA 2EMXA 4E4HA 5TRDA 2CJJA 4A3DJ 1R5ID 1TWFJ 2KZGA 1U5TC 2STWA 4IPAA 3VFZA 3H3UA 1IAWA 2GZWA 2G9WA 3QPHA 3BPVA 4GEQB 4M3DA 3VODA 1GV5A 5TGTA 4ESFA 1OCTC 4X62E 3Q9VA 1QVUA 5F1JA 3J81K 4IHVA 4II3A 4AC0A 2M2EA 3K2ZA 2EZKA 4ZTFA 2J5PA 2EN1A 2L7FP 4ZC3A 3R0AA 4A3IJ 3I3LA 2K3FA 3M1EA 2GWRA 2OQGA 1QNTA 2XAFA 3DKYA 2CQQA 2IVMA 2CO5A 3RKXA 2LD5A 2Z16A 1ZLKA 1WSUA 1J59A 2KJBA 4G12A 5CQEA 2Z99A 4UUSB 2PJRA 5DD8A 3CF5F 1HW1A 1WVRA 4DZJA 3JAMC 2FE3A 2A5WA 1FTTA 2JPAA 4C2MJ 1G3TA 2NS8A 4LF6E 5A2QC 2VJIA 3Q3SA 3WGGA 4A3FJ 2DFFA 3ASOH 2BOLA 5IP7J 4UB6C 2AXLA 2R7ZJ 1I6HJ 1P7JA 2MGQA 2HYGD 3MKYB 3RPUA 2XC7A 3KP6A 4WXDA 1FSHA 2KIMA 1U8BA 5BR8E 1L4SA 1IW7F 2V26A 5EGOA 3JRHA 3KP5A 3GZ6A 3VK6A 1K6OA 3ZP5A 4KFCA 1T2KA 1Y1WJ 4OX9E 3L2VA 3H5AA 2L9VA 3ASNH 1R7JA 2ECCA 2JA2A 1DUXC 3L2RA 1SC7A 4B47A 1IN4A 1E3HA 5GP9A 3AL0C 2KKOA 4FK5C 1B9NA 1ULYA 1MJBA 3OR2C 1K7AA 5IT9C 1E3PA 1I3AA 1ZYRF 4ESJA 2Q2EB 1T98A 2EIJH 5BQTA 4RB2C 2H1KA 1U5TA 2X4HA 4Q4ZF 3ISPA 4OIOF 3EUKL 1R5HA 1F5TA 1ZRDA 3CZ6A 2OAZA 1YS7A 2E36A 5KHDA 2V8QB 4XLAA 2EOZA 3LLHA 4RGRA 2B7EA 3JRCA 4P1WA 3L2UA 1DDNA 2R7WA 4EATA 1MIJA 2DMTA 3UNGC 1A5JA 2LOOA 1Q1HA 4ZDLA 4DR2E 2R76A 1OCPA 4EEFG 3M7GA 1WHUA 3FXLA 3OOPA 3DJWA 4XK4A 4A2UA 5FLXC 1TQMA 2ZSIB 3HZJA 1GT0C 4GKJE 2LDUA 1WGXA 2DLLA 2TCTA 2O8KA 2LCEA 4ZYAA 3SFZA 4B4CA 4BHPA 1WQ2A 2EILH 1AOYA 2XB5A 4B48A 1FJGE 1TT0A 2K7LA 2XUBA 2WAEA 1RPWA 5J8CA 2IS1A 2KDOA 5JVTA 3P9CA 1R36A 2DK5A 5KL5A 2EMYA 2F4OB 3JTHA 2L92A 3GYHX 4A3EJ 2LBSB 3OYHA 2VN2A 4KMFA 3EQLF 2X48A 4LF5E 2EWNA 2LTRA 1BL0A 4XBFA 4GYGA 1VNDA 2PMZN 1IRXA 3JRFA 4XLHA 4WF2A 1EH6A 1WHNA 1LDKB 4IQJA 1OR7C 1LLMC 2DB2A 4LIVA 4HLXA 1EA3A 2ZNZA 5A6BD 4DV3E 1MDMB 1YYVA 2UXNA 3C6KA 4LG3A 3G1OA 2XROA 1S5LC 2BY0A 2E5LE 1Y6IA 2R4GA 2WTEA 2EJRA 1W7PA 3FBIB 1X2NA 4P96A 5LGNA 3RZDJ 1SFOJ 1MNMC 1A04A 2E34A 4DV6E 4HBLA 1TW2A 3IWFA 1O3RA 1B69A 2BY1A 1BA5A 2XF5A 2WY7Q 1TBXA 3U1DA 4NB5A 5E17F 4RH8A 4F54A 5KVRA 2BB8A 