2KHXA

Drosha double-stranded rna binding motif
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease 3
publication title Solution structure of the Drosha double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation,nuclear protein
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2khxA00
1X47A 2B7TA 3P1XA 2ZM6E 2JY9A 3T1HE 3VYXA 2DB2A 2UU9E 2UUBE 4YHHE 2L3CA 2RSMA 4B3RE 2NA2A 1UHZA 4LF5E 1J5EE 1PKPA 4B3ME 2RTXA 2UXDE 2MDRA 2HHHE 5BR8E 4DR4E 1IBKE 2E5LE 4DV1E 1I94E 4WFTA 4LFAE 4DV4E 1DI2A 5CFFE 2LJHA 4DR5E 4M30A 2KHXA 1HNXE 2RS6A 1T4NA 2LUQA 4DR7E 4JYAE 2N3HA 4DV0E 2UUCE 4DR6E 1J26A 5IWAE 1T4OA 3ADGA 4OX9E 4DUZE 1YYOA 1X49A 1HR0E 2NUEA 2L2NA 4DR3E 2LBSB 1XMQE 1FJGE 1T4LB 3T1YE 2UXBE 5LMNE 1YZ9A 4JI2E 2N3GA 3ADJA 2DIXA 1FKAE 2B7VA 4LF6E 2NUGA 2LUPB 4X65E 2IHR1 1N32E 4LF8E 4LFCE 1N34E 1QU6A 4DR2E 3ADIA 3VYYA 2UUAE 4X62E 4JI0E 5LMUE 2LTSA 2EZ6A 3C4BA 2VQFE 2LRSA 4DV3E 4LF4E 2RS7A 3HTXA 2F4VE 1YYWA 4JV5E 2VQEE 4LF9E 2JVAA 1X48A 4DR1E 1XNRE 4X8WA 2NUFA 4NXNE 4LF7E 4B3SE 4LFBE 2LTRA 1HNZE 4M2ZA 1RC7A 3C4TA 4JI8E 2L2KB 4DV2E 4JI7E 4WYQB 4GKKE 4NXME 2DMYA 4OOGC 1ZBTA 2CPNA 1WHQA 4DV5E 1STUA 2B3TB 2YT4A 1XNQE 1RQ0A 4JI6E 1GQEA 3OTOE 1XMOE 2L3JA 4GKJE 1UILA 4X64E 4JI3E 1YYKA 1N33E 2UXCE 4DKKA 4YY3E 3LLHA 1N36E 1O0WA 4X66E 4JI4E 3ADLA 1IBLE 2L2MA 1IBME 4DV7E 4KHPE 3J7Yp 4AQYE 4JI5E 4K0KE 4DUYE 4JI1E 2L33A 4B3TE 1HNWE 4DV6E 1EKZA 1WHNA
chains in the Genus database with same CATH superfamily
1A1KA 2B7TA 3VK6A 2FGGA 2JP9A 2EN2A 4HEIA 3VYXA 2DB2A 2UUBE 3HPSA 2YTJA 2GLIA 3IWCA 2DSYA 2EPUA 2MKNA 4B3ME 2EPZA 2RTXA 1TF6A 2LVHA 2RSIA 2GPIA 4DV1E 4BC9A 4WSPA 2YTOA 1IQSA 3HPZA 4R2RA 2YTFA 1HNXE 5KL3A 3RMPA 2LUQA 5ADZA 2Q8UA 1A1IA 1ZR9A 5KL4A 4JYAE 2V88A 2EQ1A 4DV0E 3AV0A 2EQ3A 1WJPA 2ELYA 2R1FA 5TSEA 1J26A 2ODRC 1T4OA 2NUEA 2L2NA 2LBSB 2CSHA 5LMNE 4DMIA 4JI2E 2H36X 3ADJA 1ZBQA 1PDAA 3EPLA 2NUGA 2IHR1 1X5WA 1N32E 5FLXC 1N34E 2V85A 3VHTB 1X6EA 2R76A 2LTSA 1IMUA 1TN9A 2LRSA 4MLVA 4NZVA 1L4SA 1YUJA 2EWLA 2YTGA 2EN8A 3JTZA 4O24A 2VQEE 2LO3A 1X48A 4Q35B 1MEYC 2BB8A 4ZYDA 4F2JC 4B3SE 1RC7A 4BMJA 2L2KB 4DV2E 4NHRA 2EPAA 2DMYA 