4WXCA

Crystal structure of mycobacterium tuberculosis ogt-y139f
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGFGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wxcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wxcA01
1FYKA 3I4PA 4AIJA 1TNTA 2BV6A 2VT2A 1QZZA 4WF2A 1Z1DA 2JTVA 2FE3A 2G9WA 5ICFA 4ON0A 2NYXA 3HYIA 3RIRA 1B6AA 2FXAA 5K5OA 5FFXA 3TOBA 5KVRA 1MJBA 4I7HA 1ULYA 4GO1A 1PP7U 1WSUA 3G3ZA 3ELKA 1HKSA 1WRJA 4LB5A 1EH8A 4E70A 3DV8A 4UUVA 4IXAA 4L5IA 3CJNA 4NQWA 1ZAOA 4HA8A 3FMRA 2IA1A 4A0ZA 1FPQA 4B09A 5CVIA 1TTYA 5ICGA 3D0SA 1KU2A 2QZ8A 1LDDA 1DDNA 1IN7A 4U0VA 1QO0D 2PLYA 1MZBA 4BXUA 1E17A 4M9XA 4KIBA 3GXOA 3D5LA 3V7SA 5LHGA 1BJAA 1ZREA 2OQGA 3IHUA 4PGHA 2MLGA 3PQJA 1J0RA 2VOOA 5L3BA 2MD5A 1J75A 4LLLA 4A6EA 2EWNA 3HOTA 1LEAA 3CUQC 1TQIA 1IW7F 4EV0A 1R7JA 1KU9A 4KDPA 5DYMA 3KP7A 2Q2EA 3KP4A 2HFHA 1XD7A 5FD6A 4UVAA 1CF7B 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 2STTA 4ESJA 4IVNA 5CLSA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 3R60A 5ED4A 2MH2A 1CGPA 2EFWA 3JSOA 5J8FA 3WTYC 4AWXB 5HVQC 2XAJA 1ON1A 3WE3A 3G73A 1G3SA 1IZ1A 5HLGA 3HHGA 5E8GA 2UZKA 3QOPA 4ZYDA 1KYWA 2UXXA 4XSZF 3DPTA 1FLIA 3NEUA 1RZ4A 1I6XA 3DP7A 2BYVE 2K86A 3GUDA 1XGMA 2PI0A 1BN5A 3GYHX 2KIFA 2DBBA 1FBUA 3R6SA 3SZPA 1I27A 3MCZA 3REOA 3L9FA 1R5GA 2GA2A 3WTZA 4IPAA 3E6MA 4IRGA 2FRHA 5FO5A 4YFKF 2G7UA 2JT1A 1T38A 4CYDA 1ZRCA 2FSWA 2QENA 4LG0B 3TQNA 4LLGF 1REPC 3ABTA 5EEHA 4RB3C 1TNSA 4HV5A 4K2EA 1OYWA 3C7JA 2AS5F 4KYWA 2FU4A 1QGPA 2HWVA 2F5CA 2VE9A 4HDUA 3ROUA 4ESBA 2VBZA 2DK8A 1QNTA 4ENKA 5FFZA 2EA2A 1BC7C 3TKYA 2DQLA 2GXBA 2BE5F 5J8CA 2A61A 3F6OA 4M71A 1U5TC 1LVAA 3MAJA 1JE8A 3BJAA 2CYYA 4D0PA 2C6YA 5D8LB 5E20A 2GAUA 5D4SA 1D8JA 3ZPLA 1IXRC 2WWYA 2DTRA 3WE2A 4M9ZA 3HTSB 4CICA 3JSPA 1B1BA 3Q9SA 4EGZA 5JR3A 3PFIA 4EJTA 2KKOA 4FX0A 3MEXA 1KYZA 5L3FA 4CDGA 2LDUA 1T39A 1XMAA 1MD0A 2KRFA 4Q48A 4G7HF 5D6FA 1YW9A 2EFOA 4LJZF 5FB2A 2PFBA 5DUKA 1Z9CA 2XRNA 2BGCA 1QPMA 3FHZA 4M73A 4ZYHA 3E5UA 4MQ9F 2Z5UA 3GZ5A 2RV8A 1Y0UA 1TLHB 1KQ8A 3TO7A 1ZGJA 5L3GA 1RI7A 5KK1A 2RC4A 4LK1F 3V8JA 5E18F 5HS8A 4HX8A 2D2WA 3W6JB 2FOKA 5CJ9A 3CO7C 5ERIA 1K78A 1ZH5A 1DP7P 1ZARA 5LGUA 4UV8A 4EM0B 4M6XA 1F5TA 4ESFA 4L18B 4L5JA 2QQ9A 4A0YA 1YLFA 1FBSA 2DAOA 2GIVA 1ZGAA 4I02A 1YG2A 3R0JA 1ON2A 1XGNA 1LNWA 4CHUA 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 3EDPA 2STWA 5H20A 3QPTA 1O57A 2XAHA 1SD5A 2ZMEB 3ZMTA 2LF7A 4WXCA 3QPHA 1XSDA 4LMYA 2Y48A 2UWMA 2QBYA 2CGPA 1BIBA 2P6SA 1ZLJA 4HBLA 3T8RA 1R23A 2RDPA 3U2RA 4S04A 2BBYA 1YYVA 3CO6C 2ZNZA 2HDCA 4KN7X 5D6EA 1I1SA 5E17F 1XDUA 5FLXK 1IN8A 5BPIA 5D4RA 4WXDA 5BPDA 2FBHA 3V7RA 4G8XA 2OU2A 2RN7A 3F6VA 3ZMUA 5F1RA 3LAPA 2ELHA 4KICA 2OZUA 1IN5A 3OV8A 3P9KA 4GCVA 1IUYA 5LBQA 3K2ZA 1PP8F 1G4DA 4ZZDA 1QZYA 3KETA 2IRFG 4AIHA 3EYIA 2HOEA 2G7HA 5HDKA 2CFXA 5DCFA 1K7AA 2EFNA 4YIFA 3F8NA 3LA2A 1O3QA 3BZ6A 3FMQA 3ISPA 4G6QA 2MC3A 5FLXZ 2CW0F 1AOYA 1LB2A 3P9CA 4OIQF 5DCMB 2MH9A 2KJBA 2A6HF 4OMZA 3DXJF 5H6RA 1W7PA 2PMUA 3ECHA 3E6DA 1SFEA 4KMFA 3M1EA 2QVOA 1XN7A 3TO6A 2D1VA 3I5UA 2JPCA 4MEYF 1DPUA 3ML6A 2VONA 2A5YB 3IKTA 3GF2A 2XIGA 3I59A 1P4WA 1XSVA 1EH7A 2ETHA 4OIRF 3J80Z 4L0ZB 5FGMA 2JZYA 1TQMA 4N0BA 2DW4A 3LWFA 4KMUX 2EV0A 3E97A 2NNNA 4H0EA 4RB0A 4BHBA 1ZN2A 4UV9A 3SQNA 5A2QK 4NHJA 3I64A 2QM3A 1F4KA 1S8NA 4OINF 4OU0A 4IF4A 4HZFA 2M45A 1U78A 1FP2A 1B59A 1U5TA 4ZYGA 4I09A 4G94A 3KEOA 2FBKA 5HS7A 2QBYB 2QWWA 2VC0A 1ZRDA 3WTSC 3VFZA 3QP6A 3GO5A 2KJCA 5DD8A 2NNYA 2HYGD 5BMZA 1J7KA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 1G6NA 3E6BA 1ODDA 2VOPA 2PBIA 1JHHA 2P4WA 4R1HA 3BOQA 3Q5FA 5A2QZ 3SXYA 4A5NA 4LG0A 5IT3A 3V7CA 2V1XA 4U7DA 4Q5SF 1LEBA 4EM2A 1I1GA 3K1PA 2DI3A 1BOAA 3GEZA 3GFLA 3EETA 5L3CA 2XHKA 4KT5C 1BM9A 1O3TA 2CWEA 2OAZA 3B02A 1S6LA 5D5WB 5CVUA 2OD5A 1USTA 2IW5A 1RIOH 2V1DA 4KFCA 4Y13A 2V79A 3N97A 2WC2A 3QP5A 2O6GE 3MWMA 2E1CA 1S7OA 2W85A 3NQOA 3K9TA 4UNOA 3HOSA 4CO8A 2M5WA 1ZG3A 2FF4A 1C0WA 1NHAA 2DPUA 2RKHA 4MNUA 3RKWA 3L00A 1HW2A 5AIQA 2A68F 3V8LA 4A0XA 3BJ6A 3I0TA 2HR3A 2W25A 4KN4X 5LLQA 1FSHA 2D45A 1W5TA 1ZLKA 2XV4S 2EJRA 3DF8A 3KZZA 2QQBA 2Y0MA 4JK1X 1P92A 3L2CA 1TW2A 4G9YA 3HSFA 3IRQA 4GXOA 4PGGA 3LFKA 4XSXF 1P4AA 3GFIA 3WTUC 2A07F 1XSXA 1FSEA 2Y75A 5D8KB 1CF7A 3MZYA 1L3LA 3E5XA 3FX3A 5DV5A 3ULQB 3M9AA 2QYOA 1XMKA 4HQMA 2COMA 3GLXA 4JQFA 2M30A 1Z7UA 4LFUA 4BHCA 4PDKA 3DQVC 1OMIA 3IKVA 2PEXA 5F64A 1XB4A 2IVMA 4YFNF 3WU1B 3DKWA 1U2WA 1H9TA 2OA4A 5ICEA 3R61A 4R79A 3T5XA 2K4BA 5LGNA 4KA4A 2LNBA 2F2EA 3FMSA 4KUMA 1KQ9A 3GX4X 2V9VA 3HHHA 1HW5A 4UHTA 2HTJA 1WWXA 3WGHA 2NS0A 4FX4A 2VODA 4M72A 3N4MA 3T8TA 5AONA 4GYGA 1YS6A 4BH9A 3L09A 2DK5A 2H6CA 1WKMA 5ICCA 4HYEA 2F5DA 1Z6TA 1GHCA 2HEOA 4MEXF 4B8XA 1IXSB 3F8FA 1OKRA 1YS7A 1IAWA 4RB1A 3JTHA 2OBPA 1BI0A 5JVTA 4ENNA 2XAQA 2OZ6A 1HXDA 1BI3A 4WX9A 1QBJA 4L0YB 2FNAA 2CO5A 1LQ1A 3E3VA 2IA0A 2HKOA 4Q4ZF 4MQVA 4ENJA 1W7PB 1P6RA 4M6YA 1USSA 4ENMA 3CDHA 1K79A 1J59A 3HRUA 1O3SA 5BS6A 1FOKA 1T98A 1YO5C 3AAFA 4P9FA 2GXGA 4EQQA 4AD9A 3TO9A 4BYYA 1YFHA 4BHPA 1S7AA 3T1BA 