2KHXA

Drosha double-stranded rna binding motif
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Drosha double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation,nuclear protein
molecule keywords Ribonuclease 3
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2khxA00
2DIXA 1STUA 2JY9A 2LUQA 2B7VA 2NA2A 4JI7E 4X62E 4B3TE 4DKKA 2VQEE 4DV7E 4JV5E 2VQFE 2UUAE 4K0KE 5BR8E 3C4BA 4DV1E 4LF5E 4X64E 4M30A 4JI2E 2L2NA 3ADIA 1XNRE 2LTSA 1HR0E 3VYXA 1I94E 4NXNE 3C4TA 3OTOE 2RTXA 4JI6E 2B3TB 1UILA 2IHR1 2RS6A 3J7Yp 2UUCE 5CFFE 4GKJE 2UUBE 2E5LE 4WFTA 4DR2E 3VYYA 4OX9E 2HHHE 4M2ZA 2ZM6E 2CPNA 4JI1E 2LBSB 1T4OA 2N3HA 4LFBE 3ADLA 4JI5E 4OOGC 1EKZA 4LF4E 1YYWA 1N36E 4DR1E 1N34E 1N32E 4JI3E 4JYAE 4DV3E 4LF7E 2UU9E 2KHXA 2NUEA 1IBLE 2UXBE 4WYQB 1YYOA 1UHZA 2NUFA 2MDRA 1YZ9A 1QU6A 4X8WA 2DMYA 4LFAE 1WHQA 4JI4E 2L2KB 1HNZE 4DV5E 1J26A 1FJGE 4DUZE 4B3ME 3T1HE 5LMNE 4X65E 2LJHA 4AQYE 1PKPA 1IBKE 2NUGA 2F4VE 3HTXA 4YY3E 2RSMA 3P1XA 4DR3E 4LF6E 2B7TA 3ADJA 3LLHA 1RC7A 1XNQE 1FKAE 4LF9E 1WHNA 1O0WA 1HNXE 1DI2A 4DV0E 4DV4E 2JVAA 4X66E 4JI0E 2L2MA 4DR7E 1XMOE 2UXDE 1XMQE 4KHPE 3T1YE 4DR5E 5LMUE 2L3JA 4LF8E 1RQ0A 2L3CA 1X48A 1GQEA 4DR6E 4DV2E 2EZ6A 2LUPB 4B3SE 1N33E 1T4LB 4GKKE 4B3RE 1T4NA 2DB2A 4NXME 1J5EE 4YHHE 4DR4E 5IWAE 1X47A 4LFCE 3ADGA 1X49A 2N3GA 2RS7A 2LTRA 4DUYE 4DV6E 4JI8E 1IBME 2L33A 2YT4A 2UXCE 1YYKA 2LRSA 1HNWE 1ZBTA
chains in the Genus database with same CATH superfamily
2NA2A 2LUQA 4ZYGA 2JOXA 1EH8A 1JK2A 2YRKA 2VQEE 4JV5E 2VQFE 2UUAE 2EP3A 2YTOA 5BR8E 2LO3A 2EMYA 3C6MA 2EPPA 5ADZA 4BHBA 1AH5A 5AE2A 2LMZA 2L2NA 3ADIA 5LLQA 1WXRA 1HR0E 4J8ZA 2M1SA 4R03A 3DJWA 2CT1A 2A25A 2V8QB 4BCAA 5AC4A 3OMLA 2UUCE 1X5WA 2YU5A 1Z1BA 2FV4B 2YSOA 2UUBE 3M99B 5A6KA 4OX9E 2HHHE 2YTJA 4BHCA 4R2CA 2EQ3A 2LBSB 2V88A 2LE2A 5KL3A 4JI5E 1IQSA 