4WXCA

Crystal structure of mycobacterium tuberculosis ogt-y139f
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGFGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxcA01
2VBZA 4BAYA 1CF7A 3V8KA 3NRVA 1RNLA 3I64A 4BQAA 4KA4A 4G6QA 5LRRA 1CGPA 4LG0B 1FWZA 3WU1B 2P6TA 2XUBA 3M8EA 3LA2A 4KICA 1R7JA 2UXNA 1LDDA 2COMA 2IT0A 2V79A 3HTUA 1U3EM 3KEOA 3DQVC 1FBQA 1AWCA 2JSCA 4EGZA 2KIMA 2VN2A 2K86A 4BYYA 1L0OC 4KUMA 1J5YA 4KIFA 3R0JA 1I5ZA 2ZBKA 4RAYA 2GWRA 4WWCA 3I59B 1HKTA 4KNYA 2MBFA 3ULQB 1S29A 1BI0A 1D3YA 1RIOH 2XKPA 3ABTA 1ZRCA 4CYDA 4GO1A 1K79A 3EYYA 3MAJA 4MEXF 2BGCA 2H6CA 2VBXA 3MZHA 1WRJA 5H6QA 3MFKA 4FT8A 2EA2A 1L3LA 3WGIA 1XDUA 3DEUA 2A6EF 4ESBA 5ILUA 2MLKA 3HSFA 4WCGA 2XVCA 3QP5A 3MQ0A 1XGNA 2KIUA 3DKWA 1GVJA 3BDDA 1R1UA 1IW7F 1E17A 4Y15A 5ICCA 1YW7A 2HFHA 4LB6B 3HYIA 2W25A 2J5OA 1HBXG 4P9FA 2ELHA 2D2WA 2P5KA 3HOSA 4M74A 2DBBA 1HQCA 3RYRA 4Y13A 4A2UA 1H9TA 2HOEA 2L4AA 4A6EA 2BBYA 4CICA 3KP7A 2B0LA 1TW2A 3Q5FA 4IRGA 2W84A 1R5GA 1LNWA 2ETHA 2EFWA 4B8XA 1T39A 1SAXA 4RGSA 4RB2C 4HX4A 2WTEA 3LSTA 3C1DA 1BC8C 1ONVA 1D8KA 3Q9VA 4DNCA 5CVRA 2LDUA 5FFXA 5LEJA 2GIVA 1REPC 4LLGF 4N9IA 5LHHA 4I2OA 1IF1A 2XGXA 2FSWA 4HF2A 1KYZA 3CO7C 2OZ6A 2G9WA 1J9IA 1JHHA 5HVQC 2XASA 2MA3A 3I71A 2RN7A 1IRFA 4CXFA 2MC3A 3ZN1A 1KU3A 3HIFA 3J80Z 1XSDA 4YIIA 2M87A 2HDCA 2IRFG 4KFCA 1F4KA 2QZ8A 3JSOA 3ZMUA 4HDVA 2OA4A 4YIFA 3MWMA 1LDJA 1W5TA 2Y0MA 3QP6A 3DF8A 2CYYA 2RDPA 3MCZA 4YFNF 2Q0OA 6PAXA 1KQ9A 2W24A 2OD5A 4RB0A 3TDUC 4WX9A 2JT1A 5DUIA 1XDSA 1KQ0A 2M1BA 5L3BA 2DTRA 4P96A 2ACJA 4JQFA 4RGUA 2EFPA 3C3WA 2Q8KA 1Z9CA 3GWZA 2PEXA 3LAJA 4HA8A 5DEQA 4NHJA 4U7DA 3WE3A 2O61A 1X3UA 5E17F 1OR7A 2A5YB 2K02A 2XIGA 3HTSB 1U5TB 4ETSA 2VC0A 3G3ZA 3F22A 2VC1A 4ON0A 1WKMA 3K1PA 3L2CA 2K27A 4L9NA 1MZBA 3P9IA 4RGXA 5FD5A 1XD7A 4OMZA 1IN7A 1G3SA 4ASNA 5K1YA 2C6YA 1ZLKA 1HW5A 3ZMVA 1S3JA 1IXSB 3KZZA 4MTDA 5KVRA 1ZN2A 3WTSC 5L3CA 4OINF 1R1TA 1R1VA 2PG4A 1BM9A 5DD4A 5HLIA 3F6VA 3L9FA 5L3EA 4UHTA 5BOXA 4DQ2A 2FMYA 3ELKA 3F8MA 2A68F 2WV0A 4U88A 2DI3A 3LA3A 2PFBA 2LF8A 5CVUA 4OOIA 3ERED 1FC3A 4LFUA 5JFRA 1ZREA 1HKSA 1FSHA 5J8FA 1KGSA 5LGNA 1WWXA 2HZTA 5LGUA 2QQAA 2HWVA 2VONA 3FWEA 3ML6A 3IL2A 5HDGA 4G7ZF 2FNPA 1T2KA 4L0ZB 4A12A 5JVTA 3IRQA 2XAGA 3BJ6A 3GX4X 4UVCA 4R8HA 4OIPF 3WU0A 1K6OA 2HGCA 2DQRA 4PGHA 2H27A 2F5DA 3AAFA 3R60A 1QGPA 2XAFA 3K0LA 3S2WA 5TJJA 3F6OA 5LGTA 4F7ZA 2FQ3A 4QWQA 4LJZF 1G6NA 1STZA 5LHGA 4ENNA 3IWFA 3QAHA 1YS7A 2XV4S 1ZRFA 4U0VA 2VBYA 3R6SA 4O5VA 2EV5A 2VBWA 5D6EA 1PUEE 4EGYA 1MDMB 3D0SA 2DLLA 2R7DA 1KA8A 4WXCA 3RKXA 1U5TA 1R22A 3CTAA 3WTWC 4P9UA 2O03A 3F23A 1QNTA 4MGRA 4IRHA 4Q47A 5L3GA 2EA4A 2K4JA 4HLYA 3V4GA 1MKMA 1QZYA 5DCMB 5HDKA 2P5LC 1YG2A 3P7NA 3GFIA 2STTA 2FA5A 3EDPA 4L9JA 1SMYF 3EETA 2Q2EA 1YW9A 4IPAA 1FOKA 2J5PA 1Y0UA 1B9NA 3P9KA 1JGSA 3ZP5A 3TOBA 3M8FA 3BROA 1HXDA 3KP4A 4EQQA 5K5QA 1JHFA 1TQMA 1P4XA 2YSRA 1YS6A 2EFQA 4M9SA 3F21A 2A6HF 3F72A 1U2WA 3SZPA 3BOQA 3V8JA 5BS6A 2FEZA 4MHGA 2LKPA 3RPUA 1F1ZA 5A2QK 2DU9A 2WWYA 2O3FA 1QZZA 3VFZA 3JAMZ 1TQIA 3PFIA 2QENA 3E5XA 3KCCA 1E2XA 1W4MA 4RB1A 1JXSA 4BXUA 4HOBA 1WQ2A 5FLXK 3KETA 2VOPA 1S7AA 2W57A 3ROUA 2E1CA 2D1HA 3RJPA 4G94A 1ZG3A 4M9XA 4KN4X 1FBUA 5JR3A 5K5RA 4CGZA 3WTYC 1LB2A 3H3ZA 2Y48A 4EM1A 2FXAA 4LK1F 4EJUA 1AOYA 2V1UA 4IHSA 1XCBA 1MDMA 2KJCA 2HS5A 1S8NA 4BHCA 3LQQA 2QYOA 3CJNA 3I58A 2NNNA 5E20A 3JAMK 1TW3A 2D1VA 5BQTA 4ZZDA 3CUQC 3K69A 2E7XA 2O8XA 2M8EA 2V1DA 4KYWA 1IXCA 4S05A 3ZQ7A 3FXQA 2VODA 3T5XA 2EV0A 4IXAA 1R36A 3CLOA 1R00A 4AIJA 3WGGA 2H09A 2V6CA 4A0YA 4PGGA 4I98B 3H3UA 3KP3A 3HRMA 4Y17A 3QOPA 3M9AA 3GFJA 5JHUA 4G7OF 2EFOA 4L9TA 3BPXA 1FYKA 3QPTA 4R79A 2ZO4A 4EJVA 4R1HA 5F6FA 2LF7A 5CVJA 3GFLA 1U8RA 4HW0A 3J7AO 1J75A 3EYIA 3VODA 2UZKA 4AVPA 5FGMA 2K7LA 4EV0A 4HAMA 1XB4A 4HF0A 5DDGA 1BC7C 5HDNA 1FX7A 2EV6A 4MEYF 4ENJA 4A0ZA 4UVBA 2E7WA 1GHCA 1G4DA 3FXRA 4JK1X 2OQRA 4KMFA 4IF4A 3CO6C 1FP2A 1FYMA 4YG2F 3F3XA 1YLFA 3SFZA 4LG0A 4G8XA 3E5UA 1MD0A 2Z5UA 4GYIA 3ZMDA 3EQLF 2EB7A 4I0AA 2X4HA 5E1XA 4L5JA 2CFXA 4LMYA 3LWFA 4RGRA 2GXGA 1T6SA 1I1SA 3K9TA 3FX3A 2HEOA 1XSVA 2CO5A 3GYHX 4FX4A 2CGPA 3WGHA 4I7HA 3I59A 1FNNA 3N4MA 1O7LA 2PMUA 4I0BA 2Z33A 3ECOA 1ZHFA 2XHKA 3DPLC 2GZWA 1XGMA 3FHZA 4A6DA 3QRFF 3TOAA 2A61A 5IT9K 4EVIA 4IVNA 1GXQA 3IKVA 1ON2A 3VOEA 3GFMA 5AIPA 1P92A 3REOA 3KZYA 1ZLJA 1UFMA 4KT5C 1QBJA 3E97A 4UV8A 4AD9A 2CSOA 1RI7A 5E1WA 4GGGA 3TO7A 2MLGA 1A04A 3FMRA 3TO9A 5ILSA 1F9NA 2DW4A 5KK1A 3E6CC 2STWA 5LRSA 2QQBA 4HDUA 4H0EA 3ZMZA 2KIFA 2X0LA 2OZUA 1D8JA 5F64A 3OOPA 1FSEA 4HZFA 2FF4A 4ZYHA 2NAZA 2NYXA 3L00A 3BWGA 4WXHA 3KLOA 4BNCA 2EFNA 3BJOA 1J59A 2L4MA 1OYIA 3K2ZA 1TBXA 2RNJA 3ECHA 5AIQA 4MQVA 3MZYA 4M72A 4CDGA 2ISZA 4S04A 1UB9A 5LEKA 4LB5A 4OIQF 2PI0A 2F5CA 3CDHA 3KP6A 4ESJA 4D0PA 1BI3A 2JPBA 3PQKA 2JRTA 2AXLA 1B6AA 2GA2A 4FX0A 2ZKZA 4MNUA 3WTZA 2XRNA 1K78B 1ZRDA 1B9MA 2ZJ2A 1B4AA 3MEXA 3BJAA 2V9VA 2H94A 3F8NA 2XROA 1IXRC 3L09A 1XSXA 3WTXC 2FBIA 4UXNA 3U2RA 2MH9A 1Q1HA 3D5LA 2XAQA 2VT2A 2F5FA 3FXUA 3RKYA 1FPQA 1LDKB 2P7CB 3HUGA 1O3TA 