2KHXA

Drosha double-stranded rna binding motif
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
b'NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease 3
publication title Solution structure of the Drosha double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation,nuclear protein
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2khxA00
3VYYA 1UILA 4NXME 3VYXA 4JI4E 3OTOE 1IBLE 4DUYE 4WYQB 1STUA 2UUAE 1ZBTA 1WHNA 3P1XA 2IHR1 4B3TE 2JVAA 2VQFE 1XNRE 2L2KB 4LF4E 4JI0E 3T1HE 3C4BA 1T4OA 2ZM6E 4DV7E 2E5LE 4B3ME 4LF7E 4JI2E 1T4NA 4DV5E 2JY9A 4DV4E 3ADJA 3LLHA 2DMYA 2UU9E 2L33A 1DI2A 4DKKA 2NUEA 5LMUE 1I94E 4YY3E 1N33E 2LUPB 4KHPE 1X48A 2LJHA 4DR3E 2EZ6A 1UHZA 2L2NA 4K0KE 4OOGC 1IBME 4X66E 4X64E 2LUQA 4AQYE 2LBSB 2RS6A 4X8WA 2UXBE 2LTRA 5CFFE 4DR5E 4X65E 4DV6E 1HNWE 3J7Yp 4JYAE 4JI5E 4DR2E 1YYWA 4DUZE 4B3SE 2YT4A 1HR0E 2LTSA 1XNQE 5LMNE 2B7VA 4LFBE 2L2MA 1GQEA 4WFTA 4DV0E 1J26A 4DV2E 4LF5E 1YYOA 2NUFA 4DV1E 4JI3E 1FJGE 3ADIA 4LF8E 4JI6E 2F4VE 5BR8E 4LF9E 4LFAE 4OX9E 2CPNA 1QU6A 2UXCE 1X47A 2MDRA 4YHHE 1WHQA 4M30A 1RC7A 1IBKE 4LFCE 2LRSA 1N36E 1HNZE 2HHHE 4JI1E 1RQ0A 2L3CA 1XMOE 4LF6E 1YYKA 3HTXA 3C4TA 2UUBE 2VQEE 2B3TB 4JV5E 2DB2A 2NA2A 1YZ9A 4B3RE 2KHXA 2DIXA 1O0WA 3T1YE 3ADLA 4X62E 4GKKE 1FKAE 2L3JA 2RTXA 3ADGA 1HNXE 4JI8E 1XMQE 4GKJE 2B7TA 2RS7A 2NUGA 2UUCE 4NXNE 2N3HA 1J5EE 1X49A 2RSMA 1T4LB 1N32E 4DR1E 2N3GA 4DR4E 2UXDE 4JI7E 4DV3E 1N34E 4M2ZA 1EKZA 4DR6E 1PKPA 5IWAE 4DR7E
chains in the Genus database with same CATH superfamily
3VYYA 1UILA 2VE7C 4JI4E 3OTOE 4DUYE 4HEIA 1STUA 2UUAE 1ZBTA 4BS9A 3P1XA 4TUIA 4B3TE 1KJKA 5A6BA 2EM2A 2ADRA 2YTOA 3T1HE 2FTXB 4R2PA 3BF2A 4DV7E 3C6MA 2E5LE 3K6QA 4JI2E 2JY9A 2YTDA 2UU9E 2EJ4A 5DNYA 1DI2A 4DKKA 4F9CB 1I94E 2LUPB 2EMXA 1KYQA 2EOEA 4J8ZA 2EMKA 2EPRA 2EZ6A 1UHZA 1P47A 4K0KE 4OOGC 1G2DC 3EQ1A 4X66E 5A69A 1DGCA 2JP9A 2KONA 4IS1C 2EN3A 4R2DA 2EMFA 4NZVA 4DR5E 2EOOA 1HNWE 4JYAE 4JI5E 3HPZA 2EOSA 2DLKA 2NABA 2YZTA 5KL2A 2K7IA 2L8TA 5LMNE 2YU5A 4WFTA 4ZYHA 5AE3A 3MHSC 4R2QA 2EN2A 4LF5E 2D9HA 4F6MA 3BIDA 2ODRD 2F4VE 1YSAC 1GZ6A 2I9IA 4OX9E 2V88A 2EM8A 1QU6A 1SFEA 