2KHXA

Drosha double-stranded rna binding motif
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Drosha double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation,nuclear protein
molecule keywords Ribonuclease 3
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2khxA00
4AQYE 2LJHA 2DMYA 2UXBE 4DR2E 3T1HE 1YYWA 3ADIA 4DV1E 5BR8E 2LUQA 4DKKA 1YYOA 1RC7A 1I94E 4LF4E 1HNWE 4JI2E 1T4NA 3ADJA 1J5EE 1N36E 4DV6E 1IBME 1XNRE 1UILA 2UUBE 4JV5E 4M30A 4X8WA 1HR0E 2DB2A 2L3JA 1WHNA 3OTOE 4YY3E 4DUZE 2NUFA 4DR1E 1RQ0A 4B3SE 4DV3E 1X49A 4LF5E 4GKKE 2MDRA 4JI5E 1N34E 2E5LE 4JI3E 1DI2A 3ADLA 2UXCE 3P1XA 4LF7E 4DR3E 4DR6E 4LFBE 1T4LB 2UU9E 1XMQE 1N32E 4LFAE 1HNXE 3ADGA 1IBKE 3T1YE 1UHZA 1EKZA 4DV4E 4OOGC 4DR7E 1GQEA 2HHHE 4LF8E 2CPNA 1O0WA 1X48A 2LTSA 4B3TE 3C4TA 4JI0E 2IHR1 1X47A 3LLHA 4WYQB 2UXDE 2EZ6A 2NUEA 4KHPE 2VQEE 2RSMA 4GKJE 2LTRA 4DV2E 4YHHE 3C4BA 1HNZE 4LF9E 1PKPA 4JI7E 4M2ZA 3VYYA 3J7Yp 4X65E 1IBLE 4K0KE 4WFTA 4B3ME 4JYAE 2F4VE 2N3GA 1T4OA 4DUYE 3HTXA 5LMUE 2UUAE 4DV7E 2L2MA 4DR5E 5CFFE 4JI6E 4B3RE 2VQFE 2JVAA 2RS6A 2RS7A 5LMNE 1YZ9A 2RTXA 2LUPB 4LFCE 1FKAE 1YYKA 1WHQA 1XMOE 2L3CA 4JI4E 4DV5E 4X62E 2NA2A 2ZM6E 2NUGA 1ZBTA 2N3HA 3VYXA 4NXNE 1N33E 2KHXA 2L2KB 4DV0E 1XNQE 1J26A 2DIXA 4X64E 2UUCE 4JI1E 2B7VA 1FJGE 2L33A 4LF6E 4OX9E 2JY9A 5IWAE 1QU6A 4DR4E 2B3TB 2LRSA 4JI8E 1STUA 4X66E 2LBSB 4NXME 2L2NA 2B7TA 2YT4A
chains in the Genus database with same CATH superfamily
4RH8A 2LJHA 2JPAA 3IWCA 1YYWA 3ADIA 2EOSA 1I94E 5BR8E 2LUQA 3BIDA 2EM8A 2ENHA 4R2AA 4BS9A 4ZYEA 2JOXA 1T4NA 3ADJA 2YTOA 1NEIA 4P7DA 2EPPA 5KL2A 4MLQA 3KZYA 1WHNA 3OTOE 1UBDC 2NUFA 1QNTA 4DV3E 2EMXA 2YSOA 2MDRA 2A25A 3F6HA 2V87A 2KOUA 2FTXB 3J80C 1YUIA 3P1XA 1WRJA 1WXRA 2VF1A 3EPHA 2UU9E 1XMQE 1N32E 4LFAE 2GHFA 1B69A 1IBKE 2EMAA 2EPUA 1GQEA 3HXLA 2CPNA 2PRTA 2IHR1 2EE8A 3BF2A 1G2DC 2UXDE 3JAMC 4F9BB 2YRMA 1L4SA 2YWQA 4DV2E 3C4BA 4LF9E 2E1MA 2EMZA 1MGTA 3J7Yp 2EP3A 1IBLE 2WZOA 2N3GA 4O5GA 2EN8A 3RMPA 5LMUE 2WBSA 4IS1C 5KL5A 1SFEA 1T39A 4DR5E 2EOHA 5CFFE 2VQFE 2J7JA 1Z1BA 1DQ3A 2EN6A 4N4RB 5KL6A 2V86A 2RTXA 3IWBA 2LUPB 1YZ9A 2EQ1A 4LFCE 