4OOGC 1ZBTA 2VF1A 4DV5E 3EPKA 1STUA 2YU8A 3BGHA 2YT4A 5AC5A 1T38A 4R2QA 2ELZA 5DNYA 2L3JA 5IT9C 1XMOE 2EPMX 2EPNA 4WX9A 4GZNC 2A25A 3JU0A 4BC7A 5LL6R 4JI4E 2EMYA 1YUIA 2EPRA 1NCSA 4DV7E 5A6BD 4FK5C 3J7Yp 2M9AA 4DUYE 3IWDA 2L33A 4B3TE 2LT7A 2EN3A 4IJDA 1EKZA 1WHNA 4KZSA 2JY9A 2JOXA 2YSOA 3TQMA 1ZU1A 2ENCA 2YRMA 4YHHE 3M99B 2EJ4A 2YTPA 3DF6A 4F9CB 2JPAA 4O4KA 1UHZA 2K4VA 1J5EE 1PKPA 2I9IA 4WPYA 1BBGA 2MDRA 2HHHE 3F6GA 1KJKA 2I13A 2MDGA 2EM3A 4DR4E 1WXRA 1IBKE 1DI2A 3KZZA 5IV8B 1YPNA 3ZOQB 4DR5E 3MSWA 1BBOA 4ZYHA 2EOOA 2EMLA 2K7IA 3EPHA 2EOHA 3HXLA 4TUGA 5IWAE 2YWQA 2EMXA 2EMZA 2L6MA 3ADGA 4WXDA 1X49A 1N3GA 2VE7C 2YSPA 3C6MA 3KZYA 4TUIA 4DR3E 1Z1BA 2EQ0A 2M1SA 1XMQE 1T4LB 1SFEA 1FJGE 3QG5C 4RHBB 2VRDA 3MHSC 5A6JA 2N3GA 1FKAE 4BBYA 4WXCA 5AE1A 2CT1A 3HQ1A 4ZYGA 4LF8E 3LMLA 4DR2E 3ADIA 2V87A 2UUAE 1X6FA 4JI0E 5LMUE 2VQFE 3UK3C 5A2QC 2EOJA 5KL5A 1YYWA 1A1LA 1IQOA 2JR1A 2EM6A 1WRJA 2V83A 3IWBA 2YTEA 4DR1E 4LU9A 4NXNE 4LFBE 2LJUA 2LTRA 4M2ZA 4J8ZA 3C4TA 2EN4A 1PJQA 3DJWA 1EH8A 1RMDA 1WHQA 1P47A 1TF3A 1DGCA 2EPCA 2EOFA 2MC5A 1XNQE 1RQ0A 1UILA 3FIGA 2E1MA 4JI3E 1YYKA 3L00A 2UXCE 4YY3E 4M0VA 1N36E 2EMHA 2WCC3 2JYAA 1AH5A 4AQYE 1A1GA 4JI5E 4K0KE 1A1HA 5KL2A 2YTIA 1EH6A 2RPCA 2DLKA 2EMGA 3P1XA 2ZM6E 4R2AA 3T1HE 4O43A 2UU9E 4I8OA 5A6KA 2YTDA 2EN6A 2YTQA 1LLMC 4B3RE 2UXDE 3EQ1A 2EOEA 1SR9A 2EL4A 5BR8E 3BBGA 4BS9A 1QNTA 2E5LE 3EPJA 1I94E 4WFTA 4LFAE 3JAMC 4X9JA 2EOMA 4M30A 2KHXA 2E72A 2M4IA 2RS6A 3K6QA 2YRHA 3THOB 2EPOA 2V8QB 2DMIA 1T4NA 2EN7A 2FTXB 4R2SA 4DR7E 4RH8A 2N3HA 2EM7A 4DR6E 2D9HA 2EMKA 5KL7A 3F6HA 4O5GA 4DUZE 2EPKX 3T1YE 2JWOA 2UXBE 2YU5A 2KOUA 1YZ9A 4LTYA 2B7VA 1YSAC 2LUPB 2EL5A 4X65E 2DLQA 1ZAAC 1G2FC 2RQLA 1F2IG 2EMFA 2EZ6A 2M7QA 2RS7A 5KL6A 4P78A 2EOSA 2EM2A 1NEIA 1XNRE 4N4RB 4X8WA 2EM4A 2NUFA 1BB8A 1G2DC 4LF7E 1HNZE 3MHHC 2G7HA 2JXPA 2EPXA 5F3WA 1EH7A 1PJTA 2YZTA 4P7DA 4WYQB 4NXME 2YTNA 4R2EA 3J81C 2CPNA 2B3TB 2EP3A 1AAYA 2L8TA 4BHBA 3OTOE 4GKJE 2J7JA 4X64E 1A1FA 1N33E 5AE3A 5T6JA 1O0WA 5AE2A 5A6AA 3ADLA 2L2MA 1IBME 2EE8A 2EOYA 3BF2A 1B69A 4F54A 4JI1E 1HNWE 4DV6E 3BIDA 2F4VE 1X47A 1T39A 1GTKA 1PJSA 2EN1A 