1X47A 2YTPA 2LT7A 1ZU1A 1WHQA 2JOXA 1BBOA 2EM5A 2HC5A 1GTKA 4JI1E 5A6KA 4LF6E 2EOQA 3HTXA 2UUBE 1AAYA 2YSPA 1YUIA 2EMYA 2EPKX 4R2CA 1O0WA 3T1YE 3THNA 4BHCA 2YTQA 3J81C 1WJPA 4BCAA 1A1HA 3FIGA 2RS7A 2L6MA 2N3HA 4M0VA 1T39A 4ZYDA 3BBGA 2M4IA 4Q28A 2ELYA 2ENHA 3EPJA 4O5GA 5A6BD 5A2QC 5IWAE 3ADIA 4WSGA 4F6NA 3VYXA 4NXME 3J80C 2E1MA 1IBLE 2JYAA 4F9AB 2YPNA 5FLXC 1WHNA 4HTGA 2IHR1 1XNRE 2JOBA 1PDAA 2WBUA 4JI0E 1NCSA 2LE2A 2RQLA 5IV8B 3ZOQB 2YTFA 4LF7E 2EL6A 4DV5E 2EN7A 4DV4E 4R2SA 2ENAA 2L33A 4MLQA 2LJUA 4M9VC 5ADZA 1X48A 4L8NA 4ZYGA 2BB8A 3UK3C 3VK6A 1T38A 4R8OA 2EE8A 2EN4A 2H36X 1IBME 2LUQA 2LBSB 2B9DA 2K4VA 2UXBE 2DRPA 2YTIA 4X65E 4WXDA 3J7Yp 2LO3A 2EQ1A 4DUZE 4B3SE 2YT4A 5TSEA 4WPYA 5AC5A 2V89A 1PJSA 1IMUA 2L2MA 2PRTA 1J26A 4DV2E 1PJTA 4WX9A 1TF6A 1YUJA 2EMWA 2EOJA 4JI3E 1FJGE 2EMHA 4LF8E 4JI6E 4LF9E 2R1FA 3IWBA 2CPNA 2V86A 5KL5A 2R76A 1X6HA 2MC5A 3M99B 3IWDA 4I8OA 4P7DA 1XMOE 2M1SA 1JK2A 1YYKA 5A6JA 2VQEE 2DB2A 2EP3A 2EN6A 1YZ9A 1QNTA 4B3RE 4R2EA 3ADLA 4X62E 3HPSA 2YTGA 2JWOA 1L4SA 1DQ3A 3ADGA 3EPKA 4KZSA 1HNXE 4JI8E 2B7TA 2NUGA 2YSOA 2UUCE 1PJQA 4F9BB 4P78A 1J5EE 1X49A 2ELZA 2VRDA 2EQ3A 2FGGA 2UXDE 5LLQA 4IJDA 2YTEA 4R2AA 1N34E 4M2ZA 1EKZA 3HXLA 2JPAA 1BBGA 4DR6E 2FV4B 2F8BA 2EMLA 2EOMA 5KL7A 2EOIA 3JAMC 2EMBA 2VQFE 1WXRA 2EM9A 4LF4E 2YU8A 2EL4A 4L5NC 2YRKA 1EH8A 1T4OA 3F6GA 2EORA 2LCEA 2EPZA 1T4NA 1RMDA 5T6JA 1ZR9A 3LLHA 2DMYA 2NUEA 4TUGA 5A6AA 4YY3E 1N33E 2N8XA 2LJHA 1YFHA 1AH5A 1A1IA 4WSPA 2L2NA 2EMCA 2YRHA 2E72A 4X8WA 3L00A 5CFFE 3MSWA 4DR2E 1YYWA 4N4RB 4X9JA 2LTSA 2MKDA 2EL5A 2RPCA 2EPLX 1XNQE 3RMPA 2J7JA 3JU0A 2B7VA 4LFBE 1X3CA 1B69A 4DV0E 4O4KA 1F2IG 2DSYA 1WRJA 2EPPA 3AV0A 2LVHA 3AUZA 2NUFA 2V8QB 2EPXA 2EQ0A 2HJJA 2GHFA 5BR8E 4BHBA 1LLMC 4R2RA 1IBKE 1RC7A 5IT9C 2EOXA 2LRSA 3DF6A 1HNZE 1G2FC 2I13A 4F54A 2L3CA 2EM7A 2A25A 1A1LA 1IQSA 3C4TA 4LTYA 2B3TB 4BMJA 1X5WA 2DIXA 2EMGA 2EPOA 5KL6A 2EPUA 2V83A 1IQOA 2L3JA 2EM3A 1XMQE 1BB8A 3JTZA 3QG5C 4NHRA 4NXNE 4O43A 4BBYA 3EPLA 2EPNA 3J7AG 1T4LB 2EN8A 2RSIA 2N3GA 4DR4E 5AE2A 2EOFA 2CSHA 4JI7E 4DV3E 1MGTA 1PKPA 2EMZA 3BGHA 4WXCA 2YTNA 2ODRC 4WYQB 2WZOA 4KWYA 2JVAA 2EPMX 