1FKAE 2R76A 2JR1A 3JTZA 4HEIA 2HGHA 4TUIA 5DNYA 3KZZA 4HTGA 4X62E 1A1IA 2EMWA 4IJDA 2GLIA 2EOQA 2YU8A 2ZM6E 2EM9A 3J7AG 3VYXA 2EORA 2EPAA 4R2CA 2KHXA 4KWYA 1J26A 4X64E 2DLKA 4F9AB 2B7VA 4NHRA 2ODRC 2L33A 5IWAE 4R2QA 1N3GA 4DR4E 4JI8E 3DF6A 4NXME 2YT4A 4FK5C 4DR2E 2EOZA 2MDGA 2EPMX 3T1HE 2MKDA 4DKKA 1RC7A 3TQMA 2VRDA 2VE7C 4LF4E 1NCSA 2M4IA 2EN7A 1IBME 1GTKA 1EH8A 1UILA 2EL4A 2UUBE 2RSIA 2BBGA 4M30A 2WBUA 2L3JA 5AE3A 1ZAAC 1PDAA 4YY3E 4DR1E 1RQ0A 2ELZA 4LF5E 4M0VA 1N34E 2LCEA 4TUGA 4P78A 1DI2A 4R2DA 2UXCE 1AH5A 2F8BA 4F9CB 1PJTA 1X6FA 2EOYA 1PJQA 4LFBE 1T4LB 4LTYA 2EQ3A 4WPYA 2EN4A 3ADGA 3T1YE 1UHZA 4DV4E 2LVHA 4R03A 4ZYGA 4DR7E 3FIGA 2EOIA 4B3TE 3C4TA 4GEQB 2ODRD 2YTJA 1ZR9A 2HC5A 2DRPA 4GKJE 1YFHA 1BB8A 1HNZE 2EPNA 4WSGA 5AASA 4JI7E 2EMYA 1P47A 1X5WA 1A1KA 4B3ME 2EOEA 2CT1A 2UUAE 2EMIA 4DV7E 3ECRA 1F2IG 4WXCA 2MKNA 4JI6E 2YTPA 4B3RE 2YTIA 1BBOA 1T38A 1TF6A 2CTDA 3EQ1A 2WCC3 1X6HA 1EH6A 3MHHC 1XMOE 3THNA 4JI4E 4DV5E 2NA2A 2EPZA 2NUGA 2N3HA 2N8XA 2EOXA 2JYAA 1JK1A 1UN6B 2EPOA 4LF6E 2EMCA 2EMGA 4DMIA 4R2PA 2L8TA 2EM0A 2B3TB 4BMJA 4R2RA 2B7TA 4AQYE 2DMYA 1JK2A 5KL4A 4DV1E 1YYOA 4BC7A 3UK3C 2LE2A 2R1FA 4JI2E 4WX9A 5KL3A 1J5EE 1N36E 4DV6E 2JP9A 3J81C 2EM3A 3L00A 1XNRE 3OMLA 4Q28A 2EJ4A 4M9VC 3THOB 1HR0E 4R8OA 3DJWA 2EPXA 2WBTA 4BCAA 4DUZE 4J8ZA 1EH7A 4B3SE 3VK6A 4GKKE 1GZ6A 4JI5E 2ENCA 2LO3A 5AE1A 1ZBQA 4ZYDA 2G7HA 2DLQA 2I13A 1G2FC 5LL6R 4LF7E 2EMBA 1A1LA 5F3WA 3MSWA 2YZTA 4DR3E 2D9HA 2YTFA 1HNXE 1BBGA 2KONA 4ZYHA 5IXMB 4NZVA 4LF8E 4I8OA 3MHSC 1X48A 2DGCA 3C6KA 2EL6A 3EPJA 1SR9A 2YRKA 3LMLA 3EPLA 4BC9A 2YSPA 2LTRA 2RQLA 4YHHE 1PKPA 2YU5A 4K0KE 1PJSA 2EPKX 2YRHA 2YTNA 2M9AA 4JYAE 3BGHA 5T6JA 2F4VE 1T4OA 2EPLX 4DUYE 3HTXA 3KWRA 2V83A 2L2MA 2EL5A 1YSAC 2EOOA 2FGGA 2MC5A 1ZU1A 5LMNE 2DMIA 2B9DA 2EOFA 1IQOA 5AE2A 2L3CA 4L8NA 4RHBB 1IQSA 4R2EA 2EN1A 5AC4A 1A1JA 2GPIA 1YUJA 2Q8UA 2DIXA 4L5NC 1X6EA 4JI1E 1DGCA 2YTEA 3AV0A 3M99B 2V85A 2YPNA 2JXPA 2EPCA 2I9IA 4X66E 2V8QB 2JOBA 2YTDA 2LT7A 5A69A 5A6BA 2EN3A 2NABA 2UXBE 2EM7A 2LMZA 1HNWE 2EQ0A 2DSYA 2EM6A 4F6MA 2LV2A 4JV5E 2EM2A 4GZNC 4X8WA 1WJPA 2DB2A 5LLQA 3IWDA 5FLXC 