4G7HF 5ICEA 3GLXA 2TDXA 2IA2A 1BIAA 2RC4A 3C18A 3ZPLA 2DQLA 4NB5A 3GW2A 1DDNA 1RZ4A 3NQOA 2KJBA 2FU4A 1G3WA 3E6DA 3T8RA 3KEQA 3HHHA 3QU3A 5E8GA 5EEGA 1FP1D 1IN5A 1ZARA 3RPQA 4G6DA 2DK8A 5ICGA 2EJRA 1O3RA 4PZJA 3KP2A 1PDNC 3E3VA 1V4RA 1LQ1A 2ZMEB 4KIBA 2ISYA 1ZAOA 3GVAA 3WTVC 3DP7A 3G73A 3KFWX 2IW5A 3TO6A 4I01A 1PP8F 4HV6A 1EH8A 3CUQB 1YW8A 5H6RA 1T38A 3ZMSA 2PN6A 5D5XB 3V7CA 4O6JA 1WI9A 2YR2A 3GZ5A 5FFZA 2KKOA 2DPDA 4M9ZA 2L54A 2GXBA 2L01A 3WTTC 3T1BA 3KE2A 5A2QZ 1K78A 2CW0F 4L5IA 1OYYA 3P9CA 5LBQA 3WE2A 3IRRA 3JTHA 2P8TA 3I4PA 1BBYA 3FM5A 1J2XA 2YX7A 5H20A 1O3QA 2G7UA 1O3SA 3BY6A 1TNTA 5FLXZ 3O6BB 1Z1DA 4O3MA 4U0YA 4OIRF 4M71A 1W5SA 3V8LA 1YYVA 2BV6A 2DT5A 2P7VB 4N0BA 3JW4A 2JTVA 1XCVA 1PP7U 1G3YA 2VOOA 5D5UB 1BOAA 1Z91A 4GCVA 1XMKA 4L18B 2ZNYA 1U6GA 1MJAA 1FBSA 1T98A 5D4SA 1EH6A 1Z05A 1FY7A 2NS0A 2QQ9A 2IA0A 1EH7A 5ERIA 1R58A 1ZG5A 4K2EA 2ZFWA 2VT3A 3GEZA 3C7JA 2HTSA 1O57A 2P4WA 3V7SA 4ESFA 4CHUA 4BH9A 3BPVA 2OQGA 2ZMEA 1UCRA 2XAHA 5CJ9A 1TNSA 1B1BA 4HF1A 2IA1A 2HR3A 2XKOA 2QUFA 2Z99A 5CVVA 1ON1A 1D5VA 4IJAA 2EWNA 4EMSA 3CUQA 3ABUA 2H6BA 1OYWA 4M6XA 2HKXA 4GYGA 4KIGA 3GF2A 4JBAA 3J81Z 2G7HA 1BJAA 1LEBA 1YIOA 2W85A 1R5HA 2ESHA 3N97A 3WTUC 1YTYA 1I27A 5L3DA 3DFGA 3I0TA 3FMQA 3IC7A 5DCMA 1O7FA 2RQPA 5FB2A 1XGOA 4AIHA 4KDPA 3HRUA 5K5OA 1F5TA 1SD7A 4RAZA 1R23A 1SD4A 3BP8A 3PQJA 1Z6RA 3M1EA 3GZ6A 4KMUX 3KP5A 2AS5F 1ZGAA 2IP2A 2PLYA 4HLXA 2DPUA 3E5QA 5E18F 3CUOA 3LA7A 5LLQA 3J81K 2ZXJA 1RUNA 4XSXF 1C0WA 2RKHA 4HQEA 5J8CA 5IT3A 2P5VA 3W6JB 4ENMA 4IRIA 3HRSA 1P6RA 3JSPA 3FM3A 1P4AA 4B09A 4CO8A 2RV8A 2IVMA 3RI4A 1DPRA 4P5OA 4PDKA 5FO5A 4UVAA 1FZPB 4OIOF 3I5UA 1DP7P 5E1ZB 3IWZA 5ILVA 3Q9SA 1DUXC 4I09A 2LNBA 3RTRA 5JI6A 4CZZA 3TQNA 1J0RA 1SFXA 1DPUA 1TTYA 1SFEA 2ZCWA 4U7BA 1ODDA 3I53A 5ICFA 2F2EA 3HOTA 4ENKA 1SD6A 2YX4A 1J7KA 2Z9OA 1XGSA 4WF2A 2QBYB 1P2FA 5IT9Z 1XMAA 5CVIA 3HSEA 4EJOA 4Z2YA 2A69F 4LK0F 2DO7A 4AIKA 4A5MA 4ZZLA 1KU7A 4IHTA 4UV9A 1Z6TA 2HYGD 1XN7A 3TDZC 2DFIA 2EK5A 1MJ9A 3R4KA 2K4BA 4G9YA 1G3TA 3SQNA 3RYPA 5LHIA 2GA1A 1HW1A 4Q4ZF 1UHWA 5L3FA 1IZ1A 1KU9A 2FBKA 1OPCA 4XSZF 5DCFA 1RUOA 3R0AA 2MD5A 2QLZA 2D45A 3K1MA 4AWXB 1H9GA 2R7FA 2F5EA 1BIBA 3F8BA 1IUYA 5DUKA 3KLNA 1VTNC 1KYWA 2MH2A 3FF5A 2DAOA 1I1GA 2CWEA 3T0YA 5D5WB 2XAJA 3NEUA 1ZH5A 4Q5SF 1YQAA 1YO5C 3B73A 4N9HA 1QO0D 4BHPA 2R3SA 3E6BA 2A3SA 2KRFA 1IRGA 3RIRA 2VE8A 1WSUA 2M45A 1HW2A 3V7RA 1FLIA 1H0MA 1SFUA 2WC2A 2FOKA 3IHUA 3M7GA 1UHMA 3FZVA 3ZMTA 2NRAC 5D8KB 2V1XA 3I54A 4XLNF 3GUDA 1IN6A 2RVCA 3F8CA 2QBYA 4U0WA 3J80K 4XBFA 1MGTA 5HLGA 3F8FA 1S7OA 5HOOA 4ZH4F 4EJWA 1B59A 3WG9A 1IN4A 2JZYA 1USTA 4XLPF 5D5VB 1HSTA 4HX7A 2ADUA 4HX8A 2FE3A 5CYVA 1GXPA 4XRFA 1W7PD 3L7WA 1Z7UA 4LD5A 4HV5A 4YFKF 4UNOA 3JTGA 4QLCU 1JE8A 4I02A 1BI2A 5HLHA 1T0FA 2CG4A 1K7AA 3W6KB 2HYFA 4HQMA 4L0YB 2VXZA 1LVAA 4NQWA 1OKRA 1YFHA 2PQ8A 3DXJF 1FYLA 2CQKA 5E8IA 2M5WA 1QQIA 2OAZA 2ESNA 1KU2A 3VEPA 2GAUA 1IAWA 2VE9A 3QU6A 4MTEA 3E6MA 4LGWA 5D6FA 3BZ6A 3LQRA 1U78A 2HQNA 1P4WA 4A5NA 4EM0B 5D8LB 3RDIA 4HBLA 3TGNA 2HQRA 1LEAA 2YU3A 4LLNA 2IPQX 4GXOA 5DV5A 1TQPA 1USSA 5HS7A 3HRTA 5DYMA 3B02A 5J6XA 5ED4A 2QM3A 2GQQA 3U9GA 1LJ9A 2FMLA 1HKQA 1W7PB 4RB3C 5TRDA 2L02A 3HSRA 4WK8F 3LFKA 1KQ8A 1ZG1A 3OV8A 2ZNZA 1SD5A 3COAC 3WODF 4TV7A 5CLSA 5BPDA 2HTJA 3GO5A 1CF7B 1BN5A 2BYVE 1BI1A 5HS9A 2DK5A 2IJLA 4YFXF 4BHBA 1HSJA 5BPIA 2NNYA 4MQ9F 2YPRA 2UXXA 3QPHA 3ZN0A 5HS8A 3SZTA 4FHTA 4EJTA 2PMHA 2PJPA 2Z3YA 2O0YA 3VB2A 4ZYEA 1NHAA 2PBIA 1FT9A 1V3FA 2RGVA 1QPMA 4ZYDA 3IKTA 3TKYA 5BMZA 1U5TC 3SHFA 2UWMA 4L9VA 3DV8A 4A0XA 2JPCA 2M30A 4OMYA 4UUVA 2A07F 4WXDA 3H92A 3O3KA 4M6YA 2P6SA 2LSOA 2Y75A 2FRHA 3K1NA 3DPTA 3ISPA 2BEOA 1SMTA 3U1DA 2E1NA 3LAPA 5F1RA 1S6LA 3EUHA 3SXYA 3FMSA 2L3DA 1ULYA 4P55A 4LLLA 1TLHB 2QVOA 3HHGA 2FBHA 2O6GE 2BE5F 3GXOA 1W7PA 5DD8A 4KN7X 1MJBA 4EM2A 4Q48A 3T8TA 5EEHA 1ZYRF 5AONA 2QWWA 5D4RA 2OBPA 4HYEA 4ZYGA 3RKWA 2OU2A 1IN8A 4PCQA 2HKOA 2FNAA 1ZGJA 4E70A 1EV7A 3O2PE 5FD6A 4OU0A 3R61A 1I6XA 4RS8A 1OMIA 4M73A
chains in the Genus database with same CATH superfamily
2VBZA 4BAYA 1CF7A 3CZ6A 2EPRA 3CCVI 3V8KA 3MHSC 3NRVA 1OCCH 1RNLA 3I64A 2CRGA 3QODA 4BQAA 4KA4A 4G6QA 4DV3E 4EEFG 5LRRA 1Z1BA 1CGPA 4LG0B 1FWZA 3ZR8X 3WU1B 2EOYA 1O4XA 3IWDA 1BR2A 2P6TA 2XUBA 3G1MA 3LA2A 3M8EA 4KICA 3IV5A 1R7JA 2UXNA 1SEUA 3F6GA 1LDDA 2COMA 2JUCA 3M1CA 4C2MJ 2IT0A 3JTZA 3M99B 2V79A 1YITI 3DJWA 3HTUA 1U3EM 3KEOA 2X48A 3DQVC 4GZNC 3LMMA 2VL8A 1FBQA 1QHHD 2NVXJ 2EMIA 1AWCA 2JSCA 1A1FA 3CD6I 4XLFA 2KIMA 4EGZA 2VN2A 2K86A 4BYYA 2YTFA 1L0OC 2ODRD 4KUMA 2DMNA 2MSYA 1YUIA 4F91B 1J5YA 1VQ9I 4KIFA 3R0JA 1FMVA 1I5ZA 1RQ0A 2ZBKA 3HG9A 4RAYA 2LRSA 3CCMI 2GWRA 4WWCA 3I59B 1HKTA 3F6HA 3F9KA 1D0ZA 4KNYA 2MBFA 1JUMA 1S29A 3ULQB 2HPIA 1XNRE 1BI0A 1YRNB 2K9QA 1YX3A 4IOAF 2E2IJ 4RM3A 2CU7A 2LT7A 4BJ6C 2EN8A 1D3YA 2BY2A 2RPCA 1Z3YA 2AXTC 1RIOH 2XKPA 3ABTA 1ZRCA 1YJ9I 4CYDA 4GO1A 4ZTJA 1K79A 3EYYA 3MAJA 4MEXF 2BGCA 2FOWA 1Z7LA 2H6CA 3D5SC 1FIPA 5CKTA 2XB5A 2VBXA 3MZHA 2R5YA 3K70C 4R2PA 1WRJA 5EGOA 5KL3A 5H6QA 