4WXCA

Crystal structure of mycobacterium tuberculosis ogt-y139f
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGFGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxcA01
3SHFA 2QM3A 2P7VB 2PBIA 4B09A 4UVAA 2XROA 2VONA 4UVBA 1FPQA 1KU9A 1SFUA 4O5VA 2WC2A 4R8HA 2D1HA 2EK5A 3SQNA 3GYHX 4ZYDA 1DUXC 2WTEA 1X3UA 1OR7A 3NEUA 3TDUC 4IVNA 5TJJA 2ADUA 4H0EA 5CLSA 3P9IA 3HUGA 1YLFA 5H6QA 3EETA 3RKWA 3SFZA 1I5ZA 3IWFA 1J5YA 4WX9A 2NRAC 4EGZA 5HS7A 1YW9A 1Z6RA 3EQLF 5JVTA 2RKHA 1ZRCA 3RTRA 3TOAA 3N97A 1FOKA 1XGOA 3ZN0A 1G4DA 3C3WA 4HW0A 1VTNC 4L5IA 4PGGA 2MLKA 2KJCA 5KVRA 1XD7A 4IRIA 3LSTA 4HYEA 4MQ9F 3F23A 1BM9A 5LGNA 3O2PE 4KMUX 4WXCA 2QBYB 1ZN2A 2STWA 1TW3A 4LK0F 2FQ3A 3DPLC 3KP4A 1MZBA 2XGXA 4KNYA 5BS6A 2FBHA 3IHUA 3CUQC 2EFWA 2FE3A 1H9TA 3MQ0A 1DPRA 2XHKA 3CDHA 5E8IA 3J81Z 3GLXA 5LLQA 1RUOA 2RC4A 4ASNA 2MC3A 2CQKA 3I59B 1E17A 3HRUA 1KU3A 1P92A 3FF5A 1B4AA 5DUIA 4KN4X 1PUEE 5D4SA 1LDKB 1W4MA 2HR3A 5AONA 1B9MA 4HF1A 5LHIA 4RGXA 2MLGA 5L3FA 4Z2YA 1LVAA 5LEKA 4R79A 1R5HA 1IXRC 4GO1A 3FHZA 2FBIA 2CW0F 3LAPA 4HV6A 1RZ4A 3GFMA 4EV0A 4M73A 1SD7A 5ILUA 2LF7A 3WGHA 2DO7A 2Z33A 5ICCA 2DPUA 3TO7A 3ABUA 3RKXA 2DQRA 1NHAA 3IRRA 3H3ZA 3ABTA 4L0YB 2STTA 1KA8A 1W5TA 4G6DA 2ISYA 3U1DA 3V7RA 2EFPA 5AIPA 3R0JA 1DDNA 2BEOA 5D8KB 2DFIA 3TOBA 1XDSA 2L01A 4RGUA 1IXSB 1O3TA 3V7SA 3JAMZ 1RIOH 2OD5A 3LFKA 3RYPA 5FGMA 4R1HA 3CLOA 4CXFA 1OYIA 1T39A 1P4WA 1I27A 2Z3YA 2HKXA 3FMRA 3T8RA 2HWVA 3KLOA 1XDUA 4RGSA 1QQIA 5EEGA 4MNUA 1K7AA 3GVAA 1FSEA 3V8KA 2EA2A 3PQKA 2M87A 2HQNA 3F8BA 3QPTA 2UXXA 4ESBA 2XIGA 3WU1B 3E6DA 2PMHA 5F64A 5F6FA 1F5TA 5DYMA 2V1UA 3HHGA 1K6OA 1KYWA 2BYVE 4EM2A 4WCGA 1BBYA 1L0OC 4GCVA 4ZYHA 3WGGA 1LEBA 4G7HF 5DCMA 3M9AA 4XRFA 2HFHA 1T6SA 2QENA 2DW4A 2F2EA 1T98A 1BI3A 1E2XA 4M72A 3R0AA 2V1DA 3SZTA 2V1XA 5D4RA 3WTXC 5D6EA 1CGPA 3KP7A 5K5OA 2ETHA 2L4AA 4I09A 4LK1F 3IC7A 2AXLA 4A2UA 3HHHA 5E8GA 1QPMA 1KU2A 1Z7UA 1GHCA 2H09A 2CSOA 3KZYA 2IVMA 2FSWA 3ERED 3Q5FA 3MZYA 1ZGJA 2MA3A 4EJVA 3DV8A 3SXYA 4FT8A 2QVOA 3EUHA 3IWZA 3N4MA 1JE8A 3B73A 1PP8F 4LG0B 2ESNA 1IAWA 3E6MA 2PG4A 4U88A 1XGNA 2ACJA 2ZJ2A 2OZ6A 1LQ1A 2W84A 1B1BA 4HOBA 5D5UB 1TW2A 1REPC 1UHWA 2NS0A 2Y0MA 5BQTA 3RYRA 4BAYA 4N0BA 1ZG1A 1XGMA 2MD5A 5F1RA 1S29A 2K4JA 4M71A 4MHGA 3LA3A 1J9IA 3DP7A 2E7XA 1QBJA 3I4PA 1DP7P 4K2EA 1I1SA 2P5VA 2JSCA 3MAJA 1ZARA 2JPCA 1S7AA 5K5QA 4LB6B 4RB0A 4UXNA 5LHHA 1R1TA 1P4AA 1R23A 4I2OA 1F4KA 3CJNA 4JQFA 5FLXZ 4BHBA 3EYYA 1FP1D 2H94A 3F3XA 3WGIA 2PMUA 4U0WA 1PDNC 4OIOF 4AWXB 4N9HA 1TNSA 3BJAA 3BPXA 2Z9OA 1YW7A 2L54A 3SZPA 4KT5C 1L3LA 3TGNA 3RDIA 2IPQX 5JR3A 3T8TA 4M6XA 1U6GA 2BBYA 1MDMB 5L3BA 4HX8A 2BE5F 2M45A 2ZBKA 1ZRFA 1D8JA 3TDZC 2DLLA 3K9TA 2RVCA 5FD6A 1U5TB 5A2QZ 1KU7A 3ISPA 1FYLA 1KQ9A 4P9FA 2L02A 4U0VA 1ZLJA 4BHCA 2E1CA 4AVPA 1XSVA 1K78A 2D45A 2E7WA 3CUOA 4KIBA 4U7DA 2FRHA 3WU0A 1J59A 3V8LA 1U2WA 3ZMZA 2F5FA 3HIFA 5ILSA 4F7ZA 2QZ8A 1BI1A 1RNLA 3BY6A 4GXOA 5D5XB 1V4RA 1ULYA 3RPQA 3VEPA 4HX7A 4OMYA 2EB7A 5L3CA 2XASA 1R58A 1O3SA 1KYZA 4RAYA 1IXCA 2GXGA 2LNBA 3F6OA 2W85A 1T0FA 2GWRA 2W24A 4NHJA 1Z6TA 5E18F 2YPRA 1J7KA 4MEXF 5DDGA 1W5SA 4CICA 4MQVA 4RAZA 3ZPLA 2FU4A 2DU9A 5D5WB 4ENJA 3M1EA 2R3SA 4XSZF 1J0RA 4WK8F 3D5LA 3E5XA 4HX4A 3GUDA 3K1MA 3I58A 2VBWA 3DKWA 3I64A 2HGCA 4KIFA 1BC7C 4Y17A 4A5NA 1EH8A 2GZWA 2EFNA 4ZH4F 4ZYEA 5BPDA 2XAQA 2Y75A 1YIOA 3I59A 1I1GA 3GFJA 2KRFA 2XV4S 5IT3A 4AIJA 3H3UA 2VE9A 2DQLA 1RUNA 1H9GA 1S6LA 1ON1A 3CO6C 1YYVA 1UCRA 5AIQA 1IN6A 4YFXF 2A61A 2FF4A 4Y13A 1HXDA 1Z1DA 3LAJA 2NYXA 1XMKA 4GYGA 3LA7A 2JRTA 5ICEA 5CVRA 2K27A 3LQRA 4M74A 3K0LA 3F8MA 4LG0A 3KEOA 4XLPF 5J8FA 2VOPA 4P5OA 4CHUA 3WTSC 2MH9A 1JHHA 1IF1A 4L9TA 2M1BA 4GGGA 1G3YA 3HYIA 3PFIA 1ON2A 1OPCA 4PZJA 2XAGA 5LRSA 2JPBA 5FFXA 4XLNF 3Q9VA 4L0ZB 5H6RA 3TO9A 2FXAA 2VN2A 1A04A 3KETA 4L9JA 4AD9A 4YFKF 3U9GA 1YQAA 3GZ5A 4AIHA 2XAHA 1Z05A 2P5KA 4ZZLA 4D0PA 3BP8A 3MZHA 3J81K 4FHTA 4ETSA 1R1UA 1I6XA 2RNJA 1ZRDA 3MCZA 2C6YA 1XCBA 5FFZA 5CVIA 4HDVA 3RI4A 2ISZA 2IT0A 1STZA 3VB2A 2A6EF 5DCMB 1XB4A 3HOTA 2DBBA 3QPHA 2D1VA 4M9SA 3KP6A 3VFZA 2HEOA 1IRGA 1FY7A 1LJ9A 2VC1A 2ZO4A 1O3QA 4IHTA 3KLNA 1S3JA 1FX7A 1IUYA 5CVUA 3BZ6A 3GO5A 1WKMA 1ZGAA 2ZMEA 1UB9A 4BH9A 3ZN1A 5DV5A 2DAOA 2P4WA 3JSPA 2HYFA 1MD0A 2IP2A 2RQPA 3WE3A 1TTYA 4LLLA 2COMA 1KQ8A 3GFLA 3J80K 2PEXA 3P7NA 2E1NA 1HBXG 4KYWA 1IN7A 3RKYA 1B6AA 2VE8A 4EJTA 5ICFA 3WTWC 4UVCA 4CYDA 2ZCWA 1YW8A 5JHUA 2Y48A 3E97A 2RV8A 3ZMVA 2FOKA 1OYWA 4HBLA 4I0AA 2YU3A 3F6VA 2VOOA 3GWZA 4PCQA 2X0LA 1QZYA 5H20A 3JAMK 1DPUA 3T0YA 2HZTA 3J7AO 3ZMTA 2DK5A 1SFXA 4ON0A 5HS8A 3G73A 2H6BA 2TDXA 5HLGA 1ZH5A 3KP3A 4FX4A 3E6CC 1FLIA 3COAC 4L9VA 1C0WA 4XBFA 1G3WA 4HLXA 3R61A 2O3FA 4RB3C 5HS9A 4Q47A 5E17F 1ZG5A 3GXOA 5FB2A 2VC0A 3HTUA 2ESHA 1FP2A 5DCFA 2HTSA 1K79A 2KIUA 3REOA 2JT1A 2GA2A 2YR2A 5LRRA 1SMTA 1FZPB 3IKTA 1GXQA 3LA2A 1PP7U 4I0BA 4JK1X 2Q8KA 3ZMUA 3LQQA 3EYIA 6PAXA 1HW5A 2H27A 2HS5A 5HLHA 3KE2A 2O0YA 1BI0A 3E5QA 2YX7A 5ILVA 2A69F 3B02A 2IRFG 4HQEA 1ZREA 2OQRA 4O3MA 1BJAA 1ZAOA 1HKTA 2Z99A 2PI0A 3FZVA 4OU0A 