1MEYC 2YTGA 3JU0A 4F6NA 1X49A 4O43A 2BB8A 2E5LE 3VHTB 4JI3E 3ADLA 1X3CA 4BHBA 4MLVA 2EOJA 2ENAA 5A6AA 4DR6E 3HPSA 4WXDA 4Q35B 5A6KA 5AC5A 1A1FA 2M7QA 4O24A 1EKZA 4OOGC 2HHHE 2H36X 4F54A 2EM5A 5IT9C 1O0WA 4KZSA 2LTSA 4JI0E 4BBYA 2MC6A 2EM4A 1X47A 2M1SA 3LLHA 4WYQB 4X9JA 2LJUA 2EZ6A 3HPZA 2NUEA 5A6BD 4KHPE 1A1HA 2VQEE 2RSMA 2E72A 3BBGA 1KJKA 3K6QA 4M2ZA 3F6GA 3VYYA 4X65E 3HQ1A 2V89A 2FV4B 3EPKA 2YTQA 4WFTA 4WSPA 2EN2A 2EPRA 2EMHA 2CSHA 5ADZA 5KL7A 3AUZA 2L6MA 2JVAA 2RS6A 2HJJA 2RS7A 2RPCA 3H09A 2EOMA 1YYKA 1WHQA 2K4VA 2ADRA 2EMFA 4R2SA 2EWLA 4BHCA 4F2JC 3ZOQB 1ZBTA 4NXNE 1N33E 2L2KB 5A2QC 2L92A 4DV0E 1XNQE 2K7IA 4LU9A 2JWOA 2UUCE 1KYQA 2EMKA 2V88A 1AAYA 2ELYA 5TSEA 1FJGE 1YPNA 1IMUA 4OX9E 2JY9A 5IV8B 1QU6A 5A6JA 1A1GA 1TN9A 3QG5C 1LLMC 2EMLA 2LRSA 1RMDA 1STUA 2LBSB 3C6MA 1TF3A 2L2NA 4O4KA
chains in the Genus database with same CATH topology
4AQYE 2LJHA 2DMYA 2UXBE 3IWCA 4DR2E 3T1HE 1YYWA 3ADIA 4DV1E 5BR8E 2LUQA 2LMZA 4DKKA 2VE7C 4BC7A 1YYOA 1RC7A 2LE2A 4BS9A 4JI2E 4LF4E 2JOXA 1T4NA 3ADJA 2DSYA 2M4IA 1N36E 1J5EE 4DV6E 1IBME 3J81C 4P7DA 1XNRE 3OMLA 1UILA 4Q28A 2UUBE 4JV5E 4M30A 4X8WA 1HR0E 4R8OA 3DJWA 2DB2A 2L3JA 1WHNA 5AE3A 3OTOE 4BCAA 3IWDA 4YY3E 5FLXC 4DUZE 2NUFA 4J8ZA 4DR1E 1RQ0A 4B3SE 3JU0A 3VK6A 4DV3E 1X49A 4LF5E 4GKKE 2MDRA 1GZ6A 4M0VA 4JI5E 3F6HA 5AE1A 1ZBQA 1N34E 2E5LE 2G7HA 4TUGA 4P78A 4JI3E 2V87A 1DI2A 3ADLA 2KOUA 2UXCE 2FTXB 3J80C 3P1XA 5LL6R 2F8BA 4LF7E 4F9CB 4DR7E 5F3WA 3MSWA 1WXRA 2YZTA 2VF1A 4DR3E 4DR6E 4LFBE 1T4LB 2UU9E 4LTYA 1XMQE 4LFAE 1N32E 3HPSA 1HNXE 4WPYA 2KONA 3ADGA 1IBKE 2M7QA 3T1YE 1UHZA 1EKZA 4DV4E 1HNWE 4R03A 4OOGC 1GQEA 2H36X 3HXLA 4F54A 2HHHE 3FIGA 4I8OA 5IT9C 2CPNA 4LF8E 1O0WA 1X48A 4KZSA 2LTSA 4B3TE 3C4TA 4JI0E 4BBYA 2MC6A 4GEQB 2IHR1 2ODRD 1X47A 1SR9A 2M1SA 3LLHA 3LMLA 4WYQB 2UXDE 3JAMC 1I94E 4F9BB 3HPZA 2EZ6A 2NUEA 4BC9A 4KHPE 2VQEE 2RSMA 4GKJE 2LTRA 4DV2E 3C4BA 4YHHE 5AASA 1HNZE 4LF9E 3K6QA 1PKPA 2E1MA 3F6GA 4JI7E 3VYYA 4M2ZA 3J7Yp 4X65E 3HQ1A 2V89A 1IBLE 4K0KE 2FV4B 4WFTA 4B3ME 4JYAE 4WSPA 5T6JA 2F4VE 2WZOA 2N3GA 1T4OA 4DUYE 3HTXA 3KWRA 3RMPA 5LMUE 2V83A 5ADZA 4DV7E 2UUAE 