1Z6TA 3ECOA 3ZN0A 3NAUA 3HBLA 3ZQIA 2VONA 1QPIA 1T4NA 1FOYA 5LRRA 2VQGA 2MDRA 3DTEA 4A3CJ 1TWCJ 3TP0A 2OC6A 2ZFWA 3CJTB 3K6GA 5BMZA 5AONA 2RVCA 2NUFA 4BY1J 4CICA 2UXBE 2FXAA 2M87A 5CFFE 2VT3A 5J3LA 4E7SA 2KISA 3UKGA 3NRVA 3FM5A 3F6OA 2NRAC 2JOXA 3DTIA 1I3QJ 1MJAA 2HR3A 3R6SA 3IH4A 3ULQB 4AM3A 3B6CA 3LL7A 2PBIA 4R2QA 1L0OC 3P9KA 5D8LB 1WJAA 3HOVJ 4R1HA 4N9HA 2DPDA 1X4PA 2GLIA 3G1MA 2X0LA 4KMUX 3KPHA 3OYJA 5GADJ 2HWVA 1OYYA 2QQBA 4CA0A 3ADJA 4Z6YA 3MAJA 2QUFA 3CCJI 4LG0A 1A1LA 1MGTA 3R60A 1IGNA 4ITVA 3BR6A 3BR2A 2EOFA 4X65E 1ETQA 3GTPJ 3C18A 2HKOA 1VQ4I 2EMAA 5B66C 2V6CA 3DU6A 1OR7A 2R5YA 2RQLA 4L8NA 2RDPA 1EKEA 2RNJA 2YU8A 1PYVA 3O3KA 1UB9A 1IRZA 2N8XA 2LREA 3M1CA 2BW3B 4XRFA 5CLSA 5J40A 2DMYA 3CCYA 2ELZA 1N78A 4PK4A 1X3UA 3TQMA 1STUA 2D9HA 2DODA 1I39A 3SYTA 3L2QA 1LJ9A 4ZZDA 3M8JA 4M9XA 2FX0A 4M9VC 4BBYA 1P4XA 3BZKA 2G7HA 1JKOC 5GTIC 1XMXA 3SDBA 1W5SA 2KT0A 3P5JA 1QA6A 1UFMA 2VODA 4XLPF 5A6JA 5JLWA 3H92A 2LMZA 3IWDA 2RQQA 5E3OA 3MD2A 2OU2A 3OWTA 4F55A 4BE2A 1MNDA 1WFXA 2BE5F 4FT8A 2L0KA 1R22A 5F64A 2A07F 3A2KA 1KQ0A 3DLAA 4FCYA 1F4KA 3CDLA 3LFUA 2XSDC 3AG1H 1YIJI 1BI2A 2WB1A 3KEYA 3VSKA 3ZMDA 3KYCB 1UAAA 3SZTA 1MNEA 1W36C 1MMSA 1F2IG 2K9NA 3H35A 4LF7E 4A5MA 5DM7F 2WY8Q 4BEHA 5B3SH 3DPLC 1SMYF 3B73A 4CH7A 1A6QA 5LHGA 1J75A 2RSIA 4IS1C 2O8XA 2NXNB 5TSEA 3Q0VA 3MZHA 2BBGA 2M34A 1VFCA 1UILA 2R7FA 3D5RC 3PM1A 4I09A 1O57A 4XRSA 4MEYF 2AS5F 1UHMA 5DUKA 4B3SE 5HS8A 4DNCA 2K9QA 2PMHA 2HNHA 2DCEA 2Y0MA 4RAGA 3FXQA 5CPRB 1WWXA 4ENJA 2E1MB 3VHTB 2D5VA 2DU9A 2EN8A 2E7WA 3PNVA 1IF1A 1AU7A 2JN6A 2DJIA 3QWLA 2EFWA 1A1IA 2EFNA 2B9SA 1N34E 1IRGA 2ELHA 2B7TA 2OCCH 3ZPLA 4FISA 3BJAA 3OYKA 3BG9A 1U8RA 1AWCA 1HNXE 3OS2A 4Z2YA 3S93A 1FYKA 3OL3A 2V87A 2DJNA 1A31A 2EQ1A 2I5UA 4NC7A 1MBEA 3E5QA 4Q47A 3RQIA 2E60A 3JU0A 4FE4A 4TV7A 4X1EA 2BBYA 2EN7A 3GTQJ 5L3GA 2CH0A 1YUIA 2LP0A 3OYGA 1H89C 2K27A 2ZSHB 1BBGA 2UUZA 1N25A 4Y17A 4IHSA 2ZNYA 3JSOA 3K10A 3KWRA 