1QQIA 2V6CA 1KU3A 2UXNA 2HQRA 2JSCA 2XROA 2GZWA 3M7GA 3RYRA 4YG2F 2KIUA 1GXQA 4Q47A 2YX7A 3BROA 2ISYA 2VC1A 4HQEA 2RVCA 1PUEE 4L9NA 1BC8C 2EFQA 3QRFF 1BIAA 4O5VA 5D5XB 4EGYA 5CVJA 1D3YA 1H9GA 2ZMEA 3ZMDA 3ERED 2L3DA 2ZJ2A 1IXCA 4WCGA 1G3WA 3KZYA 1R1UA 2QLZA 4AVPA 4LB6B 3WG9A 1O7FA 2P6TA 1JHFA 4RGSA 2EFPA 3BDDA 3KP2A 3S2WA 3K1MA 4DQ2A 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 1KGSA 4U0YA 2L4MA 2KIMA 2GA1A 1W4MA 3F8BA 4Y17A 3QU3A 5E1WA 5DUIA 4HF0A 4FT8A 3GFMA 1J5YA 2IA2A 1UHWA 2PQ8A 2W84A 4DNCA 4KIGA 1X3UA 2P7VB 2JRTA 3GVAA 3KLNA 1J9IA 4HAMA 3HIFA 1UHMA 2BEOA 2O3FA 3IWFA 2F5FA 2ZBKA 4G6DA 3CUQA 2YX4A 3WODF 1UFMA 4IRHA 4L9TA 1HQCA 3JW4A 4P5OA 1F1ZA 4EM1A 3ZN0A 2VBWA 1G3TA 1ZHFA 2YSRA 5K5RA 4LK0F 1R00A 3I58A 3E5QA 4PZJA 2E7XA 5IT9K 5BOXA 4UXNA 2W24A 1U6GA 3P9IA 3W6KB 1HBXG 4A6DA 1YW8A 2V1UA 1Z05A 1H0MA 3HTUA 3C18A 2Q0OA 2RQPA 1YIOA 2ISZA 4HF1A 1OPCA 1J2XA 1E2XA 1T0FA 1XCBA 2VE8A 4HV6A 3T0YA 1MGTA 4RGRA 2XKPA 1YQAA 3RPQA 2ZNYA 1S29A 3FWEA 1Z91A 5ILUA 4L9VA 4N9IA 1XCVA 4EJWA 4ZH4F 4OIPF 3WU0A 5E1ZB 2H09A 1JXSA 1SMTA 1VTNC 2WTEA 3VOEA 3F72A 2NAZA 2X0LA 2YR2A 3B73A 3WTTC 3QAHA 2PG4A 4BQAA 4HLXA 1B9NA 5E1XA 2P5VA 3F21A 1KA8A 3IRRA 4A12A 1U3EM 1R1TA 3BP8A 2R7DA 5D5UB 2ZO4A 2ZXJA 2VT3A 1G3YA 4XBFA 5TJJA 3KP5A 3M8EA 2L02A 2F5EA 4OIOF 3KCCA 4G7ZF 1AWCA 3I59B 3EYYA 2LKPA 2MLKA 2X4HA 2FEZA 3IWZA 4EVIA 2OQRA 5HOOA 4MTDA 1OYYA 3O2PE 3ZP5A 1U5TB 5LEJA 1SAXA 4CZZA 2XGXA 5L3DA 4P96A 4OOIA 2EV5A 3WTVC 1ONVA 3GFJA 1SFXA 1R1VA 2TDXA 1HKQA 1IN6A 2P7CB 2YU3A 4RGXA 3H92A 2O8XA 2H94A 1O7LA 1OR7A 4F7ZA 4CGZA 3J80K 1IN4A 1U8RA 3HUGA 1BI2A 5L3EA 3BPVA 4EMSA 5LHIA 4NB5A 3QU6A 4LLNA 4LD5A 4U0WA 2MBFA 3ZN1A 2P5KA 5JHUA 3WTWC 3ZQ7A 2RNJA 3JAMZ 5EEGA 3RKYA 3U9GA 4LGWA 4MGRA 1O3RA 1SMYF 1EV7A 2P8TA 1IF1A 4CXFA 5F6FA 1P4XA 1Z6RA 3EQLF 4QWQA 2M8EA 4JBAA 4R8HA 1D8KA 1UCRA 3LAJA 3C3WA 1FWZA 1WI9A 5LRRA 2PJPA 2Z99A 3E6CC 2GQQA 3HRMA 3JAMK 3IL2A 2M87A 4IHSA 3WGGA 3KE2A 4WXHA 4P55A 4HX7A 2IP2A 5CVVA 1RUOA 3M8FA 6PAXA 5LEKA 3U1DA 3NRVA 2IT0A 1TW3A 2VN2A 5CYVA 5HLHA 2HKXA 1GXPA 3HSRA 3ABUA 4O3MA 1FY7A 3R4KA 5LHHA 1HSTA 2J5OA 2DO7A 2ACJA 1T2KA 5ILVA 4YIIA 3K1NA 3MQ0A 2FMYA 4BNCA 3LQRA 3J7AO 2O0YA 2HYFA 3BY6A 1BBYA 2A69F 5LRSA 2M1BA 5DEQA 4EJVA 3O6BB 4A2UA 2FQ3A 1SD7A 3BWGA 1L0OC 2EK5A 4Y15A 1SD6A 2MA3A 1K78B 3ZMZA 2VXZA 3SZTA 4WWCA 4HOBA 2Z9OA 2CSOA 3H3ZA 4ETSA 1FT9A 3LA7A 5DCMA 3GW2A 1FP1D 1ZYRF 4XLNF 1HSJA 3HRTA 4I2OA 4L9JA 1STZA 1I5ZA 3RTRA 1KQ0A 3COAC 3F22A 1B4AA 5AIPA 1MDMA 2ESNA 2K7LA 1SD4A 3DFGA 3TOAA 4KNYA 2LF8A 1MKMA 5LGTA 2K4JA 3WTXC 3FXUA 3IC7A 3F8MA 3FM5A 5HS9A 4HW0A 2A3SA 3K69A 1GVJA 4G7OF 2VBXA 1TQPA 3TGNA 5CVRA 4RB2C 1K6OA 2PN6A 2ESHA 3K0LA 3CUOA 3EUHA 2EA4A 3V8KA 2R3SA 3C1DA 2K27A 1R36A 3HSEA 3J81Z 2HQNA 2WV0A 3HRSA 4IJAA 2L54A 3PQKA 3TDUC 5TRDA 2AXLA 2DT5A 2VBYA 3ZMVA 3SHFA 4GYIA 2NRAC 4M9SA 3I54A 2Z3YA 4UVCA 4KIFA 1FC3A 1YTYA 2QQAA 3TDZC 2XAFA 3VEPA 4WK8F 2XKOA 3CLOA 1DPRA 4P9UA 2Z33A 4HDVA 1KU7A 2H6BA 3GZ6A 1T6SA 4RAYA 2L4AA 1Q1HA 2Q8KA 1LJ9A 5JI6A 1IRFA 4OMYA 2XAGA 3KLOA 3VODA 3J81K 1ZRFA 2DFIA 3I71A 1SFUA 1XGSA 4I98B 1ZG1A 3ZMSA 5E8IA 4I0BA 1EH6A 3F3XA 2D1HA 4IHTA 1FYLA 1D5VA 4HLYA 1FYMA 2R7FA 1LDJA 2ZKZA 3LA3A 5HLIA 3MZHA 3VB2A 4BAYA 3H3UA 3SFZA 1R58A 3CUQB 2E1NA 3R0AA 2K02A 1OYIA 4U88A 1V3FA 1W7PD 4ZYEA 4AIKA 1W5SA 2GWRA 3FF5A 5H6QA 4I01A 2L01A 2FBIA 4M74A 2O03A 3KP3A 1R22A 5BQTA 3FXQA 2JPBA 4YFXF 4A5MA 1JGSA 1A04A 3L7WA 3I53A 4XLPF 5FD5A 3BJOA 2PMHA 3Q9VA 1FNNA 1FZPB 1F9NA 3F23A 1IRGA 3KFWX 2FMLA 4ASNA 2E7WA 2EV6A 4GGGA 2XUBA 1BI1A 2XASA 2DQRA 3RPUA 4EJOA 4HX4A 2J5PA 3RJPA 2DLLA 2HS5A 3KEQA 2DU9A 2W57A 3OOPA 5JFRA 4MTEA 4EJUA 3RDIA 4I0AA 4IRIA 5K1YA 4N9HA 2P5LC 1R5HA 1RNLA 2IJLA 2EB7A 4S05A 4MHGA 3CTAA 3FZVA 4RS8A 3LSTA 3P7NA 4TV7A 5J6XA 5D5VB 4QLCU 1B9MA 2YPRA 3DEUA 5DDGA 3FM3A 3KP6A 2HGCA 1FX7A 1V4RA 1MDMB 3RYPA 1MJAA 2HZTA 3BPXA 3JTGA 2FA5A 2IPQX 4RGUA 3ECOA 3MFKA 2DPDA 3DPLC 5ILSA 3FXRA 2A6EF 2FNPA 4ZZLA 5DD4A 1UB9A 1DUXC 2CG4A 1HW1A 5K5QA 4HF2A 2XVCA 2B0LA 2ZFWA 5IT9Z 2ADUA 5HDNA 4U7BA 3WGIA 3LQQA 3GWZA 1PDNC 1XDSA 4UVBA 1LDKB 4O6JA 2H27A 1YW7A 1P2FA
chains in the Genus database with same CATH superfamily
1FYKA 4DUYE 4OAYA 3I4PA 4A69C 1TNTA 4AIJA 2HPMA 2EN7A 2BV6A 2VT2A 3OR1C 2OF7A 3EPZA 1FMVA 2RAEA 2EOOA 1ENHA 4B4CA 1QZZA 2ELKA 1MIJA 5A6JA 5K7FA 4WF2A 1OLTA 1Z1DA 1SVMA 2W4SA 3CLQA 2JTVA 1WI3A 2FE3A 4J19A 2X48A 2JVGA 4RH8A 4WYQB 5IT9C 2G9WA 4XL9A 5ICFA 1IBKE 2V85A 2ZJQF 4ON0A 2NYXA 3LSJA 4Y52J 3S15J 3ASOH 3HYIA 3RIRA 2EH3A 1B6AA 5EG0B 2FXAA 1YITI 5K5OA 5FFXA 4LF9E 2M4GA 3OTOE 3TOBA 5KVRA 2LFBA 1MJBA 1SVLA 4I7HA 1ULYA 1VF9A 5HODA 5E3OA 1SEUA 3AL0B 4GO1A 4JI1E 3VSKA 1PP7U 5C4XJ 1WSUA 3ZGKA 1NEIA 1J09A 5EG0A 1YZ9A 2V8QB 1F36A 3G3ZA 3ELKA 1ERDA 3OYMA 3PUFA 3LSIA 2CJJA 3OS1A 4WSPA 1HKSA 2FD5A 1I3AA 1WRJA 1YJNI 4LB5A 1EH8A 4E70A 3DV8A 3X2QH 3QPSA 4UUVA 3LSKA 4IXAA 4L5IA 3CJNA 2KONA 4XNFA 4NQWA 4S0HB 2MGQA 1ZAOA 4HA8A 3FMRA 2NVXJ 2IA1A 2Y31A 2EMIA 2K9SA 4A0ZA 1GT0C 4LF7E 5E3LA 1FPQA 4B09A 3T1HE 5CVIA 3HPZA 2UV1A 4UB8C 1TTYA 2YU8A 5ICGA 2VE7C 