3AUZA 2L2MA 4DR5E 5CFFE 4JI6E 2L6MA 4B3RE 2VQFE 2JVAA 1DQ3A 2FGGA 2MC5A 2RS6A 2RS7A 5LMNE 2V86A 2B9DA 2RTXA 3IWBA 2LUPB 1YZ9A 4LFCE 1FKAE 3H09A 2JR1A 1YYKA 5AE2A 3JTZA 1WHQA 2K4VA 1XMOE 4TUIA 5DNYA 2L3CA 4DV5E 4JI4E 4L8NA 2EWLA 4X62E 3ZOQB 2NA2A 2ZM6E 2NUGA 3J7AG 1ZBTA 2N3HA 3VYXA 4NXNE 1N33E 2KHXA 5A2QC 2L92A 2L2KB 4DV0E 1XNQE 1J26A 4LU9A 2DIXA 2JWOA 4X64E 4L5NC 2UUCE 4F9AB 4JI1E 2B7VA 2V88A 2ODRC 3AV0A 2L33A 1FJGE 4LF6E 2V85A 4OX9E 2JY9A 4DMIA 5IWAE 1QU6A 2L8TA 4DR4E 2B3TB 2LRSA 2V8QB 1STUA 2JOBA 4JI8E 4BMJA 4X66E 2LBSB 3DF6A 4NXME 2L2NA 2B7TA 2YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY E;  2LJH A;  2DMY A;  2UXB E;  4DR2 E;  3T1H E;  1YYW A;  3ADI A;  4DV1 E;  5BR8 E;  2LUQ A;  4DKK A;  1YYO A;  1RC7 A;  1I94 E;  4LF4 E;  1HNW E;  4JI2 E;  1T4N A;  3ADJ A;  1J5E E;  1N36 E;  4DV6 E;  1IBM E;  1XNR E;  1UIL A;  2UUB E;  4JV5 E;  4M30 A;  4X8W A;  1HR0 E;  2DB2 A;  2L3J A;  1WHN A;  3OTO E;  4YY3 E;  4DUZ E;  2NUF A;  4DR1 E;  1RQ0 A;  4B3S E;  4DV3 E;  1X49 A;  4LF5 E;  4GKK E;  2MDR A;  4JI5 E;  1N34 E;  2E5L E;  4JI3 E;  1DI2 A;  3ADL A;  2UXC E;  3P1X A;  4LF7 E;  4DR3 E;  4DR6 E;  4LFB E;  1T4L B;  2UU9 E;  1XMQ E;  1N32 E;  4LFA E;  1HNX E;  3ADG A;  1IBK E;  3T1Y E;  1UHZ A;  1EKZ A;  4DV4 E;  4OOG C;  4DR7 E;  1GQE A;  2HHH E;  4LF8 E;  2CPN A;  1O0W A;  1X48 A;  2LTS A;  4B3T E;  3C4T A;  4JI0 E;  2IHR 1;  1X47 A;  3LLH A;  4WYQ B;  2UXD E;  2EZ6 A;  2NUE A;  4KHP E;  2VQE E;  2RSM A;  4GKJ E;  2LTR A;  4DV2 E;  4YHH E;  3C4B A;  1HNZ E;  4LF9 E;  1PKP A;  4JI7 E;  4M2Z A;  3VYY A;  3J7Y p;  4X65 E;  1IBL E;  4K0K E;  4WFT A;  4B3M E;  4JYA E;  2F4V E;  2N3G A;  1T4O A;  4DUY E;  3HTX A;  5LMU E;  2UUA E;  4DV7 E;  2L2M A;  4DR5 E;  5CFF E;  4JI6 E;  4B3R E;  2VQF E;  2JVA A;  2RS6 A;  2RS7 A;  5LMN E;  1YZ9 A;  2RTX A;  2LUP B;  4LFC E;  1FKA E;  1YYK A;  1WHQ A;  1XMO E;  2L3C A;  4JI4 E;  4DV5 E;  4X62 E;  2NA2 A;  2ZM6 E;  2NUG A;  1ZBT A;  2N3H A;  3VYX A;  4NXN E;  1N33 E;  2KHX A;  2L2K B;  4DV0 E;  1XNQ E;  1J26 A;  2DIX A;  4X64 E;  2UUC E;  4JI1 E;  2B7V A;  1FJG E;  2L33 A;  4LF6 E;  4OX9 E;  2JY9 A;  5IWA E;  1QU6 A;  4DR4 E;  2B3T B;  2LRS A;  4JI8 E;  1STU A;  4X66 E;  2LBS B;  4NXM E;  2L2N A;  2B7T A;  2YT4 A; 