4F6NA 2V89A 2EM5A 2GHFA 3THNA 2HC5A 2EM9A 2L3CA 3OMLA 2HGHA 3ECRA 2RSMA 2WBTA 2NA2A 3KWRA 1JK1A 4LF5E 2ADRA 4F6MA 4F9AB 2JOBA 4R2DA 2DRPA 2EOQA 4MLQA 4M9VC 4DV4E 5CFFE 2LJHA 2EM0A 2ENAA 2ODRD 1X6HA 4GEQB 4BHCA 1A1JA 2EOXA 2UUCE 2YRKA 2L92A 5LLQA 2V86A 2EMAA 4OX9E 1YYOA 1HR0E 5AASA 4R2PA 2EM8A 2F8BA 1KYQA 2DIXA 4HTGA 3H09A 4LF6E 2LMZA 1JK2A 2MC6A 4IS1C 5AC4A 3J80C 4LFCE 4KWYA 1QU6A 3VYYA 4X62E 2FV4B 3C4BA 2WZOA 2EMIA 2B9DA 5A6BA 2HJJA 4DV3E 1DQ3A 4LF4E 4F9BB 3HTXA 2EORA 3AUZA 4L5NC 4R2CA 4JV5E 4BCAA 2EMCA 4LF9E 2JVAA 1UBDC 2EPLX 2WBSA 2LV2A 1X3CA 2ENHA 2PRTA 4R03A 2EOIA 4JI8E 2EOZA 4JI7E 4GKKE 4L8NA 3J7AG 2EL6A 4WSGA 2BBGA 2N8XA 2EPPA 2EMBA 2LCEA 4Q28A 2LE2A 4JI6E 1GQEA 1YFHA 2DGCA 2YPNA 4R8OA 3C6KA 4DKKA 3LLHA 2NABA 4X66E 1GZ6A 2EMWA 2WBUA 1IBLE 2KONA 5IXMB 4KHPE 5A69A 2MKDA 1UN6B 4ZYEA 1MGTA 2CTDA
chains in the Genus database with same CATH topology
1X47A 2B7TA 3P1XA 2ZM6E 2JY9A 3VK6A 2FGGA 3T1HE 2JOXA 3VYXA 2DB2A 2UU9E 2V89A 2UUBE 4I8OA 4YHHE 3DF6A 3HPSA 4F9CB 3OMLA 2L3CA 2RSMA 3IWCA 2DSYA 4B3RE 2NA2A 1UHZA 3KWRA 2K4VA 2NUEA 4LF5E 1J5EE 1PKPA 4B3ME 2RTXA 4WPYA 4F9AB 2JOBA 2MDRA 2HHHE 3F6GA 1SR9A 2UXDE 5BR8E 4DR4E 4BS9A 1WXRA 1IBKE 2E5LE 4DV1E 1I94E 4WFTA 4LFAE 3JAMC 4DV4E 1DI2A 4BC9A 5CFFE 3ZOQB 2LJHA 4DR5E 3MSWA 4WSPA 3HPZA 4M30A 2KHXA 1HNXE 2M4IA 2RS6A 3K6QA 3RMPA 2V8QB 1T4NA 2LUQA 2FTXB 2ODRD 4GEQB 4DR7E 5ADZA 4JYAE 2N3HA 2V88A 4DV0E 2UUCE 4DR6E 3AV0A 2L92A 3HXLA 2V86A 1J26A 4TUGA 5IWAE 2ODRC 1T4OA 3F6HA 2L6MA 3ADGA 4OX9E 4DUZE 1YYOA 1X49A 1HR0E 5AASA 2VE7C 2L2NA 4TUIA 4DR3E 2LBSB 1XMQE 1T4LB 2M1SA 1FJGE 3T1YE 2JWOA 2UXBE 5LMNE 4DMIA 2F8BA 2KOUA 2H36X 4JI2E 1YZ9A 2N3GA 3ADJA 2DIXA 1ZBQA 2B7VA 4LTYA 3H09A 4BBYA 1FKAE 5AE1A 4LF6E 2LMZA 2LUPB 3HQ1A 4X65E 2IHR1 1N32E 2MC6A 2NUGA 4LF8E 3LMLA 5FLXC 3J80C 4LFCE 1N34E 1QU6A 4DR2E 3ADIA 2V87A 2V85A 3VYYA 2UUAE 4KZSA 4X62E 4JI0E 5LMUE 2LTSA 2FV4B 3C4BA 2VQFE 2WZOA 2EZ6A 2B9DA 2LRSA 4DV3E 1DQ3A 2M7QA 5A2QC 4LF4E 2RS7A 4F9BB 2EWLA 3HTXA 2F4VE 3JTZA 3AUZA 4L5NC 1YYWA 4JV5E 2VQEE 2JR1A 4BCAA 4LF9E 2JVAA 2V83A 3IWBA 4P78A 1X48A 4DR1E 1XNRE 4LU9A 4X8WA 2NUFA 4NXNE 