3C6KA 4RHBB 2L2KB 2DMIA 1N3GA 2EM4A 3C4BA 2HGHA 2ZM6E 2DLQA 4GZNC 4B3ME 2MC6A 2EMAA 3ADJA 2V87A 2GLIA 3HQ1A 5F3WA 2JR1A 3OMLA 1UN6B 4GEQB 5LMUE 4KHPE 4DR3E 2BBGA 2G7HA 2EM6A 2YTJA 1A1FA 2EMIA 2EN1A 4X64E 4AQYE 2RS6A 1TN9A 2LTRA 2M9AA 3H09A 4DV6E 4BC9A 4DMIA 1UBDC 1Z1BA 3LMLA 1HR0E 2EWLA 2WCC3 2YWQA 4BC7A 1GQEA 4O24A 5KL4A 2Q8UA 3MHHC 1YYOA 4RH8A 2WBTA 2EOYA 1EH7A 4ZYEA 4DV1E 3F6HA 4MLVA 1A1JA 3VHTB 4LFAE 1YPNA 3KZYA 1MEYC 1EH6A 2UXCE 2MDRA 3IWCA 4YHHE 4M30A 2DGCA 4LFCE 2ENCA 1N36E 2EM0A 5LL6R 2HHHE 2VF1A 2V85A 1RQ0A 3KZZA 2EPCA 3TQMA 2EPAA 1NEIA 1X6FA 1A1GA 1A1KA 4R03A 2CT1A 4Q35B 3EPHA 4JV5E 2JXPA 2NA2A 2YRMA 2KHXA 2WBSA 2LMZA 1N32E 4GKKE 1X6EA 1FKAE 1ZBQA 2RTXA 1TF3A 4GKJE 5AASA 3ECRA 5KL3A 1SR9A 5AE1A 2MKNA 3DJWA 3KWRA 2MDGA 2RSMA 1ZAAC 4LU9A 5IXMB 2L92A 3THOB 2EOHA 4DR1E 2GPIA 2M7QA 2CTDA 4F2JC 1JK1A 4FK5C 2LV2A 5AC4A 2KOUA 2EOZA 4DR7E
chains in the Genus database with same CATH topology
3VYYA 1UILA 4NXME 2VE7C 3J80C 4JI4E 3VYXA 2F8BA 2E1MA 3OTOE 1IBLE 4DUYE 2ODRC 4WYQB 1STUA 2WZOA 1ZBTA 4F9AB 2UUAE 3JAMC 5FLXC 4BS9A 1WHNA 3P1XA 4TUIA 2IHR1 4B3TE 2JVAA 1WXRA 2VQFE 1XNRE 2JOBA 2L2KB 4JI0E 4LF4E 2LE2A 3T1HE 4L5NC 2FTXB 3C4BA 3ZOQB 1T4OA 2ZM6E 3F6GA 4DV7E 2E5LE 3K6QA 4B3ME 2MC6A 4JI2E 4LF7E 1T4NA 4DV5E 2JY9A 4DV4E 5T6JA 3ADJA 2V87A 3LLHA 2DMYA 2UU9E 3HQ1A 2L33A 5DNYA 2JR1A 3OMLA 5F3WA 1DI2A 4DKKA 4F9CB 2NUEA 4TUGA 4GEQB 5LMUE 1I94E 4YY3E 1N33E 5ADZA 2LUPB 1X48A 4KHPE 4L8NA 2LJHA 4J8ZA 3VK6A 4DR3E 4WSPA 2EZ6A 1UHZA 2L2NA 4R8OA 2G7HA 4OOGC 4K0KE 2H36X 4X66E 1IBME 4X64E 2LUQA 4AQYE 2LBSB 2RS6A 2B9DA 2KONA 4X8WA 2K4VA 2UXBE 2LTRA 5CFFE 4DR5E 4X65E 3H09A 4DV6E 1HNWE 3MSWA 3J7Yp 4BC9A 4JI5E 4JYAE 3HPZA 4DR2E 1YYWA 4DMIA 4DUZE 4B3SE 2YT4A 3LMLA 1HR0E 2LTSA 2EWLA 2YZTA 1XNQE 3RMPA 2L8TA 4WPYA 2V89A 5LMNE 3JU0A 2B7VA 4LFBE 2L2MA 4BC7A 1GQEA 4WFTA 5AE3A 4DV0E 1J26A 4DV2E 4LF5E 2DSYA 1YYOA 2NUFA 3AV0A 3AUZA 2V8QB 4DV1E 2ODRD 4JI3E 1FJGE 3ADIA 4LF8E 3F6HA 4JI6E 2F4VE 1GZ6A 5BR8E 4LF9E 4LFAE 4OX9E 2V88A 3IWBA 2CPNA 1QU6A 2V86A 2UXCE 1X47A 2MDRA 3IWCA 4YHHE 1WHQA 2JOXA 4M30A 2MC5A 5IT9C 1RC7A 1IBKE 2LRSA 1N36E 4LFCE 3DF6A 