2FA5A 1QZZA 1ONVA 2HYGD 4LMYA 4LGWA 2V79A 2CFXA 2MH2A 3HSRA 5EEHA 5L3GA 4KFCA 1S8NA 2YSRA 3FX3A 2PJPA 1HW2A 1O3RA 5LBQA 1TLHB 3RJPA 1LB2A 1USSA 3F8FA 5DEQA 2FBKA 2FNAA 4HZFA 4YIIA 3JW4A 2ZXJA 1WWXA 3OOPA 1TNTA 5K1YA 4M6YA 4G7OF 3FXQA 5LHGA 3DQVC 1EH6A 3U2RA 2NNNA 1WI9A 2CG4A 1MJBA 4BYYA 3W6KB 1XN7A 2O61A 4EQQA 3D0SA 3BWGA 1FC3A 1QO0D 3BJ6A 2QLZA 4P96A 2EWNA 5CYVA 1U3EM 1TQPA 3WTUC 3IL2A 1LEAA 4OINF 2GA1A 2J5PA 5D6FA 4UUVA 4G94A 5HOOA 3WODF 2Q2EA 2ZKZA 1TQIA 3QAHA 2KJBA 4EGYA 5FO5A 1U5TA 1BC8C 1YG2A 1XSXA 2V9VA 3R6SA 1V3FA 1U5TC 2W25A 2A3SA 3P9KA 3JSOA 3K1PA 5J8CA 5DUKA 1HQCA 1LDDA 4OIRF 3CTAA 3DXJF 4EM1A 4BHPA 1USTA 2M30A 4IJAA 3E5UA 4UV9A 4RS8A 3M7GA 2VT2A 2Z5UA 4ENNA 3HRMA 1R5GA 3CUQA 4M9ZA 2FMYA 2W57A 3K69A 5HDKA 2ZMEB 2A07F 2HQRA 2LF8A 2GQQA 1Q1HA 4EM0B 1W7PD 3NQOA 4UHTA 4A6DA 4P9UA 2VT3A 3HTSB 1F1ZA 2CYYA 3IRQA 2EV5A 2J5OA 3HSFA 2R7DA 1H0MA 4KA4A 3WTVC 3ZMSA 2GAUA 5E1ZB 4QLCU 4L5JA 5ED4A 4OMZA 1G6NA 1BI2A 2OU2A 3QRFF 2XKOA 3H92A 2K86A 1HKSA 2ZFWA 3MWMA 4ENKA 1YFHA 3TO6A 4HF2A 4TV7A 4EJOA 3EDPA 2VXZA 1WSUA 1FT9A 1W7PB 4MGRA 3GFIA 4L18B 2DPDA 3L9FA 1J2XA 1CF7B 2O8XA 3CUQB 3P9CA 4HLYA 3GEZA 4OIQF 1SFEA 1XSDA 2QBYA 2P6TA 2R7FA 4KDPA 4ENMA 4ESJA 2O03A 5JI6A 3KFWX 2PN6A 2XVCA 3GW2A 1SD6A 1XGSA 3C18A 4CGZA 4KICA 1P2FA 2CWEA 1IW7F 2QWWA 2OBPA 1SD4A 3E3VA 3ELKA 4WWCA 2A5YB 1R7JA 1FWZA 4HQMA 4M9XA 2KIFA 5BOXA 2UWMA 4ESFA 1BOAA 1G3SA 3BROA 1LDJA 2QQAA 4WXHA 4YG2F 1UFMA 3DEUA 1T2KA 4JBAA 5DD4A 4DNCA 1D5VA 2ELHA 2F5DA 3LWFA 1R00A 1RI7A 1O7FA 3WE2A 1ZLKA 5IT9K 3PQJA 1P6RA 1JHFA 4N9IA 4YFNF 2VBXA 4DQ2A 2K4BA 5L3DA 2IJLA 5HVQC 1G3TA 3V4GA 4HDUA 4IXAA 4BXUA 1ODDA 4I7HA 5CJ9A 1HKQA 4A0XA 3I53A 2EA4A 3L00A 2IA2A 3TQNA 4A0ZA 2O6GE 2VBYA 5E20A 3DF8A 2KKOA 1T38A 4MTDA 3BDDA 3T5XA 4U7BA 2M5WA 1SAXA 5FLXK 3K1NA 3KZZA 1J75A 1K78B 4HAMA 4A5MA 2H6CA 2G9WA 3K2ZA 5E1WA 3L09A 1WQ2A 2MBFA 2QQ9A 3KEQA 4I01A 3ULQB 1ZG3A 4Q5SF 1Z9CA 4WXDA 2OQGA 1QNTA 4IRHA 5JFRA 3MFKA 1D3YA 4LJZF 1MDMA 4MTEA 3MEXA 2EJRA 5IT9Z 4B8XA 3BJOA 3F72A 4CO8A 3FMSA 1MKMA 3HSEA 3ML6A 2XKPA 2RN7A 2EV6A 4PGHA 3BOQA 3QP6A 2OAZA 1YO5C 4I98B 1FYKA 1CF7A 2LSOA 3HRTA 3I71A 3FWEA 4S04A 1R22A 2CO5A 2FNPA 2OA4A 1W7PA 5L3EA 4OIPF 1O7LA 2LKPA 2G7HA 2HDCA 2OZUA 4G8XA 4WF2A 1JGSA 3I5UA 5LGTA 1XMAA 1EV7A 2Q0OA 4KIGA 2GIVA 3VODA 5KK1A 1IRFA 4A0YA 4HV5A 4G9YA 2X4HA 3E6BA 3ZQ7A 3DFGA 2QQBA 4KN7X 4RGRA 2A68F 4RB2C 1D8KA 4RB1A 3V8JA 2VBZA 2HTJA 2DT5A 2K7LA 1YS6A 1FBUA 4O6JA 2HOEA 2CGPA 1HSTA 4MEYF 1KGSA 2ZNZA 2A6HF 2ZNYA 1FBQA 5ERIA 4ZYGA 1BN5A 2DTRA 3BPVA 3RIRA 1YTYA 3J80Z 4EVIA 5A2QK 3S2WA 5LEJA 4LD5A 5E1XA 5ICGA 3TKYA 4E70A 1FBSA 5TRDA 1GVJA 2K02A 3QU3A 4PDKA 1AOYA 1R36A 5HLIA 5D5VB 1TQMA 3VOEA 2VODA 1OKRA 2RGVA 4LFUA 2D2WA 1Z91A 4CZZA 1HW1A 4UNOA 4Q4ZF 1BIAA 2UXNA 4EJUA 4U0YA 3HRSA 1AWCA 1P4XA 5J6XA 1BIBA 4XSXF 2P5LC 5CVJA 3WG9A 1S7OA 4IRGA 1Y0UA 2NNYA 2EFQA 3I54A 3ZP5A 1EH7A 4LB5A 2IA0A 4QWQA 3ROUA 4OOIA 3AAFA 4Y15A 5CVVA 1U78A 1IN4A 3I0TA 3W6JB 2BGCA 2DK8A 2JTVA 1SD5A 3F21A 3FM5A 3QU6A 5HDGA 1SMYF 5BMZA 1F9NA 2V6CA 3GZ6A 3F8NA 3T1BA 1IZ1A 2QUFA 3R4KA 4BNCA 4CDGA 3C1DA 4P55A 5D8LB 2F5EA 5DD8A 4G6QA 4HF0A 4YIFA 2EFOA 3CO7C 4IHSA 3KP2A 3FXRA 3FM3A 3G3ZA 1ZYRF 3GX4X 2YX4A 4NB5A 4ZZDA 3O3KA 4G7ZF 4Q48A 2P6SA 4A6EA 3FMQA 3IKVA 1YS7A 5K5RA 3L7WA 1FNNA 2F5CA 4LLGF 4BQAA 3QP5A 4A12A 4L9NA 3M8EA 1U8RA 2L4MA 1IN5A 4KUMA 2XAJA 3KCCA 1OYYA 1TBXA 2PFBA 1LNWA 2G7UA 3GF2A 2DI3A 3ECOA 5LGUA 1XCVA 1IN8A 2QYOA 1QGPA 4IPAA 2WV0A 3KP5A 2GXBA 1WRJA 3F22A 2WWYA 3FXUA 1B59A 2IW5A 2XUBA 3L2CA 3WTYC 3ECHA 3JTGA 3HOSA 3F8CA 2EV0A 4EJWA 4FX0A 3O6BB 5BPIA 2HKOA 2XAFA 1FYMA 4GYIA 2BV6A 2IA1A 1MJ9A 5HDNA 4AIKA 3RPUA 2RDPA 2FEZA 1HSJA 1ZHFA 2XRNA 1OMIA 4KMFA 3WTZA 2AS5F 3DPTA 4LLNA 1O57A 2M8EA 2KIMA 1FSHA 3M8FA 1GXPA 4UV8A 2LDUA 1KQ0A 2L3DA 2P8TA 1B9NA 2PQ8A 3R60A 3C7JA 4NQWA 3WTTC 4I02A 2PLYA 4HA8A 2FMLA 2UZKA 1MJAA 4IF4A 3JTHA 5FD5A 1UHMA 3ZMDA 3QOPA 2JZYA 3NRVA 2B0LA 2NAZA 1R1VA 4EMSA 3Q9SA 2P7CB 3V7CA 1MGTA 1JXSA 4S05A 3OV8A
chains in the Genus database with same CATH superfamily
3NWTA 1IBLE 3SHFA 2QM3A 2P7VB 3HOWJ 2O7OA 2RSMA 2ZSHB 2BY0A 2PBIA 4UVAA 4B09A 3LFUA 2XROA 2VONA 5GADJ 4UVBA 3T1YE 1FPQA 1MSFC 3H36A 1KU9A 3EQ1A 1SFUA 2KOUA 1YOVB 1T8IA 5FRMA 3TW7A 2EPPA 4O5VA 2WC2A 2YTDA 1H88C 2EWLA 4TUIA 4R8HA 2HXIA 2D1HA 2V83A 3IUOA 2EOMA 4GFBA 3DLLF 3MHSC 3HBLA 3G1OA 4Y33A 2R5YA 3FIGA 3EPHA 2YTFA 2EK5A 2EN4A 3GTPJ 4JI0E 1Y56A 1YRNB 3SQNA 3GYHX 1IV6A 4ZYDA 1DUXC 3MHHC 2WTEA 1X3UA 2K9SA 3MKYB 2EOEA 2V86A 1OR7A 1X49A 2R5ZA 3NEUA 2DMNA 1WJBA 4M3GA 3TDUC 3JTZA 3HOUJ 4P7DA 2V26A 4IVNA 2MC5A 5TJJA 5EZHA 3A2KA 4DBRA 2ADUA 2DA2A 4H0EA 4L8NA 5CLSA 3CCLI 3U21A 3P9IA 5IYDJ 1VQKI 3HUGA 2B9DA 4F9AB 1G2FC 5AE2A 2JXPA 1YLFA 5FKOA 5H6QA 3EETA 3RKWA 1Y1WJ 3SFZA 1I5ZA 2KHMA 1TWAJ 1JKRC 3HUGB 3IWFA 1GDTA 2JWTA 1J5YA 4WX9A 3D1NI 4EGZA 2NRAC 4MLVA 2EPAA 2Y69H 3QYBA 3OSGA 5FRNA 5GAEJ 1JKOC 1X1AA 2EN3A 3BQZA 5HS7A 1YW9A 1Z21A 2LY2A 1Z6RA 3EQLF 3OYGA 3J7ZI 1MMNA 2K9MA 5JVTA 2RKHA 4ANJA 3JRBA 1ZRCA 1MMSA 3LLHA 