4XLCA 3D0SA 1KU2A 2V6EA 2VIXA 2QZ8A 2UXDE 3JRDA 2QKMB 1LDDA 1DDNA 3DBHB 1MH3A 1IN7A 2L8TA 3IWDA 5K7HA 4U0VA 3FXMA 2EN4A 1QO0D 2PLYA 1MZBA 4A3DJ 4BXUA 1E17A 1ORKA 2FQ4A 4M9XA 4JI4E 5GADJ 3G71I 4KIBA 1T56A 3DKYA 4IQJA 3GXOA 3D5LA 3V7SA 5LHGA 2KOUA 1BJAA 4YIRX 3I55I 1ZREA 2VUMJ 3S3OA 4K0KE 5TISC 3H0GJ 2OQGA 3IHUA 2JUGA 4PGHA 1GV2A 1BR4A 4QSHA 2MLGA 4CZCA 3PQJA 1J0RA 2VOOA 5L3BA 3IWCA 5CFFE 2MD5A 3DLLF 1J75A 2EL5A 4LLLA 4DV0E 4A6EA 2EWNA 4LG3A 3HOTA 1GTKA 1A1KA 1LEAA 3QOEA 2HPIA 3CUQC 4AIDA 1TQIA 3DTEA 1IW7F 4EV0A 1R7JA 1KU9A 1BBGA 1HR0E 4O5GA 3F6HA 4F9CB 4KDPA 3K10A 5DYMA 1D1AA 4BJ6C 4DW6A 3BGHA 2EILH 4B43A 1DU0A 1I94E 3IH2A 3KP7A 2Q2EA 4NDLA 3KP4A 4BDYA 3IWBA 2HFHA 1MMAA 2R7TA 1XD7A 5DTDA 5FD6A 2KHXA 2EOQA 2L7MP 4UVAA 1Z0XA 2P81A 3OL3A 4XRSG 4E7LA 3HJEA 3GTPJ 3JRAA 2JJ7A 1CF7B 4HNTA 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 2STTA 2EMGA 3HTXA 4ESJA 1DQ3A 4IVNA 5CLSA 4BGDA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 2M0MA 1JK1A 1IO2A 3R60A 5ED4A 3M4OJ 2MH2A 1CGPA 2YTIA 2EFWA 2EPXA 3JSOA 1ETYA 1QRYA 1N32E 2LLKA 5J8FA 3WTYC 4AWXB 4M3DA 5HVQC 2XAJA 1ON1A 2JYAA 3WE3A 2K3FA 3BCAA 3G73A 5FLMJ 3L2VA 1G3SA 1IZ1A 3F9KA 5HLGA 3HHGA 5E8GA 2DOEA 4M3BA 2UZKA 2E35A 2F4MB 1G8XA 2OCCH 3QOPA 2JOBA 4ZYDA 4E7KA 1KYWA 2UXXA 1VQPI 4XSZF 2V86A 5J4YA 1DGRM 3DPTA 1FLIA 3CC7I 1OJLA 3NEUA 4XKWA 1D5YA 1RZ4A 2VKDA 5F1JA 1I6XA 3DP7A 3ESWB 3PO2J 5FKOA 3RZOJ 1WVRA 2BYVE 2K86A 2WAFA 3GUDA 1XGMA 1Z7LA 1P7JA 2PI0A 1BN5A 3BG9A 1BBOA 4RA2A 1DP3A 1QVTA 4LFBE 3MZ8A 3QODA 2KIFA 3GYHX 2DBBA 1FBUA 1UBDC 3BCBA 3R6SA 3SZPA 3OYBA 1LFUP 2K40A 4FK5C 2UUBE 5LFAA 1VI0A 1I27A 3MCZA 3REOA 4ZDPA 5IP9J 4PJLA 3L9FA 1R5GA 2I10A 4IZZA 1XNQE 3ZOBA 2EM6A 2GA2A 3WTZA 1TT5B 3UKGA 1VQ6I 5LMUE 2LP0A 4IPAA 4P7DA 3M8JA 3E6MA 5M3FJ 5LL6R 4IRGA 2FRHA 5FO5A 4E6KG 1UHSA 4YFKF 3AG2H 2G7UA 2JT1A 4X8WA 1P7IA 4KISA 2DT6A 4R2DA 2L2MA 3CC2I 3H9GA 1T38A 4CYDA 3LSPA 5F04A 2XPUA 1QU6A 1A1HA 5M5WJ 3ZQGA 1WXRA 1ZRCA 2FSWA 4BDZA 2DOAA 1LLMC 2NS7A 2QENA 2ID6A 4QPOA 4J8ZA 5KL4A 2UUZA 4LG0B 4DZPA 2DA7A 3TQNA 3GBGA 4RBOA 2ADRA 4LLGF 4P1WA 1REPC 2CUJA 3ABTA 2NOGA 5EEHA 2GXAA 4RB3C 1TNSA 4HV5A 4K2EA 1OYWA 3CJTB 2XGDA 3ONQA 2LJHA 4AU7A 2X51A 3IAS2 3C7JA 2ZC2A 4MFEA 2AS5F 2W00A 4KYWA 2FU4A 4IHYA 2NOJB 4DR1E 1QGPA 2HWVA 1AKHB 4RM2A 4BL0B 2B9DA 5IYDJ 4BEHB 2F5CA 4RAGA 1NK2P 2E1MA 2YTGA 2VE9A 1Y39A 4FASD 4HDUA 1X58A 5K7ZA 3S16J 2LVHA 1AA7A 2YTJA 3ROUA 4ESBA 3OYAA 2VBZA 2DK8A 2XDVA 1TWAJ 2E34A 1EKZA 1QNTA 4ENKA 1VZ0A 2L9NA 4XOTA 5FFZA 2EA2A 1OCCH 3AV0A 1AH5A 1ZR9A 1BC7C 3TKYA 1HNWE 2DQLA 2GXBA 1X3CA 2DMIA 3QYFA 2EPAA 1B72B 2MSYA 2BE5F 4BXFA 5J8CA 2YU9J 1X4PA 1TF6A 2A61A 1ETWA 4Y33A 3F6OA 4M71A 4X0GA 2BVMA 1U5TC 1LVAA 3MAJA 1JE8A 3BJAA 2CYYA 4D0PA 2C6YA 5IXMB 3G4SI 5D8LB 5E20A 3MD2A 1A6IA 2GAUA 1X1CA 2MW8A 4XR6A 5D4SA 1D8JA 2JY9A 4XM3A 3ZPLA 3VSLA 1IXRC 1W1WE 3OS2A 2L2KB 1X47A 3M1CA 2WWYA 4BACA 2VJ5A 1G2HA 4G6TB 3QPLA 4R8OA 1JUSA 2DTRA 5FKMA 3WE2A 1JK2A 4OWRB 1LFBA 3JRFA 1IJWC 4M9ZA 3HTSB 4BY7J 1AHDP 4CICA 3JSPA 1B1BA 2NXNB 3Q9SA 1AU7A 2YRKA 4EGZA 5JR3A 3PFIA 4EJTA 3AL0C 2R1FA 2EM9A 2KKOA 3SZGA 2LO3A 4B48A 3Q0VA 3S93A 4N4OB 4KITB 4FX0A 1HDDC 3ZOQB 2ZSHB 3MEXA 2KLOA 4BEHA 3ZQIA 1KYZA 5L3FA 4CDGA 1AKHA 4BBSJ 1T95A 2LDUA 1QU3A 4M3FA 2D5VA 1T39A 1XMAA 1MD0A 2WAQN 3QQAA 2KRFA 2DODA 2EM8A 2OV7A 4Q48A 2DFHA 3BZKA 4G7HF 2PRTA 3DCFA 1PKPA 4R2SA 5D6FA 1YW9A 2EFOA 4LFCE 4DV3E 3HOWJ 2VI6A 2CQ7A 2EZKA 4LJZF 1LE8B 3RSNA 5FB2A 5EGOB 2PFBA 1GDTA 5DUKA 1HA8A 1Z9CA 2XRNA 2BGCA 1KONA 1QPMA 3FHZA 3VYRB 2LD5A 4DR7E 2NVTJ 4M73A 4ZYHA 2Y2ZA 3E5UA 3OIOA 4MQ9F 2Z5UA 3GZ5A 2L9SA 2RV8A 2LCEA 2YSPA 4B3ME 2W1OA 2YRHA 2JP9A 2XRLA 4X6AJ 1Y0UA 1TLHB 1KQ8A 4R2QA 1VNDA 1ZGJA 3TO7A 1RI7A 5KK1A 5L3GA 2X6OA 2RC4A 4LK1F 1IGNA 5EJCA 3V8JA 2NUEA 4EEFG 5E18F 4AYBN 5HS8A 4HX8A 3DTKA 2D2WA 3LSHA 5A6AA 3W6JB 2FOKA 2IS2A 1RC9A 2WA0A 5CJ9A 3CO7C 5ERIA 1K78A 2CV0A 3FISA 1ZH5A 1MBKA 3J7Yp 1BW6A 1X3WB 1DP7P 1ZARA 3THNA 5LGUA 4UV8A 5GAHJ 3S3NA 4NXME 1VFCA 2MKDA 2V9PA 3GZNB 4EM0B 4M6XA 1F5TA 4ESFA 3KPHA 3OYFA 3OS0A 2N3GA 4ITVA 5KL5A 4L18B 1WFXA 3CMMA 4L5JA 4ABZA 4C2MJ 1NCSA 2QQ9A 4A0YA 1YLFA 1FBSA 3CDLA 2KDOA 4Y7NJ 2B9SA 2B3TB 2DAOA 3ZQQA 4GKJE 2GIVA 1ZGAA 4QIWN 4I02A 1A1GA 3ADIA 3BR5A 1YG2A 1NTCA 3R0JA 1ON2A 1XGNA 4JP0A 1LNWA 1D0ZA 2CMPA 2VXDA 4CHUA 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 3EDPA 1GZ6A 2VQEE 1S5LC 1X1AA 2R7OA 2STWA 1F43A 5H20A 3IH4A 3QPTA 1O57A 4PFOA 1WJEA 2XAHA 3HGYA 5GPAA 3KIOA 1ZQ3P 1T4NA 5FKKA 4YELA 3HOYJ 1Y6IA 1SD5A 2ZMEB 4JI6E 3FBNB 3ZMTA 2LBFA 2EMCA 2LF7A 1N78A 2EBIA 2BXZA 4WXCA 3FXOA 4CUGA 3QPHA 4D1QA 1XSDA 4LMYA 2Y48A 2UWMA 2QBYA 3VYYA 2CGPA 1BIBA 1PUFA 2P6SA 1MBJA 1ZLJA 4HBLA 2EOJA 3J7YJ 1B8IB 3T8RA 1R23A 1SFOJ 2DMYA 4NXNE 2YTNA 2RDPA 5KL3A 3U2RA 2L7KA 4S04A 3VHTB 2BBYA 1YYVA 1JKPC 3CO6C 2ZNZA 2HDCA 1MNDA 2IHR1 3EUAA 4KN7X 1T08B 5D6EA 5E17F 1I1SA 1XDUA 2CQXA 3OYLA 5FLXK 4JI3E 2EORA 2FOWA 2R7QA 1IN8A 2M8GX 5CKTA 1MMGA 4RAFA 5BPIA 1F2IG 2N8GA 5D4RA 4Y4RA 4WXDA 5BPDA 3OOUA 2FBHA 2DLKA 3V7RA 4G8XA 5F0HA 2OU2A 2RN7A 3F6VA 