4F9AB 1YG2A 2GXBA 2VQCA 2EOMA 3L2CA 3TW7A 3OIQA 1OISA 3VB2A 1REPC 2EFOA 1XGMA 1JKQC 3OYDA 4R03A 3DP7A 4B43A 2QSFX 3VSLA 1QU3A 2LUPB 2NOGA 3BJOA 2O3FA 2R1FA 3W2VA 2HDDA 3K4CA 2MLKA 4P7DA 4KIBA 3W2AA 2WZOA 4I98B 2BGCA 2JVAA 5GAGJ 4W1UA 5HODA 3G2BA 4CYDA 1BR1A 2R7QA 1SFEA 2DN0A 2EN6A 3IWCA 2VQHA 4KWYA 3CCEI 2N3HA 1ODDA 3K4KA 1TT5B 5FKMA 2QA4I 2EMKA 3PIPF 2Q8UA 2JRMA 2H09A 2YSOA 2JQ7A 2EOHA 3REOA 2YWQA 5H6QA 2LF8A 3BBGA 4L9VA 1JHHA 2HOTA 5BS6A 5H20A 1D8JA 2FQ3A 3I59A 4IJAA 3U2RA 1H8AC 3DCFA 2I10A 4NQWA 3SJMA 5IYDJ 4MLVA 4CCLA 5D6FA 4HF0A 3LSPA 2VQEE 1OCRH 2GA1A 5ICEA 3GBGA 4LFUA 2UUCE 3OYNA 3D1NI 3L7WA 1X1AA 3SFIA 1YYKA 3CLOA 3HOXJ 1RRJA 3E5UA 4G7OF 2I8DA 2KRFA 1EH7A 2MH9A 2COBA 1E0EA 1MBGA 4II2A 2BY2A 4A6EA 3I5UA 4V2GA 1B8IA 1A36A 2XHKA 2JA5J 3VWBA 2ADRA 3BR3A 5DD4A 4DGWB 1FBQA 1RZ4A 2CMPA 5DS9A 3QYFA 1OLTA 3J7AO 1FT9A 3HPZA 3ZMUA 3ZQFA 2JXPA 2EQRA 3F8NA 3HSFA 4ZYGA 3GTKJ 3CCMI 2YRKA 3IRRA 5HLGA 1ZRCA 2NABA 4I2OA 4KICA 1DP3A 2KFDA 4I6ZA 1W0UA 2IHR1 2B9DA 1NEIA 4BC9A 3K4LA 2EMLA 4IQ4A 3I55I 4IEJA 1UMQA 3C3WA 2V1UA 2EM2A 4F7ZA 4KDPA 4OIPF 3WGHA 1G6NA 1KZHA 3I54A 4B8XA 2O6GE 4RLFA 2V9KA 2A61A 3IUOA 3JRBA 2DK8A 5BPDA 4JYAE 2DSYA 1USSA 1X1DA 1H0MA 4CZCA 1Z1DA 1OCOH 4AVZA 3V8JA 2B63J 2DT5A 2K7IA 4L9JA 3WTVC 2P5VA 2PJPA 5ED4A 2LKPA 3EDPA 3S1NJ 2HHHE 5E3NA 4BQQA 4CSWA 5EG0A 4IHTA 1X3ZB 1R71A 3QP6A 1XSXA 3WTYC 2LFBA 2EM8A 1TC3C 2KZVA 3ZMSA 3HSRA 2NYXA 5HLHA 2JZYA 2OUMA 2F2EA 4PGHA 1LUJB 4D7MA 3LA7A 3VDXA 2VBXA 2L5QA 4CGZA 3TL4X 1SR9A 2ZMEB 1WJBA 2DT7B 2EFQA 4BE0A 3PJRA 1EV7A 3BQYA 2Z2SB 2Q8KA 3HTSB 1B72A 5H2FC 4RBOA 3NEUA 4HV5A 1V4RA 3DEUA 3PO2J 1UHWA 3MWMA 3BT9A 4DV1E 2L9NA 2X6XA 3GFJA 3PNYA 2K4JA 3G71I 5IOZA 2A6TA 2ZXHA 2CW0F 5F27A 1SAUA 1SD5A 3W6JB 4Y13A 2L4AA 2ODRD 5KL7A 4YIRX 2M4IA 2TRTA 1KU3A 5C3EJ 3P9IA 2ZBKA 1S8NA 2JR1A 4A6DA 3IV5A 1ZH5A 3GX4X 3S1RJ 4HEIA 4Y4RA 1QU6A 4RMNA 5EZHA 5J1YA 4L5IA 4AU7A 1LE8B 4M3FA 1FMVA 1YRNA 1FBUA 2CW7A 