3MFKA 2R5ZA 5AE1A 1ZGWA 4WYQB 5B66C 4FE7A 4FT8A 2R7WA 2EA2A 1L3LA 2VIXA 5E3LA 2UUAE 1X1BA 3WGIA 1XDUA 3BF2A 4IS1C 2UXDE 3DEUA 2A6EF 2R7RA 1TWHJ 4ESBA 5ILUA 2MLKA 3HSFA 4WCGA 5M5XJ 2XVCA 3QP5A 4B47A 1IC8A 1X2MA 3HXLA 1X1DA 3MQ0A 1XGNA 2WV1A 2LKXA 2LD5A 1E0EA 2HXIA 5IT9C 4CUGA 2KIUA 3DKWA 1GVJA 2LRDA 2ENCA 3BDDA 3CCSI 1R1UA 2CQNA 4HSTA 5C44J 1IW7F 3AG3H 1E17A 4X8WA 4LFAE 4Y15A 5ICCA 3OYHA 1YW7A 2HFHA 2B7TA 4LB6B 3FXKA 3A0HC 3HYIA 2RREA 2W25A 2O9LA 1VQKI 3FBIB 2J5OA 1HBXG 1YPNA 4P9FA 2ELHA 2D2WA 2P5KA 4R03A 3HOSA 4F9BB 4M74A 2DBBA 1JJ8C 1HQCA 1G59A 3HOUJ 4RDUA 3RYRA 1VQ5I 2B3TB 4Y13A 4B3XA 3AG2H 4A2UA 4BXFA 1H9TA 3O8HA 3I9V2 2HOEA 2L4AA 4A6EA 2BBYA 4CICA 1ZBQA 2BW3A 3RZOJ 2LUQA 1FJLA 3KP7A 3IP4B 1WXRA 4DR3E 4BCAA 2EILH 2B0LA 1TW2A 4IHYA 2L2NA 4OAYA 3Q5FA 4RH8A 4IRGA 2W84A 3ZGKA 1R5GA 1LNWA 3W2AA 3OTOE 5KAIC 4B3SE 1JUPA 2ETHA 1HNXE 2EFWA 1JKRC 1X3CA 2QF7A 4BS9A 4B8XA 3AFHA 2K3FA 4E4HA 3H0DA 1T39A 5KL2A 4PFPA 1SAXA 2RQLA 3EPKA 3I56I 4RGSA 1EKZA 4RB2C 4AUXA 2CT1A 3V42A 2EMYA 4HX4A 2WTEA 3PO3J 2MC5A 4GKKE 2A05A 3MHHC 3OL3A 3ADGA 3LSTA 3C1DA 1BC8C 1LVKA 1UG2A 2K4VA 2YTGA 1ONVA 3HOZJ 1MH3A 1D8KA 2DTZA 2DA7A 1D5YA 5FROA 2I13A 4II3A 2E72A 3CMYA 4BE1A 3Q9VA 4DNCA 5CVRA 2ZXWH 2JOXA 2LDUA 4AC0A 5FFXA 1UN6B 2M3AA 2WBSA 5LEJA 2GIVA 1REPC 4LLGF 1TF3A 3IH2A 2IEKA 2VQGA 4N9IA 5LHHA 4NHRA 4I2OA 1IF1A 2IBDA 2XGXA 4XLHA 1UG0A 3MN2A 2FSWA 2W48A 2LG4A 4HF2A 2EWLA 1KYZA 2CUZA 2OZ6A 3CO7C 4DKKA 2G9WA 3HQ1A 1J9IA 1OCTC 1JHHA 1MMSA 1AKHB 1TN9A 2F4OB 3PSFA 5HVQC 1GQEA 4LF8E 2A6TA 2XASA 4DOZA 4K0KE 4BACA 3HM5A 5IP7J 2MA3A 2K9SA 3I71A 2JVAA 2RN7A 3BC8A 4LF6E 1IRFA 1T4NA 2HOTA 4CXFA 1GDTA 2DYRH 2MC3A 3ZN1A 1KU3A 3HIFA 4F55A 3J80Z 2AQEA 2OV7A 4YIIA 1XSDA 2LJUA 3DU5A 2CQXA 2M87A 3GLLA 1NG6A 2HDCA 1FMWA 5J1UA 1ZU1A 2IRFG 4KFCA 1F4KA 2QZ8A 2E5ZA 3JSOA 3ZMUA 1VI0A 3W2WA 1YOVB 4HDVA 4A93J 2EQ1A 1DU6A 2OA4A 2F4IA 1RC9A 2ZXHA 4YIFA 3MWMA 4LFBE 1T4LB 1LDJA 1W5TA 2Y0MA 3QP6A 2K3PA 2R7VA 3BQYA 3DF8A 2CYYA 3RMPA 1IBLE 2L8TA 2LBFB 2RDPA 3MCZA 4YFNF 2Q0OA 3BR6A 6PAXA 1KQ9A 2W24A 2OD5A 2DA2A 3CCLI 3K6GA 4RB0A 3LSKA 4DV1E 4C2UA 3TDUC 2OJED 2XAUA 4WX9A 5FLMJ 3BG7A 3FK7A 2JT1A 4Z6YA 1SFKA 4L5EA 2KPMA 3CF5F 2EPUA 5DUIA 1PJQA 2M2EA 2UUCE 1APLC 1NK3P 4DR2E 1XDSA 1KQ0A 2EMFA 2HYJA 2M1BA 5L3BA 2V85A 2EMCA 4CCOA 2DTRA 2IXSA 2EP3A 4P96A 5F0CA 2ACJA 4JQFA 4Y7NJ 3DTIA 2DLKA 2DJIA 2L9RA 9ANTA 4RGUA 2DA5A 2VQLA 2R93J 5IWAE 2BY0A 2EFPA 2H1LA 3C3WA 2Q8KA 1Z9CA 4Q28A 2NS7A 4D5FA 2KHMA 3GWZA 2E36A 4IJDA 2PEXA 1IRXA 3SFIA 3LAJA 2YZTA 3DF6A 2DOFA 4HA8A 2YTNA 5DEQA 4NHJA 1WH5A 5EG0B 2EOQA 4U7DA 1RRJA 4HEIA 1JK1A 3WE3A 2OPTA 1B72B 2M9AA 2O61A 3DPUA 1X3UA 3HKZA 1YSAC 1XNQE 5E17F 1OR7A 2X1DA 2A5YB 2K02A 5IOZA 2XIGA 3HTSB 4FK5C 4X64E 2FUG2 1U5TB 1Z21A 4ETSA 4R2EA 3OL4A 1YHQI 2VC0A 3G3ZA 2LTSA 1LFBA 4V19K 2EOOA 3F22A 2VC1A 4ON0A 1WKMA 3K1PA 2DOAA 3L2CA 2K27A 4L9NA 1D1AA 4LIUA 1IBKE 2DJNA 1MZBA 1BL0A 3I4NJ 1UHZA 5J1RA 3H36A 1ZKGA 5A6JA 3P9IA 4RGXA 5FD5A 1XD7A 2W1OA 4OMZA 4V2GA 2OCEA 1IN7A 3BG3A 1ZAAC 4W1UA 2JXPA 1G3SA 3JRCA 4ASNA 1MNMC 1RC7A 4XNFA 5K1YA 2C6YA 1HOMA 1LKXA 5J1YA 2ZC2A 3SYTA 2QSFX 1ZLKA 2HDWA 1A35A 2EM8A 4R2RA 1HW5A 2Q2EB 3ZMVA 5E3NA 3OYCA 1S3JA 1IXSB 3KZZA 4NC7A 4MTDA 2JRMA 5KVRA 1VQ6I 1ZN2A 2UUBE 1MBFA 3WTSC 3C4TA 3UK3C 5EJCA 5TISC 5L3CA 2JA8J 1ZBTA 2VI6A 2VKDA 4OINF 4L5NC 1R1TA 1R1VA 2PG4A 1BM9A 4ANJA 5DD4A 5HLIA 4DYRA 3F6VA 3L9FA 5L3EA 1AKHA 1HA8A 4RLQA 2AQFA 4UHTA 4B43A 1D0XA 2L9SA 4IHXA 3NWSA 5BOXA 2EQ0A 4DQ2A 1TF6A 2FMYA 3ELKA 2EL4A 1TWFJ 2A68F 1OFCX 3F8MA 2WV0A 4U88A 4A3BJ 3A02A 2I10A 3BZKA 2JVGA 3U1KA 2DI3A 2KISA 3LA3A 4PUSA 2BB8A 2PFBA 2LF8A 3C2BA 2R7SA 1FKAE 2FGGA 3AG1H 4OOIA 5CVUA 3OS2A 5GTHC 1FC3A 4LFUA 1NG7A 5F08A 3ERED 2XGCA 5JFRA 1ZREA 1HKSA 1FSHA 5J8FA 2GXAA 3HB9A 1KGSA 3ZQLA 5LGNA 1WWXA 2HZTA 5LGUA 3THNA 2QQAA 3J7AG 1PJRA 2HWVA 3BQZA 2VONA 1YJNI 3BCBA 3FWEA 1T0FC 3ML6A 4B48A 4JYKA 4ITVA 5HDGA 3IL2A 3K70D 4G7ZF 2FNPA 2YT4A 1T2KA 4L0ZB 2LBFA 3HOXJ 4A12A 5JVTA 3IRQA 4PFOA 2OTJI 2XAGA 3BJ6A 4N4NB 4DJAA 1E3PA 4FE4A 3GX4X 4UVCA 4D7NA 4R8HA 4OIPF 5GAEJ 2CH0A 1A1HA 2HVSA 4Y33A 1QU6A 3WU0A 1K6OA 4JYAE 2NVYJ 2HGCA 2ZFUA 5IOYA 2DQRA 4PGHA 5EZGA 2H27A 2F5DA 1NCSA 3ABMH 3AAFA 3IWCA 3R60A 4DUZE 5K7HA 1QGPA 3HGYA 3ZOQB 2XAFA 2B7EA 3K0LA 4YRVA 1W0TA 3S2WA 2EN2A 4DV7E 3S15J 5TJJA 4D7MA 1A1LA 2X6WA 3F6OA 1A36A 1YUJA 5JLWA 5LGTA 4F7ZA 2FQ3A 2VPRA 2MC4A 1DGWY 4QWQA 1VQ4I 2V8QB 5KL5A 1OCRH 1DU0A 4LJZF 1R49A 1Y56A 1G6NA 1STZA 4F52A 3A0BC 4F3QA 5LHGA 3DWLE 3JRHA 3CCJI 1IGNA 5A6AA 2CTDA 4ENNA 3IWFA 3QAHA 3P1XA 1YS7A 5E3OA 4KT6A 2E5LE 2XV4S 1ZRFA 1MBGA 4U0VA 3MD2A 3SEZA 2EPCA 2VBYA 3ZQIA 2UV1A 2LTPA 2JWTA 4RM2A 5EG0A 3CCRI 2DIXA 3R6SA 4BGDA 2M7QA 2DYSH 2XB0X 4O5VA 2EV5A 3WU2C 5DM7F 2VBWA 4F6MA 1B72A 2JK3A 5D6EA 1PUEE 4EGYA 3S17J 3KIOA 3K4LA 1MDMB 3D0SA 2DLLA 2R7DA 4CCLA 2Z1DA 1KA8A 4WXCA 3RKXA 1U5TA 2V7FA 1R22A 3CTAA 2EZIA 3WTWC 3OYMA 4P9UA 1U9NA 2O03A 3F23A 1VQOI 1QNTA 4LIVA 3RZDJ 3H5RA 4MGRA 1U8BA 1MMAA 2JUGA 4IRHA 4Q47A 5L3GA 4FASD 3QG5C 2EA4A 