2RREA 2Z1DA 2HOSA 2R5ZB 1OCCH 4BQOA 2UUBE 4R2QA 1BA5A 3RTRA 3TOAA 3DTKA 2EZHA 3N97A 1FOKA 4A3EJ 5TGTA 4DIQA 1XGOA 3ZN0A 2JVHA 3E1SA 1G4DA 3C3WA 4A3GJ 4HW0A 1VTNC 4LF9E 4L5IA 1V5FA 4PGGA 2JA5J 2MLKA 3K70D 3FISA 2KJCA 5KVRA 3K4NA 1AAYA 4PFPA 1XD7A 3PFYA 4DV5E 5GAGJ 3OS1A 2A6TA 1Z1BA 2LREA 2N8GA 3DTEA 4IRIA 2XPWA 2IEKA 3LSTA 4HSRA 4HYEA 2ZC2A 5JLWA 1X48A 4C2TA 4MQ9F 2LFBA 4B3AA 3I55I 4DZPA 5F0CA 2NA2A 3F23A 3BZKA 1OCRH 1BM9A 1XMXA 2ME6A 5LGNA 3O2PE 3HOVJ 4KMUX 4WXCA 2UXBE 4N4NB 2QBYB 1ZN2A 2EM7A 2STWA 4X66E 1MBKA 1TW3A 4LK0F 2X48A 2FQ3A 1IRXA 3HGGA 3DPLC 3KP4A 3KWRA 2FX0A 1MZBA 2XGXA 5J47A 4KNYA 5BS6A 2FBHA 5AASA 1I3QJ 4KZSA 2LBFA 2EMLA 1U0JA 2VIXA 3IHUA 3ZQHA 1B72A 2CS3A 3BR0A 2EN2A 2ELJA 3CUQC 5J1UA 2EFWA 4ZTJA 2FE3A 3GBGA 3MQ0A 1DPRA 1NH3A 1H9TA 2XHKA 3CDHA 5E8IA 1A1JA 1S5LC 2DMTA 3J81Z 4JI7E 2I5UA 4F93B 3GLXA 1JTYA 2NVQJ 4W97A 5LLQA 1VQ6I 2DMYA 1RUOA 2RC4A 4ASNA 3LSKA 3EUHC 5C44J 2MC3A 4PUSA 2E2HJ 4PK4A 1BR1A 2CQKA 3I59B 2TRTA 1E17A 3HRUA 1KU3A 3CCRI 2JVAA 1OJLA 1SVMA 3NAUA 4UB6C 1P92A 3FF5A 1B4AA 2DLQA 4RA2A 4LTYA 2MGQA 3HOZJ 2EM6A 1YJNI 5DUIA 4KN4X 4BE0A 1PUEE 3KX2A 5D4SA 1LDKB 1W4MA 2HR3A 2JMWA 1B9MA 3MD2A 2CQ7A 4IQ4A 2Z2SB 5AONA 2L2NA 1QRYA 2X9DA 2VL8A 2HU9A 4XN3A 4HF1A 3S32A 2HI3A 5LHIA 4RGXA 2H1KA 2KRHA 2M3AA 3JRDA 2DB2A 2WY8Q 4II3A 2MLGA 5L3FA 2LTPA 3QPSA 1R49A 4Z2YA 3G71I 1LVAA 3ZCOA 5LEKA 4R79A 4BC7A 1R5HA 3FXLA 4L5EA 1IXRC 2H1LA 2L9SA 1D0ZA 2W7NA 4JYKA 3GTOJ 1TN9A 2Q8UA 4GO1A 3FHZA 2A05A 2EPOA 5KL6A 1AKHA 2KDZA 2WAQN 2DDBA 2FBIA 2CW0F 5HNFA 1G8XA 2DRPA 3LAPA 4HV6A 2J7JA 3J7AG 1RZ4A 3GFMA 3IAS2 4EV0A 4DV3E 1BR4A 4M73A 1SD7A 4RM3A 5ILUA 2LF7A 3WGHA 3TL4X 2DO7A 2Z33A 2EM4A 5ICCA 2DPUA 3TO7A 5KL3A 3PO2J 3ABUA 1SAUA 3NARA 4BL0B 1RR7A 3RKXA 2DQRA 2QKMB 1NHAA 4HSTA 1MNMC 1A5JA 3CF5F 1ZBTA 3QPLA 3IRRA 3H3ZA 3ABTA 3K4CA 1MW7A 4L0YB 4C3HJ 2STTA 1KA8A 2DFFA 1W5TA 2DJNA 4G6DA 1HF0A 2ISYA 3U1DA 3V7RA 1KYQA 3OYKA 1VQOI 2EFPA 5AIPA 3R0JA 1DDNA 2BEOA 3S17J 5D8KB 2DFIA 5AE1A 3TOBA 1XDSA 1W5CC 2L01A 4LG3A 4RGUA 1IXSB 2L7MP 3PSFA 2WAFA 1N77A 3OSFA 1O3TA 2L5QA 3RQIA 3V7SA 2KFDA 3ADJA 3HJEA 3PNVA 3JAMZ 3CC2I 1RIOH 5IY5H 2OD5A 2JUCA 2N3HA 1X47A 3LFKA 2Q2EB 3RYPA 3ESWB 5FGMA 3ECRA 4R1HA 1WH7A 3CLOA 4CXFA 1OYIA 3PM1A 1T39A 1NEIA 4B4CA 1P4WA 1I27A 2Z3YA 2LV2A 2L9RA 5J40A 2HKXA 2DXIA 5FKKA 3FMRA 1T95A 3PIOF 5E3MA 3T8RA 1UILA 4ZJZA 2KIQA 4JP0A 1JUSA 2DA5A 2HWVA 3KLOA 1XDUA 4RGSA 1S7EA 2UUAE 2E5LE 3IH4A 1QQIA 1DU6A 2CSHA 5EEGA 4CCKA 5LL6R 2KMUA 2DMQA 4F55A 4MNUA 1RKTA 1K7AA 4DR7E 3GVAA 3PUBA 1FSEA 3BTCA 3V8KA 2EA2A 3PQKA 2M87A 2HQNA 2ZSIB 4PJMA 3F8BA 2VXDA 1NG7A 3QPTA 3FDYA 2UXXA 2DA4A 4ESBA 3ZQCA 2XIGA 3BBGA 3WU1B 1X4PA 3E6DA 2PMHA 5F64A 5F6FA 1F5TA 2ENCA 4A3KJ 5DYMA 1AKHB 1DQUA 2V1UA 2L3CA 3HHGA 4FE7A 5EYRA 5EGOB 2FOWA 4E4HA 2N3GA 1OISA 1K6OA 1KYWA 2WBUA 1VFCA 2BYVE 4EM2A 3F6HA 4WCGA 1BBYA 3ADGA 1L0OC 2UV1A 2YTJA 1A1IA 1XPXA 2KHXA 2HDDA 3KPHA 2EH3A 3GZNB 5DTDA 2ZJPF 2OF7A 2RAEA 4GCVA 4IHXA 3SFIA 2XF6A 1WJAA 4XRSA 4ZYHA 3WGGA 1J5EE 2XGCA 1TF6A 4JX5A 1LEBA 4HG2A 4G7HF 2VQGA 3VYYA 4K0KE 2EOZA 5DCMA 3M9AA 4XRFA 2HFHA 1T6SA 2QENA 2DW4A 3S1NJ 2F2EA 2M34A 3CCMI 3K4JA 1T98A 1BI3A 2JA2A 4F3QA 1E2XA 1MBJA 4M72A 3FKJA 3R0AA 2V1DA 2JQ7A 5KAFC 3SZTA 2V1XA 3PSIA 5HODA 4X0GA 3L2WA 3C2BA 3RZDJ 2YSOA 3OYLA 5D4RA 4M3DA 3WTXC 1YX5A 5D6EA 5KHDA 3C2GA 2LYCA 3ZQIA 2LO3A 1H8AC 1CGPA 1UAAA 3HPSA 2EPMX 3KP7A 2DOFA 1ETKA 1EKZA 4BY1J 5K5OA 2ETHA 1IMUA 2L4AA 2EINH 2IGKA 4I09A 4LK1F 2DFHA 2O8KA 3IC7A 5J3LA 9ANTA 1VNDA 2AXLA 4A2UA 3HHHA 5E8GA 4QIWN 1POGA 1QPMA 1KU2A 1Z7UA 1GHCA 5A6KA 2E35A 5BNGA 1QVUA 2H09A 3HM5A 1RR8C 3DKXA 2CSOA 2MC6A 3M07A 1X1CA 1AU7A 3KZYA 2JA7J 3GTMJ 4R2RA 2X6WA 1Q1VA 2IVMA 2FSWA 2VASA 3ERED 3Q5FA 3MZYA 2Y0SA 1ZGJA 3CC4I 3BF2A 2MA3A 2YRKA 4AIDA 4F6NA 4EJVA 3DV8A 2DYSH 3GTKJ 3SXYA 3DEWA 1WJFA 4F6MA 4YEJA 4FT8A 2QVOA 4XR6A 2EPRA 3EUHA 3IWZA 3VYSB 2BXZA 3K6GA 4RDUA 3N4MA 1JE8A 3HQ1A 3B73A 2CQNA 5IOYA 3V42A 1PP8F 3SDBA 1K4SA 4LG0B 2ESNA 4R03A 2VPRA 1IAWA 3E6MA 2HVQA 2PG4A 3OYIA 2WZOA 3H9GA 2M7AA 2XGEA 3EPZA 4U88A 2Y9YA 1FJLA 1WFXA 1MH4A 1VQNI 2E1MA 2VQFE 1A1LA 1XGNA 2NS7A 1BR2A 2ACJA 2ZJ2A 2OZ6A 2DMPA 3S1MJ 1LQ1A 2H36X 4BEHA 2ODRD 2W84A 1B1BA 4HOBA 4HEIA 2X6YA 2HHHE 2ZJQF 1T33A 5D5UB 2L8TA 2KZVA 4RAFA 1VQMI 2JPAA 4A3LJ 1PJTA 3LSJA 1TW2A 1REPC 1UHWA 2PRTA 1JTXA 2NS0A 1WHNA 2Y0MA 5BQTA 3RYRA 2JA8J 4BAYA 1O4XA 4N0BA 2XAUA 4E7SA 1ZG1A 1XGMA 2F4OB 2MD5A 4IS1C 5F1RA 2R1FA 4HRIA 2EN6A 2E34A 2MD0A 1S29A 2K4JA 4OOGC 3JRCA 1MEYC 4M71A 3VYRB 4MHGA 3LA3A 4BU2A 1J9IA 3DP7A 2E7XA 5EG0B 1QBJA 3ZOQB 2EPCA 2LP0A 3I4PA 5B66C 2EZLA 3PNYA 1DP7P 4YY3E 4K2EA 2K7IA 1I1SA 2P5VA 5C4XJ 4M3FA 2JSCA 4PSXA 3JREA 3GTLJ 3MAJA 5H2FC 1ZARA 1UHSA 3CMEI 2BOLA 2JPCA 1S7AA 1XX5A 5K5QA 4LB6B 4RB0A 4UXNA 5J1RA 5LHHA 3K4BA 4F9BB 4BCAA 2YUSA 4XK4A 1R1TA 1AHDP 1P4AA 2RNGA 3P1XA 2VKEA 2B7EA 2VQCA 2YU9J 3G1MA 1R23A 3CESA 4CH7A 4I2OA 1F4KA 2ZM6E 3FBIB 1N3GA 3CJNA 3HKZN 4JI5E 2QF7A 3HXLA 3H5NA 3C2HA 4JQFA 1MBHA 5FLXZ 3TW6A 4BHBA 2K3FA 2LOOA 3EYYA 1FP1D 2DA1A 