#chains in the Genus database with same CATH topology
 4RH8 A;  2LJH A;  2JPA A;  3IWC A;  1YYW A;  3ADI A;  2EOS A;  1I94 E;  5BR8 E;  2LUQ A;  3BID A;  2EM8 A;  2ENH A;  4R2A A;  4BS9 A;  4ZYE A;  2JOX A;  1T4N A;  3ADJ A;  2YTO A;  1NEI A;  4P7D A;  2EPP A;  5KL2 A;  4MLQ A;  3KZY A;  1WHN A;  3OTO E;  1UBD C;  2NUF A;  1QNT A;  4DV3 E;  2EMX A;  2YSO A;  2MDR A;  2A25 A;  3F6H A;  2V87 A;  2KOU A;  2FTX B;  3J80 C;  1YUI A;  3P1X A;  1WRJ A;  1WXR A;  2VF1 A;  3EPH A;  2UU9 E;  1XMQ E;  1N32 E;  4LFA E;  2GHF A;  1B69 A;  1IBK E;  2EMA A;  2EPU A;  1GQE A;  3HXL A;  2CPN A;  2PRT A;  2IHR 1;  2EE8 A;  3BF2 A;  1G2D C;  2UXD E;  3JAM C;  4F9B B;  2YRM A;  1L4S A;  2YWQ A;  4DV2 E;  3C4B A;  4LF9 E;  2E1M A;  2EMZ A;  1MGT A;  3J7Y p;  2EP3 A;  1IBL E;  2WZO A;  2N3G A;  4O5G A;  2EN8 A;  3RMP A;  5LMU E;  2WBS A;  4IS1 C;  5KL5 A;  1SFE A;  1T39 A;  4DR5 E;  2EOH A;  5CFF E;  2VQF E;  2J7J A;  1Z1B A;  1DQ3 A;  2EN6 A;  4N4R B;  5KL6 A;  2V86 A;  2RTX A;  3IWB A;  2LUP B;  1YZ9 A;  2EQ1 A;  4LFC E;  1FKA E;  2R76 A;  2JR1 A;  3JTZ A;  4HEI A;  2HGH A;  4TUI A;  5DNY A;  3KZZ A;  4HTG A;  4X62 E;  1A1I A;  2EMW A;  4IJD A;  2GLI A;  2EOQ A;  2YU8 A;  2ZM6 E;  2EM9 A;  3J7A G;  3VYX A;  2EOR A;  2EPA A;  4R2C A;  2KHX A;  4KWY A;  1J26 A;  4X64 E;  2DLK A;  4F9A B;  2B7V A;  4NHR A;  2ODR C;  2L33 A;  5IWA E;  4R2Q A;  1N3G A;  4DR4 E;  4JI8 E;  3DF6 A;  4NXM E;  2YT4 A;  4FK5 C;  4DR2 E;  2EOZ A;  2MDG A;  2EPM X;  3T1H E;  2MKD A;  4DKK A;  1RC7 A;  3TQM A;  2VRD A;  2VE7 C;  4LF4 E;  1NCS A;  2M4I A;  2EN7 A;  1IBM E;  1GTK A;  1EH8 A;  1UIL A;  2EL4 A;  2UUB E;  2RSI A;  2BBG A;  4M30 A;  2WBU A;  2L3J A;  5AE3 A;  1ZAA C;  1PDA A;  4YY3 E;  4DR1 E;  1RQ0 A;  2ELZ A;  4LF5 E;  4M0V A;  1N34 E;  2LCE A;  4TUG A;  4P78 A;  1DI2 A;  4R2D A;  2UXC E;  1AH5 A;  2F8B A;  4F9C B;  1PJT A;  1X6F A;  2EOY A;  1PJQ A;  4LFB E;  1T4L B;  4LTY A;  2EQ3 A;  4WPY