2K4JA 2P0WA 4J01A 4HLYA 3V4GA 1MKMA 2GM4A 4WSPA 1QZYA 3Q3SA 5DCMB 5HDKA 1ITYA 2EMBA 2K7IA 3S1NJ 1UZCA 2P5LC 4FETA 1YG2A 1A6IA 3P7NA 1WFXA 4PJNA 1XMQE 3GFIA 1STUA 2EPMX 3OWTA 2STTA 3M07A 2DGCA 1H88C 1MBJA 2F5VA 2FA5A 1GV5A 3EDPA 4L9JA 2X6YA 1OCPA 1MMGA 1SMYF 2GLIA 3EETA 2EOXA 2E35A 5IYBJ 2X1EA 1X6FA 1SFOJ 4FTHA 1YIJI 3LMLA 2EM6A 2Q2EA 2YRMA 1YW9A 4IPAA 2EPAA 4W97A 1FOKA 2J5PA 4F9AB 2UU9E 3CCYA 1Y0UA 1QRYA 1B9NA 3ZRGA 5GPCA 4XIDA 5C3EJ 4HNUA 3P9KA 2R76A 3DBHB 1HNWE 2WAFA 4X62E 1JGSA 4HEA2 1IMUA 3ZP5A 2KHXA 3TOBA 3M8FA 4BC7A 3BROA 2DT6A 1HXDA 3KP4A 2EN6A 1WCMJ 1FEXA 3VYRB 4XLEA 4EQQA 5K5QA 3ZOBA 2GPIA 1JHFA 1TQMA 1P4XA 4R2DA 2YSRA 3BGHA 2V88A 1YS6A 2EFQA 4M9SA 3EPJA 4WFTA 4KHPE 3F21A 2A6HF 3F72A 1F43A 1U2WA 2EOEA 3SZPA 1JTXA 3BOQA 5IV8B 3V8JA 2NXNB 2V89A 3RSNA 1I3AA 1IG7A 2QKMB 2EL6A 5BS6A 3FKIJ 4A3MJ 2FEZA 2V4JC 1XG1A 4MHGA 2EPOA 2AHQA 2F48A 2LKPA 2RAEA 1F1ZA 3IAS2 3RPUA 3BTLA 4CCMA 5A2QK 2MC6A 2UXBE 3K6QA 4B3AA 2DU9A 2WWYA 2VKHA 2O3FA 4DR6E 1QZZA 4E7SA 1D0YA 3VFZA 3JAMZ 3DBLB 1TQIA 3PFIA 2QENA 1ETXA 1AH5A 4JX6A 3E5XA 2CQ7A 2TCTA 3KCCA 1E2XA 1WJEA 1W4MA 4RB1A 5CQGA 2LP0A 3M8JA 4M3EA 1JXSA 2R4GA 4BXUA 4QIWN 4HOBA 1WQ2A 2CUJA 5FLXK 4HNTA 3KETA 2VOPA 1S7AA 2W57A 3ROUA 2E1CA 5DS9A 3T1YE 1UBDC 1SVOA 2D1HA 3K4CA 3RJPA 4HSRA 4BDYA 2EMZA 4G94A 5GTIC 1ZG3A 4M9XA 4KN4X 3MKYB 1FBUA 2CFOA 4X1EA 3SEQA 5JR3A 2EMXA 3ASOH 5K5RA 4AYBA 5B1AH 2FD5A 4CGZA 5KL6A 3WTYC 1LB2A 3H3ZA 2JR1A 2Y48A 4EM1A 2FXAA 1VNDA 4LK1F 2ECBA 2LVSA 3TL4X 4EJUA 2EINH 4NC6A 3PFYA 1FTZA 2XGEA 1AOYA 1N36E 1HR0E 2V1UA 4IHSA 1K83J 2ZJPF 1XCBA 2NUFA 1MDMA 4Y4RA 2KJCA 2Q1ZB 1HC8A 2YWQA 1N75A 2HS5A 1S8NA 4BHCA 3LQQA 2ZMEC 1MH4A 5DM6F 1MIJA 2QYOA 3PUFA 3CJNA 3S2DJ 3I58A 2NNNA 3OS0A 5FLVA 2LV2A 5E20A 4BE0A 2WB1A 3C4BA 3JAMK 4C3IJ 1A1GA 1TW3A 2E71A 2UXCE 2D1VA 2VPLA 2CUFA 5BQTA 4ZZDA 3CUQC 3K69A 5KAFC 4DUYE 2E7XA 2O8XA 2M8EA 3JR9A 2V1DA 3TMOA 4KYWA 4BBSJ 4E7JA 2V86A 2YU8A 3SDBA 1IXCA 3JRBA 4A3JJ 4M0VA 4S05A 3ZQ7A 3FXQA 4A3KJ 2VODA 2V9PA 3T5XA 4LFCE 1RETA 3BG6A 2EV0A 4JX4A 3JCUC 2MKDA 3QWLA 2KIQA 2ZXIA 4IXAA 4JI4E 1X6HA 2IAIA 2ID6A 1R36A 1TZLA 3CLOA 1R00A 4AIJA 3WGGA 3CMMA 2H09A 3CQZJ 3S32A 1I94E 2V6CA 1CQTA 4A0YA 5GADJ 4HTGA 4WPYA 4PGGA 3F0CA 4I98B 5LD2C 4A3DJ 2Y2ZA 1H8AC 3H3UA 1S9HA 3KP3A 2L5QA 2BVLA 5J4YA 3S93A 3HRMA 1I39A 2KRCA 1R4NB 4Y17A 2RQQA 4F2JC 3QOPA 2VQFE 3OSFA 3M9AA 3GFJA 5JHUA 4GDFA 4G7OF 3HGGA 2EFOA 4L9TA 3HTXA 3BPXA 2LY9A 1FYKA 3S14J 3QPTA 3QYEA 4R79A 2YTDA 2ZO4A 2DA6A 4EJVA 1Y0NA 1XTAA 4R1HA 3S3NA 1XS9A 3H5NA 5F6FA 2LF7A 3JU0A 1HDPA 5CVJA 3GFLA 1U8RA 2IS2A 4XRMA 2ELJA 3HPSA 2WAQA 4HW0A 3J7AO 3NWTA 1J75A 3DKYA 4TUGA 3EYIA 3VODA 5BNGA 2VASA 2UZKA 1QU3A 1RKTA 5E79C 2CV1A 2RTXA 2VF1A 2EOHA 2MDGA 3BTIA 3H9JA 2QGUA 4NZVA 4AVPA 2BBGA 5FGMA 2BY3A 2K7LA 4RA2A 4EV0A 2B9SA 4HAMA 1XB4A 2WADA 4OX9E 4HF0A 4NDLA 5DDGA 1BC7C 5HDNA 1S7EA 5KL7A 3H9QA 1EF4A 1FX7A 1I3QJ 2EV6A 4MEYF 2R7UA 2HGHA 2X6XA 1AHDP 1PKPA 3A03A 4ENJA 4A0ZA 4TUIA 3OYLA 4E7IA 4UVBA 2E7WA 3NARA 1GHCA 3Q0VA 1G4DA 3FXRA 3J7YJ 4A3FJ 4JK1X 3DBRB 2CUEA 2N3HA 4RHBB 1HLVA 4LITA 3OYBA 3ASNH 2OQRA 2CPNA 3L2QA 2N8XA 3PSIA 4IF4A 4KMFA 3CO6C 1FP2A 1JKPC 1N78A 2DODA 1X2NA 2JP9A 2MKNA 4PJLA 5FKOA 1FYMA 1W5CC 3PM1A 3NAUA 3TP3A 4YG2F 4LU9A 2VB6A 2KONA 3F3XA 4O43A 1YLFA 3SFZA 1AAYA 4LG0A 4G8XA 3E5UA 1MD0A 3JRFA 2Z5UA 4MLOA 1ZR4A 1V5EA 2M4KA 4GYIA 3H9GA 3ZMDA 3EQLF 2EB7A 4I0AA 1K4TA 2X4HA 3BR3A 2DFFA 3MKLA 2WY8Q 5E1XA 3L2UA 4L5JA 2CFXA 1X4PA 2XF7A 4LMYA 3LWFA 3H1CA 1PUFB 5IYCJ 4C2TA 3I4MJ 4RGRA 4RBOA 3L1PA 2GXGA 1T6SA 1EJ9A 3GTPJ 1PJTA 3CCUI 3K4KA 1I1SA 4QTRA 3J80C 2KP6A 3K9TA 2BZTA 3FX3A 2DMTA 1SAUA 4DBQA 2HEOA 3QPLA 1N77A 1XSVA 3LSGA 2CO5A 3GYHX 4FX4A 2H8RA 2CGPA 3WGHA 4I7HA 1IQSA 5K7FA 3I59A 3GTGJ 1FNNA 3N4MA 2X51A 1O7LA 2PMUA 4I0BA 5LL6R 2Z33A 2XPVA 1DGCA 3ECOA 2DFHA 1YRNA 1V54H 3ZQHA 5BR8E 3B6AA 1ZHFA 2XHKA 3BR2A 3DPLC 2GZWA 1XGMA 4JI0E 1Y8QB 3LSMA 3AUZA 1EKEA 3FHZA 4PJ0C 4A6DA 3VYUB 1OLTA 2JA2A 2NVQJ 3B6CA 3QRFF 3HUGB 2Y9ZA 2PMZA 3OMYA 2A61A 3TOAA 1LFUP 1IRZA 3J7Yp 2VJ5A 1ZR9A 5IT9K 3OYAA 5A6BD 4EVIA 4IVNA 1GXQA 4ZC3A 3IKVA 4IQJA 2UUZA 2Z2SB 2FX0A 1RESA 1ON2A 2LY2A 3W2VA 1ZTRA 3GFMA 3K4BA 2V1NA 5AIPA 1P92A 3VOEA 3REOA 2OF7A 4GEQB 3I55I 3CLQA 3KZYA 4XN3A 1ZLJA 1UFMA 1UELB 2H8WA 2JN6A 2VKEA 2VE7C 1FTTA 5AC4A 4KT5C 1QBJA 3PIPF 3E97A 4JI6E 4UV8A 4AD9A 3C6MA 2DXIA 3A4CA 3VDXA 2CSOA 3OIPA 1RI7A 2KDZA 5E1WA 3K4MA 4GGGA 2Y30A 3TO7A 2MLGA 1A04A 3FMRA 3TO9A 2YS9A 1N34E 2CSHA 4M3FA 2GBYA 1TWAJ 5ILSA 1FIAA 1YX5A 1RMDA 4G6TB 1F9NA 2DW4A 1GV2A 5KK1A 1KONA 3E6CC 1QVUA 1MSEC 2STWA 5LRSA 2QQBA 4HDUA 4H0EA 3LLHA 4MLQA 3KX2A 2EZ6A 3ZMZA 4JV5E 2HOAA 4XKWA 2KIFA 2X0LA 3HBLA 2JQ7A 2OZUA 2LC2A 2Y0SN 1D8JA 1IQOA 4X9JA 2XRLA 5F64A 3OOPA 1FSEA 4HZFA 2FF4A 2HPMA 3A1YA 4ZYHA 4IHWA 2L0KA 2MG4A 2NAZA 3FIGA 2NYXA 3L00A 1PJSA 2EE8A 4BQOA 1VZ0A 1N33E 3BWGA 4WXHA 3KLOA 1RR8C 1ENHA 4BE2A 4BNCA 2EFNA 2ZM6E 1EA3A 3BJOA 3H09A 2XSDC 1J59A 4IZZA 2L4MA 1OYIA 3K2ZA 3OMLA 1TBXA 2NUEA 2RNJA 3ECHA 3OYEA 1R4MB 2YU5A 4B3RE 2DMQA 5AIQA 