4LF7E 4B3SE 4LFBE 4R03A 2LTRA 1HNZE 4M2ZA 1RC7A 2G7HA 4J8ZA 3C4TA 4JI8E 4BMJA 2L2KB 5F3WA 3DJWA 2YZTA 4DV2E 4P7DA 4WYQB 4L8NA 4JI7E 4NXME 4GKKE 2DMYA 4OOGC 3J7AG 1ZBTA 3J81C 2CPNA 1WHQA 2VF1A 4DV5E 1STUA 2B3TB 2MC5A 2YT4A 1XNQE 1RQ0A 4Q28A 2L8TA 2LE2A 4JI6E 1GQEA 3OTOE 5DNYA 2L3JA 5IT9C 1XMOE 4GKJE 1UILA 3FIGA 2E1MA 4X64E 4JI3E 1YYKA 1N33E 4R8OA 2UXCE 3JU0A 4BC7A 4DKKA 4YY3E 3LLHA 5AE3A 4M0VA 5T6JA 5LL6R 1N36E 1O0WA 5AE2A 1GZ6A 4X66E 4JI4E 3ADLA 1IBLE 2L2MA 1IBME 4DV7E 2KONA 4KHPE 3J7Yp 4AQYE 4JI5E 4K0KE 4F54A 4DUYE 3IWDA 2L33A 4B3TE 4JI1E 1HNWE 4DV6E 1EKZA 1WHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X47 A;  2B7T A;  3P1X A;  2ZM6 E;  2JY9 A;  3T1H E;  3VYX A;  2DB2 A;  2UU9 E;  2UUB E;  4YHH E;  2L3C A;  2RSM A;  4B3R E;  2NA2 A;  1UHZ A;  4LF5 E;  1J5E E;  1PKP A;  4B3M E;  2RTX A;  2UXD E;  2MDR A;  2HHH E;  5BR8 E;  4DR4 E;  1IBK E;  2E5L E;  4DV1 E;  1I94 E;  4WFT A;  4LFA E;  4DV4 E;  1DI2 A;  5CFF E;  2LJH A;  4DR5 E;  4M30 A;  2KHX A;  1HNX E;  2RS6 A;  1T4N A;  2LUQ A;  4DR7 E;  4JYA E;  2N3H A;  4DV0 E;  2UUC E;  4DR6 E;  1J26 A;  5IWA E;  1T4O A;  3ADG A;  4OX9 E;  4DUZ E;  1YYO A;  1X49 A;  1HR0 E;  2NUE A;  2L2N A;  4DR3 E;  2LBS B;  1XMQ E;  1FJG E;  1T4L B;  3T1Y E;  2UXB E;  5LMN E;  1YZ9 A;  4JI2 E;  2N3G A;  3ADJ A;  2DIX A;  1FKA E;  2B7V A;  4LF6 E;  2NUG A;  2LUP B;  4X65 E;  2IHR 1;  1N32 E;  4LF8 E;  4LFC E;  1N34 E;  1QU6 A;  4DR2 E;  3ADI A;  3VYY A;  2UUA E;  4X62 E;  4JI0 E;  5LMU E;  2LTS A;  2EZ6 A;  3C4B A;  2VQF E;  2LRS A;  4DV3 E;  4LF4 E;  2RS7 A;  3HTX A;  2F4V E;  1YYW A;  4JV5 E;  2VQE E;  4LF9 E;  2JVA A;  1X48 A;  4DR1 E;  1XNR E;  4X8W A;  2NUF A;  4NXN E;  4LF7 E;  4B3S E;  4LFB E;  2LTR A;  1HNZ E;  4M2Z A;  1RC7 A;  3C4T A;  4JI8 E;  2L2K B;  4DV2 E;  4JI7 E;  4WYQ B;  4GKK E;  4NXM E;  2DMY A;  4OOG C;  1ZBT A;  2CPN A;  1WHQ A;  4DV5 E;  1STU A;  2B3T B;  2YT4 A;  1XNQ E;  1RQ0 A;  4JI6 E;  1GQE A;  3OTO E;  1XMO E;  2L3J A;  4GKJ E;  1UIL A;  4X64 E;  4JI3 E;  1YYK A;  1N33 E;  2UXC E;  4DKK A;  4YY3 E;  3LLH A;  1N36 E;  1O0W A;  4X66 E;  4JI4 E;  3ADL A;  1IBL E;  2L2M A;  1IBM E;  4DV7 E;  4KHP E;  3J7Y p;  4AQY E;  4JI5 E;  4K0K E;  4DUY E;  4JI1 E;  2L33 A;  4B3T E;  1HNW E;  4DV6 E;  1EKZ A;  1WHN A; 