2M2EA 3G2BA 3ZMUA 3ZXSA 5F1RA 3LAPA 2ELHA 2LBFB 4AM3A 3OL4A 3VDXA 4KICA 2OZUA 1MSEC 4X65E 2BY2A 4KT6A 5J47A 1Y1WJ 1I50J 4GZNC 2QEXI 2RNGA 1IN5A 3OV8A 3HBLA 3P9KA 3ERMA 3BTCA 4GCVA 2IBDA 1UG0A 1CQTA 3OYHA 1IUYA 5LBQA 3K2ZA 3J81C 1R4NB 2DDBA 2NA2A 4GFBA 3BR1A 1PP8F 1G4DA 3FKJA 5CPRB 4ZZDA 2RS7A 1QZYA 3KETA 2IRFG 5KNLA 3PO3J 5AE1A 1WH7A 4CCNA 2PJRB 2MDRA 3LFUA 4AIHA 3EYIA 2HOEA 1HNXE 2G7HA 2BB8A 5HDKA 2CFXA 2DDAA 5DCFA 1K7AA 2EFNA 3KEYA 3BZCA 4YIFA 2QSHX 2CUFA 1MMSA 2EM0A 3F8NA 3S1RJ 4HNVA 3LA2A 2ID3A 1JJ8C 1YYOA 2E5NA 1O3QA 3AG3H 2YTPA 3BZ6A 3FMQA 3ISPA 4G6QA 2MC3A 5FLXZ 2CW0F 1Z67A 1X4OA 2PMZN 5GP9A 1AOYA 1N77A 4IHWA 1LB2A 3BR6A 3P9CA 4OIQF 5DCMB 1LVKA 2MH9A 2KJBA 2A6HF 1UAAA 4OMZA 1UILA 1UG2A 2GIZA 3DXJF 1RC7A 2CU7A 2IGNA 5H6RA 4E7ZA 1W7PA 1MNEA 2PMUA 3JRBA 1YUJA 3VYXA 1S7EA 3ECHA 3E6DA 1SFEA 4KMFA 3OSGA 2X1CA 3M1EA 2QVOA 1XN7A 3CP8A 3PM1A 3TO6A 2D1VA 1T33A 2DJIA 4I8OA 2H27A 2CQNA 3GTJJ 2ME6A 3I5UA 2JPCA 2VPRA 4MEYF 4HG2A 2NVUB 5JLXA 3H9JA 1DPUA 2L92A 3ML6A 1J5EE 3PNTA 3TEDA 1FJLA 4YRVA 3DLAA 3B6CA 4X1EA 2VONA 4FQGA 2A5YB 2CW8A 4CSWA 1UELB 3IKTA 2LY1A 3ADJA 3GF2A 1RR8C 2XIGA 2YWQA 4UB6C 3A03A 3I59A 1P4WA 2WAQA 5J3LA 2DXIA 1XSVA 4LTYA 4X66E 3L2RA 1EH7A 2ETHA 2F48A 4JYKA 3MKZA 4OIRF 2Y69H 3CCEI 1B69A 3J80Z 1DGCA 4L0ZB 2M3AA 2DTZA 3C4TA 2YTEA 2BHZA 2JZYA 5FGMA 5EGOA 1TQMA 3HUGB 4N0BA 2DW4A 2IS1A 2EOIA 2DMTA 1XMQE 3LWFA 3LSMA 4F91B 1VQNI 4KMUX 2EV0A 3E97A 2NNNA 1IV6A 4RB0A 4H0EA 2V83A 4BHBA 4F54A 4YY3E 1ZN2A 4UV9A 4Q35B 5M5YJ 2DLQA 3SQNA 5GPCA 1ZBTA 1JJ6C 5A2QK 4NHJA 5KL6A 1XC5A 3I64A 2QM3A 2E2HJ 3O8HA 3DJWA 1F4KA 3PUBA 1S8NA 5DS9A 4OINF 2EPCA 4BBYA 1WPKA 3Q3SA 4OU0A 4E4HA 2EPNA 4IF4A 2BW3B 2LH9A 3QYEA 4HZFA 2M45A 1U78A 3CCRI 3HB9A 1FP2A 4XIDA 1B59A 1U5TA 1S9HA 1YUIA 3W2VA 4ZYGA 4IS1C 4I09A 4G94A 3KEOA 5T6JA 2VQFE 2FBKA 4UUTA 2Z1DA 1B72A 3JAMC 2YTQA 2F5VA 2JWOA 5HS7A 3WG7H 2QBYB 2QWWA 2VC0A 4NNJA 1ZRDA 2M7QA 2D9HA 4AUXA 3WTSC 2DSYA 3VFZA 3QP6A 3GO5A 2M1SA 2E1MC 2KJCA 5DD8A 1VQKI 2R7WA 2L6MA 4DOZA 2NNYA 3GLLA 1FOWA 2HYGD 2IGMA 1TWCJ 5BMZA 1J7KA 1ACIA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 2DA4A 1G6NA 2EZIA 3E6BA 4A3GJ 2HGHA 2B63J 2CQQA 1ODDA 2VOPA 4FCYA 2PBIA 1JHHA 3CP2A 2ODRC 2P4WA 1N34E 4R1HA 2V26A 4A3BJ 4F2JC 4LIVA 4JI0E 4B3RE 3BOQA 3Q5FA 4CCLA 4PJ0C 5A2QZ 4NHRA 1IQOA 3SXYA 4A5NA 3EQ1A 2LUPB 2OPTA 2XF6A 4LG0A 3RKQA 3DWLE 5IT3A 5EEAA 2K3PA 3I9V2 1IQSA 5KL7A 5E3MA 3V7CA 2V1XA 1RKWA 4U7DA 4MIMA 1WJDA 4Q5SF 1LEBA 4EM2A 2DIXA 5DNYA 3J7ZI 3ASNH 1VQ8I 1I1GA 3K1PA 3CCVI 3BF2A 2DI3A 1BOAA 3GEZA 3BC8A 4C9YA 2JRMA 4BJ5C 4F92B 3GFLA 4MLQA 5J4VA 3EETA 5L3CA 2XHKA 2ZSIB 4KT5C 1BM9A 3FK7A 1VQ7I 2EM2A 2X6YA 1O3TA 2CWEA 2OAZA 2EL4A 3B02A 1S6LA 2IXSA 3GTKJ 5D5WB 5CVUA 2F4VE 2OD5A 1USTA 1IBME 2NUFA 2R5ZA 2IW5A 4A3CJ 1RIOH 2ZM6E 4BJTA 2V1DA 4KFCA 1WHUA 2EMLA 4Y13A 4PFPA 2LC2A 2V79A 3N97A 4KWYA 2WC2A 4JX5A 1OFCX 3QP5A 5C44J 2O6GE 3MWMA 2RPCA 1PYVA 2L3CA 2E1CA 1S7OA 2ZMEC 3VYUB 2B7VA 2EWLA 2W85A 4XN3A 3FDYA 4A3FJ 3NQOA 1RQ0A 5AC4A 4J01A 4I76A 3G1MA 2VJ4A 3K9TA 4UNOA 2JA6J 4X62E 3HOSA 1ETXA 4UUSA 4CO8A 2M5WA 4R2AA 2KZGA 2E19A 1ZG3A 4OAZA 2EOSA 2FF4A 1C0WA 1NHAA 2IS4A 2R7UA 3IUOA 2KT0A 4C3JJ 2DPUA 2RKHA 4N4RB 4MNUA 1N36E 1A1JA 3TP0A 2IEKA 1SANA 3RKWA 2EN8A 2ZJPF 1Y1VJ 3L00A 1HW2A 3K4JA 4PSWA 5AIQA 2KZVA 2R76A 5IY5H 1ZK8A 3L2WA 3VPRA 5AC5A 1YX3A 2A68F 3V8LA 2LKXA 4A0XA 3C2BA 2DMQA 3BJ6A 3CMYA 4DV6E 1RR7A 3I0TA 3K70C 2HR3A 2W25A 2LTRA 4KN4X 5LLQA 1VQ5I 1FSHA 2EMXA 2D45A 3HOZJ 1W5TA 4IOCF 1MNMC 2QA4I 2XV4S 1ZLKA 2EJRA 5JHFA 3DF8A 3KZZA 5B1BH 2KDZA 3SJMA 1MW7A 2QQBA 1LPQA 3U1KA 1X1DA 1NK3P 3RPUD 5IP7J 4DYRA 4GRIA 3CCUI 2Y0MA 2MABA 4JK1X 1P92A 4GDFA 2QKLB 3L2CA 1TW2A 3KZIC 4G9YA 4DYCA 1OISA 3P5JA 3VYSB 3EPJA 3HSFA 2OJED 1JUMA 2NUGA 2Q2EB 4GXOA 1RESA 3K7AJ 4PGGA 3IRQA 1SR9A 3LFKA 4XSXF 1P4AA 3NAUA 3K4NA 3GFIA 2MKNA 2JOXA 2A25A 3WTUC 2NVQJ 2A07F 2F4OB 1XSXA 1FSEA 5B66C 2Y75A 5D8KB 1CF7A 3MZYA 1L3LA 3S32A 3AG4H 3QYBA 3E5XA 3FX3A 5DV5A 3ULQB 3M9AA 5F0CA 3HC7A 3CCSI 2QYOA 1XMKA 4BQOA 4HQMA 2COMA 3GLXA 3DBRB 4JQFA 3ECRA 3FXLA 2M30A 1Z7UA 4LFUA 2FV4B 4R2RA 4BHCA 1DGWY 4PDKA 1E3PA 3S1NJ 2CRGA 2VQHA 2ECCA 2GBYA 3DQVC 1OMIA 3IKVA 2PEXA 5F0FA 2E71A 5F64A 1XB4A 2IVMA 2EN1A 2M4KA 3M07A 4MLVA 1D0XA 1YX5A 4Z6YA 4AQYE 1TWGJ 3E1SA 4YFNF 3WU1B 2MD0A 3DKWA 1U2WA 2G0EA 1H9TA 2OA4A 5ICEA 2EM4A 3R61A 4DKKA 2KQRA 4R79A 2VQLA 3T5XA 2K4BA 2MC5A 3K70D 5LGNA 4DBQA 1VQMI 2WBSA 3FXKA 4X64E 1KZHA 4KA4A 2JA8J 2LNBA 3BQZA 2F2EA 3FMSA 3HGGA 4KUMA 4HNUA 3CQZJ 2EOYA 1KQ9A 2L2OA 3GX4X 2V9VA 3UNGC 3MKWB 2BW3A 1OR7C 3HHHA 4NC7A 2K5CA 1HW5A 1YOVB 3FHNA 1POGA 4UHTA 2HTJA 1WWXA 3WGHA 2NS0A 4FX4A 2EIMH 2VODA 4L5NC 4M72A 3N4MA 4Y3OA 2XAUA 3T8TA 5AONA 2YPNA 2EMYA 4GYGA 4E7JA 1YS6A 3OYCA 1VQ4I 3S8PA 4BH9A 1HNZE 3TW6A 2DGCA 3L09A 2DK5A 2H6CA 2CFOA 1MSFC 1X6EA 3HZJA 1WKMA 4XK4A 1IRZA 2CW7A 4HYEA 5ICCA 2F5DA 1X2NA 2RQQA 3FXJA 1Z6TA 1GHCA 4ZTJA 2HEOA 3K6QA 4BC9A 4MEXF 4B8XA 1IXSB 3F8FA 1OKRA 1YS7A 1GQEA 1IAWA 1H8AC 4JOMA 3LMMA 4E7SA 4RB1A 4C2UA 3JTHA 2CV1A 2OBPA 1BI0A 3VWBA 5JVTA 4ENNA 4OOGC 5C4JJ 