4MQVA 2F4MB 1G8XA 3MZYA 4M72A 4CDGA 1WJ5A 2ISZA 4S04A 1MBKA 1UB9A 3KWRA 1P7IA 5LEKA 4LB5A 4OIQF 2PRTA 2PI0A 2F5CA 2XPUA 4LF7E 3BZCA 3CDHA 2M1SA 3KP6A 2JA7J 4ESJA 2IHR1 2YTQA 4R2QA 3EUKL 4D0PA 3G71I 4JX5A 4XMYA 4NXME 1BI3A 2JPBA 3TP0A 3C2HA 3PQKA 2M7AA 1QZEA 2EZLA 4BL0B 1WJDA 2JRTA 3FBNB 2VKVA 1T56A 1YZ9A 2AXLA 1S72I 2WB1N 1B6AA 2GA2A 4FX0A 2ZKZA 2ZSHB 4MNUA 4Y3OA 1B69A 3THOB 2JWOA 1YYKA 4M30A 2M8GX 3WTZA 2DOEA 2D9HA 2XRNA 5F0FA 1K78B 1ZRDA 2E2JJ 1B9MA 2ZJ2A 1B4AA 2WAEA 2XDVA 3EQ1A 1E3HA 3IH3A 3MEXA 3BJAA 1QVTA 1GTKA 2IGNA 3CC4I 4UY8I 2V9VA 2EMKA 2H94A 3F8NA 2F8BA 4WSGA 4XONA 5M5WJ 2XROA 1IXRC 2EPLX 2FTXB 3L09A 2LJHA 1XSXA 2AO9A 2X85A 2XPWA 3WTXC 2FBIA 5FRMA 4UXNA 3U2RA 3D5RC 2MH9A 2ME6A 3L2VA 1Q1HA 3D5LA 2DSYA 4KWYA 2XAQA 2VT2A 3O8GA 3D1NI 2F5FA 2JMWA 2ICWG 2EM3A 4R2AA 1OCZH 3FXUA 3RKYA 1FPQA 2JSPA 2R92J 1YYWA 1LDKB 2RSIA 2EQRA 4XM3A 2K85A 2RS7A 2ID3A 4J8ZA 4Q35B 2P7CB 2EOJA 4IX7A 4HPQA 3HUGA 4HNVA 1O3TA 2IS1A 1ACIA 2W82A 3BLYA 3PUBA 5FKMA 2HQAA 4G7HF 5ICEA 3GLXA 4JOMA 2VJ4A 3W3CA 2NOGA 1H89C 4NC8A 4M2ZA 2TDXA 2F4VE 2IA2A 1BIAA 4KJZA 4XR6A 2RC4A 4IHVA 1BR1A 3C18A 1I6HJ 5B1BH 1KJKA 2ZB9A 1LUJB 3ZPLA 3LSPA 4QSHA 4J00A 2DQLA 4NB5A 4B3TE 3GW2A 2M9HA 4IO9F 1DDNA 2JVHA 1RZ4A 3NQOA 1YYOA 3MMYB 2KJBA 2FU4A 4M3BA 1G3WA 3E6DA 2LYCA 3T8RA 5KHDA 4AIDA 3KEQA 4JI1E 2NABA 3HHHA 3QU3A 5E8GA 5EEGA 2DA3A 3VSKA 4BBYA 2V87A 2HJJA 3JREA 1FP1D 2EPFA 4BY7J 1IN5A 1ZARA 3RPQA 1QA6A 4G6DA 2DK8A 1A1IA 2MDRA 2BY1A 2O8KA 5ICGA 3CESA 4CCJA 2EJRA 1O3RA 4PZJA 4XN0A 3KP2A 3JRGA 2G0EA 3BBGA 1WHUA 1PDNC 5FKNA 1POGA 3E3VA 1K61A 3EPZA 1WH7A 1A1KA 3VYYA 1V4RA 2ZJRF 2FV4B 3HPHA 1X5WA 2JA6J 1LQ1A 2ZMEB 1E3OC 2LMDA 4KIBA 4D1QA 4MIMA 2ISYA 1IJWC 1MNEA 1ZAOA 3GVAA 2KZVA 3WTVC 2DDAA 3DP7A 3G73A 3KFWX 4XLAA 2IW5A 3TO6A 1SR9A 1ZQ3P 4I01A 5KCMA 4H4KC 1PP8F 4A3LJ 5AE3A 4HV6A 2A5WA 1EH8A 3CUQB 1YW8A 3ERMA 5H6RA 2E34A 3CMEI 4P7DA 1X3WB 1T38A 1LFPA 2LBSB 2X1CA 3ZMSA 1PYVA 2PN6A 2E1MC 3V7CA 4O6JA 3HC7A 5D5XB 2YRHA 1WI9A 3BG5A 1XX5A 2EM4A 2JJ7A 2KZGA 3ECRA 2WCC3 2YR2A 3GZ5A 2NS8A 5FFZA 2KKOA 2DPDA 3J7ZI 1T95A 2DMPA 5T6JA 2EM7A 2QKLB 4M9ZA 3OYKA 5F3WA 2L54A 3WG7H 2GXBA 3BT9A 2L7MP 3BG9A 1WJAA 5J47A 2L01A 1BW5A 4P1WA 5HODA 4Y52J 1WHQA 2L2KB 3WTTC 3T1BA 2GIZA 4KISA 3KE2A 3HL2A 2E60A 4HRIA 3GMEA 4X65E 5A2QZ 1K78A 3SJMA 2CW0F 4L5IA 5K7ZA 1OYYA 3P9CA 1K4SA 4CYCB 5LBQA 4N4RB 3WE2A 4OWRB 3IRRA 3JTHA 1ETWA 1V55H 2P8TA 4BJ5C 3I4PA 1X1AA 5FKKA 3HJEA 4E7ZA 3AKZA 1BBYA 1ETKA 2E2HJ 1X47A 1X19A 3SZGA 2ENAA 3FM5A 1X48A 1J2XA 3DU6A 3HOYJ 2YX7A 5H20A 1O3QA 2G7UA 1O3SA 5A69A 1JK2A 3BY6A 3BR5A 1TNTA 2HQ5A 3O6BB 4I76A 1Z1DA 5FLXZ 4O3MA 2O7OA 1IBME 2I8DA 4U0YA 4BU2A 4X66E 2EZHA 2PX9A 4OIRF 4M71A 3TW6A 3S1QJ 3GTLJ 1N3GA 4KITB 3LSRA 1W5SA 2L33A 1NTCA 3V8LA 1YYVA 4MFDA 4DMIA 2BV6A 4DZPA 2DT5A 4KZSA 2P7VB 2CJJA 4N0BA 3DEEA 2XF5A 5M3FJ 3JW4A 4A69C 2JTVA 4BUPA 1V5FA 5GPAA 3DCFA 4CSWA 3C6KA 3JAMC 4R2SA 2Y69H 1XCVA 2CMPA 4ZTFA 5LMNE 3G2BA 2GHFA 3BCAA 2WBMA 1UMQA 3OIQA 1MNDA 1PP7U 1G3YA 4JI8E 2VOOA 5D5UB 2HC5A 1BOAA 3ZQFA 4E6KG 5M5YJ 2R5YB 1Z91A 2VJJA 3G1LA 4GCVA 3OYDA 1XMKA 4L18B 2ZNYA 4DR1E 1AU7A 1U6GA 1MJAA 2EN1A 2NA2A 4FQGA 2B63J 1WJFA 4C9YA 2R5ZB 1FBSA 4RLFA 1WGXA 2XF6A 3SDGA 1WJPA 4O4KA 1T98A 3WHBA 5D4SA 2BHYA 3A2KA 4O5GA 1NEIA 5DNYA 1EH6A 2K9MA 1Z05A 1FY7A 1DQ3A 2NS0A 3CP8A 1WJBA 2QQ9A 1ETYA 2IA0A 1N32E 1EH7A 3ADIA 5ERIA 5LMUE 1JKQC 5C4XJ 1R58A 1ZG5A 2PJRB 4K2EA 4XQFA 2ZFWA 2KRHA 2VT3A 3GEZA 2JYAA 3C7JA 4BY1J 4MLVA 2HVRA 2HTSA 1G2DC 1O57A 3ABKH 5HNFA 2P4WA 3V7SA 4ESFA 2TRTA 3AV0A 1SVLA 2R1FA 4F92B 4PK4A 4BH9A 4CHUA 4X0GA 2HHHE 3BPVA 2OQGA 2ZMEA 1Y39A 3HDDA 1UCRA 2XAHA 4LOCA 5CJ9A 1TNSA 1SC7A 1B1BA 4HF1A 2IA1A 1VF9A 2HR3A 2MGQA 1B8IB 4ZDPA 2XKOA 4L8NA 2QUFA 2Z99A 5CVVA 4AVZA 2LUPB 1M1EB 1ON1A 3MZ8A 1D5VA 5FRNA 4IJAA 2EWNA 4BQQA 5ADZA 2HI3A 4EMSA 3CUQA 3ABUA 3HKZN 4XRSA 3MKZA 2H6BA 4LTYA 1OCOH 5F04A 5GAHJ 1OYWA 3CDLA 2HKXA 2OCCH 4GYGA 4M6XA 4RMNA 4XRSG 3PJRA 2OC6A 4KIGA 5HLTA 3GF2A 3LSJA 4JBAA 3J81Z 3EUHC 2G7HA 1BJAA 3RCOA 1LEBA 1YIOA 1HCRA 2W85A 1R5HA 2ESHA 2ADRA 3N97A 1Z3XA 2QEXI 3S3MA 1S5LC 2EM2A 3WTUC 1YTYA 4BDZA 4GRIA 2CV0A 2ENHA 2Y31A 2GOXB 1I27A 3WHCA 5L3DA 3DFGA 3BR1A 3I0TA 4IQ4A 1TT0A 3FMQA 2EH3A 2L7ZA 2MD0A 1LPQA 3IC7A 2YTOA 5DCMA 3KYCB 3AL0C 1O7FA 2ZJQF 1HF0A 5KNLA 3TQMA 2O5RA 4AQYE 2VQHA 2KDOA 2RQPA 2EJ4A 5FB2A 1XGOA 4LF5E 4DBRA 4AIHA 3X2QH 4KDPA 2MW8A 3HRUA 3ONQA 5K5OA 1WZ2A 1IDYA 1F5TA 1HNZE 2IGOA 1SD7A 4RAZA 1R23A 3H0GJ 3CJRB 4B1RA 4CYCA 3BP8A 1SD4A 1VQ8I 3PQJA 2M34A 3KEYA 3RQIA 1Z6RA 3M1EA 3BTJA 4BBRJ 2QSHX 3GZ6A 2P81A 3E7LA 4R8OA 4ZDLA 1MBEA 4KMUX 2Q8UA 3KP5A 3K2AA 2AS5F 3IWBA 1DQUA 1J26A 1ZGAA 2ME0A 2NOJB 3LNQA 2IP2A 2QQ8A 4AM3A 2PLYA 4HLXA 1TC3C 1GZ6A 2BHZA 3CC7I 4CZCA 3ZXSA 2DPUA 2EOFA 3E5QA 4BEHB 3DTEA 4BXXJ 3LL7A 4F93B 1XC5A 5E18F 4R2CA 4IL6C 3KPHA 3CUOA 3LA7A 4IKFA 5LLQA 2HU9A 3J81K 3OS1A 2YU9J 2ZXJA 1RUNA 4A3CJ 4XSXF 4M6VA 1FOYA 4E7LA 1C0WA 1VQ7I 4NXNE 2RKHA 4ABZA 2V26A 4HQEA 5TGTA 5J8CA 3G4SI 3FDYA 5IT3A 2P5VA 3W6JB 4ENMA 1Z67A 4IRIA 2QCOA 