2H94A 3F3XA 3WGIA 3S3NA 2M9HA 1JT6A 4B1RA 4M3BA 2I10A 3W2AA 2PMUA 2V7FA 4U0WA 1PDNC 3LMMA 2JN6A 4OIOF 4I8OA 5BR8E 4CSWA 4AWXB 1VQ4I 5EGOA 3WU2C 2IGOA 4N9HA 1TNSA 3DBHB 3OYAA 3BJAA 3BPXA 2Z9OA 1W36C 2FUG2 3BZCA 1YW7A 3M99B 1RKWA 2LBSB 2L54A 3SZPA 4DZJA 4KT5C 3HEFA 1TL8A 3AUZA 3AG3H 1L3LA 4BBYA 5K7HA 3AFHA 4X8WA 3TGNA 3ZR8X 4F52A 3RDIA 4MLQA 4IL6C 5EZGA 4X65E 1E0EA 3S16J 2IPQX 5JR3A 3T8TA 4M6XA 3LSRA 3LL7A 4N4OB 3L2VA 4X62E 1U6GA 5IYCJ 2BBYA 2V9KA 1MDMB 4GRIA 3TEDA 3M1CA 5L3BA 3G6EI 4HX8A 2BE5F 2DA6A 2M45A 2ZBKA 3H5AA 1ZRFA 4PJLA 4WPYA 5J1YA 2X1CA 1ETXA 5IP7J 1D8JA 2OCEA 4DUZE 1X4OA 3TDZC 2DLLA 3K9TA 2VQLA 2CV2A 3J7YJ 2RVCA 3CJRB 4FE4A 4IZZA 2D5VA 1WHUA 4N4RB 5FD6A 1U5TB 5A2QZ 1DQ3A 4Y4RA 1KU7A 5A6BA 5M5WJ 3ISPA 3UK3C 1FYLA 1KQ9A 1TWHJ 2BXYA 4P9FA 4NC7A 3J80C 2L02A 4U0VA 1X19A 1TWCJ 1ZLJA 4BHCA 3S15J 1GLNA 2E1CA 2EM8A 1YYOA 1WCMJ 4AVPA 4AM3A 3BG5A 1XSVA 1K78A 2D45A 4NC6A 2X1EA 2E7WA 3BLYA 3F9KA 3CUOA 1GV2A 2YU8A 4KIBA 4U7DA 2FRHA 3WU0A 3OYHA 3VPRA 1J59A 2M4IA 2R76A 3V8LA 1U2WA 3ZMZA 2F5FA 3HIFA 5ILSA 3KYCB 3VWBA 4F7ZA 1ZR9A 2QZ8A 3MKZA 1F43A 1BI1A 2OC6A 1RNLA 3LNQA 3BY6A 3HZJA 4KT6A 4GXOA 3OYMA 4Y52J 3HPZA 5D5XB 2LRSA 1V4RA 1ULYA 3RPQA 3VEPA 4XLEA 4HX7A 1X6HA 5KL2A 2LRDA 4OMYA 2IGMA 2HQ5A 4LF6E 2EB7A 5L3CA 1SANA 2XASA 1R58A 1O3SA 1KYZA 2MKNA 4RAYA 4KJZA 3DEEA 1JGGA 1IXCA 2EIKH 2GXGA 3DKYA 3A03A 3G4SI 2LNBA 3F6OA 2W85A 2EN1A 1A31A 1T0FA 3OL4A 2GWRA 1YRNA 3PL8A 3H0DA 1FTTA 2W24A 2FD5A 2O9LA 4Q28A 2IXSA 4C2UA 1Z6TA 5E18F 4NHJA 2YPRA 3F6GA 4FTHA 4NBQA 1D0YA 1J7KA 2OTLI 4Y7NJ 4DV6E 4MEXF 1R5ID 3OR1C 1Z77A 5DDGA 2CTDA 1W5SA 2L2OA 4R2AA 4CICA 4MQVA 4RAZA 3ZPLA 5B5EC 2BB8A 2FU4A 1JI8A 3K10A 2DU9A 5D5WB 4ENJA 1RRJA 1B8IB 3N05A 1PKPA 2WCC3 3QQAA 2WBTA 3M1EA 2R3SA 2NUEA 3BTIA 4XSZF 1J0RA 4WK8F 2K9LA 3D5LA 4A93J 3BR6A 2P0WA 4J19A 3E5XA 1I3AA 3M4OJ 1FIPA 2NXNB 4HX4A 3VHTB 2K85A 3GUDA 3I58A 3K1MA 2VBWA 3DKWA 3VK6A 3I64A 5IOZA 3SYTA 3ZQLA 4DR1E 2HGCA 1WH5A 1FOXA 4KIFA 3CCEI 1BC7C 4Y17A 4A5NA 1EH8A 2GZWA 2EFNA 4PFOA 4HNVA 4ZH4F 3W6VA 3DWLE 4ZYEA 1IJWC 1VF9A 4XQFA 2R7TA 4JX6A 5BPDA 2Y75A 2ZB9A 2XAQA 1YIOA 1EJ9A 3I59A 3PO3J 1I1GA 3GFJA 2W48A 1H89C 1HLVA 1VQ7I 1IRZA 3BGHA 3OS0A 2KRFA 1TWFJ 2XV4S 5JLXA 1UELB 1GTKA 2E72A 5IT3A 4IOAF 4AIJA 1QHGA 4E6KG 2CU7A 3H3UA 2H8WA 2VE9A 4QPQA 5IT9C 2DQLA 1RUNA 1H9GA 4BQNA 1S6LA 2AXTC 2EN8A 4DV1E 1ON1A 2CMPA 4DMIA 2EIJH 3CO6C 2R7VA 2A25A 3J7Yp 1YYVA 2YTPA 1UCRA 5AIQA 2P81A 4CCLA 1IN6A 4YFXF 1B72B 3Q0WA 2A61A 2FF4A 4Y13A 2MDRA 2BY2A 1HXDA 3GMEA 4BC9A 2DFEA 2ELKA 5E3OA 1Z1DA 3LAJA 5FKNA 2NYXA 4JI1E 1P9QC 1XMKA 4GYGA 2XPUA 3LA7A 5M5XJ 2UUCE 2QQ8A 1XC5A 3ABLH 2JRTA 1AH5A 2IS1A 5HNHA 2HGHA 4XLFA 2JUGA 1X5WA 3MKLA 4XLHA 1N75A 5ICEA 5CVRA 2K27A 3LQRA 5KL4A 1LFUP 1OQYA 4M74A 1J26A 2HNHA 1VZ0A 3K0LA 3F8MA 4LG0A 2EPLX 3KEOA 4XLPF 5J8FA 2OUMA 1NCSA 4A3CJ 2VOPA 2XPVA 4P5OA 4CHUA 1PJQA 2F4MB 3GLLA 3KYLA 3WTSC 4Z6YA 3I56I 2AQFA 2MH9A 4XLCA 4ZC3A 4DUYE 1JHHA 1IF1A 4L9TA 2M1BA 4GGGA 1G3YA 2IGNA 3HYIA 1ON2A 3PFIA 4O4KA 1UZCA 2BHYA 1OPCA 3FBNB 4MLOA 4PZJA 2XAGA 4JYAE 5FFXA 2JPBA 5LRSA 4XLNF 3Q9VA 4L0ZB 2LJHA 5H6RA 3TO9A 2FXAA 2MKDA 1PUFA 1JJ6C 2VN2A 3PNTA 1A1KA 1A04A 3KETA 4L9JA 4AD9A 4YFKF 3IV5A 3B6AA 3U9GA 1SVOA 1YQAA 1D1BA 4CYCB 3GZ5A 1OCPA 5ADZA 1QU6A 2M4KA 4AIHA 2XAHA 1Z05A 2P5KA 4LF5E 3ASNH 4ZZLA 3OYCA 4D0PA 3BP8A 3MZHA 3J7AY 3OIQA 3J81K 3QYFA 3W2WA 3H5RA 4FHTA 2EQRA 1PYVA 5T6JA 5AC5A 4ETSA 1R1UA 1I6XA 2RNJA 2DODA 3H35A 2M8GX 1ZRDA 2VUMJ 4IEJA 2DIXA 2FGGA 3MCZA 2C6YA 4HTGA 1XCBA 5FFZA 3K70C 5CVIA 4HDVA 2YWQA 4WSPA 2XF5A 3RI4A 2ISZA 2IT0A 1Y8QB 1ERDA 2F8BA 5CFFE 1STZA 3VB2A 2A6EF 5AE3A 5DCMB 4OX9E 1XB4A 3HOTA 2W82A 2DBBA 3QPHA 3BR5A 2D1VA 2ME0A 4PJ0C 3Q3SA 4M9SA 3RQ4A 3KP6A 2LY9A 3VFZA 2HEOA 1IRGA 3I9V2 4A3FJ 3K4MA 1ZU1A 1FY7A 2L3JA 1LJ9A 2DN0A 2EOQA 2VC1A 2ZO4A 1O3QA 3BT9A 4C3IJ 4AU7A 4IHTA 3KLNA 2EOJA 1QHHD 5KAIC 2YTNA 4ZDOA 1MBEA 2LVSA 1S3JA 4JX4A 5J4YA 1XMOE 2Q1ZB 4V2FA 2LH9A 2XB5A 1FX7A 4CUGA 2ZXIA 1IUYA 4WYQB 5CVUA 2EMKA 4B43A 3BZ6A 4IHWA 2WADA 3GO5A 1WKMA 1X2MA 2DGCA 1ZGAA 2MFZA 2ZMEA 1UB9A 2YTOA 5K7ZA 2QCOA 1ZR4A 2CW8A 3ZXSA 3ZN1A 4BH9A 5DV5A 2DAOA 1WI3A 4F9CB 2WA0A 2EZKA 2P4WA 3JSPA 2HYFA 1MD0A 2IP2A 2RQPA 3WE3A 1TTYA 2PMZN 4LLLA 2COMA 3Q0VA 1KQ8A 3GFLA 2JSPA 1WZ2A 3J80K 4IQJA 2PEXA 2FJ1A 3P7NA 2E1NA 4LIUA 1UG2A 2L33A 3JRAA 2EMGA 1HBXG 4KYWA 1IN7A 1MIJA 2OJED 3IAM2 3RKYA 4R2EA 1MMGA 1B6AA 4PJNA 2VE8A 4EJTA 5ICFA 2LT7A 3WTWC 4UVCA 1HNXE 3P5JA 4CYDA 4DOZA 1T4LB 2HQAA 5FKLA 2ZCWA 1YW8A 2CPNA 5FKMA 2R93J 5JHUA 4LFAE 2GLIA 4M3EA 1PDAA 2BY3A 2Y48A 1XNQE 4BKXA 4XIDA 3E97A 3KIOA 2EM9A 2RV8A 2CQQA 4X64E 1IO2A 2BW3B 2HDWA 2LJUA 4BY7J 1LPQA 3ZMVA 1TT5B 1V5GA 2OPTA 4XN0A 2FOKA 1Y0NA 3ADLA 1OYWA 4D5FA 4HBLA 2K9NA 4I0AA 3F6VA 2YU3A 2F4VE 1MNDA 2VOOA 3GWZA 4PCQA 2X0LA 1QZYA 2EPFA 5H20A 3JAMK 2IS2A 2KISA 1DPUA 2NOGA 3D5SC 2EMCA 4M0VA 3T0YA 2BZTA 5K7FA 5KL7A 2HZTA 3J7AO 3ZMTA 1Y8RB 2FQ4A 2DK5A 1SFXA 4ON0A 5HS8A 5J4VA 1JUMA 3G73A 1G59A 5LD2C 2E5NA 4XORA 2R0QC 2EMHA 2VLAA 2H6BA 2TDXA 2X6XA 