2EPFA 2XAQA 3S14J 2OZ6A 2LTPA 1HXDA 1BI3A 4WX9A 1XG1A 1PDAA 3ZCOA 3A0HC 2YTFA 3OMLA 3JRHA 2WB1A 5DM7F 3DF6A 2DRPA 1QBJA 4L0YB 2FNAA 2CO5A 2Y9YA 5KHDA 3KYLA 1LQ1A 1E3HA 3E3VA 1UHZA 4JI7E 2IA0A 2EIJH 4NQWB 2HKOA 4XKCA 3BT9A 2TRTA 4Q4ZF 3H9QA 1FEXA 1DQUA 4F3QA 2M0CA 4MQVA 3SEQA 4ENJA 2EMAA 1W7PB 1P6RA 4M6YA 2K4VA 3CD6I 5AASA 2LR8A 2ZXIA 3Q0UA 1USSA 2AQFA 4XQFA 3CDHA 4ENMA 1K79A 1J59A 3HRUA 3S2HJ 1O3SA 5BS6A 5AE3A 3A0BC 1SAUA 1FOKA 1T98A 4AYBA 5JLWA 1YO5C 3AAFA 2OC6A 3BIDA 4P9FA 4BE0A 2EZHA 3CJQB 2GXGA 4EQQA 4FTHA 1Z1BA 4F55A 3CCJI 1YE9A 4C3HJ 4AD9A 1N3GA 5IPAA 3TO9A 4NZVA 3ZR8X 4BYYA 1MBHA 1YFHA 2LMDA 2JXPA 4BHPA 4IL6C 1S7AA 3T1BA 3MMYB 1UN6B 4XRMA 2KL4A 2NVYJ 3FIGA 1MEYC 1X5WA 5A69A 1QQIA 2IGOA 3C2GA 4WPYA 2V6CA 3TP3A 1KU3A 2UUAE 4E7HA 2UXNA 1K4TA 2HQRA 2R7ZJ 3ADGA 4B3SE 2JSCA 4CH7A 2XROA 2GZWA 3M7GA 3RYRA 4L8NA 1U9NA 4YG2F 4F52A 2KIUA 4IOAF 1GXQA 1MBFA 2HDDA 3C6KA 2DFFA 4Q47A 2YX7A 3BROA 4B3XA 1HLVA 2Q1ZB 2EMZA 1J26A 2ISYA 2VC1A 4HQEA 4G12A 2RVCA 1PUEE 2DN0A 2YU5A 4R03A 3E0JB 1HF0A 4L9NA 4JI5E 1BC8C 4CCKA 5KCMA 2EFQA 2EL6A 2K9LA 1VQ9I 2HU9A 3QRFF 1P47A 4A3JJ 1BIAA 2HI3A 2XGCA 4O5VA 5D5XB 1RPWA 1JUPA 4EGYA 5FRNA 5CVJA 1IDYA 4QTRA 2QQ8A 1D3YA 1ZGWA 2QGUA 1H9GA 2ZMEA 3ZMDA 3SYTA 3CESA 3ERED 2L3DA 2GOMA 2HJJA 2ZJ2A 2EZLA 3K4KA 5TSEA 3HG9A 1IXCA 4WCGA 4LOCA 3GTLJ 1G3WA 3KZYA 2IS6A 1ZR2A 1R1UA 1WCMJ 1IUFA 1Y8RB 2QLZA 4AVPA 4LB6B 2HZDA 3WG9A 1Z3XA 1O7FA 1YJ9I 4DV1E 1U9OA 3OYEA 2K9QA 2P6TA 2XPVA 2P0WA 2YUSA 1JHFA 4HEIA 4GKKE 4O43A 2XB0X 4RGSA 1X49A 2EFPA 2OTJI 2VKVA 3HKZN 1GV5A 1TT0A 2WY7Q 3I56I 3BDDA 3KP2A 1LUJB 2E5ZA 3S2WA 2WBTA 3K1MA 4DQ2A 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 3THOB 3FK6A 1W36C 2JR1A 1IMUA 1KGSA 1BB8A 4U0YA 2L4MA 2WAEA 4ZTFA 3M99B 2KIMA 1JKRC 1W4MA 2GA1A 3F8BA 4ZC3A 4Y17A 4A3IJ 2AQEA 3QU3A 2O8KA 2CT1A 1ZR4A 2R93J 5E1WA 3F6GA 5DUIA 4HF0A 4DUZE 4FT8A 1OCRH 4N4NB 1R9TJ 1EA3A 3DKXA 3GFMA 1V55H 1J5YA 2IA2A 2DT7B 1UHWA 2HDWA 2L9VA 2E1MB 1N25A 4F6MA 2E72A 4B3TE 2PQ8A 2BY0A 5FROA 2W84A 4DNCA 1N75A 2V9KA 4KIGA 1SFKA 2DYRH 1A35A 4CYCB 2Y30A 2LVSA 2IAIA 1I3QJ 4PUSA 1X3UA 2EM5A 2P7VB 3CJRB 1W5CC 2JRTA 4A93J 2VPLA 2HC5A 2N8XA 2VJIA 3L2QA 4IJDA 2EPZA 3GVAA 2BY1A 3KLNA 4XICA 2KPMA 4HAMA 1J9IA 3HIFA 1UHMA 2LKSA 2BEOA 3H35A 2O3FA 3IWFA 2F5FA 2EPKX 2V1NA 2ZBKA 1T4LB 1U8BA 4G6DA 3MN2A 3CUQA 2YX4A 3WODF 3PSFA 2LY9A 1ZBQA 1UFMA 5J1YA 3SDBA 2Q8UA 1H89C 3JRCA 4IRHA 2EPMX 2CV2A 4L9TA 4XLAA 4I99C 4BY1J 1HQCA 2KISA 3JW4A 4P5OA 3M3YJ 1F1ZA 4EM1A 3J7AG 1IG7A 3ZN0A 2KIQA 2VBWA 3W2WA 3W2AA 2RSMA 1G3TA 1K83J 4M30A 1ZHFA 2YSRA 5K5RA 3OMYA 4LK0F 1R00A 2I13A 4IHXA 4JI8E 3I58A 3E5QA 4PZJA 4UUSB 1RMDA 1ETVA 2E7XA 4ZYAA 5IT9K 2L9RA 3DEEA 2JMWA 2EOEA 2L2NA 2V88A 5BOXA 4CCMA 4UXNA 2W24A 3N05A 1U6GA 3IV5A 2ECBA 3P9IA 2EMHA 4PJMA 3RQ4A 5M3MJ 1OCPA 1P9QC 4BQQA 2EOFA 1W0TA 3K6GA 5HNFA 3W6KB 4IHVA 3LL7A 3A01A 5J40A 1HBXG 4A6DA 2HOAA 2EE8A 1YW8A 1K4SA 1MH4A 2HXIA 5LD2C 2V1UA 1Z05A 1BL0A 1PVEA 1MMNA 1H0MA 2BY3A 3W3CA 2R5ZB 3HTUA 3C18A 2VLAA 2KMUA 2A6TA 2Q0OA 2RQPA 1YIOA 2ISZA 3HPHA 4HF1A 1YPNA 2LV2A 3BG3A 5GAGJ 3O8GA 1OPCA 4IKFA 4YHHE 1J2XA 1E2XA 1T0FA 2EM3A 5IYBJ 1XCBA 2QSGX 2VE8A 4EATA 5DM6F 2VKEA 1WH5A 4HV6A 5AE2A 3ABKH 4DIQA 1T8IA 2ZFUA 3T0YA 1MGTA 4RGRA 3JRIA 2XKPA 1FOYA 2AHQA 1YQAA 5TGTA 1ETKA 2ZNYA 3RPQA 5FJ8J 2IGKA 1S29A 2UUCE 1FJGE 2JWTA 3FWEA 1WZ2A 1Z91A 2DA2A 2GLOA 1IBLE 4A3LJ 4NC6A 5ILUA 4L9VA 4N9IA 3BQYA 4C30A 3DU5A 4M9VC 3CCQI 2LYCA 1XCVA 1YIJI 2ENCA 3LMLA 5IP6A 1JGGA 2LTSA 3OYNA 1NG6A 3C4BA 1TWFJ 5EZHA 2EPPA 4EJWA 2EOZA 4HEA2 2EQ3A 3WHBA 3H36A 4ZH4F 1ZAAC 1R71A 4OIPF 1XTAA 3WU0A 2ME0A 5E1ZB 1FMWA 1HDPA 4DV2E 2H09A 1JXSA 1L4SA 3CCLI 3S2DJ 1SMTA 4A3EJ 3HOVJ 3H09A 3OYDA 1VTNC 2WTEA 2ZJRF 3VOEA 1H88C 2HXOA 2XF7A 3F72A 3GMEA 2EMFA 1RKTA 2NAZA 2TCTA 2X0LA 2YR2A 3B73A 1YHQI 3HQ1A 3WTTC 1V5GA 3QAHA 1YI2I 3ZQFA 2PG4A 4BQAA 4HLXA 2XB5A 1B9NA 5E1XA 3OYJA 2P5VA 3F21A 2VRDA 3MKYB 1NH3A 1JTYA 2R7VA 1IRXA 1KA8A 3IRRA 1PJSA 5JVGF 1ZTRA 3BTJA 5IV8B 4A12A 1U3EM 2H36X 1WGXA 4LFAE 5F3WA 2EOHA 2JN6A 2WY8Q 1R1TA 2BOLA 2CH0A 2XGEA 2R7DA 3BP8A 1Q1VA 1HOMA 2AXTC 2K85A 5CQGA 2HVQA 2K9NA 5D5UB 2GPIA 4KJZA 2ZO4A 2ZXJA 2VT3A 2A5WA 3HEFA 3KX2A 2HHHE 1G3YA 4XBFA 2HVSA 5TJJA 2DA5A 2UXCE 3KP5A 3M8EA 4AC0A 1RETA 1SVOA 4JV5E 2L02A 3JRGA 1X48A 1XS9A 2F5EA 4OIOF 2FTXB 3I3LA 3KCCA 4G7ZF 4JX6A 1AWCA 2BHYA 3I59B 3EYYA 3E7LA 2LKPA 2MLKA 2X4HA 4ZJZA 2YT4A 3W6VA 2WBMA 3KYCB 1UMQA 1FOXA 1JKOC 2FEZA 3IWZA 2JK3A 3TW7A 2B7EA 2DYSH 2ZXWH 2RQLA 4EVIA 2OQRA 4UY8I 5HOOA 4MTDA 1OYYA 3O2PE 3ZP5A 1U5TB 4MO7A 5LEJA 1SAXA 4IEJA 4CZZA 2O7OA 1X19A 2XGXA 5L3DA 2EN6A 2UU9E 4P96A 2CSHA 2ELJA 2QSFX 3OIQA 4OOIA 3SDGA 4FETA 4LITA 3H3VK 2EV5A 3WTVC 2X6XA 3AKZA 1QHHD 1A31A 2VJJA 1ONVA 1FTZA 2VQGA 3GFJA 2PMZA 3MVPA 1SFXA 1R1VA 2CUZA 4TUGA 3S1QJ 2TDXA 3DBLB 1HKQA 2JVHA 2L7FP 1IN6A 1QVUA 2MYSA 5C3EJ 3TQMA 4RGXA 2YU3A 2P7CB 1XPXA 3H92A 2XC7A 2O8XA 2R7SA 2Z16A 2H94A 3HL2A 3HOXJ 1O7LA 1OR7A 1G59A 4F7ZA 1HCRA 3CDIA 3J80K 3GCMA 4CGZA 2J7JA 1IN4A 1U8RA 1MBEA 3HUGA 4ANJA 2CPNA 1BI2A 2ICWG 3PJRA 4TUIA 2KP6A 