2W25A 2QZ8A 1V5GA 3FZVA 1J5EE 5E20A 5D8KB 4ZZLA 5L3FA 4E6KG 3KETA 1BIAA 2Y31A 2DFHA 3C6MA 4HYEA 4D0PA 5KCMA 1V3FA 5JVGF 4L0ZB 3IAM2 2L9RA 4Y15A 1XDSA 3L9FA 4BJ5C 2Z1DA 2WAQN 3T8RA 2DDBA 5DUIA 2PI0A 1BBYA 1MBKA 3ZOQB 1Z3XA 2OA4A 2ME6A 2UXDE 3BGHA 4FX0A 4JI8E 2QKMB 4U88A 2V1DA 4Y7NJ 2X1EA 1QGPA 1FJLA 1Z05A 2KIQA 2ACJA 2VOPA 3W6VA 2YT4A 5HVQC 1O3SA 1SFUA 2AQFA 5LMUE 4NBQA 2KLOA 1JTXA 1LFUP 1X5WA 2E19A 2M7QA 1T0FC 3RQ4A 3VOEA 1WPKA 2RKHA 3KCCA 1O3TA 5B1AH 1P2FA 2IS6A 3ZQHA 1VQ9I 1HCRA 2KMUA 1ZU1A 4XQFA 2LRSA 3HGYA 5ILSA 4KN4X 1JGSA 1YUJA 2XPVA 1FOXA 2G7UA 2L01A 4C2UA 4U0VA 4C9YA 5JHFA 1ZR4A 1ETKA 2RSMA 2BZTA 2O9LA 2OTLI 2CG4A 4OMYA 2DXIA 2GOMA 3QQAA 5K7FA 4UUSA 5DV5A 2DA1A 1I5ZA 4OAYA 1FOWA 4DYRA 2EZ6A 2RREA 1ACIA 3PNTA 1P4AA 1YS6A 3FWEA 5D5UB 2VT2A 3ZGKA 2EV6A 1DU6A 1ZN2A 3CMMA 3R4KA 1P4WA 2KPMA 2ME0A 2LT7A 4Q35B 1IZ1A 2LV2A 2HYJA 3WG7H 3I0TA 1JK1A 2L3DA 2HYFA 1RNLA 5FKLA 5LGUA 4O4KA 3TO6A 3BG6A 5F1RA 4E7LA 1J2XA 2P5KA 4E7IA 1BBOA 3QPTA 2NA2A 1L3LA 2CGPA 3OSGA 2OBPA 2PG4A 4O5VA 1MW7A 1HF0A 2H6BA 4ENMA 2Y9ZA 2F5EA 1GXQA 4HX4A 2DMUA 1VQ5I 3S2DJ 1H9GA 5K5OA 5J4YA 4AQYE 2XIGA 2YR2A 2QQAA 3QP5A 3BP8A 2R3SA
chains in the Genus database with same CATH topology
2A69F 4ENKA 1FWZA 1S3JA 1BIBA 2FSWA 2Q2EA 1T39A 3BZ6A 1T0FA 4L5JA 3D0SA 2MBFA 5J6XA 4CXFA 2UWMA 4A0YA 1XSVA 3SXYA 1PDNC 5LLQA 4EQQA 5JFRA 1FYLA 5ERIA 3EYYA 3HOSA 3HHHA 2Z5UA 1I1GA 1U2WA 3HIFA 4G7HF 3V4GA 3DV8A 4LJZF 1HXDA 2ZCWA 3S2WA 2PFBA 2M45A 3K1MA 4WWCA 1U78A 4S05A 4I7HA 5FO5A 1NHAA 2KJCA 3ECHA 1QQIA 3FM3A 1IXSB 3EUHA 3KLOA 4XSZF 1W5TA 1C0WA 4HV6A 2OQRA 1YFHA 3GXOA 2HQNA 4QWQA 4YIIA 4GYIA 3TQNA 1OYIA 4HF2A 1HQCA 4L0YB 2RGVA 2QBYB 2M8EA 4UV8A 1BI0A 2HOEA 3I71A 2ESNA 2J5OA 2FNAA 3HHGA 4M73A 4RGUA 5HDNA 3FF5A 4GCVA 1R00A 4P5OA 4EJWA 4E70A 1TNTA 1W7PD 4KUMA 5DCMA 4H0EA 4KA4A 1F1ZA 3B02A 5IT3A 2ZKZA 1SMTA 4A0ZA 5K5QA 1HKQA 4LLNA 1LNWA 3DPTA 3C7JA 3L09A 4WCGA 3RJPA 2Z33A 2P6SA 3WU1B 