4C3JJ 5HLGA 1ZH5A 2GBYA 5B1BH 3KP3A 3C4BA 1YI2I 4FX4A 2YZTA 4CYCA 3E6CC 2R7ZJ 1FLIA 2YT4A 3COAC 4L9VA 1C0WA 4XBFA 1G3WA 4HLXA 1OFCX 2NVYJ 1MSEC 4IJDA 3R61A 2O3FA 4RB3C 2NUFA 3KEYA 3AKZA 5HS9A 4Q47A 5E17F 1ZG5A 3T1HE 1Z3XA 1NK2P 3GXOA 1Z7LA 3DLAA 5FB2A 1BL0A 4PJJA 2VC0A 2ECCA 2ESHA 3HTUA 1FP2A 5DCFA 1R4NB 2HTSA 1K79A 2KIUA 3REOA 4O5GA 2JT1A 3FXMA 1U8BA 3CDIA 1YJWI 4UUTA 4BXXJ 2IS4A 4BBSJ 3G1LA 1OR7C 4G12A 1UN6B 2GA2A 2YR2A 5LRRA 1SMTA 1FZPB 2NS8A 3IKTA 4LFBE 1GXQA 4BE1A 3LA2A 1NK3P 4XM3A 1PP7U 2R7UA 4I0BA 1ZQ3P 4BGDA 4JK1X 1TZLA 1WJDA 2O5RA 2Q8KA 2XSDC 2PJRB 1XMQE 2Y2ZA 3THNA 2ID3A 3ZMUA 4BXFA 3LQQA 2EQ1A 1VI0A 4X1EA 3EYIA 3CP2A 6PAXA 2EZ6A 3HOXJ 5A2QC 1HW5A 2M7BA 2CUEA 3W3CA 2UUZA 4B48A 2H27A 3CZ6A 1IV8A 2JK3A 2HS5A 1I50J 5HLHA 2YTEA 2QSFX 4FASD 2BW3A 3KE2A 2O0YA 2EOIA 2CT1A 1BI0A 2VJIA 4R2DA 3E5QA 2YX7A 4RM2A 2GXAA 5ILVA 2A69F 3OYFA 1HNZE 3B02A 2VF1A 2IRFG 2EMBA 4V2GA 3K4LA 4HQEA 4KHPE 1ZREA 2YU5A 1D1CA 1IBKE 3OL3A 2OQRA 4O3MA 1BJAA 1V55H 1ZAOA 1HKTA 2Z99A 2PI0A 4UUSB 2QEXI 2EL5A 3JRHA 4JI3E 3FZVA 4B3SE 4J8ZA 4OU0A 2FA5A 1WPKA 3AL0C 1QZZA 1ONVA 2HYGD 2R7QA 5FLVA 2XRLA 2D9HA 4LMYA 4LGWA 2V79A 2CFXA 1E3HA 1YPNA 1IQOA 4FETA 2MH2A 2GOXB 3HSRA 5EEHA 5L3GA 1SC7A 4A3DJ 1IDZA 4D7MA 1KONA 1YYWA 3SEZA 4KFCA 1S8NA 2YSRA 1OLTA 5B1AH 3FX3A 2PJPA 1HW2A 1B69A 3HOYJ 4XMYA 4IHVA 1O3RA 3HPGA 4NZVA 5LBQA 1QPIA 1TLHB 4MO7A 5B3SH 3BR1A 3RJPA 1LB2A 2DMUA 1USSA 3F8FA 1ETWA 4FCYA 4DR2E 5DEQA 3LMLA 2FBKA 2FNAA 4A69C 2QSHX 4HZFA 4YIIA 3JW4A 2ZXJA 1IC8A 1UMQA 1W0UA 3PJRA 4BE2A 2V85A 4O43A 1WWXA 3OOPA 1TNTA 5K1YA 4M6YA 1E3PA 4G7OF 3FXQA 3HB9A 4NDLA 2CUFA 2IAIA 2EILH 5JVGF 2MW8A 3DQVC 1EH6A 5LHGA 4HNTA 1ETYA 5LMUE 2KP6A 3CCYA 3U2RA 2NNNA 1WI9A 5DNYA 3MN2A 5FJ8J 1NTCA 3BG3A 2CG4A 1ZK8A 1MJBA 2E2JJ 1X3WB 3NWSA 4BYYA 1TT0A 2EL4A 3W6KB 2GOMA 2I9IA 1XN7A 1MBGA 4DYRA 4EQQA 2O61A 3D0SA 2GLOA 2EM5A 1UBDC 1XNRE 3BWGA 1LFPA 2EMFA 1FC3A 4BJ6C 1QO0D 2K5CA 3BJ6A 1LE8B 4BDZA 4DR3E 2JR1A 2QLZA 3JRFA 4E7KA 4WFTA 2F48A 3BCBA 4M9VC 4P96A 2W1OA 4DR6E 2EWNA 5CYVA 1U3EM 1XS9A 4D9JA 2NVXJ 1TQPA 3WTUC 1IGNA 2MDGA 4CCNA 3IL2A 4XICA 2DOAA 2ZMEC 1LEAA 4OINF 4R2CA 2EMXA 2V4JC 2GA1A 2J5PA 4NXME 5D6FA 2HPMA 2GPIA 4RLFA 2YSPA 4UUVA 4G94A 4DKKA 5HOOA 1YIJI 1S72I 3WODF 2Q2EA 2ZKZA 1TQIA 3M8JA 1ETOA 2KJBA 3QAHA 4EGYA 3K4KA 2HVSA 5FO5A 2E1MC 1U5TA 2LE2A 1BC8C 1YG2A 5CKTA 4B3RE 4DV0E 1XSXA 2E36A 2V9VA 2VQHA 3R6SA 1V3FA 1JKQC 4MIMA 2KL4A 3DPUA 1U5TC 2W25A 2A3SA 2VKDA 3P9KA 2GHFA 4XRMA 3ZQFA 3JSOA 3H1CA 3K1PA 5J8CA 2HJJA 5DUKA 1HQCA 1ZBQA 1LDDA 4OIRF 3CTAA 2EL6A 4FK5C 2QSGX 3DXJF 1DU0A 3OMLA 3A4CA 3BR2A 5IYBJ 4EM1A 4XOPA 2JWOA 2QKLB 1Z67A 3BTLA 2M9AA 3S93A 1USTA 2CW7A 2M30A 4IJAA 4BHPA 3E5UA 4UV9A 2RPCA 4JI4E 4O24A 4RS8A 2MSYA 1CQTA 5DS9A 3M7GA 1UHZA 2VT2A 1ITYA 2Z5UA 4EEFG 2F4IA 4ENNA 2V89A 4M2ZA 3QODA 3HRMA 3CMYA 1SFOJ 2R92J 3CCSI 1R5GA 5EF6A 3CUQA 2KQRA 2FMYA 2W57A 1X1BA 3K69A 4M9ZA 5HDKA 2ZMEB 1QA6A 5FLMJ 2A07F 2HQRA 2LF8A 2GQQA 2WBMA 4EATA 1JK1A 2EPNA 3PUFA 2EOXA 1Q1HA 4EM0B 1W7PD 3L2QA 2B63J 1BBGA 3NQOA 4UHTA 4A6DA 4P9UA 2EM3A 3CP8A 3CCVI 2LC2A 4RHBB 2VT3A 4E7JA 2VKVA 4HEA2 4C9YA 3HTSB 3HPHA 2EMZA 2YRHA 1F1ZA 2CYYA 2NOJB 4CCJA 1TWGJ 4L5NC 3IRQA 4DR5E 2V9PA 2EV5A 1AA7A 4BQQA 2J5OA 3U1KA 3ZQGA 2Y9ZA 3HSFA 2R7DA 1H0MA 4GDFA 4KA4A 1BW6A 3I4NJ 4CCMA 2EIMH 3WTVC 2Y0SN 2EE8A 3ZMSA 3CDLA 3OYBA 2GAUA 2CFOA 3LSHA 4FISA 5E1ZB 4QLCU 3QG5C 4BDYA 1FMVA 4L5JA 5ED4A 3WG7H 4OMZA 1G6NA 1BI2A 2OU2A 3QRFF 2E1OA 2XKOA 3FXKA 3H92A 3TBIA 1JJ8C 2OTJI 1SFKA 4RAGA 4W1UA 1SEUA 4KISA 4QPOA 2K86A 5F0FA 1HKSA 2ZFWA 3MWMA 1L4SA 2MG4A 4ENKA 1YFHA 2ODRC 3RPUD 3TO6A 4HF2A 4TV7A 4EJOA 1APLC 4U87A 5E3LA 1KJKA 3EDPA 2LVHA 3LOCA 2VXZA 4XKWA 4LU9A 1N34E 1WSUA 1DGCA 1R71A 2FTXB 1FT9A 1W7PB 4F92B 4MGRA 4LIVA 3GFIA 2X51A 4D7NA 4L18B 3DJWA 5TISC 4CZCA 4G6TB 3ZRGA 3L9FA 1Y39A 2DPDA 1J2XA 1CF7B 3DCFA 1A35A 3IH2A 2O8XA 3DTIA 1E3OC 3DF6A 3CUQB 2EMAA 2VB6A 2F5VA 3VYXA 2CQXA 3P9CA 4HLYA 4X9JA 2CV1A 5A6AA 3GEZA 3IWDA 5LFAA 4OIQF 5CQEA 2XGDA 3VSKA 4OWRB 3RSNA 2XSJC 2R7RA 2DCEA 1SFEA 1O0WA 5F04A 2ZJRF 1XSDA 2QBYA 5IP6A 3BG7A 4GEQB 2E1MB 2L7ZA 2VJ5A 3VSLA 5GTIC 2P6TA 2R7FA 4KDPA 3J81C 4ENMA 4ESJA 3A0BC 2O03A 5JI6A 3FIWA 2RQLA 3KFWX 2PN6A 2XVCA 2JVGA 3GW2A 1SD6A 1XGSA 3C18A 4CGZA 4DGWB 4JI6E 3A0HC 2ZFUA 3RZOJ 4KICA 2HOAA 1DP3A 1WJEA 3EUKL 5IPAA 1P2FA 2CWEA 1IW7F 4Q35B 2QWWA 2WAQA 2MC4A 2HOTA 2OBPA 4DYQA 3K7AJ 1SD4A 3C4TA 3L1PA 3E3VA 2VI6A 4UY8I 3ELKA 2ELYA 4WWCA 4GKKE 2A5YB 1Y6IA 5C4JJ 1HOMA 1R7JA 4IO9F 1FWZA 1LFBA 2EORA 5LMNE 4IKFA 4HQMA 4M30A 2EBIA 4M9XA 1RPWA 2KIFA 5BOXA 4V19K 2KONA 1IBME 4GKJE 2UWMA 2V8QB 4ESFA 2R7OA 2EM0A 4MFDA 2LKSA 1BOAA 1G3SA 3BROA 1DI2A 1MH3A 3ZQQA 3HTXA 1A6QA 1LDJA 2QQAA 3EPJA 4WXHA 3BCAA 4Y3OA 1D1AA 4YG2F 2EPKX 4F54A 5DM6F 1UFMA 3DBLB 4YHHE 1YITI 4AYBN 2RSIA 3DEUA 2L7KA 1BB8A 1T2KA 4JBAA 5DD4A 4DNCA 1ZKGA 3MSWA 2R7WA 1Z3YA 3HGYA 1K4TA 1D5VA 3AV0A 1EKEA 2ELHA 3IP4B 4ZTFA 1T08B 1P7IA 2F5DA 1VQ9I 3CLQA 3LWFA 1R00A 1RI7A 1O7FA 3AG4H 3WE2A 2LLKA 3O8HA 1I39A 1LUJB 1WVRA 1ZLKA 