1GVDA 5L3EA 4O4KA 4W1UA 5E3NA 3BPVA 4BE2A 2OUMA 1ZELA 2EN2A 1WHQA 2Z2SB 3EUKL 1GLNA 4EMSA 3BG6A 4L5EA 5LHIA 4NB5A 3J80C 3QU6A 1KJKA 4LLNA 4LD5A 3T1YE 1XNRE 4U0WA 4CYCA 2UXBE 2MBFA 1TZLA 4CA0A 3ZN1A 2DMUA 2P5KA 1D1BA 4BUPA 3LSGA 4XLHA 3A2KA 2BXYA 1G2DC 1X3ZB 5JHUA 3U21A 3WTWC 3PFYA 3EUHC 1IV8A 3ZQ7A 1EF4A 2EOXA 1JTXA 4DBRA 2RNJA 4W97A 3JAMZ 5EEGA 3RKYA 2HYJA 2MDGA 3U9GA 4LGWA 4MGRA 1O3RA 1SMYF 1EV7A 2A05A 2P8TA 2V4JC 1IF1A 5F6FA 1P4XA 4CXFA 3CF5F 1V5EA 2JA7J 1Z6RA 3EQLF 2WBUA 3PL8A 4QWQA 1TF3A 5IYCJ 2M8EA 4RDUA 4JYAE 4JBAA 4R8HA 4R2CA 3GTOJ 1UCRA 1D8KA 3LAJA 4F93B 3C3WA 2R92J 2XSDC 1FWZA 1WI9A 3FBIB 5LRRA 2PJPA 3FKIJ 2Z99A 1EJ9A 1A1FA 3E6CC 2M34A 4H4KC 3H5AA 4RLQA 5A6BA 3BLYA 2GQQA 2N3HA 3HRMA 2WCC3 3JAMK 3IL2A 2M87A 3QWLA 4IHSA 3WGGA 2ENHA 3I4NJ 1VQOI 3KE2A 5EF6A 2E2IJ 4WXHA 4P55A 1WJBA 4HX7A 2IP2A 5CVVA 5J1UA 5IOYA 1RUOA 3AUZA 2W7NA 2W48A 3M8FA 4MLOA 2LK2A 4B1RA 1G2FC 6PAXA 2EMKA 3CCYA 1Z3YA 5LEKA 2HVRA 3U1DA 2ENAA 1ETQA 3NRVA 2IT0A 3BR2A 1T0FC 4JI2E 1R49A 1TW3A 2R7RA 2VN2A 3Q0WA 5CYVA 5HLHA 1YRNA 2HKXA 1GXPA 2PJRA 3NARA 4DGWB 4GEQB 5FRMA 3S3MA 3HSRA 3ABUA 2K7IA 5EDNA 1FIAA 1WJCA 2JA2A 1R6RA 2VB6A 5B5EC 1YRNB 4O3MA 3SEZA 2DA6A 1FY7A 3R4KA 2GHFA 1K61A 4XONA 4Q28A 3BBGA 5LHHA 1ITYA 2R0QC 1HC8A 1LKXA 1HSTA 2DA3A 1NG7A 2J5OA 2VKHA 1YJWI 2DMNA 2DO7A 3NWSA 2WV1A 2YZTA 3H0DA 2ACJA 5F08A 1B8IA 4CCOA 1T2KA 1E0EA 3H5RA 4M3GA 1K6YA 5ILVA 4YIIA 1XMOE 4BKXA 4X9JA 3RZDJ 1I6HJ 1WJ5A 2LRDA 4XMYA 5FKLA 3UR3C 3K1NA 3MQ0A 3K4CA 2FMYA 4BNCA 3LQRA 3J7AO 2O0YA 5FLVA 4LU9A 4AVZA 1X6HA 2HYFA 3HKZA 3BY6A 1BBYA 3IH3A 4NUBA 2A69F 5LRSA 2M1BA 3JCUC 5DEQA 4EJVA 1KYQA 2CUEA 1OCOH 2EP3A 3MHHC 3O6BB 4A2UA 2HQ5A 4C3IJ 5IOZA 1OCTC 4IX7A 1BW5A 2FJ1A 2FQ3A 1SD7A 2EOMA 1FIPA 2GM4A 2M7BA 4E7IA 3BWGA 5IWAE 2QF7A 2Y0SN 1L0OC 3ZQCA 3MKLA 2EK5A 1I39A 1OCZH 3DU6A 3A02A 4Y15A 3EPLA 3B6AA 1SD6A 3CMEI 4WSGA 2I8DA 2MA3A 4LF4E 4JX4A 1K78B 2KRHA 3ZMZA 3GTQJ 4RMNA 2M4IA 3CCMI 2JA5J 2VXZA 2KFDA 2RREA 2VL8A 3SZTA 4WWCA 5BR8E 4HOBA 1YYWA 2Z9OA 2CSOA 3H3ZA 4ETSA 3JREA 1FT9A 3LA7A 3LOCA 5DCMA 4HTGA 3TMOA 1A6QA 3CZ6A 3UK3C 1YYKA 4HSRA 2QCOA 4QPQA 4XKVA 3GW2A 1FP1D 1ZYRF 4XORA 2LBSB 4LF5E 4XLNF 3TBIA 1HSJA 3HRTA 4MFDA 4DR2E 4PSXA 3OWTA 1ZKGA 4D5FA 1ZU1A 4B3AA 2MG4A 2HOTA 4I2OA 3QG5C 4HSTA 1JT6A 2VQCA 4L9JA 5HNHA 4NBQA 2EZ6A 1STZA 4KHPE 3BTIA 4DV4E 1MBGA 4A3MJ 1O4XA 1I5ZA 1TC3C 2EINH 2JVAA 3RTRA 1KQ0A 5B3SH 3COAC 2K9MA 2OCEA 3CF2A 1B4AA 3F22A 5F27A 4BE1A 2FGGA 5AIPA 4BCAA 1MDMA 2ESNA 2K7LA 1TP4A 2E5LE 1SD4A 2KRCA 3DFGA 3K4MA 3BR3A 3TOAA 4KNYA 2LF8A 1MKMA 5LGTA 1LE8A 4D5CA 2FUG2 2K4JA 3WTXC 3FXUA 3OIPA 4XOPA 3IC7A 2X1EA 3F8MA 3FM5A 2ELZA 5HS9A 3PIPF 2HQAA 3NWTA 4HW0A 2A3SA 3K69A 4WFTA 2YTDA 1GVJA 4G7OF 1ETOA 2VBXA 1TQPA 1EKEA 4DR6E 3TGNA 5CVRA 5A6KA 5FKNA 4I6ZA 2L0KA 4RB2C 1WJFA 3D5SC 1WJPA 1K6OA 2PN6A 4LIUA 3RMPA 2EPUA 1TWHJ 2ESHA 3K0LA 3CUOA 3EUHA 1AAYA 2LG4A 2EA4A 3V8KA 2R3SA 4XKBA 3C1DA 2KHMA 2K27A 1R36A 3HSEA 3LSRA 3IP4B 3J81Z 3JTZA 2HQNA 4XLEA 2WV0A 5KL2A 3HRSA 4IJAA 4R2PA 1QHGA 2L54A 4RLFA 1R5ID 2LRSA 3PQKA 4M0VA 3TDUC 5TRDA 2AXLA 2DT5A 2VBYA 1DU6A 3ZMVA 4D7MA 3SHFA 4GYIA 2NRAC 3G1OA 2GOXB 4J00A 1JKQC 4PJJA 1PUFB 1N33E 2L3JA 2DOFA 1BR2A 3A1YA 4M9SA 3C2HA 1X1BA 5GTHC 2ZXHA 3WHCA 3OSFA 2EM7A 3I54A 2Z3YA 2L7ZA 4M6VA 4UVCA 4KIFA 1JI8A 3K4BA 5J1RA 1FC3A 3HOUJ 1IC8A 3EPKA 2FX0A 1YTYA 4XLFA 1OQYA 4V19K 3GTMJ 5FLXC 1PJRA 1D0YA 4B44A 2WZOA 4BQNA 2LJUA 4FE7A 2X6WA 2QQAA 4YEJA 3ZQHA 2RTXA 3TDZC 2X9DA 2XAFA 3VEPA 1Z21A 4WK8F 2XKOA 3CLOA 1W36D 3TL4X 4BXXJ 1DPRA 2X1DA 4P9UA 3ABMH 2E60A 2Z33A 2EPOA 3KWRA 5KAIC 1XMXA 5GTIC 5GAEJ 3C6MA 3VK6A 4HDVA 3H1CA 1PJQA 1WHNA 1KU7A 2V7FA 3WU2C 5KAFC 1VQLI 1GUUA 2LREA 2H6BA 1STUA 3GZ6A 1MMDA 1T6SA 2AO9A 4RAYA 2L4AA 1JT0A 5E79C 1Q1HA 2Q8KA 4II2A 2F6CA 2F4IA 3OY9A 3BTLA 2V89A 1LJ9A 5EZGA 1R4MB 1IRFA 5JI6A 4OX9E 4OMYA 2XAGA 3KLOA 3VODA 5HLTA 3J81K 1QZEA 2Y9ZA 2I9IA 1ZRFA 2H8RA 2DFIA 3I71A 1SFUA 3CMAI 2WB1N 1XGSA 3BG7A 3BG5A 3MHSC 3EPHA 4I98B 2F8BA 4LF6E 2L33A 4V2GA 1TN9A 2DJNA 1ZG1A 2O5RA 4DV7E 3ZMSA 5E8IA 2X85A 3PSIA 4FISA 4I0BA 4B47A 3H5NA 1EH6A 3F3XA 2D1HA 4IHTA 1FYLA 5LMNE 2JSPA 1D5VA 4HLYA 2R4GA 4M2ZA 1FYMA 3JU0A 4D9JA 2R5YB 3AG1H 2R7FA 1LDJA 2ZKZA 5BNGA 3LA3A 3OR2C 3KYDB 2XF5A 5M5XJ 3LLHA 5HLIA 3MZHA 2HNHA 2XSJC 3ADLA 2RSIA 3VB2A 3RCOA 3P1XA 2LOOA 4BAYA 2LMZA 4F9BB 4DR4E 1A5JA 2JPAA 4DR3E 3H3UA 4R2EA 4M3EA 3SFZA 4A3KJ 1FTTA 1R58A 1SC7A 2O9LA 3CUQB 4V2FA 3OYGA 2E1NA 3R0AA 2K02A 4O24A 1WJAA 5B1AH 2M9HA 1OYIA 4U88A 1QA6A 1V3FA 4ZDLA 3VYTB 1W7PD 4ZYEA 5A6BD 3DPUA 4AIKA 1RRJA 1W5SA 2LT7A 2GWRA 4RM3A 3FF5A 5H6QA 4DZJA 2MC6A 3A01B 4I01A 5H2FC 1TL8A 5ADZA 1V5FA 3DTIA 2L01A 3D5RC 1QPIA 4F9AB 3L1PA 1Y8QB 1PJTA 2LUQA 2R5YA 2EQRA 2FBIA 4BMJA 3PNYA 4M74A 4BBRJ 2Y0SA 1X6FA 2O03A 3ZRGA 3KP3A 2EQ1A 4PK4A 2ELYA 2DB2A 3AFHA 3OYKA 1R22A 5BQTA 3FXQA 2COBA 1BOBA 2JPBA 4YFXF 4IO9F 3K4LA 4A5MA 2EN3A 1JGSA 3HPSA 3IAM2 2E1OA 1DI2A 1A04A 3I4MJ 4ZDOA 1FKAE 2NABA 3L7WA 1APLC 4U87A 3I53A 3OYIA 1A36A 1LFPA 4XLPF 4HRIA 5FD5A 1U0JA 3BJOA 2PMHA 1X1PA 3Q9VA 1XX5A 1A1LA 1FNNA 3CC4I 1FZPB 