4OOGC 1EKZA 2MC6A 2LT7A 2DLKA 2MDGA 4DR1E 1N34E 3ECRA 2EOIA 4L5NC 1WRJA 2WBSA 2NUEA 2EOSA 1GTKA 1YYOA 2UXBE 4F54A 2EMZA 2EOJA 2MDRA 4RH8A 1SR9A 2EOYA 4LFAE 4N4RB 4DV5E 1J26A 3F6GA 4B3ME 1LLMC 1KJKA 4GZNC 1IBKE 2RSIA 5AASA 5T6JA 4YY3E 2B7TA 2FTXB 3ADJA 2EMBA 1FKAE 5LL6R 1DI2A 4DV0E 2EL4A 4O43A 4X66E 4JI0E 2EM2A 2EMKA 2ENHA 2EOHA 1RQ0A 5IXMB 2LUPB 5KL5A 2EM6A 1T4NA 1X6HA 2EMIA 2H36X 4YHHE 5IWAE 2KOUA 3HPZA 2EN6A 1RMDA 3VK6A 2L33A 1GZ6A 2YT4A 4F2JC 3IWDA 5KL6A 4R2RA 2JY9A 2EN4A 4DKKA 1SFEA 2LCEA 2J7JA 4R8OA 2EPKX 5TSEA 2EN7A 1T39A 2V85A 4WSGA 4X64E 5A6BA 2VF1A 4BMJA 4JI2E 4HTGA 2EOEA 3BF2A 1YFHA 2V83A 1P47A 2WCC3 3KZZA 4LU9A 1I94E 3VHTB 4NXNE 1PDAA 2EPLX 2KONA 2RTXA 3ZOQB 4JI6E 2B3TB 2Q8UA 3EPHA 2EORA 5A69A 3RMPA 1YUIA 2EM7A 3EPJA 2V87A 5AC5A 2E5LE 4WFTA 5DNYA 2JWOA 2N3HA 4LTYA 3JU0A 2YTFA 2EQ1A 1YYWA 1NEIA 2E1MA 1F2IG 4JYAE 2YSPA 2ODRD 4F9AB 2UU9E 1PJSA 2EM8A 2EPCA 2YTQA 2EMFA 3HXLA 5A6AA 2K7IA 1IBLE 2EOFA 2EQ0A 5F3WA 3TQMA 2EN8A 4BS9A 4IJDA 2DMYA 4ZYDA 2DRPA 2EOMA 2JP9A 1HNZE 1YPNA 2YPNA 4L8NA 5LMNE 2LJHA 1PKPA 2EMAA 4WSPA 1TF3A 2NUGA 1G2FC 2BB8A 2RSMA 4DR3E 3LLHA 1RC7A 1XNQE 1X6FA 2EM9A 4M9VC 1O0WA 4DV4E 2EN1A 2JVAA 1XMOE 1EH6A 3EPLA 2EE8A 3THOB 4DR5E 4IS1C 4LF8E 2VRDA 4DR6E 1UBDC 4RHBB 4WX9A 1YUJA 2R76A 4B3RE 2EOOA 5AE1A 2V89A 2YRMA 4DR4E 1X47A 2LV2A 2N3GA 2WZOA 2LTRA 4DUYE 2DGCA 4GEQB 2N8XA 4DV6E 4WXCA 2NABA 4Q35B 2EMLA 2DIXA 1STUA 4B3TE 4P78A 4P7DA 4X62E 3LMLA 2GHFA 1L4SA 2EPNA 2I13A 2LVHA 3C4BA 4DV1E 2GLIA 2EL5A 2MKNA 3MHSC 2YTGA 1TF6A 2B9DA 1XNRE 4R2QA 4KZSA 1MGTA 2YTNA 2EN2A 1A1LA 3C4TA 4TUIA 1X6EA 2YU8A 2D9HA 2EPOA 2YTPA 1A1FA 2RS6A 2IHR1 3J7Yp 5CFFE 2RQLA 4GKJE 2EJ4A 1ZBQA 2ENAA 4M0VA 3AUZA 2ZM6E 4NHRA 4JI1E 4NZVA 2HJJA 2LJUA 4LFBE 4R2EA 3J80C 5AE3A 5A6JA 2R1FA 1IMUA 1N36E 4HEIA 2EM5A 4BC7A 4DV3E 5KL7A 2GPIA 