#chains in the Genus database with same CATH topology
 1A1K A;  2B7T A;  3VK6 A;  2FGG A;  2JP9 A;  2EN2 A;  4HEI A;  3VYX A;  2DB2 A;  2UUB E;  3HPS A;  2YTJ A;  2GLI A;  3IWC A;  2DSY A;  2EPU A;  2MKN A;  4B3M E;  2EPZ A;  2RTX A;  1TF6 A;  2LVH A;  2RSI A;  2GPI A;  4DV1 E;  4BC9 A;  4WSP A;  2YTO A;  1IQS A;  3HPZ A;  4R2R A;  2YTF A;  1HNX E;  5KL3 A;  3RMP A;  2LUQ A;  5ADZ A;  2Q8U A;  1A1I A;  1ZR9 A;  5KL4 A;  4JYA E;  2V88 A;  2EQ1 A;  4DV0 E;  3AV0 A;  2EQ3 A;  1WJP A;  2ELY A;  2R1F A;  5TSE A;  1J26 A;  2ODR C;  1T4O A;  2NUE A;  2L2N A;  2LBS B;  2CSH A;  5LMN E;  4DMI A;  4JI2 E;  2H36 X;  3ADJ A;  1ZBQ A;  1PDA A;  3EPL A;  2NUG A;  2IHR 1;  1X5W A;  1N32 E;  5FLX C;  1N34 E;  2V85 A;  3VHT B;  1X6E A;  2R76 A;  2LTS A;  1IMU A;  1TN9 A;  2LRS A;  4MLV A;  4NZV A;  1L4S A;  1YUJ A;  2EWL A;  2YTG A;  2EN8 A;  3JTZ A;  4O24 A;  2VQE E;  2LO3 A;  1X48 A;  4Q35 B;  1MEY C;  2BB8 A;  4ZYD A;  4F2J C;  4B3S E;  1RC7 A;  4BMJ A;  2L2K B;  4DV2 E;  4NHR A;  2EPA A;  2DMY A;  4OOG C;  1ZBT A;  2VF1 A;  4DV5 E;  3EPK A;  1STU A;  2YU8 A;  3BGH A;  2YT4 A;  5AC5 A;  1T38 A;  4R2Q A;  2ELZ A;  5DNY A;  2L3J A;  5IT9 C;  1XMO E;  2EPM X;  2EPN A;  4WX9 A;  4GZN C;  2A25 A;  3JU0 A;  4BC7 A;  5LL6 R;  4JI4 E;  2EMY A;  1YUI A;  2EPR A;  1NCS A;  4DV7 E;  5A6B D;  4FK5 C;  3J7Y p;  2M9A A;  4DUY E;  3IWD A;  2L33 A;  4B3T E;  2LT7 A;  2EN3 A;  4IJD A;  1EKZ A;  1WHN A;  4KZS A;  2JY9 A;  2JOX A;  2YSO A;  3TQM A;  1ZU1 A;  2ENC A;  2YRM A;  4YHH E;  3M99 B;  2EJ4 A;  2YTP A;  3DF6 A;  4F9C B;  2JPA A;  4O4K A;  1UHZ A;  2K4V A;  1J5E E;  1PKP A;  2I9I A;  4WPY A;  1BBG A;  2MDR A;  2HHH E;  3F6G A;  1KJK A;  2I13 A;  2MDG A;  2EM3 A;  4DR4 E;  1WXR A;  1IBK E;  1DI2 A;  3KZZ A;  5IV8 B;  1YPN A;  3ZOQ B;  4DR5 E;  3MSW A;  1BBO A;  4ZYH A;  2EOO A;  2EML A;  2K7I A;  3EPH A;  2EOH A;  3HXL A;  4TUG A;  5IWA E;  2YWQ A;  2EMX A;  2EMZ A;  2L6M