5IT9K 3ABKH 3S14J 3PQJA 1B8IA 3EPLA 3W2VA 5F08A 2DJIA 5JHFA 1X3CA 4R8OA 3AG1H 1EA3A 3GTQJ 4JV5E 3S8PA 1P6RA 2VJ4A 3K2AA 1JHFA 4DJAA 3IWCA 2K3PA 4N9IA 4YFNF 1M1EB 2VBXA 4DQ2A 5IP9J 2K4BA 2F6CA 5L3DA 3WHCA 2IJLA 5E79C 5HVQC 3I4MJ 1JT0A 1G3TA 2PX9A 1RESA 3OIOA 3V4GA 1GT0C 2DTZA 4HDUA 4IXAA 3O8GA 1D0XA 4HPQA 4I76A 1Y1VJ 4BXUA 2XB0X 4YRVA 1ODDA 4LITA 4I7HA 4XRSG 1ZR2A 4LF4E 5CJ9A 1HKQA 3RMPA 4A0XA 3I53A 2EA4A 1K61A 3L00A 2IA2A 3TQNA 4A0ZA 2O6GE 1J09A 1VQ5I 1QZEA 2IBDA 2VBYA 3JCUC 5E20A 3DF8A 2KKOA 4A3IJ 1QVTA 1T38A 4MTDA 2BVLA 1X1DA 3BDDA 3T5XA 3L2RA 5DM7F 3EUAA 2V87A 4U7BA 3AL0B 3KYDB 1D5YA 3EPKA 5AC4A 2M5WA 1SAXA 5FLXK 3CJTB 2M0MA 2G0EA 3S2HJ 3K1NA 1OCOH 2AQEA 3KZZA 1J75A 2KZGA 1HDPA 1K78B 4HAMA 4II2A 1ORKA 4A5MA 2EN7A 2WY7Q 3QWLA 2H6CA 2G9WA 4DYCA 4C30A 2B9SA 1U9OA 4CA0A 1YHQI 3K2ZA 4H4KC 5E1WA 3L09A 1WQ2A 3OMYA 2NABA 4AYBA 2V88A 2MBFA 2QQ9A 3KEQA 4I01A 3ULQB 2I13A 2XF7A 1ZG3A 1T4OA 2CRGA 1WHQA 3FK6A 3MZ8A 1SVLA 2ELZA 1HDDC 4Q5SF 1Z9CA 3WHBA 4WXDA 3OY9A 1FOYA 5GTHC 2PJRA 5CPRB 2OQGA 1QNTA 2EPZA 4IRHA 4BEHB 5JFRA 3MFKA 3CC7I 4AQYE 1JUPA 1D3YA 4LJZF 2GM4A 1MDMA 4MTEA 1HNWE 2EOHA 3X2QH 1MMAA 3GTJJ 1LE8A 3MEXA 1STUA 2EJRA 2BBGA 4X6AJ 5IT9Z 3OOUA 4B8XA 2YS9A 2JOBA 3C6KA 4I99C 4OAZA 3BJOA 2HPIA 3F72A 4CO8A 3FMSA 2L2MA 4LOCA 1MKMA 3QOEA 4GZNC 2W4SA 3HSEA 3ML6A 4JOMA 4E7HA 4A3BJ 1MBFA 5F1JA 2ICWG 2V1NA 2EOSA 2XKPA 2RN7A 2ZXHA 1BJZA 2COBA 4XKCA 2E2IJ 5IV8B 2M0CA 1SR9A 2EV6A 4PGHA 3BOQA 1N25A 1HA8A 3QP6A 2KT0A 2IS6A 3IH3A 2R7SA 2OAZA 1YO5C 2MYSA 4I98B 1FYKA 1CF7A 1MMDA 2LSOA 1TC3C 2XC7A 3S3MA 3HRTA 3I71A 3FWEA 4S04A 1R22A 4XOTA 2CO5A 2FNPA 3S1QJ 3THOB 4A3MJ 2OA4A 1W7PA 5L3EA 4OIPF 2LUQA 4BS9A 1O7LA 2LKPA 2PMZA 2G7HA 1YUJA 5GAHJ 4F91B 4NC8A 2HDCA 2OZUA 4QSHA 1W36D 4G8XA 4WF2A 3SZGA 1JGSA 3ZGKA 3I5UA 1A1FA 4AVZA 5LGTA 1XMAA 1EV7A 2Q0OA 2ENAA 4KIGA 2CJJA 2GIVA 3VODA 5KK1A 4R2SA 1IRFA 3E7LA 3H09A 4A0YA 3HC7A 2HVRA 4HV5A 4G9YA 4XKBA 2DOEA 2EPUA 2X4HA 3E6BA 3ZQ7A 3DFGA 3ERMA 5A6BD 4DV4E 2QQBA 4KN7X 4LF8E 1YX3A 4RGRA 2A68F 4RB2C 2H8RA 1N32E 1D8KA 4RB1A 3V8JA 2VBZA 2E71A 2HTJA 2NVTJ 2DSYA 2DT5A 2LD5A 2B3TB 5A6JA 2UXCE 4ABZA 5EG0A 2K7LA 1WJCA 2EP3A 1YS6A 1I94E 3Q0UA 1FJGE 1FBUA 4O6JA 4DW6A 2LTRA 2HOEA 5KCMA 2CGPA 1HSTA 4IX7A 2DT7B 5M3MJ 1OCTC 4MEYF 4I6ZA 3HG9A 2DMIA 2Y30A 1N78A 3LSIA 1KGSA 1X1PA 2QGUA 2ZNZA 1JKPC 1Z0XA 2UXDE 2A6HF 2ZNYA 3TP0A 2WAEA 1FBQA 3B6CA 4QTRA 1T56A 5ERIA 4ZYGA 1BN5A 2AO9A 2DTRA 3BPVA 3RIRA 1YTYA 1XG1A 1R9TJ 3J80Z 2I8DA 4EVIA 5A2QK 2UU9E 2AHQA 3S2WA 3HKZA 4LD5A 5LEJA 2YTQA 3AG2H 2KPMA 1FOWA 5E1XA 5M3FJ 5ICGA 5F0HA 4XKVA 3TKYA 2EPXA 2JYAA 2CH0A 4E70A 4PSWA 1GV5A 1FBSA 5TRDA 2V6EA 1GVJA 2K02A 4ZYAA 3QU3A 2L7FP 4PDKA 1X6FA 1AOYA 1R36A 2K4VA 2JRMA 3DU5A 1BBOA 5HLIA 3OR2C 4AUXA 5FLXC 1ZELA 3BR3A 2K9QA 5D5VB 4A3JJ 1TQMA 3VOEA 1FKAE 2CUJA 2VODA 1HC8A 1OKRA 4BMJA 2OCCH 2RGVA 2LMDA 2WB1N 2EOYA 1K6YA 4LFUA 4HNUA 2D2WA 1Z91A 2EQ0A 4CZZA 1HW1A 4UB8C 2EMIA 4ITVA 5FROA 4UNOA 1ETQA 4Q4ZF 5KL5A 2CUZA 1BIAA 2B7VA 1TP4A 3DU6A 3G2BA 5IXMB 2UXNA 4EJUA 4JI8E 3CD6I 5HLTA 1FIAA 4U0YA 3CCUI 2EJ4A 1LVKA 1ACIA 5F3WA 2RS7A 3HRSA 1AWCA 1P4XA 5J6XA 2KDOA 1BIBA 1X2NA 4XL9A 2E5ZA 2Y31A 4YIRX 5TSEA 1VQPI 4XSXF 2DT6A 4BJ5C 1T0FC 2P5LC 5CVJA 3WG9A 3S1RJ 1S7OA 2VE7C 2E19A 3ONQA 4IRGA 1Y0UA 2LUPB 3BTJA 2NNYA 4KWYA 2EFQA 3CF2A 2FV4B 3I54A 3ZP5A 1EH7A 4B3TE 4LB5A 1X6EA 3LSGA 2EOOA 4B3XA 2IA0A 2LCEA 4QWQA 1ZAAC 3ROUA 2LK2A 4OOIA 3RCOA 3AAFA 3MKWB 2JJ7A 4Y15A 4NXNE 3A02A 5CVVA 1U78A 2DA3A 3HL2A 1LKXA 5CQGA 4WSGA 2VQEE 2HZDA 1IN4A 3I0TA 2IHR1 2WV1A 5KNLA 1R4MB 3W6JB 4CCOA 1G2HA 3GCMA 2BGCA 2DK8A 2JTVA 3OYNA 3K6QA 1SD5A 2NVUB 3F21A 3FM5A 3UKGA 3L2UA 3QU6A 1GVDA 2TCTA 1GZ6A 5HDGA 1SMYF 1IDYA 5BMZA 1F9NA 2V6CA 4E7IA 2RS6A 3UNGC 3DBRB 4MFEA 3GZ6A 2L6MA 4IOCF 4TUGA 3F8NA 2YTIA 1G2DC 2L92A 3T1BA 4B47A 1WGXA 4P1WA 1ZGWA 4B44A 1PJSA 3ADIA 1V54H 4BJTA 2CV0A 2M4GA 2VRDA 3SDGA 1IZ1A 2ECBA 2QUFA 3S3OA 3R4KA 2Z16A 4S0HB 3SEQA 4BNCA 1XTAA 4CDGA 3BQYA 1YJ9I 2DA7A 4RBOA 1HR0E 1PVEA 5GP9A 3C1DA 3VYUB 3SJMA 2JY9A 1FTZA 4P55A 4D5CA 5EDNA 3LSPA 1RETA 2EZIA 5D8LB 2F5EA 3FHNA 5DD8A 1ETVA 4G6QA 4BUPA 4HF0A 1YUIA 2DYRH 1HCRA 2WB1A 3FK7A 3KZIC 4YIFA 2EFOA 4DBQA 3CO7C 4IHSA 1WJ5A 3KP2A 3FXRA 1RC9A 1UJ8A 3S2DJ 2DDAA 3FM3A 3G3ZA 3A1YA 3OYJA 1ZYRF 1QU3A 3GX4X 2XDVA 2YX4A 3H9JA 4NB5A 4NQWB 3M3YJ 3TQMA 4ZZDA 1X3ZB 1DGRM 4UUSA 1KZHA 2W00A 3CJQB 1MNEA 3OIPA 3O3KA 3FXJA 3CQZJ 4G7ZF 4Q48A 2P6SA 3F0CA 4RLQA 2EMYA 3ABMH 4C2MJ 2YTGA 1VQ8I 4A6EA 3A01A 1N33E 2L2KB 3FMQA 1RQ0A 1OCZH 4DR4E 4DV7E 4BACA 3IKVA 2OV7A 1YS7A 3TMOA 1K83J 3BG9A 4M6VA 4AC0A 5K5RA 3BG6A 1VQLI 2X1DA 5EEAA 3OS2A 3ASOH 2QA4I 3L7WA 3H0GJ 1FNNA 2F5CA 4LLGF 1X58A 4BQAA 3QP5A 2HXOA 4BBRJ 1A6IA 5E3NA 4A12A 2EQ3A 3PIPF 4L9NA 4XNFA 4NHRA 3M8EA 3D5RC 4ZDPA 3JU0A 2RQQA 1U8RA 5C3EJ 2L4MA 3VDXA 1IN5A 3QYEA 4KUMA 5EJCA 2GIZA 3FKIJ 2XAJA 3UR3C 1BW5A 2EM2A 3KCCA 2M1SA 1OYYA 4P78A 1TBXA 2PFBA 2EOFA 1LNWA 2G7UA 3GF2A 1WJPA 2DI3A 1PJRA 3ECOA 1UG0A 1T4NA 2LG4A 5LGUA 4E7ZA 1F36A 4D1QA 2A5WA 1WXRA 1XCVA 4LF7E 