2QM3A 1FP2A 3K1PA 1YLFA 1JHFA 2EA4A 1ZG3A 3KZZA 1ZGJA 3N4MA 2HZTA 1KYWA 4MNUA 1XCVA 1K78B 2A68F 4KIFA 1IN5A 5HDKA 4QLCU 3BJ6A 2P5LC 4R79A 3QAHA 2MC3A 2V9VA 3V7RA 1XN7A 2XRNA 3IL2A 3KP2A 3GZ5A 4EJUA 5E8GA 3RIRA 3LAPA 3FXUA 1DPUA 4AIJA 4IXAA 3NQOA 1FC3A 2B0LA 1KA8A 3WE3A 3Q9SA 2EFPA 4CZZA 2COMA 4AD9A 3IRQA 4L9TA 2XASA 4A12A 5DDGA 1ZAOA 3JW4A 4UHTA 3W6KB 3LAJA 2EK5A 1IN6A 2VOOA 1XCBA 4HW0A 3WGIA 3RPQA 5CVUA 3COAC 1I6XA 4AVPA 1W4MA 3LSTA 4PGGA 4EVIA 1G4DA 1FX7A 3HYIA 1S7OA 2IP2A 3KZYA 2QVOA 2F5DA 3JAMZ 1R23A 1TNSA 3K0LA 2IJLA 4FX4A 1OYWA 3C1DA 1BN5A 4YIFA 1QBJA 2IW5A 3QU3A 3FXRA 3K69A 2YU3A 1IXCA 2GIVA 5HS7A 2CFXA 4HQMA 2ESHA 1ON1A 5LEKA 3WTXC 4ZYHA 1T38A 4UVCA 3QRFF 1ZLJA 3LQRA 4RS8A 3R0JA 5D4RA 3WTWC 4XSXF 1EH8A 3IWZA 5CVVA 1B1BA 1XGOA 5HS9A 3F6VA 5CYVA 1P6RA 1HKSA 4OU0A 3E6CC 3ERED 1XSDA 3M8EA 2HTJA 2ZXJA 5ILVA 5E1ZB 5D5VB 2WV0A 1FLIA 4JQFA 4I01A 4EGYA 2V1XA 2D1HA 4RGSA 1ZG5A 4AWXB 2NAZA 5L3DA 3RDIA 4HZFA 2IA2A 3PFIA 5FB2A 4LG0B 2ADUA 4ZYEA 1QZYA 3T5XA 4P55A 4KIGA 3DFGA 4O6JA 1FPQA 4KNYA 2P8TA 3O6BB 4EM2A 4XLNF 2NNNA 3ZN1A 3I53A 1MJ9A 3SZPA 2ZMEA 3LQQA 3TKYA 3HTUA 3V8LA 1CF7B 3KEOA 2MH2A 4M9SA 2D2WA 4RB0A 2W57A 2MA3A 4WXCA 3KEQA 2A3SA 2KIUA 1LVAA 1O3QA 3V8KA 2FNPA 3HRMA 1I27A 3F3XA 3WE2A 4M6XA 3GFMA 2LF7A 3FMRA 1YW9A 5DYMA 1U6GA 1ZG1A 4BAYA 1LEBA 2DO7A 2XVCA 1I1SA 1S29A 1P92A 1Y0UA 5LBQA 3HRSA 5L3EA 3TDUC 1HW5A 3JAMK 1R58A 1R5GA 3CO6C 1SD4A 3FX3A 4ON0A 3CUQB 4DQ2A 4U0YA 3DKWA 1RI7A 4N9IA 2HS5A 4G9YA 1HSTA 2H27A 5LGTA 1LQ1A 2HQRA 3K9TA 4WXHA 2DQLA 3F72A 4U7DA 4RB1A 1FP1D 4PZJA 1MD0A 2NNYA 2FU4A 4FHTA 1KU9A 4MQ9F 1KYZA 2Y75A 4ESBA 2JRTA 1J7KA 3GF2A 2HTSA 1USTA 4UXNA 2P6TA 3MCZA 3TGNA 3L00A 3MQ0A 1MKMA 5JHUA 1TQPA 3GVAA 4B09A 3Q5FA 1KQ9A 1FY7A 3CTAA 2OZ6A 3RYRA 1BI1A 4G6DA 2A5YB 2BYVE 3WTUC 2DAOA 3WODF 1QZZA 2E7XA 1YO5C 1LEAA 3R61A 2QWWA 5LEJA 4A0XA 2Z9OA 2DQRA 1Z6RA 4R8HA 1J0RA 3DQVC 4UUVA 5HOOA 3IKTA 4BQAA 3BWGA 5CVJA 3ZMTA 5JR3A 