2ZB9A 1F9NA 3HDDA 3F23A 2OTLI 1IRGA 3KFWX 2DCEA 2E2JJ 2RS6A 2GLIA 1T4OA 2FMLA 3HM5A 4ASNA 2E7WA 2EV6A 4GGGA 1S72I 1E3OC 2DFEA 2XUBA 1BI1A 2LY2A 2VASA 2XASA 3LNQA 2VF1A 2YSOA 2DQRA 5A2QC 3RPUA 2B7TA 4EJOA 4HX4A 9ANTA 2BBGA 2EMWA 2J5PA 3RJPA 2DLLA 2HS5A 1BR1A 3KEQA 4RHBB 4BC7A 3HXLA 2EIKH 2DU9A 2W57A 3OOPA 5JFRA 2H1KA 4C2TA 2H8WA 4MTEA 4EJUA 3RQIA 1Y0NA 2E36A 4D7NA 1UJ8A 3D1NI 3RDIA 4I0AA 4P78A 3JR9A 4IRIA 2CTDA 4KZSA 2R7XA 5K1YA 4N9HA 2EMBA 1Y56A 5EYRA 2P5LC 1R5HA 1RNLA 2MC4A 2IJLA 1W0UA 2EB7A 4DV5E 4S05A 2ODRD 4CCJA 1UZCA 4MHGA 3CTAA 2BZTA 3FZVA 2NS8A 4RS8A 2JUCA 3LSTA 1BA5A 3P7NA 4TV7A 5J6XA 2DMPA 4DR5E 1O0WA 3SFIA 5D5VB 4QLCU 4XN0A 1B9MA 2I5UA 2YPRA 3DEUA 2EPRA 3K2AA 4PJNA 2EQ0A 3L2UA 5DDGA 3FM3A 2YS9A 2EPLX 2LE2A 4DYQA 3KP6A 4DJAA 3A4CA 3ZQLA 2JQ7A 4BS9A 4XRSA 2HGCA 1FX7A 1V4RA 1MDMB 4DMIA 3RYPA 1MJAA 2V87A 2HZTA 2M7AA 3BPXA 3GTGJ 3G6EI 3HPGA 4IQ4A 3JTGA 2FA5A 2IPQX 3MSWA 2YRMA 4RGUA 4BU2A 3ECOA 3J7AY 3MFKA 5CQEA 2DPDA 1M1EB 4F6NA 3F0CA 2PX9A 1X2MA 3DPLC 1A1IA 3FIWA 5ILSA 3DEWA 3FXRA 3G1LA 2M9AA 4FE4A 2WADA 2A6EF 2XPWA 2FNPA 4ZZLA 5DD4A 1UB9A 1DUXC 4NC8A 2CG4A 1HW1A 2L5QA 5K5QA 3V42A 4HF2A 4II3A 1BJZA 2XVCA 2B0LA 2EJ4A 3PNVA 2H1LA 3ABLH 2DA1A 2HOSA 3S17J 2ZFWA 1IDZA 5IT9Z 2ADUA 3PIOF 2BVLA 5HDNA 4LF8E 1Z77A 2CS3A 4U7BA 1D1CA 2MFZA 3WGIA 3LQQA 1V54H 3GWZA 3S1MJ 1YSAC 1PDNC 1XDSA 4HPQA 4UVBA 2YTOA 1LDKB 4O6JA 3BR0A 1YW7A 2W82A 1P2FA
chains in the Genus database with same CATH topology
1FYKA 3I4PA 4AIJA 1TNTA 2BV6A 2VT2A 1QZZA 4WF2A 1Z1DA 2JTVA 2FE3A 2G9WA 5ICFA 4ON0A 2NYXA 3HYIA 3RIRA 1B6AA 2FXAA 5K5OA 5FFXA 3TOBA 5KVRA 1MJBA 4I7HA 1ULYA 4GO1A 1PP7U 1WSUA 3G3ZA 3ELKA 1HKSA 1WRJA 4LB5A 1EH8A 4E70A 3DV8A 4UUVA 4IXAA 4L5IA 3CJNA 4NQWA 1ZAOA 4HA8A 3FMRA 2IA1A 4A0ZA 1FPQA 4B09A 5CVIA 1TTYA 5ICGA 3D0SA 1KU2A 2QZ8A 1LDDA 1DDNA 1IN7A 4U0VA 1QO0D 2PLYA 1MZBA 4BXUA 1E17A 4M9XA 4KIBA 3GXOA 3D5LA 3V7SA 5LHGA 1BJAA 1ZREA 2OQGA 3IHUA 4PGHA 2MLGA 3PQJA 1J0RA 2VOOA 5L3BA 2MD5A 1J75A 4LLLA 4A6EA 2EWNA 3HOTA 1LEAA 3CUQC 1TQIA 1IW7F 4EV0A 1R7JA 1KU9A 4KDPA 5DYMA 3KP7A 2Q2EA 3KP4A 2HFHA 1XD7A 5FD6A 4UVAA 1CF7B 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 2STTA 4ESJA 4IVNA 5CLSA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 3R60A 5ED4A 2MH2A 1CGPA 2EFWA 3JSOA 5J8FA 3WTYC 4AWXB 5HVQC 2XAJA 1ON1A 3WE3A 3G73A 1G3SA 1IZ1A 5HLGA 3HHGA 5E8GA 2UZKA 3QOPA 4ZYDA 1KYWA 2UXXA 4XSZF 3DPTA 1FLIA 3NEUA 1RZ4A 1I6XA 3DP7A 2BYVE 2K86A 3GUDA 1XGMA 2PI0A 1BN5A 3GYHX 2KIFA 2DBBA 1FBUA 3R6SA 3SZPA 1I27A 3MCZA 3REOA 3L9FA 1R5GA 2GA2A 3WTZA 4IPAA 3E6MA 4IRGA 2FRHA 5FO5A 4YFKF 2G7UA 2JT1A 1T38A 4CYDA 1ZRCA 2FSWA 2QENA 4LG0B 3TQNA 4LLGF 1REPC 3ABTA 5EEHA 4RB3C 1TNSA 4HV5A 4K2EA 1OYWA 3C7JA 2AS5F 4KYWA 2FU4A 1QGPA 2HWVA 2F5CA 2VE9A 4HDUA 3ROUA 4ESBA 2VBZA 2DK8A 1QNTA 4ENKA 5FFZA 2EA2A 1BC7C 3TKYA 2DQLA 2GXBA 2BE5F 5J8CA 2A61A 3F6OA 4M71A 1U5TC 1LVAA 3MAJA 1JE8A 3BJAA 2CYYA 4D0PA 2C6YA 5D8LB 5E20A 2GAUA 5D4SA 1D8JA 3ZPLA 1IXRC 2WWYA 2DTRA 3WE2A 4M9ZA 3HTSB 4CICA 3JSPA 1B1BA 3Q9SA 4EGZA 5JR3A 3PFIA 4EJTA 2KKOA 4FX0A 3MEXA 1KYZA 5L3FA 4CDGA 2LDUA 1T39A 1XMAA 1MD0A 2KRFA 4Q48A 4G7HF 5D6FA 1YW9A 2EFOA 4LJZF 5FB2A 2PFBA 5DUKA 1Z9CA 2XRNA 2BGCA 1QPMA 3FHZA 4M73A 4ZYHA 3E5UA 4MQ9F 2Z5UA 3GZ5A 2RV8A 1Y0UA 1TLHB 1KQ8A 3TO7A 1ZGJA 5L3GA 1RI7A 5KK1A 2RC4A 4LK1F 3V8JA 5E18F 5HS8A 4HX8A 2D2WA 3W6JB 2FOKA 5CJ9A 3CO7C 5ERIA 1K78A 1ZH5A 1DP7P 1ZARA 5LGUA 4UV8A 4EM0B 4M6XA 1F5TA 4ESFA 4L18B 4L5JA 2QQ9A 4A0YA 1YLFA 1FBSA 2DAOA 2GIVA 1ZGAA 4I02A 1YG2A 3R0JA 1ON2A 1XGNA 1LNWA 4CHUA 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 3EDPA 2STWA 5H20A 3QPTA 1O57A 2XAHA 1SD5A 2ZMEB 3ZMTA 2LF7A 4WXCA 3QPHA 1XSDA 4LMYA 2Y48A 2UWMA 2QBYA 2CGPA 1BIBA 2P6SA 1ZLJA 4HBLA 3T8RA 1R23A 2RDPA 3U2RA 4S04A 2BBYA 1YYVA 3CO6C 2ZNZA 2HDCA 4KN7X 5D6EA 1I1SA 5E17F 1XDUA 5FLXK 1IN8A 5BPIA 5D4RA 4WXDA 5BPDA 2FBHA 3V7RA 4G8XA 2OU2A 2RN7A 3F6VA 3ZMUA 5F1RA 3LAPA 2ELHA 4KICA 2OZUA 1IN5A 3OV8A 3P9KA 4GCVA 1IUYA 5LBQA 3K2ZA 1PP8F 1G4DA 4ZZDA 1QZYA 3KETA 2IRFG 4AIHA 3EYIA 2HOEA 2G7HA 5HDKA 2CFXA 5DCFA 1K7AA 2EFNA 4YIFA 3F8NA 3LA2A 1O3QA 3BZ6A 3FMQA 3ISPA 4G6QA 2MC3A 5FLXZ 2CW0F 1AOYA 1LB2A 3P9CA 4OIQF 5DCMB 2MH9A 2KJBA 2A6HF 4OMZA 3DXJF 5H6RA 1W7PA 2PMUA 3ECHA 3E6DA 1SFEA 4KMFA 3M1EA 2QVOA 1XN7A 3TO6A 2D1VA 3I5UA 2JPCA 4MEYF 1DPUA 3ML6A 2VONA 2A5YB 3IKTA 3GF2A 2XIGA 3I59A 1P4WA 1XSVA 1EH7A 2ETHA 4OIRF 3J80Z 4L0ZB 5FGMA 2JZYA 1TQMA 4N0BA 2DW4A 3LWFA 4KMUX 2EV0A 3E97A 2NNNA 4H0EA 4RB0A 4BHBA 1ZN2A 4UV9A 3SQNA 5A2QK 4NHJA 3I64A 2QM3A 1F4KA 1S8NA 4OINF 4OU0A 4IF4A 4HZFA 2M45A 1U78A 1FP2A 1B59A 1U5TA 4ZYGA 4I09A 4G94A 3KEOA 2FBKA 5HS7A 2QBYB 2QWWA 2VC0A 1ZRDA 3WTSC 3VFZA 3QP6A 3GO5A 2KJCA 5DD8A 2NNYA 2HYGD 5BMZA 1J7KA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 1G6NA 3E6BA 1ODDA 2VOPA 2PBIA 1JHHA 2P4WA 4R1HA 3BOQA 3Q5FA 5A2QZ 3SXYA 4A5NA 4LG0A 5IT3A 3V7CA 2V1XA 4U7DA 4Q5SF 1LEBA 4EM2A 1I1GA 3K1PA 2DI3A 1BOAA 3GEZA 3GFLA 3EETA 5L3CA 2XHKA 4KT5C 1BM9A 1O3TA 2CWEA 2OAZA 3B02A 1S6LA 5D5WB 5CVUA 2OD5A 1USTA 