1IN8A 2QYOA 1QGPA 4IPAA 3JR9A 1A1HA 2WV0A 3H3VK 1YZ9A 4LFCE 1PUFB 1FMWA 3KP5A 2GXBA 4KITB 2NUGA 2YRMA 2R7XA 4YELA 3JRGA 1IQSA 2YPNA 2BY1A 2VPLA 4IHYA 1WRJA 3F22A 2L9NA 2JA6J 2LKXA 2RTXA 2N8XA 2WWYA 3FXUA 4E7LA 5F27A 1B59A 2IW5A 2XUBA 3MVPA 5GPAA 1LLMC 3CMMA 3WTYC 3L2CA 2M7QA 1A36A 1S9HA 3ECHA 1F2IG 3JTGA 1RMDA 3HOSA 4J00A 3MMYB 3F8CA 4ZDLA 2EV0A 4EJWA 1FEXA 2ADRA 1W0TA 4NUBA 5GPCA 4FX0A 3O6BB 4NNJA 5BPIA 2HKOA 3E0JB 2XAFA 2JOXA 1FYMA 4GYIA 3BIDA 2KLOA 2BV6A 2IA1A 2LR8A 1R6RA 2MABA 3VYTB 3CMAI 5M5YJ 1MJ9A 1W1WE 3GTGJ 1DGWY 3BC8A 3OYEA 3OTOE 2K40A 2LY1A 5HDNA 4AIKA 1TF3A 3HDDA 3RPUA 2RDPA 2KRCA 2E60A 3LSMA 2FEZA 1HSJA 1ZHFA 2XRNA 2LMZA 1OMIA 2X6OA 3WTZA 2AS5F 3DPTA 4KMFA 2DLKA 4LLNA 1P47A 1O57A 1ZTRA 2M8EA 3OWTA 2KIMA 1FSHA 3M8FA 4J01A 1GXPA 4UV8A 1ENHA 3C6MA 2LDUA 4FQGA 1JK2A 2R5YB 1GQEA 2LTSA 5IWAE 1KQ0A 2HYJA 2L3DA 3A01B 2P8TA 1B9NA 1BOBA 1NG6A 4DV2E 2B7TA 1U9NA 2PQ8A 2VJJA 2L0KA 3R60A 3JRIA 2ID6A 5A69A 1V5EA 3C7JA 1GUUA 4NQWA 1P7JA 3H9QA 3WTTC 1YE9A 4I02A 2PLYA 4HA8A 2X85A 2FMLA 4B3ME 2UZKA 1IG7A 2ZXWH 4JI2E 3FXOA 1YSAC 3CCQI 2LBFB 1MJAA 4IF4A 3IWBA 4RMNA 2BVMA 3TP3A 3JTHA 1A1GA 5FD5A 1UHMA 2VKHA 3I3LA 3ZMDA 4F2JC 2EMWA 2M2EA 2WBSA 2HC5A 1N36E 3QOPA 4XONA 3CCJI 1RC7A 1YYKA 2JZYA 4R2PA 4OAYA 3OYDA 4RH8A 2BHZA 3NRVA 2B0LA 3JAMC 2NAZA 1IUFA 1R1VA 4XLAA 1EF4A 4EMSA 2JP9A 3RKQA 2L9VA 3Q9SA 3V7CA 3ZOBA 1MGTA 2P7CB 2R4GA 4S05A 1JXSA 2ENHA 1I6HJ 3OV8A
chains in the Genus database with same CATH topology
3SHFA 2QM3A 2P7VB 2PBIA 4B09A 4UVAA 2XROA 2VONA 4UVBA 1FPQA 1KU9A 1SFUA 4O5VA 2WC2A 4R8HA 2D1HA 2EK5A 3SQNA 3GYHX 4ZYDA 1DUXC 2WTEA 1X3UA 1OR7A 3NEUA 3TDUC 4IVNA 5TJJA 2ADUA 4H0EA 5CLSA 3P9IA 3HUGA 1YLFA 5H6QA 3EETA 3RKWA 3SFZA 1I5ZA 3IWFA 1J5YA 4WX9A 2NRAC 4EGZA 5HS7A 1YW9A 1Z6RA 3EQLF 5JVTA 2RKHA 1ZRCA 3RTRA 3TOAA 3N97A 1FOKA 1XGOA 3ZN0A 1G4DA 3C3WA 4HW0A 1VTNC 4L5IA 4PGGA 2MLKA 2KJCA 5KVRA 1XD7A 4IRIA 3LSTA 4HYEA 4MQ9F 3F23A 1BM9A 5LGNA 3O2PE 4KMUX 4WXCA 2QBYB 1ZN2A 2STWA 1TW3A 4LK0F 2FQ3A 3DPLC 3KP4A 1MZBA 2XGXA 4KNYA 5BS6A 2FBHA 3IHUA 3CUQC 2EFWA 2FE3A 1H9TA 3MQ0A 1DPRA 2XHKA 3CDHA 5E8IA 3J81Z 3GLXA 5LLQA 1RUOA 2RC4A 4ASNA 2MC3A 2CQKA 3I59B 1E17A 3HRUA 1KU3A 1P92A 3FF5A 1B4AA 5DUIA 4KN4X 1PUEE 5D4SA 1LDKB 1W4MA 2HR3A 5AONA 1B9MA 4HF1A 5LHIA 4RGXA 2MLGA 5L3FA 4Z2YA 1LVAA 5LEKA 4R79A 1R5HA 1IXRC 4GO1A 3FHZA 2FBIA 2CW0F 3LAPA 4HV6A 1RZ4A 3GFMA 4EV0A 4M73A 1SD7A 5ILUA 2LF7A 3WGHA 2DO7A 2Z33A 5ICCA 2DPUA 3TO7A 3ABUA 3RKXA 2DQRA 1NHAA 3IRRA 3H3ZA 3ABTA 4L0YB 2STTA 1KA8A 1W5TA 4G6DA 2ISYA 3U1DA 3V7RA 2EFPA 5AIPA 3R0JA 1DDNA 2BEOA 5D8KB 2DFIA 3TOBA 1XDSA 2L01A 4RGUA 1IXSB 1O3TA 3V7SA 3JAMZ 1RIOH 2OD5A 3LFKA 3RYPA 5FGMA 4R1HA 3CLOA 4CXFA 1OYIA 1T39A 1P4WA 1I27A 2Z3YA 2HKXA 3FMRA 3T8RA 2HWVA 3KLOA 1XDUA 4RGSA 1QQIA 5EEGA 4MNUA 1K7AA 3GVAA 1FSEA 3V8KA 2EA2A 3PQKA 2M87A 2HQNA 3F8BA 3QPTA 2UXXA 4ESBA 2XIGA 3WU1B 3E6DA 2PMHA 5F64A 5F6FA 1F5TA 5DYMA 2V1UA 3HHGA 1K6OA 1KYWA 2BYVE 4EM2A 4WCGA 1BBYA 1L0OC 4GCVA 4ZYHA 3WGGA 1LEBA 4G7HF 5DCMA 3M9AA 4XRFA 2HFHA 1T6SA 2QENA 2DW4A 2F2EA 1T98A 1BI3A 1E2XA 4M72A 3R0AA 2V1DA 3SZTA 2V1XA 5D4RA 3WTXC 5D6EA 1CGPA 3KP7A 5K5OA 2ETHA 2L4AA 4I09A 4LK1F 3IC7A 2AXLA 4A2UA 3HHHA 5E8GA 1QPMA 1KU2A 1Z7UA 1GHCA 2H09A 2CSOA 3KZYA 2IVMA 2FSWA 3ERED 3Q5FA 3MZYA 1ZGJA 2MA3A 4EJVA 3DV8A 3SXYA 4FT8A 2QVOA 3EUHA 3IWZA 3N4MA 1JE8A 3B73A 1PP8F 4LG0B 2ESNA 1IAWA 3E6MA 2PG4A 4U88A 1XGNA 2ACJA 2ZJ2A 2OZ6A 1LQ1A 2W84A 1B1BA 4HOBA 5D5UB 1TW2A 1REPC 1UHWA 2NS0A 2Y0MA 5BQTA 3RYRA 4BAYA 4N0BA 1ZG1A 1XGMA 2MD5A 5F1RA 1S29A 2K4JA 4M71A 4MHGA 3LA3A 1J9IA 3DP7A 2E7XA 1QBJA 3I4PA 1DP7P 4K2EA 1I1SA 2P5VA 2JSCA 3MAJA 1ZARA 2JPCA 1S7AA 5K5QA 4LB6B 4RB0A 4UXNA 5LHHA 1R1TA 1P4AA 1R23A 4I2OA 1F4KA 3CJNA 4JQFA 5FLXZ 4BHBA 3EYYA 1FP1D 2H94A 3F3XA 3WGIA 2PMUA 4U0WA 1PDNC 4OIOF 4AWXB 4N9HA 1TNSA 3BJAA 3BPXA 2Z9OA 1YW7A 2L54A 3SZPA 4KT5C 1L3LA 3TGNA 3RDIA 2IPQX 5JR3A 3T8TA 4M6XA 1U6GA 2BBYA 1MDMB 5L3BA 4HX8A 2BE5F 2M45A 2ZBKA 1ZRFA 1D8JA 3TDZC 2DLLA 3K9TA 2RVCA 5FD6A 1U5TB 5A2QZ 1KU7A 3ISPA 1FYLA 1KQ9A 4P9FA 2L02A 4U0VA 1ZLJA 4BHCA 2E1CA 4AVPA 1XSVA 1K78A 2D45A 2E7WA 3CUOA 4KIBA 4U7DA 2FRHA 3WU0A 1J59A 3V8LA 1U2WA 3ZMZA 2F5FA 3HIFA 5ILSA 4F7ZA 2QZ8A 1BI1A 1RNLA 3BY6A 4GXOA 5D5XB 1V4RA 1ULYA 3RPQA 3VEPA 4HX7A 4OMYA 2EB7A 5L3CA 2XASA 1R58A 1O3SA 1KYZA 4RAYA 1IXCA 2GXGA 2LNBA 3F6OA 2W85A 1T0FA 2GWRA 2W24A 4NHJA 1Z6TA 5E18F 2YPRA 1J7KA 4MEXF 5DDGA 1W5SA 4CICA 4MQVA 4RAZA 3ZPLA 2FU4A 2DU9A 5D5WB 4ENJA 3M1EA 2R3SA 4XSZF 1J0RA 4WK8F 3D5LA 3E5XA 4HX4A 3GUDA 3K1MA 3I58A 2VBWA 3DKWA 3I64A 2HGCA 4KIFA 1BC7C 4Y17A 4A5NA 1EH8A 2GZWA 2EFNA 4ZH4F 4ZYEA 5BPDA 2XAQA 2Y75A 1YIOA 3I59A 1I1GA 3GFJA 2KRFA 2XV4S 5IT3A 4AIJA 3H3UA 2VE9A 2DQLA 1RUNA 1H9GA 1S6LA 1ON1A 3CO6C 1YYVA 1UCRA 5AIQA 1IN6A 4YFXF 2A61A 2FF4A 4Y13A 1HXDA 1Z1DA 3LAJA 2NYXA 1XMKA 4GYGA 3LA7A 2JRTA 5ICEA 5CVRA 2K27A 3LQRA 4M74A 3K0LA 3F8MA 4LG0A 3KEOA 4XLPF 5J8FA 2VOPA 4P5OA 4CHUA 3WTSC 2MH9A 1JHHA 1IF1A 4L9TA 2M1BA 4GGGA 1G3YA 3HYIA 3PFIA 1ON2A 1OPCA 4PZJA 2XAGA 