2F5CA 3TOBA 1ZARA 1ZRFA 2Z3YA 4EM1A 3IHUA 1WKMA 1FBSA 1LDDA 2CWEA 3V7SA 3OV8A 5CVRA 2IPQX 4Q5SF 1B4AA 1O7FA 3HRUA 4ASNA 4LLGF 1YW8A 2YX7A 3GFIA 5BOXA 3BOQA 2VBWA 3ZQ7A 3ML6A 3GEZA 1ZREA 3F22A 4UVBA 4JBAA 2P7CB 2QBYA 3PQKA 3E6BA 1DP7P 2STTA 2ETHA 3KP7A 2EV0A 2JPBA 3TO7A 5ICFA 2P7VB 1HKTA 3WTTC 5ICGA 1B9MA 2QLZA 5F6FA 3E97A 4YFXF 4IF4A 5FD5A 2CSOA 3RKYA 3I58A 1GXPA 1RUOA 1STZA 4O3MA 4M74A 1T6SA 1LB2A 2CQKA 3H3ZA 1Z7UA 4I0BA 3GO5A 4HX7A 3LA2A 1BM9A 3SHFA 2HKXA 4M6YA 4Q48A 3CO7C 4HLYA 1RIOH 2A6EF 4CHUA 1YTYA 3RYPA 1XMAA 3HRTA 3ROUA 1XB4A 2DBBA 4CO8A 1BI3A 3TOAA 5LRSA 5ILUA 1K78A 4ETSA 1FSEA 1MDMA 4MTEA 4UVAA 5ICCA 3MZYA 3TDZC 3M8FA 2O61A 1B59A 4YFNF 3BY6A 2W84A 2D45A 3SQNA 4LLLA 4M9ZA 2FBKA 1UCRA 3T8TA 5LHHA 3WU0A 3KE2A 1Z91A 1S6LA 3KFWX 4YFKF 1D3YA 3ELKA 5D5XB 2CYYA 1R1TA 4GGGA 4IVNA 1FOKA 1KQ8A 2W24A 4LB5A 3ZMZA 2PLYA 2ISYA 3WG9A 3I64A 4WK8F 1ZGAA 1BC8C 2JPCA 4S04A 5DCFA 3EYIA 4EV0A 1BOAA 5KK1A 2EB7A 3J80Z 1IN7A 2RN7A 4M72A 3IC7A 2LNBA 2YSRA 3TO9A 4HDUA 5FFXA 4EJOA 2VBYA 2GXGA 3I4PA 1IN8A 4M71A 4G94A 4UV9A 2PQ8A 2LSOA 1OPCA 1YW7A 4WX9A 3WTZA 3AAFA 2DFIA 2H94A 3QOPA 3F23A 2OZUA 2P4WA 4CDGA 1KU7A 2FEZA 1U5TB 2M5WA 1JXSA 3G73A 1TTYA 2O0YA 4BHCA 4HOBA 4P9FA 3O2PE 3CJNA 2JSCA 2EV5A 3BPXA 5EEGA 1WI9A 5DCMB 2QYOA 4IRHA 1OMIA 2HFHA 2GAUA 1R1UA 2XV4S 3ABTA 1OKRA 1Z9CA 3LWFA 5A2QZ 1XDUA 1ONVA 2WC2A 3P7NA 4U7BA 2VE9A 2NS0A 4GXOA 4IRGA 3IKVA 5E1XA 4KT5C 4BNCA 4OIRF 2UZKA 3F8FA 2OD5A 3F8MA 5CJ9A 1GVJA 1G3YA 1FYMA 5IT9Z 1E2XA 5AIQA 1J5YA 4HDVA 1E17A 1W7PB 1TW3A 2ISZA 3CUQC 3E6MA 3ABUA 5J8FA 3T0YA 4NHJA 2XKOA 1CF7A 5AIPA 4JK1X 1XGNA 4G8XA 2HEOA 2VE8A 4P9UA 2W85A 2DTRA 2GQQA 3N97A 5FLXZ 3GW2A 5H6RA 4PCQA 2D1VA 4PDKA 4EJVA 4EGZA 1FZPB 1LDJA 3GWZA 5TJJA 4UNOA 4OINF 2QQ9A 1ZHFA 5E18F 3M9AA 2EA2A 2FMLA 5D6EA 1SAXA 4I02A 5EEHA 3J80K 3E3VA 3E6DA 1D5VA 4HX8A 1G3SA 4I0AA 2GA2A 4N0BA 3CUQA 1DPRA 2Y48A 1HBXG 2IA1A 4LGWA 2E1NA 4LB6B 1HSJA 4L9NA 4KYWA 3BROA 