3IWDA 4I8OA 2VF1A 5LL6R 1HNZE 2HHHE 2V85A 1RQ0A 4P7DA 4F54A 4JI1E 2L3CA 1XMOE 4LF6E 4R03A 2M1SA 1YYKA 3HTXA 3C4TA 4LTYA 2UUBE 2B3TB 2VQEE 4BMJA 4JV5E 2DB2A 2NA2A 1YZ9A 4B3RE 2KHXA 2DIXA 1O0WA 2LMZA 3T1YE 3ADLA 2V83A 4X62E 3HPSA 4GKKE 2JWOA 1FKAE 1ZBQA 2L3JA 2RTXA 3J81C 1DQ3A 3ADGA 4KZSA 1HNXE 4JI8E 4BCAA 5AASA 1XMQE 4GKJE 3JTZA 3FIGA 2B7TA 2RS7A 2L6MA 2NUGA 1SR9A 2UUCE 5AE1A 4F9BB 2N3HA 3DJWA 4NXNE 4M0VA 3KWRA 4P78A 4BBYA 1J5EE 1X49A 2RSMA 3J7AG 1T4LB 1N32E 4LU9A 2L92A 2N3GA 4DR1E 2M7QA 2FGGA 2M4IA 4DR4E 5AE2A 2UXDE 4Q28A 4JI7E 4DV3E 1N34E 4M2ZA 1EKZA 3HXLA 4DR6E 1PKPA 2KOUA 5A2QC 5IWAE 2FV4B 4DR7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYY A;  1UIL A;  4NXM E;  3VYX A;  4JI4 E;  3OTO E;  1IBL E;  4DUY E;  4WYQ B;  1STU A;  2UUA E;  1ZBT A;  1WHN A;  3P1X A;  2IHR 1;  4B3T E;  2JVA A;  2VQF E;  1XNR E;  2L2K B;  4LF4 E;  4JI0 E;  3T1H E;  3C4B A;  1T4O A;  2ZM6 E;  4DV7 E;  2E5L E;  4B3M E;  4LF7 E;  4JI2 E;  1T4N A;  4DV5 E;  2JY9 A;  4DV4 E;  3ADJ A;  3LLH A;  2DMY A;  2UU9 E;  2L33 A;  1DI2 A;  4DKK A;  2NUE A;  5LMU E;  1I94 E;  4YY3 E;  1N33 E;  2LUP B;  4KHP E;  1X48 A;  2LJH A;  4DR3 E;  2EZ6 A;  1UHZ A;  2L2N A;  4K0K E;  4OOG C;  1IBM E;  4X66 E;  4X64 E;  2LUQ A;  4AQY E;  2LBS B;  2RS6 A;  4X8W A;  2UXB E;  2LTR A;  5CFF E;  4DR5 E;  4X65 E;  4DV6 E;  1HNW E;  3J7Y p;  4JYA E;  4JI5 E;  4DR2 E;  1YYW A;  4DUZ E;  4B3S E;  2YT4 A;  1HR0 E;  2LTS A;  1XNQ E;  5LMN E;  2B7V A;  4LFB E;  2L2M A;  1GQE A;  4WFT A;  4DV0 E;  1J26 A;  4DV2 E;  4LF5 E;  1YYO A;  2NUF A;  4DV1 E;  4JI3 E;  1FJG E;  3ADI A;  4LF8 E;  4JI6 E;  2F4V E;  5BR8 E;  4LF9 E;  4LFA E;  4OX9 E;  2CPN A;  1QU6 A;  2UXC E;  1X47 A;  2MDR A;  4YHH E;  1WHQ A;  4M30 A;  1RC7 A;  1IBK E;  4LFC E;  2LRS A;  1N36 E;  1HNZ E;  2HHH E;  4JI1 E;  1RQ0 A;  2L3C A;  1XMO E;  4LF6 E;  1YYK A;  3HTX A;  3C4T A;  2UUB E;  2VQE E;  2B3T B;  4JV5 E;  2DB2 A;  2NA2 A;  1YZ9 A;  4B3R E;  2KHX A;  2DIX A;  1O0W A;  3T1Y E;  3ADL A;  4X62 E;  4GKK E;  1FKA E;  2L3J A;  2RTX A;  3ADG A;  1HNX E;  4JI8 E;  1XMQ E;  4GKJ E;  2B7T A;  2RS7 A;  2NUG A;  2UUC E;  4NXN E;  2N3H A;  1J5E E;  1X49 A;  2RSM A;  1T4L B;  1N32 E;  4DR1 E;  2N3G A;  4DR4 E;  2UXD E;  4JI7 E;  4DV3 E;  1N34 E;  4M2Z A;  1EKZ A;  4DR6 E;  1PKP A;  5IWA E;  4DR7 E; 