A;  2EN4 A;  3ADG A;  3T1Y E;  1UHZ A;  4DV4 E;  2LVH A;  4R03 A;  4ZYG A;  4DR7 E;  3FIG A;  2EOI A;  4B3T E;  3C4T A;  4GEQ B;  2ODR D;  2YTJ A;  1ZR9 A;  2HC5 A;  2DRP A;  4GKJ E;  1YFH A;  1BB8 A;  1HNZ E;  2EPN A;  4WSG A;  5AAS A;  4JI7 E;  2EMY A;  1P47 A;  1X5W A;  1A1K A;  4B3M E;  2EOE A;  2CT1 A;  2UUA E;  2EMI A;  4DV7 E;  3ECR A;  1F2I G;  4WXC A;  2MKN A;  4JI6 E;  2YTP A;  4B3R E;  2YTI A;  1BBO A;  1T38 A;  1TF6 A;  2CTD A;  3EQ1 A;  2WCC 3;  1X6H A;  1EH6 A;  3MHH C;  1XMO E;  3THN A;  4JI4 E;  4DV5 E;  2NA2 A;  2EPZ A;  2NUG A;  2N3H A;  2N8X A;  2EOX A;  2JYA A;  1JK1 A;  1UN6 B;  2EPO A;  4LF6 E;  2EMC A;  2EMG A;  4DMI A;  4R2P A;  2L8T A;  2EM0 A;  2B3T B;  4BMJ A;  4R2R A;  2B7T A;  4AQY E;  2DMY A;  1JK2 A;  5KL4 A;  4DV1 E;  1YYO A;  4BC7 A;  3UK3 C;  2LE2 A;  2R1F A;  4JI2 E;  4WX9 A;  5KL3 A;  1J5E E;  1N36 E;  4DV6 E;  2JP9 A;  3J81 C;  2EM3 A;  3L00 A;  1XNR E;  3OML A;  4Q28 A;  2EJ4 A;  4M9V C;  3THO B;  1HR0 E;  4R8O A;  3DJW A;  2EPX A;  2WBT A;  4BCA A;  4DUZ E;  4J8Z A;  1EH7 A;  4B3S E;  3VK6 A;  4GKK E;  1GZ6 A;  4JI5 E;  2ENC A;  2LO3 A;  5AE1 A;  1ZBQ A;  4ZYD A;  2G7H A;  2DLQ A;  2I13 A;  1G2F C;  5LL6 R;  4LF7 E;  2EMB A;  1A1L A;  5F3W A;  3MSW A;  2YZT A;  4DR3 E;  2D9H A;  2YTF A;  1HNX E;  1BBG A;  2KON A;  4ZYH A;  5IXM B;  4NZV A;  4LF8 E;  4I8O A;  3MHS C;  1X48 A;  2DGC A;  3C6K A;  2EL6 A;  3EPJ A;  1SR9 A;  2YRK A;  3LML A;  3EPL A;  4BC9 A;  2YSP A;  2LTR A;  2RQL A;  4YHH E;  1PKP A;  2YU5 A;  4K0K E;  1PJS A;  2EPK X;  2YRH A;  2YTN A;  2M9A A;  4JYA E;  3BGH A;  5T6J A;  2F4V E;  1T4O A;  2EPL X;  4DUY E;  3HTX A;  3KWR A;  2V83 A;  2L2M A;  2EL5 A;  1YSA C;  2EOO A;  2FGG A;  2MC5 A;  1ZU1 A;  5LMN E;  2DMI A;  2B9D A;  2EOF A;  1IQO A;  5AE2 A;  2L3C A;  4L8N A;  4RHB B;  1IQS A;  4R2E A;  2EN1 A;  5AC4 A;  1A1J A;  2GPI A;  1YUJ A;  2Q8U A;  2DIX A;  4L5N C;  1X6E A;  4JI1 E;  1DGC A;  2YTE A;  3AV0 A;  3M99 B;  2V85 A;  2YPN A;  2JXP A;  2EPC A;  2I9I A;  4X66 E;  2V8Q B;  2JOB A;  2YTD A;  2LT7 A;  5A69 A;  5A6B A;  2EN3 A;  2NAB A;  2UXB