4LF7E 2KHXA 4R2SA 4ZYHA 2VE7C 2JYAA 2YTEA 1UHZA 2EMCA 2NUFA 3KWRA 1YZ9A 2EPAA 4X8WA 2F8BA 2YZTA 1ZAAC 2RPCA 4JI4E 2L2KB 2JPAA 1UN6B 1KYQA 3UK3C 4X65E 1T38A 3KZYA 4O24A 1G2DC 4F6NA 2JXPA 2F4VE 3K6QA 3HTXA 3P1XA 2ELYA 3H09A 2M7QA 4LF9E 1BB8A 2DSYA 4DR7E 3C6KA 2CSHA 5KL4A 5LMUE 2M9AA 1X48A 4DV2E 2EZ6A 3IWBA 1T4LB 2JOBA 2DB2A 2G7HA 1J5EE 2YWQA 2EMHA 4BBYA 4F6MA 4LFCE 2L8TA 2RS7A 4TUGA 1EH7A 1QNTA 1WJPA 2DLQA 1IBME 2ADRA 2UXCE 1YYKA 1MEYC 2EPMX 2FGGA 1HNWE 4DMIA 3DF6A 2B7VA 4JI7E 2EL6A 4DV7E 2YRHA 2EM3A 1A1KA 4K0KE 3J7AG 4Q28A 1A1JA 4ZYEA 1IQOA 4LF5E 1PJQA 2EWLA 4WXDA 4M30A 5IV8B 1BBGA 2JR1A 2LTSA 3VYXA 4KWYA 2V86A 3OTOE 3BIDA 4R2DA 2E72A 2EPZA 2I9IA 1UILA 2EMXA 2PRTA 1BBOA 4DR2E 1YSAC 3VYYA 3QG5C 4M2ZA 2CPNA 2EM0A 1T4OA 3HQ1A 1DQ3A 3ADLA 2L92A 4LF4E 3BGHA 4X9JA 1N32E 2EMWA 4JI3E 2WBTA 2YTIA 2EM4A 2EN3A 3MSWA 2WBUA 1A1HA 4WYQB 1TN9A 1AAYA 3BBGA 2EMGA 2ENCA 2EPUA 1QU6A 1WHQA 3F6HA 2MC5A 4I8OA 1FJGE 3IWCA 4R2PA 4DUZE 3T1HE 1DGCA 2EPRA 2M4IA 3HPSA 4AQYE 4O4KA 1ZR9A 5A6BD 4BC9A 3EQ1A 4FK5C 2EOQA 3JTZA 4LF6E 4R2AA 3L00A 1WHNA 4F9CB 5KL2A 3AV0A 1HNXE 2ELZA 2L2MA 4MLVA 5IT9C 2UXDE 2EPXA 1XMQE 3EPKA 1NCSA 3T1YE 4KHPE 2HC5A 2BBGA 5FLXC 2L3JA 2L3CA 2CTDA 1A1GA 1GQEA 3THNA 1A1IA 4MLQA 4O5GA 4B3SE 1N33E 3FIGA 4F9BB 2EOZA 2YTDA 1B69A 4GKKE 4NXME 2MKDA 3JAMC 3J81C 1PJTA 5A2QC 1JK1A 2L6MA 3ADGA 1X49A 2EOXA 2ODRC 2K4VA 1ZU1A 4JI8E 2DMIA 2HGHA 1N3GA 2LRSA 1X3CA 3MHHC 4WPYA 1ZBTA
chains in the Genus database with same CATH topology
2DIXA 1STUA 2JY9A 2LUQA 2B7VA 2NA2A 2JOXA 4P78A 3LMLA 4P7DA 4JI7E 4DKKA 4X62E 2VQEE 4DV7E 4JV5E 2VQFE 2UUAE 4K0KE 5BR8E 4R8OA 3J7AG 3C4BA 4DV1E 1I94E 4Q28A 5ADZA 2V85A 4LF5E 4X64E 2VF1A 4M30A 2EWLA 2L2NA 2LMZA 4BMJA 5AE2A 4JI2E 3ADIA 2B9DA 1XNRE 2V83A 2JR1A 1WXRA 4KZSA 2LTSA 1HR0E 3VYXA 4J8ZA 2M1SA 4LU9A 2V86A 