#chains in the Genus database with same CATH topology
 3VYY A;  1UIL A;  2VE7 C;  4JI4 E;  3OTO E;  4DUY E;  4HEI A;  1STU A;  2UUA E;  1ZBT A;  4BS9 A;  3P1X A;  4TUI A;  4B3T E;  1KJK A;  5A6B A;  2EM2 A;  2ADR A;  2YTO A;  3T1H E;  2FTX B;  4R2P A;  3BF2 A;  4DV7 E;  3C6M A;  2E5L E;  3K6Q A;  4JI2 E;  2JY9 A;  2YTD A;  2UU9 E;  2EJ4 A;  5DNY A;  1DI2 A;  4DKK A;  4F9C B;  1I94 E;  2LUP B;  2EMX A;  1KYQ A;  2EOE A;  4J8Z A;  2EMK A;  2EPR A;  2EZ6 A;  1UHZ A;  1P47 A;  4K0K E;  4OOG C;  1G2D C;  3EQ1 A;  4X66 E;  5A69 A;  1DGC A;  2JP9 A;  2KON A;  4IS1 C;  2EN3 A;  4R2D A;  2EMF A;  4NZV A;  4DR5 E;  2EOO A;  1HNW E;  4JYA E;  4JI5 E;  3HPZ A;  2EOS A;  2DLK A;  2NAB A;  2YZT A;  5KL2 A;  2K7I A;  2L8T A;  5LMN E;  2YU5 A;  4WFT A;  4ZYH A;  5AE3 A;  3MHS C;  4R2Q A;  2EN2 A;  4LF5 E;  2D9H A;  4F6M A;  3BID A;  2ODR D;  2F4V E;  1YSA C;  1GZ6 A;  2I9I A;  4OX9 E;  2V88 A;  2EM8 A;  1QU6 A;  1SFE A;  1X47 A;  2YTP A;  2LT7 A;  1ZU1 A;  1WHQ A;  2JOX A;  1BBO A;  2EM5 A;  2HC5 A;  1GTK A;  4JI1 E;  5A6K A;  4LF6 E;  2EOQ A;  3HTX A;  2UUB E;  1AAY A;  2YSP A;  1YUI A;  2EMY A;  2EPK X;  4R2C A;  1O0W A;  3T1Y E;  3THN A;  4BHC A;  2YTQ A;  3J81 C;  1WJP A;  4BCA A;  1A1H A;  3FIG A;  2RS7 A;  2L6M A;  2N3H A;  4M0V A;  1T39 A;  4ZYD A;  3BBG A;  2M4I A;  4Q28 A;  2ELY A;  2ENH A;  3EPJ A;  4O5G A;  5A6B D;  5A2Q C;  5IWA E;  3ADI A;  4WSG A;  4F6N A;  3VYX A;  4NXM E;  3J80 C;  2E1M A;  1IBL E;  2JYA A;  4F9A B;  2YPN A;  5FLX C;  1WHN A;  4HTG A;  2IHR 1;  1XNR E;  2JOB A;  1PDA A;  2WBU A;  4JI0 E;  1NCS A;  2LE2 A;  2RQL A;  5IV8 B;  3ZOQ B;  2YTF A;  4LF7 E;  2EL6 A;  4DV5 E;  2EN7 A;  4DV4 E;  4R2S A;  2ENA A;  2L33 A;  4MLQ A;  2LJU A;  4M9V C;  5ADZ A;  1X48 A;  4L8N A;  4ZYG A;  2BB8 A;  3UK3 C;  3VK6 A;  1T38 A;  4R8O A;  2EE8 A;  2EN4 A;  2H36 X;  1IBM E;  2LUQ A;  2LBS B;  2B9D A;  2K4V A;  2UXB E;  2DRP A;  