E;  2EM7 A;  2LMZ A;  1HNW E;  2EQ0 A;  2DSY A;  2EM6 A;  4F6M A;  2LV2 A;  4JV5 E;  2EM2 A;  4GZN C;  4X8W A;  1WJP A;  2DB2 A;  5LLQ A;  3IWD A;  5FLX C;  1MEY C;  2YTG A;  3JU0 A;  4F6N A;  1X49 A;  4O43 A;  2BB8 A;  2E5L E;  3VHT B;  4JI3 E;  3ADL A;  1X3C A;  4BHB A;  4MLV A;  2EOJ A;  2ENA A;  5A6A A;  4DR6 E;  3HPS A;  4WXD A;  4Q35 B;  5A6K A;  5AC5 A;  1A1F A;  2M7Q A;  4O24 A;  1EKZ A;  4OOG C;  2HHH E;  2H36 X;  4F54 A;  2EM5 A;  5IT9 C;  1O0W A;  4KZS A;  2LTS A;  4JI0 E;  4BBY A;  2MC6 A;  2EM4 A;  1X47 A;  2M1S A;  3LLH A;  4WYQ B;  4X9J A;  2LJU A;  2EZ6 A;  3HPZ A;  2NUE A;  5A6B D;  4KHP E;  1A1H A;  2VQE E;  2RSM A;  2E72 A;  3BBG A;  1KJK A;  3K6Q A;  4M2Z A;  3F6G A;  3VYY A;  4X65 E;  3HQ1 A;  2V89 A;  2FV4 B;  3EPK A;  2YTQ A;  4WFT A;  4WSP A;  2EN2 A;  2EPR A;  2EMH A;  2CSH A;  5ADZ A;  5KL7 A;  3AUZ A;  2L6M A;  2JVA A;  2RS6 A;  2HJJ A;  2RS7 A;  2RPC A;  3H09 A;  2EOM A;  1YYK A;  1WHQ A;  2K4V A;  2ADR A;  2EMF A;  4R2S A;  2EWL A;  4BHC A;  4F2J C;  3ZOQ B;  1ZBT A;  4NXN E;  1N33 E;  2L2K B;  5A2Q C;  2L92 A;  4DV0 E;  1XNQ E;  2K7I A;  4LU9 A;  2JWO A;  2UUC E;  1KYQ A;  2EMK A;  2V88 A;  1AAY A;  2ELY A;  5TSE A;  1FJG E;  1YPN A;  1IMU A;  4OX9 E;  2JY9 A;  5IV8 B;  1QU6 A;  5A6J A;  1A1G A;  1TN9 A;  3QG5 C;  1LLM C;  2EML A;  2LRS A;  1RMD A;  1STU A;  2LBS B;  3C6M A;  1TF3 A;  2L2N A;  4O4K A; 
#chains in the Genus database with same CATH homology
 4AQY E;  2LJH A;  2DMY A;  2UXB E;  3IWC A;  4DR2 E;  3T1H E;  1YYW A;  3ADI A;  4DV1 E;  5BR8 E;  2LUQ A;  2LMZ A;  4DKK A;  2VE7 C;  4BC7 A;  1YYO A;  1RC7 A;  2LE2 A;  4BS9 A;  4JI2 E;  4LF4 E;  2JOX A;  1T4N A;  3ADJ A;  2DSY A;  2M4I A;  1N36 E;  1J5E E;  4DV6 E;  1IBM E;  3J81 C;  4P7D A;  1XNR E;  3OML A;  1UIL A;  4Q28 A;  2UUB E;  4JV5 E;  4M30 A;  4X8W A;  1HR0 E;  4R8O A;  3DJW A;  2DB2 A;  2L3J A;  1WHN A;  5AE3 A;  3OTO E;  4BCA A;  3IWD A;  4YY3 E;  5FLX C;  4DUZ E;  2NUF A;  4J8Z A;  4DR1 E;  1RQ0 A;  4B3S E;  3JU0 A;  3VK6 A;  4DV3 E;  1X49 A;  4LF5 E;  4GKK E;  2MDR A;  1GZ6 A;  4M0V A;  4JI5 E;  3F6H A;  