3HRSA 3HPZA 3TW7A 3N05A 3FHNA 1P6RA 4PJMA 3OR2C 4CCNA 3JSPA 4CCKA 2R7OA 3FM3A 1P4AA 4B09A 4HG2A 2EM0A 4FISA 4CO8A 3IAM2 2RV8A 2K5CA 1JT6A 1T08B 2IVMA 4UUTA 4IOCF 3RI4A 2I9IA 1Y1VJ 5M3MJ 1DPRA 4P5OA 2YUSA 4PDKA 5FO5A 4IEJA 4UVAA 5J3LA 1YJWI 1HDDC 4DGWB 1FZPB 4OIOF 3I5UA 1DP7P 3I3LA 4DV4E 1JUSA 5E1ZB 3IWZA 2PJRA 4JP0A 4DW6A 1P47A 1T8IA 1MSFC 5ILVA 3Q9SA 1DUXC 1K6YA 3CCEI 4DYCA 2EQ3A 4I09A 2LNBA 4BC9A 4B3ME 3RTRA 5JI6A 4CZZA 1T4OA 3VYTB 3TQNA 1J0RA 1SFXA 1DPUA 1A6QA 1AA7A 3IH4A 1TTYA 1SFEA 4C3JJ 2ZCWA 4U7BA 3M4OJ 4BQNA 1ODDA 3I53A 5ICFA 4EATA 1B8IA 4JI2E 1U0JA 4F6NA 4FCYA 2L2MA 2F2EA 3HOTA 4ENKA 1SD6A 5AC5A 2YX4A 3PNTA 1J7KA 2Z9OA 3PNVA 3VPRA 1RPWA 1XGSA 4WF2A 2QBYB 1P2FA 5IT9Z 2ELZA 1XMAA 2L6MA 5CVIA 1T33A 3HSEA 3VHTB 5DTDA 4EJOA 3EPHA 5F27A 2YTEA 4OAZA 4PSWA 4M3DA 2A69F 2BVMA 4Z2YA 1IUFA 4LK0F 2DO7A 2LK2A 4AIKA 4A5MA 4ZZLA 2W4SA 1KU7A 4IHTA 4YIRX 4UV9A 2L3JA 2K40A 1BBGA 1Z6TA 3LOCA 2M4IA 2HYGD 2CQQA 1XN7A 3TDZC 2DMIA 2RS6A 1UAAA 2DFIA 4XKBA 4XK4A 2EK5A 2V83A 2MFZA 1MJ9A 3R4KA 1R5ID 2K4BA 4G9YA 5CQEA 1G3TA 1U9OA 2E5NA 1IO2A 3SQNA 2L2OA 3RYPA 3FK6A 5LHIA 2OUMA 2GA1A 1Q1VA 3ZQGA 2EPXA 1PVEA 1HW1A 1IV6A 5H2FC 4Q4ZF 1UHSA 3VYXA 1UHWA 5L3FA 1BB8A 5HNHA 1RR7A 4U87A 2CW7A 1IZ1A 2DDBA 2EM5A 2YPNA 1KU9A 1LE8B 2FBKA 1OPCA 4XSZF 3L2WA 1X1CA 1ZR2A 1W0UA 2QSGX 4XKCA 3K4JA 4DR7E 4II2A 2B7VA 2F6CA 2M4GA 2DCEA 5DCFA 4M9VC 1RUOA 3R0AA 1ETOA 2M0MA 2MD5A 2EPZA 3OYFA 5B5EC 2QLZA 2EPNA 2D45A 3GTQJ 3K1MA 3GZNB 4NQWB 2R7ZJ 4AWXB 1H9GA 2IGMA 4O24A 2R7FA 4BEHA 2NVTJ 2F5EA 5CPRB 2R7XA 1BIBA 5IP9J 3F8BA 2HDDA 2W00A 2EMWA 1RKWA 2LH9A 1IUYA 5KL4A 4V2FA 5C4JJ 1BOBA 3FXLA 2VXDA 5DUKA 1WPKA 2GLOA 3KLNA 2VUMJ 2YTJA 2DA1A 2H36X 5IPAA 1VTNC 2VQEE 1KYWA 4B4CA 3UR3C 1KYQA 2MH2A 3MKWB 4DV0E 2VRDA 3A01B 3FF5A 2DAOA 3DTKA 1I1GA 4AU7A 2CWEA 2X6OA 3T0YA 3GTKJ 5JVGF 1F36A 4JI5E 5D5WB 3UKGA 2XAJA 3NEUA 4G12A 5JLXA 1Y1WJ 1ZH5A 5FJ8J 1YQAA 1YO5C 3B73A 4Q5SF 3ZCOA 4N9HA 4A3IJ 1QO0D 4BHPA 3AG4H 2R3SA 1ETQA 3E6BA 2A3SA 2KRFA 1IRGA 1UILA 3DLLF 3RIRA 1W36C 4ZYAA 2L9NA 2VE8A 1WSUA 2E1MB 2M45A 1A5JA 3E1SA 1HW2A 1NH3A 4OOGC 1OJLA 3V7RA 2HZDA 4MO7A 5EEAA 1OISA 1FLIA 2KLOA 5IP6A 1H0MA 1SFUA 4XOPA 2WC2A 2FOKA 3IHUA 1F2IG 1Z0XA 3M7GA 1UHMA 3QYFA 1YI2I 3FZVA 4XLCA 3ZMTA 3CP2A 5GAGJ 2NRAC 1KZHA 1I50J 3FKJA 1X49A 1D1CA 5GP9A 5D8KB 2V1XA 2D5VA 3I54A 5J40A 4DV5E 4XLNF 4MFEA 4AYBN 1R9TJ 2J7JA 5EZHA 3E0JB 3GUDA 3S2HJ 1IN6A 3OYGA 2DN0A 5B3SH 2DMYA 2B9DA 4D5CA 2EPPA 3HZJA 1W1WE 2RVCA 1DGRM 1VQMI 3F8CA 4ZDOA 2QBYA 4U0WA 4LF9E 1BW6A 3VYSB 2EN4A 3J80K 4C3HJ 2YTIA 4CH7A 4XBFA 2XSJC 1MGTA 5HLGA 3F8FA 1MMDA 3PNYA 3ZQCA 2EOZA 1S7OA 5HOOA 5A6KA 1JKOC 2MABA 2JA5J 4ZH4F 4EJWA 1B59A 3S16J 2KL4A 3WG9A 3JRDA 3H35A 1IN4A 1A31A 1WJCA 2DRPA 2JZYA 1USTA 4NUBA 5F1JA 4DYQA 4XLPF 3OYJA 1VQLI 1X1PA 5D5VB 1HSTA 3CC2I 1A1JA 1VFCA 3RPUD 2LCEA 2ODRC 1MW7A 2L3CA 1FOWA 4HX7A 1PUFA 4GKJE 2XC7A 4JI7E 2H1KA 3ADLA 2KT0A 1FJGE 5J4VA 2ADUA 2EMGA 2DLQA 4HX8A 1TP4A 2FE3A 3EUAA 3LSHA 4RAGA 5CYVA 2EMLA 2ECCA 1GXPA 4XRFA 2DT7B 2M7BA 1W7PD 3L7WA 1Z7UA 3BR0A 1TT5B 2LREA 4HV5A 4LD5A 4YFKF 3JRIA 3OYIA 4UNOA 3JTGA 4QLCU 3FXMA 1JE8A 4I02A 1LE8A 5EYRA 2CV2A 1BI2A 3DKXA 3IUOA 5HLHA 1T0FA 5IYDJ 2CG4A 2V6EA 1K7AA 3W6KB 2HYFA 2FQ4A 4HQMA 4L0YB 2VXZA 2LOOA 1OR7C 1LVAA 4X6AJ 4F9CB 3GTJJ 2CW8A 3J7AY 4NQWA 1OKRA 2BXYA 5FKLA 1YFHA 3PO2J 1BR4A 2PQ8A 4DR4E 3EPLA 3DXJF 2W7NA 1FYLA 2CQKA 3ZQQA 2N3GA 2EIJH 1TWCJ 5E8IA 1ERDA 2M5WA 3VK6A 1DP3A 1X58A 3KYLA 3FIWA 1QQIA 2OAZA 2ESNA 5LFAA 4XICA 4P78A 2IS6A 5AE2A 2JPAA 1KU2A 3VEPA 2GAUA 1IAWA 2EZKA 3KZIC 2EPKX 1QHGA 4DR5E 3A01A 3LFUA 2VE9A 1ZK8A 2WAQN 2Y9YA 3HPGA 3Q0WA 3OR1C 3K10A 3QU6A 4MTEA 2LR8A 2EL5A 2EIMH 3E6MA 4YY3E 2WZOA 4LGWA 3K7AJ 5D6FA 1SANA 3UNGC 3BZ6A 3LQRA 1U78A 2HQNA 1P4WA 4A5NA 1XMOE 2LY1A 2BXZA 4EM0B 4M3GA 5D8LB 2KOUA 2CS3A 3RDIA 5TSEA 3T1HE 4HBLA 3TGNA 1OQYA 1ZELA 2HQRA 4XORA 5EDNA 2E1MA 2YRKA 1MEYC 1ETVA 4YEJA 1LEAA 3QQAA 3U21A 3JRAA 2YU3A 2L7FP 4I6ZA 2OTLI 3W6VA 3S8PA 3CDIA 3S1MJ 4LLNA 2IPQX 4GXOA 2VLAA 5DV5A 1TQPA 1USSA 5HS7A 5IXMB 3HRTA 2VJIA 5DYMA 3B02A 4XOTA 5J6XA 3MVPA 4XKVA 5ED4A 4S0HB 2QM3A 2IS4A 2GQQA 3U9GA 1WVRA 1LJ9A 2FMLA 1HKQA 1W7PB 4DZJA 4RB3C 5TRDA 2L02A 1JJ6C 3HSRA 1GLNA 4QPOA 3AL0B 2WA0A 1MBHA 2COBA 1GVDA 3LFKA 4WK8F 4E7HA 1JT0A 3GTOJ 1KQ8A 1XMXA 3RKQA 1ZG1A 2A25A 2NVUB 2WBUA 2R7QA 2X9DA 3OV8A 4BKXA 2ELYA 2ZNZA 3OOUA 3S1RJ 1SD5A 4E7KA 3DLAA 1IV8A 4NBQA 4BMJA 4UB8C 5JHFA 2DA4A 3QYBA 3COAC 2HOSA 3VWBA 3H5AA 3CMAI 3WODF 4TV7A 2YSOA 2L7KA 4CA0A 4UUSB 1BJZA 5A2QC 1NK2P 5CLSA 3OYNA 1BA5A 1X6EA 3OSGA 5BPDA 4A3GJ 2KFDA 2N8GA 5A6BA 2WBTA 2HTJA 1GUUA 3CJQB 3GO5A 1CF7B 2L92A 2EORA 4YELA 1BN5A 1WHNA 1P9QC 2RNGA 2HNHA 1GT0C 2K9LA 1XPXA 4XL9A 2BYVE 1BI1A 4BJTA 5HS9A 3FXOA 2DK5A 2IJLA 4YFXF 5FLXC 3S3OA 2MYSA 4I99C 4BHBA 1HSJA 5BPIA 3MSWA 2NNYA 4MQ9F 4F54A 2EMAA 2XGDA 2HVQA 2UXXA 2YPRA 4ZJZA 4PSXA 4D9JA 4PJJA 2LLKA 3QPHA 3ZN0A 3BTCA 4I8OA 5HS8A 4NNJA 4FHTA 3SZTA 4EJTA 2R7TA 2JOBA 2PMHA 3H3VK 1X4OA 2PJPA 2K9NA 2O0YA 2Z3YA 3VB2A 5F0HA 4ZYEA 2KQRA 