2YTI A;  4X65 E;  4WXD A;  3J7Y p;  2LO3 A;  2EQ1 A;  4DUZ E;  4B3S E;  2YT4 A;  5TSE A;  4WPY A;  5AC5 A;  2V89 A;  1PJS A;  1IMU A;  2L2M A;  2PRT A;  1J26 A;  4DV2 E;  1PJT A;  4WX9 A;  1TF6 A;  1YUJ A;  2EMW A;  2EOJ A;  4JI3 E;  1FJG E;  2EMH A;  4LF8 E;  4JI6 E;  4LF9 E;  2R1F A;  3IWB A;  2CPN A;  2V86 A;  5KL5 A;  2R76 A;  1X6H A;  2MC5 A;  3M99 B;  3IWD A;  4I8O A;  4P7D A;  1XMO E;  2M1S A;  1JK2 A;  1YYK A;  5A6J A;  2VQE E;  2DB2 A;  2EP3 A;  2EN6 A;  1YZ9 A;  1QNT A;  4B3R E;  4R2E A;  3ADL A;  4X62 E;  3HPS A;  2YTG A;  2JWO A;  1L4S A;  1DQ3 A;  3ADG A;  3EPK A;  4KZS A;  1HNX E;  4JI8 E;  2B7T A;  2NUG A;  2YSO A;  2UUC E;  1PJQ A;  4F9B B;  4P78 A;  1J5E E;  1X49 A;  2ELZ A;  2VRD A;  2EQ3 A;  2FGG A;  2UXD E;  5LLQ A;  4IJD A;  2YTE A;  4R2A A;  1N34 E;  4M2Z A;  1EKZ A;  3HXL A;  2JPA A;  1BBG A;  4DR6 E;  2FV4 B;  2F8B A;  2EML A;  2EOM A;  5KL7 A;  2EOI A;  3JAM C;  2EMB A;  2VQF E;  1WXR A;  2EM9 A;  4LF4 E;  2YU8 A;  2EL4 A;  4L5N C;  2YRK A;  1EH8 A;  1T4O A;  3F6G A;  2EOR A;  2LCE A;  2EPZ A;  1T4N A;  1RMD A;  5T6J A;  1ZR9 A;  3LLH A;  2DMY A;  2NUE A;  4TUG A;  5A6A A;  4YY3 E;  1N33 E;  2N8X A;  2LJH A;  1YFH A;  1AH5 A;  1A1I A;  4WSP A;  2L2N A;  2EMC A;  2YRH A;  2E72 A;  4X8W A;  3L00 A;  5CFF E;  3MSW A;  4DR2 E;  1YYW A;  4N4R B;  4X9J A;  2LTS A;  2MKD A;  2EL5 A;  2RPC A;  2EPL X;  1XNQ E;  3RMP A;  2J7J A;  3JU0 A;  2B7V A;  4LFB E;  1X3C A;  1B69 A;  4DV0 E;  4O4K A;  1F2I G;  2DSY A;  1WRJ A;  2EPP A;  3AV0 A;  2LVH A;  3AUZ A;  2NUF A;  2V8Q B;  2EPX A;  2EQ0 A;  2HJJ A;  2GHF A;  5BR8 E;  4BHB A;  1LLM C;  4R2R A;  1IBK E;  1RC7 A;  5IT9 C;  2EOX A;  2LRS A;  3DF6 A;  1HNZ E;  1G2F C;  2I13 A;  4F54 A;  2L3C A;  2EM7 A;  2A25 A;  1A1L A;  1IQS A;  3C4T A;  4LTY A;  2B3T B;  4BMJ A;  1X5W A;  2DIX A;  2EMG A;  2EPO A;  5KL6 A;  2EPU A;  2V83 A;  1IQO A;  2L3J A;  2EM3 A;  1XMQ E;  1BB8 A;  3JTZ A;  3QG5 C;  4NHR A;  4NXN E;  4O43 A;  4BBY A;  3EPL A;  2EPN A;  3J7A G;  1T4L B;  2EN8 A;  2RSI A;  2N3G A;  4DR4 E;  5AE2 A;  2EOF A;  2CSH A;  4JI7 E;  4DV3 E;  1MGT A;  1PKP