4R03A 3C4TA 3DJWA 4TUIA 3OTOE 2KONA 4NXNE 2RTXA 3ZOQB 2V8QB 4BCAA 4JI6E 2B3TB 3OMLA 1UILA 2IHR1 2RS6A 3J7Yp 3RMPA 2UUCE 5CFFE 2FV4B 4GKJE 2V87A 2UUBE 1ZBQA 2E5LE 4WFTA 4DR2E 4M0VA 3VYYA 5DNYA 4OX9E 3AUZA 2HHHE 4M2ZA 2ZM6E 2JWOA 2CPNA 4JI1E 2LBSB 1T4OA 3HQ1A 2N3HA 1DQ3A 2LE2A 2V88A 4LTYA 3JU0A 2L92A 4JI5E 3J80C 3ADLA 4OOGC 5AE3A 1EKZA 2MC6A 4LF4E 1YYWA 1N36E 4DR1E 1N34E 1N32E 4JI3E 2E1MA 4L5NC 4JYAE 4BC7A 4DV3E 2ODRD 4LF7E 4F9AB 2UU9E 3MSWA 2KHXA 3HXLA 2NUEA 1IBLE 2UXBE 4WYQB 1YYOA 2VE7C 4F54A 1UHZA 5F3WA 2NUFA 2MDRA 3KWRA 4BS9A 1YZ9A 1QU6A 2F8BA 2YZTA 1SR9A 2DMYA 4X8WA 4LFAE 1WHQA 4JI4E 2L2KB 1HNZE 3F6HA 4DV5E 1J26A 2MC5A 4I8OA 1FJGE 4B3TE 3F6GA 3IWCA 4L8NA 4DUZE 3T1HE 5LMNE 4B3ME 4X65E 2M4IA 2LJHA 3HPSA 4AQYE 1PKPA 1IBKE 5AASA 4WSPA 2NUGA 4BC9A 5T6JA 2F4VE 3K6QA 3HTXA 4YY3E 2RSMA 3JTZA 3P1XA 4DR3E 4LF6E 2B7TA 2FTXB 3ADJA 3LLHA 1RC7A 1XNQE 3H09A 2M7QA 1FKAE 1WHNA 5LL6R 4LF9E 4F9CB 2DSYA 1O0WA 3AV0A 1HNXE 1DI2A 4DV0E 4DV4E 2JVAA 4X66E 4JI0E 2L2MA 5IT9C 4DR7E 1XMOE 2UXDE 1XMQE 4KHPE 3T1YE 4DR5E 5LMUE 5FLXC 2L3JA 1RQ0A 4LF8E 2L3CA 1X48A 1GQEA 4DR6E 4DV2E 2EZ6A 3IWBA 2LUPB 4B3SE 1T4LB 2JOBA 3FIGA 4F9BB 4GKKE 1N33E 4B3RE 1T4NA 2DB2A 2G7HA 2H36X 4NXME 5AE1A 1J5EE 4YHHE 3JAMC 2V89A 5A2QC 5IWAE 3J81C 2KOUA 4DR4E 1X47A 4LFBE 2L6MA 3HPZA 4BBYA 4LFCE 3ADGA 1X49A 2L8TA 2N3GA 2RS7A 2LTRA 2WZOA 2ODRC 4TUGA 2K4VA 4DUYE 3VK6A 4GEQB 4JI8E 4DV6E 1IBME 2L33A 1GZ6A 2YT4A 2UXCE 1YYKA 3IWDA 2LRSA 2FGGA 1HNWE 4WPYA 4DMIA 1ZBTA 3DF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIX A;  1STU A;  2JY9 A;  2LUQ A;  2B7V A;  2NA2 A;  4JI7 E;  4X62 E;  4B3T E;  4DKK A;  2VQE E;  4DV7 E;  4JV5 E;  2VQF E;  2UUA E;  4K0K E;  5BR8 E;  3C4B A;  4DV1 E;  4LF5 E;  4X64 E;  4M30 A;  4JI2 E;  2L2N A;  3ADI A;  1XNR E;  2LTS A;  1HR0 E;  3VYX A;  1I94 