5AE1 A;  1ZBQ A;  1N34 E;  2E5L E;  2G7H A;  4TUG A;  4P78 A;  4JI3 E;  2V87 A;  1DI2 A;  3ADL A;  2KOU A;  2UXC E;  2FTX B;  3J80 C;  3P1X A;  5LL6 R;  2F8B A;  4LF7 E;  4F9C B;  4DR7 E;  5F3W A;  3MSW A;  1WXR A;  2YZT A;  2VF1 A;  4DR3 E;  4DR6 E;  4LFB E;  1T4L B;  2UU9 E;  4LTY A;  1XMQ E;  4LFA E;  1N32 E;  3HPS A;  1HNX E;  4WPY A;  2KON A;  3ADG A;  1IBK E;  2M7Q A;  3T1Y E;  1UHZ A;  1EKZ A;  4DV4 E;  1HNW E;  4R03 A;  4OOG C;  1GQE A;  2H36 X;  3HXL A;  4F54 A;  2HHH E;  3FIG A;  4I8O A;  5IT9 C;  2CPN A;  4LF8 E;  1O0W A;  1X48 A;  4KZS A;  2LTS A;  4B3T E;  3C4T A;  4JI0 E;  4BBY A;  2MC6 A;  4GEQ B;  2IHR 1;  2ODR D;  1X47 A;  1SR9 A;  2M1S A;  3LLH A;  3LML A;  4WYQ B;  2UXD E;  3JAM C;  1I94 E;  4F9B B;  3HPZ A;  2EZ6 A;  2NUE A;  4BC9 A;  4KHP E;  2VQE E;  2RSM A;  4GKJ E;  2LTR A;  4DV2 E;  3C4B A;  4YHH E;  5AAS A;  1HNZ E;  4LF9 E;  3K6Q A;  1PKP A;  2E1M A;  3F6G A;  4JI7 E;  3VYY A;  4M2Z A;  3J7Y p;  4X65 E;  3HQ1 A;  2V89 A;  1IBL E;  4K0K E;  2FV4 B;  4WFT A;  4B3M E;  4JYA E;  4WSP A;  5T6J A;  2F4V E;  2WZO A;  2N3G A;  1T4O A;  4DUY E;  3HTX A;  3KWR A;  3RMP A;  5LMU E;  2V83 A;  5ADZ A;  4DV7 E;  2UUA E;  3AUZ A;  2L2M A;  4DR5 E;  5CFF E;  4JI6 E;  2L6M A;  4B3R E;  2VQF E;  2JVA A;  1DQ3 A;  2FGG A;  2MC5 A;  2RS6 A;  2RS7 A;  5LMN E;  2V86 A;  2B9D A;  2RTX A;  3IWB A;  2LUP B;  1YZ9 A;  4LFC E;  1FKA E;  3H09 A;  2JR1 A;  1YYK A;  5AE2 A;  3JTZ A;  1WHQ A;  2K4V A;  1XMO E;  4TUI A;  5DNY A;  2L3C A;  4DV5 E;  4JI4 E;  4L8N A;  2EWL A;  4X62 E;  3ZOQ B;  2NA2 A;  2ZM6 E;  2NUG A;  3J7A G;  1ZBT A;  2N3H A;  3VYX A;  4NXN E;  1N33 E;  2KHX A;  5A2Q C;  2L92 A;  2L2K B;  4DV0 E;  1XNQ E;  1J26 A;  4LU9 A;  2DIX A;  2JWO A;  4X64 E;  4L5N C;  2UUC E;  4F9A B;  4JI1 E;  2B7V A;  2V88 A;  2ODR C;  3AV0 A;  2L33 A;  1FJG E;  4LF6 E;  2V85 A;  4OX9 E;  2JY9 A;  4DMI A;  5IWA E;  1QU6 A;  2L8T A;  4DR4 E;  2B3T B;  2LRS A;  2V8Q B;  1STU A;  2JOB A;  4JI8 E;  4BMJ A;  4X66 E;  2LBS B;  3DF6 A;  4NXM E;  2L2N A;  2B7T A;  2YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...