A;  2EMZ A;  3BGH A;  4WXC A;  2YTN A;  2ODR C;  4WYQ B;  2WZO A;  4KWY A;  2JVA A;  2EPM X;  3C6K A;  4RHB B;  2L2K B;  2DMI A;  1N3G A;  2EM4 A;  3C4B A;  2HGH A;  2ZM6 E;  2DLQ A;  4GZN C;  4B3M E;  2MC6 A;  2EMA A;  3ADJ A;  2V87 A;  2GLI A;  3HQ1 A;  5F3W A;  2JR1 A;  3OML A;  1UN6 B;  4GEQ B;  5LMU E;  4KHP E;  4DR3 E;  2BBG A;  2G7H A;  2EM6 A;  2YTJ A;  1A1F A;  2EMI A;  2EN1 A;  4X64 E;  4AQY E;  2RS6 A;  1TN9 A;  2LTR A;  2M9A A;  3H09 A;  4DV6 E;  4BC9 A;  4DMI A;  1UBD C;  1Z1B A;  3LML A;  1HR0 E;  2EWL A;  2WCC 3;  2YWQ A;  4BC7 A;  1GQE A;  4O24 A;  5KL4 A;  2Q8U A;  3MHH C;  1YYO A;  4RH8 A;  2WBT A;  2EOY A;  1EH7 A;  4ZYE A;  4DV1 E;  3F6H A;  4MLV A;  1A1J A;  3VHT B;  4LFA E;  1YPN A;  3KZY A;  1MEY C;  1EH6 A;  2UXC E;  2MDR A;  3IWC A;  4YHH E;  4M30 A;  2DGC A;  4LFC E;  2ENC A;  1N36 E;  2EM0 A;  5LL6 R;  2HHH E;  2VF1 A;  2V85 A;  1RQ0 A;  3KZZ A;  2EPC A;  3TQM A;  2EPA A;  1NEI A;  1X6F A;  1A1G A;  1A1K A;  4R03 A;  2CT1 A;  4Q35 B;  3EPH A;  4JV5 E;  2JXP A;  2NA2 A;  2YRM A;  2KHX A;  2WBS A;  2LMZ A;  1N32 E;  4GKK E;  1X6E A;  1FKA E;  1ZBQ A;  2RTX A;  1TF3 A;  4GKJ E;  5AAS A;  3ECR A;  5KL3 A;  1SR9 A;  5AE1 A;  2MKN A;  3DJW A;  3KWR A;  2MDG A;  2RSM A;  1ZAA C;  4LU9 A;  5IXM B;  2L92 A;  3THO B;  2EOH A;  4DR1 E;  2GPI A;  2M7Q A;  2CTD A;  4F2J C;  1JK1 A;  4FK5 C;  2LV2 A;  5AC4 A;  2KOU A;  2EOZ A;  4DR7 E; 
#chains in the Genus database with same CATH homology
 3VYY A;  1UIL A;  4NXM E;  2VE7 C;  3J80 C;  4JI4 E;  3VYX A;  2F8B A;  2E1M A;  3OTO E;  1IBL E;  4DUY E;  2ODR C;  4WYQ B;  1STU A;  2WZO A;  1ZBT A;  4F9A B;  2UUA E;  3JAM C;  5FLX C;  4BS9 A;  1WHN A;  3P1X A;  4TUI A;  2IHR 1;  4B3T E;  2JVA A;  1WXR A;  2VQF E;  1XNR E;  2JOB A;  2L2K B;  4JI0 E;  4LF4 E;  2LE2 A;  3T1H E;  4L5N C;  2FTX B;  3C4B A;  3ZOQ B;  1T4O A;  2ZM6 E;  3F6G A;  4DV7 E;  2E5L E;  3K6Q A;  4B3M E;  2MC6 A;  4JI2 E;  4LF7 E;  1T4N A;  4DV5 E;  2JY9 A;  4DV4 E;  5T6J A;  3ADJ A;  2V87 A;  3LLH A;  2DMY A;  2UU9 E;  3HQ1 A;  2L33 A;  5DNY A;  2JR1 A;  3OML A;  5F3W A;  1DI2 A;  4DKK A;  