2LVHA 1NHAA 1WI3A 2PBIA 4YHHE 1FT9A 1VQNI 4UB6C 3ABLH 1V3FA 1V5GA 2RGVA 4LG3A 1QPMA 4DV6E 2NUGA 2PMZN 1Z77A 5E3MA 4ZYDA 3ESWB 3IKTA 3GBGA 3TKYA 1FOXA 2YSPA 3P5JA 5BMZA 2EN3A 2FJ1A 1U5TC 3PIOF 2GOMA 2E19A 3QOEA 1VQPI 2LO3A 3SHFA 5CFFE 2WY7Q 5AASA 1X3ZB 2UWMA 4L9VA 3DV8A 5EF6A 1JTYA 3CF2A 4A0XA 4JI3E 3QPSA 2HXOA 3TEDA 1O0WA 2EM9A 2LMZA 1TWGJ 2JPCA 3FISA 2M30A 5IY5H 4OMYA 4DIQA 2EN7A 4RAFA 1UJ8A 2YTPA 4UUVA 2A07F 4WXDA 3H92A 2KMUA 3O3KA 4M6YA 4J19A 3HOVJ 5EGOB 2P6SA 4B44A 2LSOA 4QPQA 2ELKA 2EBIA 3CCQI 2Y75A 3LSIA 1PDAA 3RQ4A 1G2HA 2FRHA 3K1NA 3CJTB 3GCMA 2EOMA 3ADJA 3DPTA 3ISPA 1Y8RB 2DB2A 2RSMA 2BEOA 3OIOA 2EOSA 2QA4I 3HEFA 1QPIA 1SMTA 2I5UA 3OY9A 2LKSA 3U1DA 2JY9A 2E1NA 3LAPA 4LF4E 5F1RA 1S6LA 2M0CA 1BBOA 2E1OA 3EUHA 3Q0UA 3SXYA 3TBIA 3FMSA 1G2FC 2L3DA 2ZSIB 1ULYA 4DV2E 3M3YJ 1P7JA 3J81C 4P55A 4LLLA 3GTMJ 4A3EJ 3DEWA 2DMUA 1SVMA 3C2GA 3G1OA 3K4NA 1W36D 1TLHB 2BOLA 2QVOA 2L9VA 3HHGA 2FBHA 2O6GE 2BE5F 1YE9A 3GXOA 1ORKA 1N25A 1W7PA 2DFEA 1D1BA 1Y6IA 1MMNA 5DD8A 2R0QC 4KN7X 1MJBA 4EM2A 1JGGA 1DI2A 4N4OB 4Q48A 3G6EI 2VQCA 2IGKA 3T8TA 5EEHA 1ZYRF 2Z16A 5AONA 2QWWA 2V9KA 5D4RA 2OBPA 4HYEA 2Y0SA 3RKWA 4ZYGA 1TL8A 1R71A 2OU2A 1IN8A 2BW3B 2EOIA 2LTRA 3KYDB 2HKOA 4PCQA 1J09A 2FNAA 4C30A 3PL8A 1R6RA 2EMHA 3FXJA 1L4SA 3VSLA 1ZGJA 4E70A 4UUSA 3L2RA 1LLMC 1EV7A 3O2PE 3HOWJ 5FD6A 2EIKH 2LFBA 4OU0A 3R61A 1I6XA 4RS8A 3BIDA 4GFBA 1OMIA 4M73A 1IDZA 1J5EE 2LE2A 1JI8A
chains in the Genus database with same CATH topology
2VBZA 4BAYA 1CF7A 3V8KA 3NRVA 1RNLA 3I64A 4BQAA 4KA4A 4G6QA 5LRRA 1CGPA 4LG0B 1FWZA 3WU1B 2P6TA 2XUBA 3M8EA 3LA2A 4KICA 1R7JA 2UXNA 1LDDA 2COMA 2IT0A 2V79A 3HTUA 1U3EM 3KEOA 3DQVC 1FBQA 1AWCA 2JSCA 4EGZA 2KIMA 2VN2A 2K86A 4BYYA 1L0OC 4KUMA 1J5YA 4KIFA 3R0JA 1I5ZA 2ZBKA 4RAYA 2GWRA 4WWCA 3I59B 1HKTA 4KNYA 2MBFA 3ULQB 1S29A 1BI0A 1D3YA 1RIOH 2XKPA 3ABTA 1ZRCA 4CYDA 4GO1A 1K79A 3EYYA 3MAJA 4MEXF 2BGCA 2H6CA 2VBXA 3MZHA 1WRJA 5H6QA 3MFKA 4FT8A 2EA2A 1L3LA 3WGIA 1XDUA 3DEUA 2A6EF 4ESBA 5ILUA 2MLKA 3HSFA 4WCGA 2XVCA 3QP5A 3MQ0A 1XGNA 2KIUA 3DKWA 1GVJA 3BDDA 1R1UA 1IW7F 1E17A 4Y15A 5ICCA 1YW7A 2HFHA 4LB6B 3HYIA 2W25A 2J5OA 1HBXG 4P9FA 2ELHA 2D2WA 2P5KA 3HOSA 4M74A 2DBBA 1HQCA 3RYRA 4Y13A 4A2UA 1H9TA 2HOEA 2L4AA 4A6EA 2BBYA 4CICA 3KP7A 2B0LA 1TW2A 3Q5FA 4IRGA 2W84A 1R5GA 1LNWA 2ETHA 2EFWA 4B8XA 1T39A 1SAXA 4RGSA 4RB2C 4HX4A 2WTEA 3LSTA 3C1DA 1BC8C 1ONVA 1D8KA 3Q9VA 4DNCA 5CVRA 2LDUA 5FFXA 5LEJA 2GIVA 1REPC 4LLGF 4N9IA 5LHHA 4I2OA 1IF1A 2XGXA 2FSWA 4HF2A 1KYZA 3CO7C 2OZ6A 2G9WA 1J9IA 1JHHA 5HVQC 2XASA 2MA3A 3I71A 2RN7A 1IRFA 4CXFA 2MC3A 3ZN1A 1KU3A 3HIFA 3J80Z 1XSDA 4YIIA 2M87A 2HDCA 2IRFG 4KFCA 1F4KA 2QZ8A 3JSOA 3ZMUA 4HDVA 2OA4A 4YIFA 3MWMA 1LDJA 1W5TA 2Y0MA 3QP6A 3DF8A 2CYYA 2RDPA 3MCZA 4YFNF 2Q0OA 6PAXA 1KQ9A 2W24A 2OD5A 4RB0A 3TDUC 4WX9A 2JT1A 5DUIA 1XDSA 1KQ0A 2M1BA 5L3BA 2DTRA 4P96A 2ACJA 4JQFA 4RGUA 2EFPA 3C3WA 2Q8KA 1Z9CA 3GWZA 2PEXA 3LAJA 4HA8A 5DEQA 4NHJA 4U7DA 3WE3A 2O61A 1X3UA 5E17F 1OR7A 2A5YB 2K02A 2XIGA 3HTSB 1U5TB 4ETSA 2VC0A 3G3ZA 3F22A 2VC1A 4ON0A 1WKMA 3K1PA 3L2CA 2K27A 4L9NA 1MZBA 3P9IA 4RGXA 5FD5A 1XD7A 4OMZA 1IN7A 1G3SA 4ASNA 5K1YA 2C6YA 1ZLKA 1HW5A 3ZMVA 1S3JA 1IXSB 3KZZA 4MTDA 5KVRA 1ZN2A 3WTSC 5L3CA 4OINF 1R1TA 1R1VA 2PG4A 1BM9A 5DD4A 5HLIA 3F6VA 3L9FA 5L3EA 4UHTA 5BOXA 4DQ2A 2FMYA 3ELKA 3F8MA 2A68F 2WV0A 4U88A 2DI3A 3LA3A 2PFBA 2LF8A 5CVUA 4OOIA 3ERED 1FC3A 4LFUA 5JFRA 1ZREA 1HKSA 1FSHA 5J8FA 1KGSA 5LGNA 1WWXA 2HZTA 5LGUA 2QQAA 2HWVA 2VONA 3FWEA 3ML6A 3IL2A 5HDGA 4G7ZF 2FNPA 1T2KA 4L0ZB 4A12A 5JVTA 3IRQA 2XAGA 3BJ6A 3GX4X 4UVCA 4R8HA 4OIPF 3WU0A 1K6OA 2HGCA 2DQRA 4PGHA 2H27A 2F5DA 3AAFA 3R60A 1QGPA 2XAFA 3K0LA 3S2WA 5TJJA 3F6OA 5LGTA 4F7ZA 2FQ3A 4QWQA 4LJZF 1G6NA 1STZA 5LHGA 4ENNA 3IWFA 3QAHA 1YS7A 2XV4S 1ZRFA 4U0VA 2VBYA 3R6SA 4O5VA 2EV5A 2VBWA 5D6EA 1PUEE 4EGYA 1MDMB 3D0SA 2DLLA 2R7DA 1KA8A 4WXCA 3RKXA 1U5TA 1R22A 3CTAA 3WTWC 4P9UA 2O03A 3F23A 1QNTA 4MGRA 4IRHA 4Q47A 5L3GA 2EA4A 2K4JA 4HLYA 3V4GA 1MKMA 1QZYA 5DCMB 5HDKA 2P5LC 1YG2A 3P7NA 3GFIA 2STTA 2FA5A 3EDPA 4L9JA 1SMYF 3EETA 2Q2EA 1YW9A 4IPAA 1FOKA 2J5PA 1Y0UA 1B9NA 3P9KA 1JGSA 3ZP5A 3TOBA 3M8FA 3BROA 1HXDA 3KP4A 4EQQA 5K5QA 1JHFA 1TQMA 1P4XA 2YSRA 1YS6A 2EFQA 4M9SA 3F21A 2A6HF 3F72A 1U2WA 3SZPA 3BOQA 3V8JA 5BS6A 2FEZA 4MHGA 2LKPA 3RPUA 1F1ZA 5A2QK 2DU9A 2WWYA 2O3FA 1QZZA 3VFZA 3JAMZ 1TQIA 3PFIA 2QENA 3E5XA 3KCCA 1E2XA 1W4MA 4RB1A 1JXSA 4BXUA 4HOBA 1WQ2A 5FLXK 3KETA 2VOPA 1S7AA 2W57A 3ROUA 2E1CA 2D1HA 3RJPA 4G94A 1ZG3A 4M9XA 4KN4X 1FBUA 5JR3A 5K5RA 4CGZA 3WTYC 1LB2A 3H3ZA 2Y48A 4EM1A 2FXAA 4LK1F 4EJUA 1AOYA 2V1UA 4IHSA 1XCBA 1MDMA 2KJCA 2HS5A 1S8NA 4BHCA 3LQQA 2QYOA 3CJNA 3I58A 2NNNA 5E20A 3JAMK 1TW3A 2D1VA 5BQTA 4ZZDA 3CUQC 3K69A 2E7XA 2O8XA 2M8EA 2V1DA 4KYWA 1IXCA 4S05A 3ZQ7A 3FXQA 2VODA 3T5XA 2EV0A 4IXAA 1R36A 3CLOA 1R00A 4AIJA 3WGGA 2H09A 2V6CA 4A0YA 4PGGA 4I98B 3H3UA 3KP3A 3HRMA 4Y17A 3QOPA 3M9AA 3GFJA 5JHUA 4G7OF 2EFOA 4L9TA 3BPXA 1FYKA 3QPTA 4R79A 2ZO4A 4EJVA 4R1HA 5F6FA 2LF7A 5CVJA 3GFLA 1U8RA 4HW0A 3J7AO 1J75A 