A;  3ADG A;  4WXD A;  1X49 A;  1N3G A;  2VE7 C;  2YSP A;  3C6M A;  3KZY A;  4TUI A;  4DR3 E;  1Z1B A;  2EQ0 A;  2M1S A;  1XMQ E;  1T4L B;  1SFE A;  1FJG E;  3QG5 C;  4RHB B;  2VRD A;  3MHS C;  5A6J A;  2N3G A;  1FKA E;  4BBY A;  4WXC A;  5AE1 A;  2CT1 A;  3HQ1 A;  4ZYG A;  4LF8 E;  3LML A;  4DR2 E;  3ADI A;  2V87 A;  2UUA E;  1X6F A;  4JI0 E;  5LMU E;  2VQF E;  3UK3 C;  5A2Q C;  2EOJ A;  5KL5 A;  1YYW A;  1A1L A;  1IQO A;  2JR1 A;  2EM6 A;  1WRJ A;  2V83 A;  3IWB A;  2YTE A;  4DR1 E;  4LU9 A;  4NXN E;  4LFB E;  2LJU A;  2LTR A;  4M2Z A;  4J8Z A;  3C4T A;  2EN4 A;  1PJQ A;  3DJW A;  1EH8 A;  1RMD A;  1WHQ A;  1P47 A;  1TF3 A;  1DGC A;  2EPC A;  2EOF A;  2MC5 A;  1XNQ E;  1RQ0 A;  1UIL A;  3FIG A;  2E1M A;  4JI3 E;  1YYK A;  3L00 A;  2UXC E;  4YY3 E;  4M0V A;  1N36 E;  2EMH A;  2WCC 3;  2JYA A;  1AH5 A;  4AQY E;  1A1G A;  4JI5 E;  4K0K E;  1A1H A;  5KL2 A;  2YTI A;  1EH6 A;  2RPC A;  2DLK A;  2EMG A;  3P1X A;  2ZM6 E;  4R2A A;  3T1H E;  4O43 A;  2UU9 E;  4I8O A;  5A6K A;  2YTD A;  2EN6 A;  2YTQ A;  1LLM C;  4B3R E;  2UXD E;  3EQ1 A;  2EOE A;  1SR9 A;  2EL4 A;  5BR8 E;  3BBG A;  4BS9 A;  1QNT A;  2E5L E;  3EPJ A;  1I94 E;  4WFT A;  4LFA E;  3JAM C;  4X9J A;  2EOM A;  4M30 A;  2KHX A;  2E72 A;  2M4I A;  2RS6 A;  3K6Q A;  2YRH A;  3THO B;  2EPO A;  2V8Q B;  2DMI A;  1T4N A;  2EN7 A;  2FTX B;  4R2S A;  4DR7 E;  4RH8 A;  2N3H A;  2EM7 A;  4DR6 E;  2D9H A;  2EMK A;  5KL7 A;  3F6H A;  4O5G A;  4DUZ E;  2EPK X;  3T1Y E;  2JWO A;  2UXB E;  2YU5 A;  2KOU A;  1YZ9 A;  4LTY A;  2B7V A;  1YSA C;  2LUP B;  2EL5 A;  4X65 E;  2DLQ A;  1ZAA C;  1G2F C;  2RQL A;  1F2I G;  2EMF A;  2EZ6 A;  2M7Q A;  2RS7 A;  5KL6 A;  4P78 A;  2EOS A;  2EM2 A;  1NEI A;  1XNR E;  4N4R B;  4X8W A;  2EM4 A;  2NUF A;  1BB8 A;  1G2D C;  4LF7 E;  1HNZ E;  3MHH C;  2G7H A;  2JXP A;  2EPX A;  5F3W A;  1EH7 A;  1PJT A;  2YZT A;  4P7D A;  4WYQ B;  4NXM E;  2YTN A;  4R2E A;  3J81 C;  2CPN A;  2B3T B;  2EP3 A;  1AAY A;  2L8T A;  4BHB A;  3OTO E;  4GKJ E;  2J7J A;  4X64 E;  1A1F A;  1N33 E;  5AE3 A;  5T6J A;  1O0W A;  5AE2 A;  5A6A A;  3ADL A;  2L2M A;  