4F9C B;  2NUE A;  4TUG A;  4GEQ B;  5LMU E;  1I94 E;  4YY3 E;  1N33 E;  5ADZ A;  2LUP B;  1X48 A;  4KHP E;  4L8N A;  2LJH A;  4J8Z A;  3VK6 A;  4DR3 E;  4WSP A;  2EZ6 A;  1UHZ A;  2L2N A;  4R8O A;  2G7H A;  4OOG C;  4K0K E;  2H36 X;  4X66 E;  1IBM E;  4X64 E;  2LUQ A;  4AQY E;  2LBS B;  2RS6 A;  2B9D A;  2KON A;  4X8W A;  2K4V A;  2UXB E;  2LTR A;  5CFF E;  4DR5 E;  4X65 E;  3H09 A;  4DV6 E;  1HNW E;  3MSW A;  3J7Y p;  4BC9 A;  4JI5 E;  4JYA E;  3HPZ A;  4DR2 E;  1YYW A;  4DMI A;  4DUZ E;  4B3S E;  2YT4 A;  3LML A;  1HR0 E;  2LTS A;  2EWL A;  2YZT A;  1XNQ E;  3RMP A;  2L8T A;  4WPY A;  2V89 A;  5LMN E;  3JU0 A;  2B7V A;  4LFB E;  2L2M A;  4BC7 A;  1GQE A;  4WFT A;  5AE3 A;  4DV0 E;  1J26 A;  4DV2 E;  4LF5 E;  2DSY A;  1YYO A;  2NUF A;  3AV0 A;  3AUZ A;  2V8Q B;  4DV1 E;  2ODR D;  4JI3 E;  1FJG E;  3ADI A;  4LF8 E;  3F6H A;  4JI6 E;  2F4V E;  1GZ6 A;  5BR8 E;  4LF9 E;  4LFA E;  4OX9 E;  2V88 A;  3IWB A;  2CPN A;  1QU6 A;  2V86 A;  2UXC E;  1X47 A;  2MDR A;  3IWC A;  4YHH E;  1WHQ A;  2JOX A;  4M30 A;  2MC5 A;  5IT9 C;  1RC7 A;  1IBK E;  2LRS A;  1N36 E;  4LFC E;  3DF6 A;  3IWD A;  4I8O A;  2VF1 A;  5LL6 R;  1HNZ E;  2HHH E;  2V85 A;  1RQ0 A;  4P7D A;  4F54 A;  4JI1 E;  2L3C A;  1XMO E;  4LF6 E;  4R03 A;  2M1S A;  1YYK A;  3HTX A;  3C4T A;  4LTY A;  2UUB E;  2B3T B;  2VQE E;  4BMJ A;  4JV5 E;  2DB2 A;  2NA2 A;  1YZ9 A;  4B3R E;  2KHX A;  2DIX A;  1O0W A;  2LMZ A;  3T1Y E;  3ADL A;  2V83 A;  4X62 E;  3HPS A;  4GKK E;  2JWO A;  1FKA E;  1ZBQ A;  2L3J A;  2RTX A;  3J81 C;  1DQ3 A;  3ADG A;  4KZS A;  1HNX E;  4JI8 E;  4BCA A;  5AAS A;  1XMQ E;  4GKJ E;  3JTZ A;  3FIG A;  2B7T A;  2RS7 A;  2L6M A;  2NUG A;  1SR9 A;  2UUC E;  5AE1 A;  4F9B B;  2N3H A;  3DJW A;  4NXN E;  4M0V A;  3KWR A;  4P78 A;  4BBY A;  1J5E E;  1X49 A;  2RSM A;  3J7A G;  1T4L B;  1N32 E;  4LU9 A;  2L92 A;  2N3G A;  4DR1 E;  2M7Q A;  2FGG A;  2M4I A;  4DR4 E;  5AE2 A;  2UXD E;  4Q28 A;  4JI7 E;  4DV3 E;  1N34 E;  4M2Z A;  1EKZ A;  3HXL A;  4DR6 E;  1PKP A;  2KOU A;  5A2Q C;  5IWA E;  2FV4 B;  4DR7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...