1JE8A 1S7AA 1SD7A 2DW4A 1HW2A 2RC4A 1XGSA 4ZYDA 3HSEA 5LHIA 4RAYA 1O7LA 2FF4A 3QU6A 5DEQA 2XGXA 5D5WB 1KGSA 3KP3A 1VTNC 4EJTA 2BV6A 3JSPA 1KU2A 2FBIA 4RGXA 2YX4A 5L3CA 2KIFA 2HGCA 2L02A 2YPRA 2K02A 3HUGA 3GLXA 2R7DA 3F8BA 4YG2F 5A2QK 1K79A 2V79A 3GFLA 1J9IA 4AIHA 2IA0A 2FMYA 3CUOA 3K1NA 4HF1A 3ZMVA 1F9NA 4BH9A 1CGPA 2XAGA 1PP7U 4MHGA 2RV8A 5L3BA 5D4SA 4G6QA 3G3ZA 1B6AA 1BC7C 5IT9K 2HDCA 3FMSA 5BPIA 5HDGA 5K5RA 3J81Z 1GHCA 3PQJA 4A5NA 1IUYA 4MTDA 1ON2A 1MZBA 2PEXA 4GO1A 1QO0D 2XKPA 2RQPA 2BEOA 4BXUA 2H6CA 3I59B 3LA3A 2DI3A 1QPMA 2JTVA 3EETA 4OMZA 4EM0B 2IRFG 4K2EA 5FLXK 1XMKA 4G7ZF 4AIKA 3F21A 1YIOA 2TDXA 4RB3C 3KP4A 4MEXF 4KN7X 2PN6A 1H9TA 2M1BA 3T1BA 1WRJA 3DXJF 4IRIA 2QENA 2IT0A 2M30A 5FD6A 2FA5A 5E1WA 3MEXA 2XAJA 3D5LA 1IXRC 3HOTA 4U0WA 1XD7A 3E5XA 2XAHA 2F5FA 1TLHB 5K1YA 2VC0A 4OOIA 2MLGA 3VEPA 5HLIA 1SD6A 5CVIA 3F8CA 4MGRA 1U3EM 4LK1F 2VC1A 4HAMA 1PUEE 1D8KA 3CDHA 3U9GA 3WTSC 2XAQA 4OIQF 3V7CA 1TQIA 1IRFA 2ZO4A 4L18B 4LMYA 3RI4A 2L54A 2UXXA 3GUDA 1FNNA 1SFXA 3RTRA 2MD5A 2VBZA 2A6HF 2Q0OA 2VXZA 5FFZA 2DPUA 4MQVA 4ENNA 4HA8A 3DF8A 2ZJ2A 2JT1A 1G3WA 4EMSA 4LK0F 6PAXA 1PP8F 5JI6A 5E8IA 2FOKA 3FMQA 1RUNA 3MFKA 2L4MA 4HQEA 2K4BA 2FBHA 3KLNA 1R1VA 2K86A 4LD5A 4RAZA 1BJAA 2PMUA 3FHZA 5FGMA 3JTGA 1YQAA 3RKWA 2E1CA 4ZH4F 3LFKA 2O03A 2C6YA 2WWYA 4BYYA 4BHBA 2FRHA 3BDDA 5TRDA 2STWA 1U5TC 4IPAA 3VFZA 3H3UA 1IAWA 2GZWA 2G9WA 3QPHA 3BPVA 3VODA 4ESFA 3Q9VA 3J81K 3K2ZA 2J5PA 3R0AA 3M1EA 2GWRA 2OQGA 1QNTA 2XAFA 3RKXA 2IVMA 2CO5A 1ZLKA 1WSUA 1J59A 2KJBA 2Z99A 5DD8A 1HW1A 2FE3A 1G3TA 3WGGA 2AXLA 2HYGD 3RPUA 3KP6A 4WXDA 1FSHA 2KIMA 1IW7F 3KP5A 3GZ6A 1K6OA 3ZP5A 4KFCA 1T2KA 1R7JA 1DUXC 1IN4A 2KKOA 1B9NA 1ULYA 1MJBA 1K7AA 1ZYRF 4ESJA 1T98A 5BQTA 4RB2C 1U5TA 2X4HA 4Q4ZF 3ISPA 4OIOF 1R5HA 1F5TA 1ZRDA 2OAZA 1YS7A 4RGRA 1DDNA 1Q1HA 3M7GA 3OOPA 4A2UA 1TQMA 2LDUA 2DLLA 3SFZA 4BHPA 1WQ2A 1AOYA 2K7LA 2XUBA 5J8CA 5JVTA 3P9CA 1R36A 2DK5A 3JTHA 3GYHX 2VN2A 