1IBM E;  2EE8 A;  2EOY A;  3BF2 A;  1B69 A;  4F54 A;  4JI1 E;  1HNW E;  4DV6 E;  3BID A;  2F4V E;  1X47 A;  1T39 A;  1GTK A;  1PJS A;  2EN1 A;  4F6N A;  2V89 A;  2EM5 A;  2GHF A;  3THN A;  2HC5 A;  2EM9 A;  2L3C A;  3OML A;  2HGH A;  3ECR A;  2RSM A;  2WBT A;  2NA2 A;  3KWR A;  1JK1 A;  4LF5 E;  2ADR A;  4F6M A;  4F9A B;  2JOB A;  4R2D A;  2DRP A;  2EOQ A;  4MLQ A;  4M9V C;  4DV4 E;  5CFF E;  2LJH A;  2EM0 A;  2ENA A;  2ODR D;  1X6H A;  4GEQ B;  4BHC A;  1A1J A;  2EOX A;  2UUC E;  2YRK A;  2L92 A;  5LLQ A;  2V86 A;  2EMA A;  4OX9 E;  1YYO A;  1HR0 E;  5AAS A;  4R2P A;  2EM8 A;  2F8B A;  1KYQ A;  2DIX A;  4HTG A;  3H09 A;  4LF6 E;  2LMZ A;  1JK2 A;  2MC6 A;  4IS1 C;  5AC4 A;  3J80 C;  4LFC E;  4KWY A;  1QU6 A;  3VYY A;  4X62 E;  2FV4 B;  3C4B A;  2WZO A;  2EMI A;  2B9D A;  5A6B A;  2HJJ A;  4DV3 E;  1DQ3 A;  4LF4 E;  4F9B B;  3HTX A;  2EOR A;  3AUZ A;  4L5N C;  4R2C A;  4JV5 E;  4BCA A;  2EMC A;  4LF9 E;  2JVA A;  1UBD C;  2EPL X;  2WBS A;  2LV2 A;  1X3C A;  2ENH A;  2PRT A;  4R03 A;  2EOI A;  4JI8 E;  2EOZ A;  4JI7 E;  4GKK E;  4L8N A;  3J7A G;  2EL6 A;  4WSG A;  2BBG A;  2N8X A;  2EPP A;  2EMB A;  2LCE A;  4Q28 A;  2LE2 A;  4JI6 E;  1GQE A;  1YFH A;  2DGC A;  2YPN A;  4R8O A;  3C6K A;  4DKK A;  3LLH A;  2NAB A;  4X66 E;  1GZ6 A;  2EMW A;  2WBU A;  1IBL E;  2KON A;  5IXM B;  4KHP E;  5A69 A;  2MKD A;  1UN6 B;  4ZYE A;  1MGT A;  2CTD A; 
#chains in the Genus database with same CATH homology
 1X47 A;  2B7T A;  3P1X A;  2ZM6 E;  2JY9 A;  3VK6 A;  2FGG A;  3T1H E;  2JOX A;  3VYX A;  2DB2 A;  2UU9 E;  2V89 A;  2UUB E;  4I8O A;  4YHH E;  3DF6 A;  3HPS A;  4F9C B;  3OML A;  2L3C A;  2RSM A;  3IWC A;  2DSY A;  4B3R E;  2NA2 A;  1UHZ A;  3KWR A;  2K4V A;  2NUE A;  4LF5 E;  1J5E E;  1PKP A;  4B3M E;  2RTX A;  4WPY A;  4F9A B;  2JOB A;  2MDR A;  2HHH E;  3F6G A;  1SR9 A;  2UXD E;  5BR8 E;  4DR4 E;  4BS9 A;  1WXR A;  1IBK E;  2E5L E;  4DV1 E;  1I94 E;  4WFT A;  4LFA E;  3JAM C;  4DV4 E;  1DI2 A;  4BC9 A;  5CFF E;  3ZOQ B;  2LJH A;  4DR5 E;  3MSW A;  4WSP A;  3HPZ A;  4M30 A;  2KHX A;  1HNX E;  2M4I A;  2RS6 A;  3K6Q A;  