E;  4NXN E;  3C4T A;  3OTO E;  2RTX A;  4JI6 E;  2B3T B;  1UIL A;  2IHR 1;  2RS6 A;  3J7Y p;  2UUC E;  5CFF E;  4GKJ E;  2UUB E;  2E5L E;  4WFT A;  4DR2 E;  3VYY A;  4OX9 E;  2HHH E;  4M2Z A;  2ZM6 E;  2CPN A;  4JI1 E;  2LBS B;  1T4O A;  2N3H A;  4LFB E;  3ADL A;  4JI5 E;  4OOG C;  1EKZ A;  4LF4 E;  1YYW A;  1N36 E;  4DR1 E;  1N34 E;  1N32 E;  4JI3 E;  4JYA E;  4DV3 E;  4LF7 E;  2UU9 E;  2KHX A;  2NUE A;  1IBL E;  2UXB E;  4WYQ B;  1YYO A;  1UHZ A;  2NUF A;  2MDR A;  1YZ9 A;  1QU6 A;  4X8W A;  2DMY A;  4LFA E;  1WHQ A;  4JI4 E;  2L2K B;  1HNZ E;  4DV5 E;  1J26 A;  1FJG E;  4DUZ E;  4B3M E;  3T1H E;  5LMN E;  4X65 E;  2LJH A;  4AQY E;  1PKP A;  1IBK E;  2NUG A;  2F4V E;  3HTX A;  4YY3 E;  2RSM A;  3P1X A;  4DR3 E;  4LF6 E;  2B7T A;  3ADJ A;  3LLH A;  1RC7 A;  1XNQ E;  1FKA E;  4LF9 E;  1WHN A;  1O0W A;  1HNX E;  1DI2 A;  4DV0 E;  4DV4 E;  2JVA A;  4X66 E;  4JI0 E;  2L2M A;  4DR7 E;  1XMO E;  2UXD E;  1XMQ E;  4KHP E;  3T1Y E;  4DR5 E;  5LMU E;  2L3J A;  4LF8 E;  1RQ0 A;  2L3C A;  1X48 A;  1GQE A;  4DR6 E;  4DV2 E;  2EZ6 A;  2LUP B;  4B3S E;  1N33 E;  1T4L B;  4GKK E;  4B3R E;  1T4N A;  2DB2 A;  4NXM E;  1J5E E;  4YHH E;  4DR4 E;  5IWA E;  1X47 A;  4LFC E;  3ADG A;  1X49 A;  2N3G A;  2RS7 A;  2LTR A;  4DUY E;  4DV6 E;  4JI8 E;  1IBM E;  2L33 A;  2YT4 A;  2UXC E;  1YYK A;  2LRS A;  1HNW E;  1ZBT A; 
#chains in the Genus database with same CATH topology
 2NA2 A;  2LUQ A;  4ZYG A;  2JOX A;  1EH8 A;  1JK2 A;  2YRK A;  2VQE E;  4JV5 E;  2VQF E;  2UUA E;  2EP3 A;  2YTO A;  5BR8 E;  2LO3 A;  2EMY A;  3C6M A;  2EPP A;  5ADZ A;  4BHB A;  1AH5 A;  5AE2 A;  2LMZ A;  2L2N A;  3ADI A;  5LLQ A;  1WXR A;  1HR0 E;  4J8Z A;  2M1S A;  4R03 A;  3DJW A;  2CT1 A;  2A25 A;  2V8Q B;  4BCA A;  5AC4 A;  3OML A;  2UUC E;  1X5W A;  2YU5 A;  1Z1B A;  