4KMFA 3EQLF 2EWNA 4XBFA 4GYGA 4WF2A 1EH6A 1LDKB 4HLXA 2ZNZA 1MDMB 1YYVA 2UXNA 2XROA 2WTEA 2EJRA 1W7PA 4P96A 5LGNA 1A04A 4HBLA 1TW2A 3IWFA 1O3RA 1TBXA 3U1DA 4NB5A 5E17F 5KVRA 1Z6TA 3ECOA 3ZN0A 2VONA 5LRRA 2ZFWA 5BMZA 5AONA 2RVCA 4CICA 2FXAA 2M87A 2VT3A 3NRVA 3FM5A 3F6OA 2NRAC 1MJAA 2HR3A 3R6SA 3ULQB 2PBIA 1L0OC 3P9KA 5D8LB 4R1HA 4N9HA 2DPDA 2X0LA 4KMUX 2HWVA 1OYYA 2QQBA 3MAJA 2QUFA 4LG0A 1MGTA 3R60A 3C18A 2HKOA 2V6CA 1OR7A 2RDPA 2RNJA 3O3KA 1UB9A 4XRFA 5CLSA 1X3UA 1LJ9A 4ZZDA 4M9XA 1P4XA 2G7HA 1W5SA 2VODA 1UFMA 4XLPF 3H92A 2OU2A 2BE5F 4FT8A 5F64A 1R22A 2A07F 1KQ0A 1F4KA 1BI2A 3ZMDA 3SZTA 4A5MA 3DPLC 1SMYF 3B73A 5LHGA 1J75A 2O8XA 3MZHA 2R7FA 2AS5F 4I09A 1O57A 4MEYF 1UHMA 5DUKA 5HS8A 4DNCA 2PMHA 4ENJA 2Y0MA 3FXQA 1WWXA 2DU9A 2E7WA 1IF1A 2EFWA 2EFNA 1IRGA 2ELHA 3ZPLA 1U8RA 3BJAA 1AWCA 4Z2YA 1FYKA 3E5QA 4Q47A 4TV7A 2BBYA 5L3GA 2K27A 4Y17A 4IHSA 2ZNYA 3JSOA 1YG2A 2GXBA 3L2CA 3VB2A 1REPC 2EFOA 1XGMA 3DP7A 3BJOA 2O3FA 2MLKA 4KIBA 4I98B 2BGCA 4CYDA 1SFEA 1ODDA 2H09A 3REOA 5H6QA 2LF8A 4L9VA 1JHHA 5BS6A 5H20A 1D8JA 2FQ3A 3I59A 4IJAA 3U2RA 4NQWA 5D6FA 4HF0A 2GA1A 5ICEA 4LFUA 3L7WA 3CLOA 3E5UA 4G7OF 2KRFA 1EH7A 2MH9A 4A6EA 3I5UA 2XHKA 5DD4A 1FBQA 1RZ4A 3J7AO 1FT9A 3ZMUA 3F8NA 3HSFA 4ZYGA 3IRRA 5HLGA 1ZRCA 4I2OA 4KICA 3C3WA 2V1UA 4F7ZA 4KDPA 4OIPF 3WGHA 1G6NA 3I54A 4B8XA 2O6GE 2A61A 5BPDA 2DK8A 1USSA 1H0MA 1Z1DA 3V8JA 2DT5A 4L9JA 3WTVC 2P5VA 2PJPA 5ED4A 2LKPA 3EDPA 4IHTA 3QP6A 1XSXA 3WTYC 3ZMSA 3HSRA 2NYXA 5HLHA 2JZYA 2F2EA 4PGHA 3LA7A 2VBXA 4CGZA 2ZMEB 2EFQA 1EV7A 2Q8KA 3HTSB 3NEUA 4HV5A 1V4RA 3DEUA 1UHWA 3MWMA 3GFJA 2K4JA 2CW0F 4Y13A 1SD5A 3W6JB 2L4AA 1KU3A 3P9IA 2ZBKA 1S8NA 4A6DA 1ZH5A 3GX4X 4L5IA 1FBUA 2W25A 2QZ8A 3FZVA 5E20A 5D8KB 4ZZLA 5L3FA 3KETA 1BIAA 4HYEA 4D0PA 1V3FA 4L0ZB 4Y15A 1XDSA 3L9FA 3T8RA 5DUIA 2PI0A 1BBYA 2OA4A 4FX0A 4U88A 2V1DA 1QGPA 1Z05A 2ACJA 2VOPA 5HVQC 1O3SA 1SFUA 3VOEA 2RKHA 3KCCA 1O3TA 1P2FA 5ILSA 4KN4X 1JGSA 2G7UA