3RMP A;  2V8Q B;  1T4N A;  2LUQ A;  2FTX B;  2ODR D;  4GEQ B;  4DR7 E;  5ADZ A;  4JYA E;  2N3H A;  2V88 A;  4DV0 E;  2UUC E;  4DR6 E;  3AV0 A;  2L92 A;  3HXL A;  2V86 A;  1J26 A;  4TUG A;  5IWA E;  2ODR C;  1T4O A;  3F6H A;  2L6M A;  3ADG A;  4OX9 E;  4DUZ E;  1YYO A;  1X49 A;  1HR0 E;  5AAS A;  2VE7 C;  2L2N A;  4TUI A;  4DR3 E;  2LBS B;  1XMQ E;  1T4L B;  2M1S A;  1FJG E;  3T1Y E;  2JWO A;  2UXB E;  5LMN E;  4DMI A;  2F8B A;  2KOU A;  2H36 X;  4JI2 E;  1YZ9 A;  2N3G A;  3ADJ A;  2DIX A;  1ZBQ A;  2B7V A;  4LTY A;  3H09 A;  4BBY A;  1FKA E;  5AE1 A;  4LF6 E;  2LMZ A;  2LUP B;  3HQ1 A;  4X65 E;  2IHR 1;  1N32 E;  2MC6 A;  2NUG A;  4LF8 E;  3LML A;  5FLX C;  3J80 C;  4LFC E;  1N34 E;  1QU6 A;  4DR2 E;  3ADI A;  2V87 A;  2V85 A;  3VYY A;  2UUA E;  4KZS A;  4X62 E;  4JI0 E;  5LMU E;  2LTS A;  2FV4 B;  3C4B A;  2VQF E;  2WZO A;  2EZ6 A;  2B9D A;  2LRS A;  4DV3 E;  1DQ3 A;  2M7Q A;  5A2Q C;  4LF4 E;  2RS7 A;  4F9B B;  2EWL A;  3HTX A;  2F4V E;  3JTZ A;  3AUZ A;  4L5N C;  1YYW A;  4JV5 E;  2VQE E;  2JR1 A;  4BCA A;  4LF9 E;  2JVA A;  2V83 A;  3IWB A;  4P78 A;  1X48 A;  4DR1 E;  1XNR E;  4LU9 A;  4X8W A;  2NUF A;  4NXN E;  4LF7 E;  4B3S E;  4LFB E;  4R03 A;  2LTR A;  1HNZ E;  4M2Z A;  1RC7 A;  2G7H A;  4J8Z A;  3C4T A;  4JI8 E;  4BMJ A;  2L2K B;  5F3W A;  3DJW A;  2YZT A;  4DV2 E;  4P7D A;  4WYQ B;  4L8N A;  4JI7 E;  4NXM E;  4GKK E;  2DMY A;  4OOG C;  3J7A G;  1ZBT A;  3J81 C;  2CPN A;  1WHQ A;  2VF1 A;  4DV5 E;  1STU A;  2B3T B;  2MC5 A;  2YT4 A;  1XNQ E;  1RQ0 A;  4Q28 A;  2L8T A;  2LE2 A;  4JI6 E;  1GQE A;  3OTO E;  5DNY A;  2L3J A;  5IT9 C;  1XMO E;  4GKJ E;  1UIL A;  3FIG A;  2E1M A;  4X64 E;  4JI3 E;  1YYK A;  1N33 E;  4R8O A;  2UXC E;  3JU0 A;  4BC7 A;  4DKK A;  4YY3 E;  3LLH A;  5AE3 A;  4M0V A;  5T6J A;  5LL6 R;  1N36 E;  1O0W A;  5AE2 A;  1GZ6 A;  4X66 E;  4JI4 E;  3ADL A;  1IBL E;  2L2M A;  1IBM E;  4DV7 E;  2KON A;  4KHP E;  3J7Y p;  4AQY E;  4JI5 E;  4K0K E;  4F54 A;  4DUY E;  3IWD A;  2L33 A;  4B3T E;  4JI1 E;  1HNW E;  4DV6 E;  1EKZ A;  1WHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...