2FV4 B;  2YSO A;  2UUB E;  3M99 B;  5A6K A;  4OX9 E;  2HHH E;  2YTJ A;  4BHC A;  4R2C A;  2EQ3 A;  2LBS B;  2V88 A;  2LE2 A;  5KL3 A;  4JI5 E;  1IQS A;  4OOG C;  1EKZ A;  2MC6 A;  2LT7 A;  2DLK A;  2MDG A;  4DR1 E;  1N34 E;  3ECR A;  2EOI A;  4L5N C;  1WRJ A;  2WBS A;  2NUE A;  2EOS A;  1GTK A;  1YYO A;  2UXB E;  4F54 A;  2EMZ A;  2EOJ A;  2MDR A;  4RH8 A;  1SR9 A;  2EOY A;  4LFA E;  4N4R B;  4DV5 E;  1J26 A;  3F6G A;  4B3M E;  1LLM C;  1KJK A;  4GZN C;  1IBK E;  2RSI A;  5AAS A;  5T6J A;  4YY3 E;  2B7T A;  2FTX B;  3ADJ A;  2EMB A;  1FKA E;  5LL6 R;  1DI2 A;  4DV0 E;  2EL4 A;  4O43 A;  4X66 E;  4JI0 E;  2EM2 A;  2EMK A;  2ENH A;  2EOH A;  1RQ0 A;  5IXM B;  2LUP B;  5KL5 A;  2EM6 A;  1T4N A;  1X6H A;  2EMI A;  2H36 X;  4YHH E;  5IWA E;  2KOU A;  3HPZ A;  2EN6 A;  1RMD A;  3VK6 A;  2L33 A;  1GZ6 A;  2YT4 A;  4F2J C;  3IWD A;  5KL6 A;  4R2R A;  2JY9 A;  2EN4 A;  4DKK A;  1SFE A;  2LCE A;  2J7J A;  4R8O A;  2EPK X;  5TSE A;  2EN7 A;  1T39 A;  2V85 A;  4WSG A;  4X64 E;  5A6B A;  2VF1 A;  4BMJ A;  4JI2 E;  4HTG A;  2EOE A;  3BF2 A;  1YFH A;  2V83 A;  1P47 A;  2WCC 3;  3KZZ A;  4LU9 A;  1I94 E;  3VHT B;  4NXN E;  1PDA A;  2EPL X;  2KON A;  2RTX A;  3ZOQ B;  4JI6 E;  2B3T B;  2Q8U A;  3EPH A;  2EOR A;  5A69 A;  3RMP A;  1YUI A;  2EM7 A;  3EPJ A;  2V87 A;  5AC5 A;  2E5L E;  4WFT A;  5DNY A;  2JWO A;  2N3H A;  4LTY A;  3JU0 A;  2YTF A;  2EQ1 A;  1YYW A;  1NEI A;  2E1M A;  1F2I G;  4JYA E;  2YSP A;  2ODR D;  4F9A B;  2UU9 E;  1PJS A;  2EM8 A;  2EPC A;  2YTQ A;  2EMF A;  3HXL A;  5A6A A;  2K7I A;  1IBL E;  2EOF A;  2EQ0 A;  5F3W A;  3TQM A;  2EN8 A;  4BS9 A;  4IJD A;  2DMY A;  4ZYD A;  2DRP A;  2EOM A;  2JP9 A;  1HNZ E;  1YPN A;  2YPN A;  4L8N A;  5LMN E;  2LJH A;  1PKP A;  2EMA A;  4WSP A;  1TF3 A;  2NUG A;  1G2F C;  2BB8 A;  