5LRSA 2JPBA 5FFXA 4XLNF 3Q9VA 4L0ZB 5H6RA 3TO9A 2FXAA 2VN2A 1A04A 3KETA 4L9JA 4AD9A 4YFKF 3U9GA 1YQAA 3GZ5A 4AIHA 2XAHA 1Z05A 2P5KA 4ZZLA 4D0PA 3BP8A 3MZHA 3J81K 4FHTA 4ETSA 1R1UA 1I6XA 2RNJA 1ZRDA 3MCZA 2C6YA 1XCBA 5FFZA 5CVIA 4HDVA 3RI4A 2ISZA 2IT0A 1STZA 3VB2A 2A6EF 5DCMB 1XB4A 3HOTA 2DBBA 3QPHA 2D1VA 4M9SA 3KP6A 3VFZA 2HEOA 1IRGA 1FY7A 1LJ9A 2VC1A 2ZO4A 1O3QA 4IHTA 3KLNA 1S3JA 1FX7A 1IUYA 5CVUA 3BZ6A 3GO5A 1WKMA 1ZGAA 2ZMEA 1UB9A 4BH9A 3ZN1A 5DV5A 2DAOA 2P4WA 3JSPA 2HYFA 1MD0A 2IP2A 2RQPA 3WE3A 1TTYA 4LLLA 2COMA 1KQ8A 3GFLA 3J80K 2PEXA 3P7NA 2E1NA 1HBXG 4KYWA 1IN7A 3RKYA 1B6AA 2VE8A 4EJTA 5ICFA 3WTWC 4UVCA 4CYDA 2ZCWA 1YW8A 5JHUA 2Y48A 3E97A 2RV8A 3ZMVA 2FOKA 1OYWA 4HBLA 4I0AA 2YU3A 3F6VA 2VOOA 3GWZA 4PCQA 2X0LA 1QZYA 5H20A 3JAMK 1DPUA 3T0YA 2HZTA 3J7AO 3ZMTA 2DK5A 1SFXA 4ON0A 5HS8A 3G73A 2H6BA 2TDXA 5HLGA 1ZH5A 3KP3A 4FX4A 3E6CC 1FLIA 3COAC 4L9VA 1C0WA 4XBFA 1G3WA 4HLXA 3R61A 2O3FA 4RB3C 5HS9A 4Q47A 5E17F 1ZG5A 3GXOA 5FB2A 2VC0A 3HTUA 2ESHA 1FP2A 5DCFA 2HTSA 1K79A 2KIUA 3REOA 2JT1A 2GA2A 2YR2A 5LRRA 1SMTA 1FZPB 3IKTA 1GXQA 3LA2A 1PP7U 4I0BA 4JK1X 2Q8KA 3ZMUA 3LQQA 3EYIA 6PAXA 1HW5A 2H27A 2HS5A 5HLHA 3KE2A 2O0YA 1BI0A 3E5QA 2YX7A 5ILVA 2A69F 3B02A 2IRFG 4HQEA 1ZREA 2OQRA 4O3MA 1BJAA 1ZAOA 1HKTA 2Z99A 2PI0A 3FZVA 4OU0A 2FA5A 1QZZA 1ONVA 2HYGD 4LMYA 4LGWA 2V79A 2CFXA 2MH2A 3HSRA 5EEHA 5L3GA 4KFCA 1S8NA 2YSRA 3FX3A 2PJPA 1HW2A 1O3RA 5LBQA 1TLHB 3RJPA 1LB2A 1USSA 3F8FA 5DEQA 2FBKA 2FNAA 4HZFA 4YIIA 3JW4A 2ZXJA 1WWXA 3OOPA 1TNTA 5K1YA 4M6YA 4G7OF 3FXQA 5LHGA 3DQVC 1EH6A 3U2RA 2NNNA 1WI9A 2CG4A 1MJBA 4BYYA 3W6KB 1XN7A 2O61A 4EQQA 3D0SA 3BWGA 1FC3A 1QO0D 3BJ6A 2QLZA 4P96A 2EWNA 5CYVA 1U3EM 1TQPA 3WTUC 3IL2A 1LEAA 4OINF 2GA1A 2J5PA 5D6FA 4UUVA 4G94A 5HOOA 3WODF 2Q2EA 2ZKZA 1TQIA 3QAHA 2KJBA 4EGYA 5FO5A 1U5TA 1BC8C 1YG2A 1XSXA 2V9VA 3R6SA 1V3FA 1U5TC 2W25A 2A3SA 3P9KA 3JSOA 3K1PA 5J8CA 5DUKA 1HQCA 1LDDA 4OIRF 3CTAA 3DXJF 4EM1A 4BHPA 1USTA 2M30A 4IJAA 3E5UA 4UV9A 4RS8A 3M7GA 2VT2A 2Z5UA 4ENNA 3HRMA 1R5GA 3CUQA 4M9ZA 2FMYA 2W57A 3K69A 5HDKA 2ZMEB 2A07F 2HQRA 2LF8A 2GQQA 1Q1HA 4EM0B 1W7PD 3NQOA 4UHTA 4A6DA 4P9UA 2VT3A 3HTSB 1F1ZA 2CYYA 3IRQA 2EV5A 2J5OA 3HSFA 2R7DA 1H0MA 4KA4A 3WTVC 3ZMSA 2GAUA 5E1ZB 4QLCU 4L5JA 5ED4A 4OMZA 1G6NA 1BI2A 2OU2A 3QRFF 2XKOA 3H92A 2K86A 1HKSA 2ZFWA 3MWMA 4ENKA 1YFHA 3TO6A 4HF2A 4TV7A 4EJOA 3EDPA 2VXZA 1WSUA 1FT9A 1W7PB 4MGRA 3GFIA 4L18B 2DPDA 3L9FA 1J2XA 1CF7B 2O8XA 3CUQB 3P9CA 4HLYA 3GEZA 4OIQF 1SFEA 1XSDA 2QBYA 2P6TA 2R7FA 4KDPA 4ENMA 4ESJA 2O03A 5JI6A 3KFWX 2PN6A 2XVCA 3GW2A 1SD6A 1XGSA 3C18A 4CGZA 4KICA 1P2FA 2CWEA 1IW7F 2QWWA 2OBPA 1SD4A 3E3VA 3ELKA 4WWCA 2A5YB 1R7JA 1FWZA 4HQMA 4M9XA 2KIFA 5BOXA 2UWMA 4ESFA 1BOAA 1G3SA 3BROA 1LDJA 2QQAA 4WXHA 4YG2F 1UFMA 3DEUA 1T2KA 4JBAA 5DD4A 4DNCA 1D5VA 2ELHA 2F5DA 3LWFA 1R00A 1RI7A 1O7FA 3WE2A 1ZLKA 5IT9K 3PQJA 1P6RA 1JHFA 4N9IA 4YFNF 2VBXA 4DQ2A 2K4BA 5L3DA 2IJLA 5HVQC 1G3TA 3V4GA 4HDUA 4IXAA 4BXUA 1ODDA 4I7HA 5CJ9A 1HKQA 4A0XA 3I53A 2EA4A 3L00A 2IA2A 3TQNA 4A0ZA 2O6GE 2VBYA 5E20A 3DF8A 2KKOA 1T38A 4MTDA 3BDDA 3T5XA 4U7BA 2M5WA 1SAXA 5FLXK 3K1NA 3KZZA 1J75A 1K78B 4HAMA 4A5MA 2H6CA 2G9WA 3K2ZA 5E1WA 3L09A 1WQ2A 2MBFA 2QQ9A 3KEQA 4I01A 3ULQB 1ZG3A 4Q5SF 1Z9CA 4WXDA 2OQGA 1QNTA 4IRHA 5JFRA 3MFKA 1D3YA 4LJZF 1MDMA 4MTEA 3MEXA 2EJRA 5IT9Z 4B8XA 3BJOA 3F72A 4CO8A 3FMSA 1MKMA 3HSEA 3ML6A 2XKPA 2RN7A 2EV6A 4PGHA 3BOQA 3QP6A 2OAZA 1YO5C 4I98B 1FYKA 1CF7A 2LSOA 3HRTA 3I71A 3FWEA 4S04A 1R22A 2CO5A 2FNPA 2OA4A 1W7PA 5L3EA 4OIPF 1O7LA 2LKPA 2G7HA 2HDCA 2OZUA 4G8XA 4WF2A 1JGSA 3I5UA 5LGTA 1XMAA 1EV7A 2Q0OA 4KIGA 2GIVA 3VODA 5KK1A 1IRFA 4A0YA 4HV5A 4G9YA 2X4HA 3E6BA 3ZQ7A 3DFGA 2QQBA 4KN7X 4RGRA 2A68F 4RB2C 1D8KA 4RB1A 3V8JA 2VBZA 2HTJA 2DT5A 2K7LA 1YS6A 1FBUA 4O6JA 2HOEA 2CGPA 1HSTA 4MEYF 1KGSA 2ZNZA 2A6HF 2ZNYA 1FBQA 5ERIA 4ZYGA 1BN5A 2DTRA 3BPVA 3RIRA 1YTYA 3J80Z 4EVIA 5A2QK 3S2WA 5LEJA 4LD5A 5E1XA 5ICGA 3TKYA 4E70A 1FBSA 5TRDA 1GVJA 2K02A 3QU3A 4PDKA 1AOYA 1R36A 5HLIA 5D5VB 1TQMA 3VOEA 2VODA 1OKRA 2RGVA 4LFUA 2D2WA 1Z91A 4CZZA 1HW1A 4UNOA 4Q4ZF 1BIAA 2UXNA 4EJUA 4U0YA 3HRSA 1AWCA 1P4XA 5J6XA 1BIBA 4XSXF 2P5LC 5CVJA 3WG9A 1S7OA 4IRGA 1Y0UA 2NNYA 2EFQA 3I54A 3ZP5A 1EH7A 4LB5A 2IA0A 4QWQA 3ROUA 4OOIA 3AAFA 4Y15A 5CVVA 1U78A 1IN4A 3I0TA 3W6JB 2BGCA 2DK8A 2JTVA 1SD5A 3F21A 3FM5A 3QU6A 5HDGA 1SMYF 5BMZA 1F9NA 2V6CA 3GZ6A 3F8NA 3T1BA 1IZ1A 2QUFA 3R4KA 4BNCA 4CDGA 3C1DA 4P55A 5D8LB 2F5EA 5DD8A 4G6QA 4HF0A 4YIFA 2EFOA 3CO7C 4IHSA 3KP2A 3FXRA 3FM3A 3G3ZA 1ZYRF 3GX4X 2YX4A 4NB5A 4ZZDA 3O3KA 4G7ZF 4Q48A 2P6SA 4A6EA 3FMQA 3IKVA 1YS7A 5K5RA 3L7WA 1FNNA 2F5CA 4LLGF 4BQAA 3QP5A 4A12A 4L9NA 3M8EA 1U8RA 2L4MA 1IN5A 4KUMA 2XAJA 3KCCA 1OYYA 1TBXA 2PFBA 1LNWA 2G7UA 3GF2A 2DI3A 3ECOA 5LGUA 1XCVA 1IN8A 2QYOA 1QGPA 4IPAA 2WV0A 3KP5A 2GXBA 1WRJA 3F22A 2WWYA 3FXUA 1B59A 2IW5A 2XUBA 3L2CA 3WTYC 3ECHA 3JTGA 3HOSA 3F8CA 2EV0A 4EJWA 4FX0A 3O6BB 5BPIA 2HKOA 2XAFA 1FYMA 4GYIA 2BV6A 2IA1A 1MJ9A 5HDNA 4AIKA 3RPUA 2RDPA 2FEZA 1HSJA 1ZHFA 2XRNA 1OMIA 4KMFA 3WTZA 2AS5F