3EYIA 3VODA 2UZKA 4AVPA 5FGMA 2K7LA 4EV0A 4HAMA 1XB4A 4HF0A 5DDGA 1BC7C 5HDNA 1FX7A 2EV6A 4MEYF 4ENJA 4A0ZA 4UVBA 2E7WA 1GHCA 1G4DA 3FXRA 4JK1X 2OQRA 4KMFA 4IF4A 3CO6C 1FP2A 1FYMA 4YG2F 3F3XA 1YLFA 3SFZA 4LG0A 4G8XA 3E5UA 1MD0A 2Z5UA 4GYIA 3ZMDA 3EQLF 2EB7A 4I0AA 2X4HA 5E1XA 4L5JA 2CFXA 4LMYA 3LWFA 4RGRA 2GXGA 1T6SA 1I1SA 3K9TA 3FX3A 2HEOA 1XSVA 2CO5A 3GYHX 4FX4A 2CGPA 3WGHA 4I7HA 3I59A 1FNNA 3N4MA 1O7LA 2PMUA 4I0BA 2Z33A 3ECOA 1ZHFA 2XHKA 3DPLC 2GZWA 1XGMA 3FHZA 4A6DA 3QRFF 3TOAA 2A61A 5IT9K 4EVIA 4IVNA 1GXQA 3IKVA 1ON2A 3VOEA 3GFMA 5AIPA 1P92A 3REOA 3KZYA 1ZLJA 1UFMA 4KT5C 1QBJA 3E97A 4UV8A 4AD9A 2CSOA 1RI7A 5E1WA 4GGGA 3TO7A 2MLGA 1A04A 3FMRA 3TO9A 5ILSA 1F9NA 2DW4A 5KK1A 3E6CC 2STWA 5LRSA 2QQBA 4HDUA 4H0EA 3ZMZA 2KIFA 2X0LA 2OZUA 1D8JA 5F64A 3OOPA 1FSEA 4HZFA 2FF4A 4ZYHA 2NAZA 2NYXA 3L00A 3BWGA 4WXHA 3KLOA 4BNCA 2EFNA 3BJOA 1J59A 2L4MA 1OYIA 3K2ZA 1TBXA 2RNJA 3ECHA 5AIQA 4MQVA 3MZYA 4M72A 4CDGA 2ISZA 4S04A 1UB9A 5LEKA 4LB5A 4OIQF 2PI0A 2F5CA 3CDHA 3KP6A 4ESJA 4D0PA 1BI3A 2JPBA 3PQKA 2JRTA 2AXLA 1B6AA 2GA2A 4FX0A 2ZKZA 4MNUA 3WTZA 2XRNA 1K78B 1ZRDA 1B9MA 2ZJ2A 1B4AA 3MEXA 3BJAA 2V9VA 2H94A 3F8NA 2XROA 1IXRC 3L09A 1XSXA 3WTXC 2FBIA 4UXNA 3U2RA 2MH9A 1Q1HA 3D5LA 2XAQA 2VT2A 2F5FA 3FXUA 3RKYA 1FPQA 1LDKB 2P7CB 3HUGA 1O3TA 4G7HF 5ICEA 3GLXA 2TDXA 2IA2A 1BIAA 2RC4A 3C18A 3ZPLA 2DQLA 4NB5A 3GW2A 1DDNA 1RZ4A 3NQOA 2KJBA 2FU4A 1G3WA 3E6DA 3T8RA 3KEQA 3HHHA 3QU3A 5E8GA 5EEGA 1FP1D 1IN5A 1ZARA 3RPQA 4G6DA 2DK8A 5ICGA 2EJRA 1O3RA 4PZJA 3KP2A 1PDNC 3E3VA 1V4RA 1LQ1A 2ZMEB 4KIBA 2ISYA 1ZAOA 3GVAA 3WTVC 3DP7A 3G73A 3KFWX 2IW5A 3TO6A 4I01A 1PP8F 4HV6A 1EH8A 3CUQB 1YW8A 5H6RA 1T38A 3ZMSA 2PN6A 5D5XB 3V7CA 4O6JA 1WI9A 2YR2A 3GZ5A 5FFZA 2KKOA 2DPDA 4M9ZA 2L54A 2GXBA 2L01A 3WTTC 3T1BA 3KE2A 5A2QZ 1K78A 2CW0F 4L5IA 1OYYA 3P9CA 5LBQA 3WE2A 3IRRA 3JTHA 2P8TA 3I4PA 1BBYA 3FM5A 1J2XA 2YX7A 5H20A 1O3QA 2G7UA 1O3SA 3BY6A 1TNTA 5FLXZ 3O6BB 1Z1DA 4O3MA 4U0YA 4OIRF 4M71A 1W5SA 3V8LA 1YYVA 2BV6A 2DT5A 2P7VB 4N0BA 3JW4A 2JTVA 1XCVA 1PP7U 1G3YA 2VOOA 5D5UB 1BOAA 1Z91A 4GCVA 1XMKA 4L18B 2ZNYA 1U6GA 1MJAA 1FBSA 1T98A 5D4SA 1EH6A 1Z05A 1FY7A 2NS0A 2QQ9A 2IA0A 1EH7A 5ERIA 1R58A 1ZG5A 4K2EA 2ZFWA 2VT3A 3GEZA 3C7JA 2HTSA 1O57A 2P4WA 3V7SA 4ESFA 4CHUA 4BH9A 3BPVA 2OQGA 2ZMEA 1UCRA 2XAHA 5CJ9A 1TNSA 1B1BA 4HF1A 2IA1A 2HR3A 2XKOA 2QUFA 2Z99A 5CVVA 1ON1A 1D5VA 4IJAA 2EWNA 4EMSA 3CUQA 3ABUA 2H6BA 1OYWA 4M6XA 2HKXA 4GYGA 4KIGA 3GF2A 4JBAA 3J81Z 2G7HA 1BJAA 1LEBA 1YIOA 2W85A 1R5HA 2ESHA 3N97A 3WTUC 1YTYA 1I27A 5L3DA 3DFGA 3I0TA 3FMQA 3IC7A 5DCMA 1O7FA 2RQPA 5FB2A 1XGOA 4AIHA 4KDPA 3HRUA 5K5OA 1F5TA 1SD7A 4RAZA 1R23A 1SD4A 3BP8A 3PQJA 1Z6RA 3M1EA 3GZ6A 4KMUX 3KP5A 2AS5F 1ZGAA 2IP2A 2PLYA 4HLXA 2DPUA 3E5QA 5E18F 3CUOA 3LA7A 5LLQA 3J81K 2ZXJA 1RUNA 4XSXF 1C0WA 2RKHA 4HQEA 5J8CA 5IT3A 2P5VA 3W6JB 4ENMA 4IRIA 3HRSA 1P6RA 3JSPA 3FM3A 1P4AA 4B09A 4CO8A 2RV8A 2IVMA 3RI4A 1DPRA 4P5OA 4PDKA 5FO5A 4UVAA 1FZPB 4OIOF 3I5UA 1DP7P 5E1ZB 3IWZA 5ILVA 3Q9SA 1DUXC 4I09A 2LNBA 3RTRA 5JI6A 4CZZA 3TQNA 1J0RA 1SFXA 1DPUA 1TTYA 1SFEA 2ZCWA 4U7BA 1ODDA 3I53A 5ICFA 2F2EA 3HOTA 4ENKA 1SD6A 2YX4A 1J7KA 2Z9OA 1XGSA 4WF2A 2QBYB 1P2FA 5IT9Z 1XMAA 5CVIA 3HSEA 4EJOA 4Z2YA 2A69F 4LK0F 2DO7A 4AIKA 4A5MA 4ZZLA 1KU7A 4IHTA 4UV9A 1Z6TA 2HYGD 1XN7A 3TDZC 2DFIA 2EK5A 1MJ9A 3R4KA 2K4BA 4G9YA 1G3TA 3SQNA 3RYPA 5LHIA 2GA1A 1HW1A 4Q4ZF 1UHWA 5L3FA 1IZ1A 1KU9A 2FBKA 1OPCA 4XSZF 5DCFA 1RUOA 3R0AA 2MD5A 2QLZA 2D45A 3K1MA 4AWXB 1H9GA 2R7FA 2F5EA 1BIBA 3F8BA 1IUYA 5DUKA 3KLNA 1VTNC 1KYWA 2MH2A 3FF5A 2DAOA 1I1GA 2CWEA 3T0YA 5D5WB 2XAJA 3NEUA 1ZH5A 4Q5SF 1YQAA 1YO5C 3B73A 4N9HA 1QO0D 4BHPA 2R3SA 3E6BA 2A3SA 2KRFA 1IRGA 3RIRA 2VE8A 1WSUA 2M45A 1HW2A 3V7RA 1FLIA 1H0MA 1SFUA 2WC2A 2FOKA 3IHUA 3M7GA 1UHMA 3FZVA 3ZMTA 2NRAC 5D8KB 2V1XA 3I54A 4XLNF 3GUDA 1IN6A 2RVCA 3F8CA 2QBYA 4U0WA 3J80K 4XBFA 1MGTA 5HLGA 3F8FA 1S7OA 5HOOA 4ZH4F 4EJWA 1B59A 3WG9A 1IN4A 2JZYA 1USTA 4XLPF 5D5VB 1HSTA 4HX7A 2ADUA 4HX8A 2FE3A 5CYVA 1GXPA 4XRFA 1W7PD 3L7WA 1Z7UA 4LD5A 4HV5A 4YFKF 4UNOA 3JTGA 4QLCU 1JE8A 4I02A 1BI2A 5HLHA 1T0FA 2CG4A 1K7AA 3W6KB 2HYFA 4HQMA 4L0YB 2VXZA 1LVAA 4NQWA 1OKRA 1YFHA 2PQ8A 3DXJF 1FYLA 2CQKA 5E8IA 2M5WA 1QQIA 2OAZA 2ESNA 1KU2A 3VEPA 2GAUA 1IAWA 2VE9A 3QU6A 4MTEA 3E6MA 4LGWA 5D6FA 3BZ6A 3LQRA 1U78A 2HQNA 1P4WA 4A5NA 4EM0B 5D8LB 3RDIA 4HBLA 3TGNA 2HQRA 1LEAA 2YU3A 4LLNA 2IPQX 4GXOA 5DV5A 1TQPA 1USSA 5HS7A 3HRTA 5DYMA 3B02A 5J6XA 5ED4A 2QM3A 2GQQA 3U9GA 1LJ9A 2FMLA 1HKQA 1W7PB 4RB3C 5TRDA 2L02A 3HSRA 4WK8F 3LFKA 1KQ8A 1ZG1A 3OV8A 2ZNZA 1SD5A 3COAC 3WODF 4TV7A 5CLSA 5BPDA 2HTJA 3GO5A 1CF7B 1BN5A 2BYVE 1BI1A 5HS9A 2DK5A 2IJLA 4YFXF 4BHBA 1HSJA 5BPIA 2NNYA 4MQ9F 2YPRA 2UXXA 3QPHA 3ZN0A 5HS8A 3SZTA 4FHTA 4EJTA 2PMHA 2PJPA 2Z3YA 2O0YA 3VB2A 4ZYEA 1NHAA 2PBIA 1FT9A 1V3FA 2RGVA 1QPMA 4ZYDA 3IKTA 3TKYA 5BMZA 1U5TC 3SHFA 2UWMA 4L9VA 3DV8A 4A0XA 2JPCA 2M30A 4OMYA 4UUVA 2A07F 4WXDA 3H92A 3O3KA 4M6YA 2P6SA 2LSOA 2Y75A 2FRHA 3K1NA 3DPTA 3ISPA 2BEOA 1SMTA 3U1DA 2E1NA 3LAPA 5F1RA 1S6LA 3EUHA 3SXY