2IW5A 1RIOH 2V1DA 4KFCA 4Y13A 2V79A 3N97A 2WC2A 3QP5A 2O6GE 3MWMA 2E1CA 1S7OA 2W85A 3NQOA 3K9TA 4UNOA 3HOSA 4CO8A 2M5WA 1ZG3A 2FF4A 1C0WA 1NHAA 2DPUA 2RKHA 4MNUA 3RKWA 3L00A 1HW2A 5AIQA 2A68F 3V8LA 4A0XA 3BJ6A 3I0TA 2HR3A 2W25A 4KN4X 5LLQA 1FSHA 2D45A 1W5TA 1ZLKA 2XV4S 2EJRA 3DF8A 3KZZA 2QQBA 2Y0MA 4JK1X 1P92A 3L2CA 1TW2A 4G9YA 3HSFA 3IRQA 4GXOA 4PGGA 3LFKA 4XSXF 1P4AA 3GFIA 3WTUC 2A07F 1XSXA 1FSEA 2Y75A 5D8KB 1CF7A 3MZYA 1L3LA 3E5XA 3FX3A 5DV5A 3ULQB 3M9AA 2QYOA 1XMKA 4HQMA 2COMA 3GLXA 4JQFA 2M30A 1Z7UA 4LFUA 4BHCA 4PDKA 3DQVC 1OMIA 3IKVA 2PEXA 5F64A 1XB4A 2IVMA 4YFNF 3WU1B 3DKWA 1U2WA 1H9TA 2OA4A 5ICEA 3R61A 4R79A 3T5XA 2K4BA 5LGNA 4KA4A 2LNBA 2F2EA 3FMSA 4KUMA 1KQ9A 3GX4X 2V9VA 3HHHA 1HW5A 4UHTA 2HTJA 1WWXA 3WGHA 2NS0A 4FX4A 2VODA 4M72A 3N4MA 3T8TA 5AONA 4GYGA 1YS6A 4BH9A 3L09A 2DK5A 2H6CA 1WKMA 5ICCA 4HYEA 2F5DA 1Z6TA 1GHCA 2HEOA 4MEXF 4B8XA 1IXSB 3F8FA 1OKRA 1YS7A 1IAWA 4RB1A 3JTHA 2OBPA 1BI0A 5JVTA 4ENNA 2XAQA 2OZ6A 1HXDA 1BI3A 4WX9A 1QBJA 4L0YB 2FNAA 2CO5A 1LQ1A 3E3VA 2IA0A 2HKOA 4Q4ZF 4MQVA 4ENJA 1W7PB 1P6RA 4M6YA 1USSA 4ENMA 3CDHA 1K79A 1J59A 3HRUA 1O3SA 5BS6A 1FOKA 1T98A 1YO5C 3AAFA 4P9FA 2GXGA 4EQQA 4AD9A 3TO9A 4BYYA 1YFHA 4BHPA 1S7AA 3T1BA 1QQIA 2V6CA 1KU3A 2UXNA 2HQRA 2JSCA 2XROA 2GZWA 3M7GA 3RYRA 4YG2F 2KIUA 1GXQA 4Q47A 2YX7A 3BROA 2ISYA 2VC1A 4HQEA 2RVCA 1PUEE 4L9NA 1BC8C 2EFQA 3QRFF 1BIAA 4O5VA 5D5XB 4EGYA 5CVJA 1D3YA 1H9GA 2ZMEA 3ZMDA 3ERED 2L3DA 2ZJ2A 1IXCA 4WCGA 1G3WA 3KZYA 1R1UA 2QLZA 4AVPA 4LB6B 3WG9A 1O7FA 2P6TA 1JHFA 4RGSA 2EFPA 3BDDA 3KP2A 3S2WA 3K1MA 4DQ2A 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 1KGSA 4U0YA 2L4MA 2KIMA 2GA1A 1W4MA 3F8BA 4Y17A 3QU3A 5E1WA 5DUIA 4HF0A 4FT8A 3GFMA 1J5YA 2IA2A 1UHWA 2PQ8A 2W84A 4DNCA 4KIGA 1X3UA 2P7VB 2JRTA 3GVAA 3KLNA 1J9IA 4HAMA 3HIFA 1UHMA 2BEOA 2O3FA 3IWFA 2F5FA 2ZBKA 4G6DA 3CUQA 2YX4A 3WODF 1UFMA 4IRHA 4L9TA 1HQCA 3JW4A 4P5OA 1F1ZA 4EM1A 3ZN0A 2VBWA 1G3TA 1ZHFA 2YSRA 5K5RA 4LK0F 1R00A 3I58A 3E5QA 4PZJA 2E7XA 5IT9K 5BOXA 4UXNA 2W24A 1U6GA 3P9IA 3W6KB 1HBXG 4A6DA 1YW8A 2V1UA 1Z05A 1H0MA 3HTUA 3C18A 2Q0OA 2RQPA 1YIOA 2ISZA 4HF1A 1OPCA 1J2XA 1E2XA 1T0FA 1XCBA 2VE8A 4HV6A 3T0YA 1MGTA 4RGRA 2XKPA 1YQAA 3RPQA 2ZNYA 1S29A 3FWEA 1Z91A 5ILUA 4L9VA 4N9IA 1XCVA 4EJWA 4ZH4F 4OIPF 3WU0A 5E1ZB 2H09A 1JXSA 1SMTA 1VTNC 2WTEA 3VOEA 3F72A 2NAZA 2X0LA 2YR2A 3B73A 3WTTC 3QAHA 2PG4A 4BQAA 4HLXA 1B9NA 5E1XA 2P5VA 3F21A 1KA8A 3IRRA 4A12A 1U3EM 1R1TA 3BP8A 2R7DA 5D5UB 2ZO4A 2ZXJA 2VT3A 1G3YA 4XBFA 5TJJA 3KP5A 3M8EA 2L02A 2F5EA 4OIOF 3KCCA 4G7ZF 1AWCA 3I59B 3EYYA 2LKPA 2MLKA 2X4HA 2FEZA 3IWZA 4EVIA 2OQRA 5HOOA 4MTDA 1OYYA 3O2PE 3ZP5A 1U5TB 5LEJA 1SAXA 4CZZA 2XGXA 5L3DA 4P96A 4OOIA 2EV5A 3WTVC 1ONVA 3GFJA 1SFXA 1R1VA 2TDXA 1HKQA 1IN6A 2P7CB 2YU3A 4RGXA 3H92A 2O8XA 2H94A 1O7LA 1OR7A 4F7ZA 4CGZA 3J80K 1IN4A 1U8RA 3HUGA 1BI2A 5L3EA 3BPVA 4EMSA 5LHIA 4NB5A 3QU6A 4LLNA 4LD5A 4U0WA 2MBFA 3ZN1A 2P5KA 5JHUA 3WTWC 3ZQ7A 2RNJA 3JAMZ 5EEGA 3RKYA 3U9GA 4LGWA 4MGRA 1O3RA 1SMYF 1EV7A 2P8TA 1IF1A 4CXFA 5F6FA 1P4XA 1Z6RA 3EQLF 4QWQA 2M8EA 4JBAA 4R8HA 1D8KA 1UCRA 3LAJA 3C3WA 1FWZA 1WI9A 5LRRA 2PJPA 2Z99A 3E6CC 2GQQA 3HRMA 3JAMK 3IL2A 2M87A 4IHSA 3WGGA 3KE2A 4WXHA 4P55A 4HX7A 2IP2A 5CVVA 1RUOA 3M8FA 6PAXA 5LEKA 3U1DA 3NRVA 2IT0A 1TW3A 2VN2A 5CYVA 5HLHA 2HKXA 1GXPA 3HSRA 3ABUA 4O3MA 1FY7A 3R4KA 5LHHA 1HSTA 2J5OA 2DO7A 2ACJA 1T2KA 5ILVA 4YIIA 3K1NA 3MQ0A 2FMYA 4BNCA 3LQRA 3J7AO 2O0YA 2HYFA 3BY6A 1BBYA 2A69F 5LRSA 2M1BA 5DEQA 4EJVA 3O6BB 4A2UA 2FQ3A 1SD7A 3BWGA 1L0OC 2EK5A 4Y15A 1SD6A 2MA3A 1K78B 3ZMZA 2VXZA 3SZTA 4WWCA 4HOBA 2Z9OA 2CSOA 3H3ZA 4ETSA 1FT9A 3LA7A 5DCMA 3GW2A 1FP1D 1ZYRF 4XLNF 1HSJA 3HRTA 4I2OA 4L9JA 1STZA 1I5ZA 3RTRA 1KQ0A 3COAC 3F22A 1B4AA 5AIPA 1MDMA 2ESNA 2K7LA 1SD4A 3DFGA 3TOAA 4KNYA 2LF8A 1MKMA 5LGTA 2K4JA 3WTXC 3FXUA 3IC7A 3F8MA 3FM5A 5HS9A 4HW0A 2A3SA 3K69A 1GVJA 4G7OF 2VBXA 1TQPA 3TGNA 5CVRA 4RB2C 1K6OA 2PN6A 2ESHA 3K0LA 3CUOA 3EUHA 2EA4A 3V8KA 2R3SA 3C1DA 2K27A 1R36A 3HSEA 3J81Z 2HQNA 2WV0A 3HRSA 4IJAA 2L54A 3PQKA 3TDUC 5TRDA 2AXLA 2DT5A 2VBYA 3ZMVA 3SHFA 4GYIA 2NRAC 4M9SA 3I54A 2Z3YA 4UVCA 4KIFA 1FC3A 1YTYA 2QQAA 3TDZC 2XAFA 3VEPA 4WK8F 2XKOA 3CLOA 1DPRA 4P9UA 2Z33A 4HDVA 1KU7A 2H6BA 3GZ6A 1T6SA 4RAYA 2L4AA 1Q1HA 2Q8KA 1LJ9A 5JI6A 1IRFA 4OMYA 2XAGA 3KLOA 3VODA 3J81K 1ZRFA 2DFIA 3I71A 1SFUA 1XGSA 4I98B 1ZG1A 3ZMSA 5E8IA 4I0BA 1EH6A 3F3XA 2D1HA 4IHTA 1FYLA 1D5VA 4HLYA 1FYMA 2R7FA 1LDJA 2ZKZA 3LA3A 5HLIA 3MZHA 3VB2A 4BAYA 3H3UA 3SFZA 1R58A 3CUQB 2E1NA 3R0AA 2K02A 1OYIA 4U88A 1V3FA 1W7PD 4ZYEA 4AIKA 1W5SA 2GWRA 3FF5A 5H6QA 4I01A 2L01A 2FBIA 4M74A 2O03A 3KP3A 1R22A 5BQTA 3FXQA 2JPBA 4YFXF 4A5MA 1JGSA 1A04A 3L7WA 3I53A 4XLPF 5FD5A 3BJOA 2PMHA 3Q9VA 1FNNA 1FZPB 1F9NA 3F23A 1IRGA 3KFWX 2FMLA 4ASNA 2E7WA 2EV6A 4GGGA 2XUBA 1BI1A 2XASA 2DQRA 3RPUA 4EJOA 4HX4A 2J5PA 3RJPA 2DLLA 2HS5A 3KEQA 2DU9A 2W57A 3OOPA 5JFRA 4MTEA 4EJUA 3RDIA 4I0AA 4IRIA 5K1YA 4N9HA 2P5LC 1R5HA 1RNLA 2IJLA 2EB7A 4S05A 4MHGA 3CTAA 3FZVA 4RS8A 3LSTA 3P7NA 4TV7A 5J6XA 5D5VB 4QLCU 1B9MA 2YPRA 3DEUA 5DDGA 3FM3A 3KP6A 2HGCA 1FX7A