2RSM A;  4DR3 E;  3LLH A;  1RC7 A;  1XNQ E;  1X6F A;  2EM9 A;  4M9V C;  1O0W A;  4DV4 E;  2EN1 A;  2JVA A;  1XMO E;  1EH6 A;  3EPL A;  2EE8 A;  3THO B;  4DR5 E;  4IS1 C;  4LF8 E;  2VRD A;  4DR6 E;  1UBD C;  4RHB B;  4WX9 A;  1YUJ A;  2R76 A;  4B3R E;  2EOO A;  5AE1 A;  2V89 A;  2YRM A;  4DR4 E;  1X47 A;  2LV2 A;  2N3G A;  2WZO A;  2LTR A;  4DUY E;  2DGC A;  4GEQ B;  2N8X A;  4DV6 E;  4WXC A;  2NAB A;  4Q35 B;  2EML A;  2DIX A;  1STU A;  4B3T E;  4P78 A;  4P7D A;  4X62 E;  3LML A;  2GHF A;  1L4S A;  2EPN A;  2I13 A;  2LVH A;  3C4B A;  4DV1 E;  2GLI A;  2EL5 A;  2MKN A;  3MHS C;  2YTG A;  1TF6 A;  2B9D A;  1XNR E;  4R2Q A;  4KZS A;  1MGT A;  2YTN A;  2EN2 A;  1A1L A;  3C4T A;  4TUI A;  1X6E A;  2YU8 A;  2D9H A;  2EPO A;  2YTP A;  1A1F A;  2RS6 A;  2IHR 1;  3J7Y p;  5CFF E;  2RQL A;  4GKJ E;  2EJ4 A;  1ZBQ A;  2ENA A;  4M0V A;  3AUZ A;  2ZM6 E;  4NHR A;  4JI1 E;  4NZV A;  2HJJ A;  2LJU A;  4LFB E;  4R2E A;  3J80 C;  5AE3 A;  5A6J A;  2R1F A;  1IMU A;  1N36 E;  4HEI A;  2EM5 A;  4BC7 A;  4DV3 E;  5KL7 A;  2GPI A;  4LF7 E;  2KHX A;  4R2S A;  4ZYH A;  2VE7 C;  2JYA A;  2YTE A;  1UHZ A;  2EMC A;  2NUF A;  3KWR A;  1YZ9 A;  2EPA A;  4X8W A;  2F8B A;  2YZT A;  1ZAA C;  2RPC A;  4JI4 E;  2L2K B;  2JPA A;  1UN6 B;  1KYQ A;  3UK3 C;  4X65 E;  1T38 A;  3KZY A;  4O24 A;  1G2D C;  4F6N A;  2JXP A;  2F4V E;  3K6Q A;  3HTX A;  3P1X A;  2ELY A;  3H09 A;  2M7Q A;  4LF9 E;  1BB8 A;  2DSY A;  4DR7 E;  3C6K A;  2CSH A;  5KL4 A;  5LMU E;  2M9A A;  1X48 A;  4DV2 E;  2EZ6 A;  3IWB A;  1T4L B;  2JOB A;  2DB2 A;  2G7H A;  1J5E E;  2YWQ A;  2EMH A;  4BBY A;  4F6M A;  4LFC E;  2L8T A;  2RS7 A;  4TUG A;  1EH7 A;  1QNT A;  1WJP A;  2DLQ A;  1IBM E;  2ADR A;  2UXC E;  1YYK A;  1MEY C;  2EPM X;  2FGG A;  1HNW E;  4DMI A;  3DF6 A;  2B7V A;  4JI7 E;  2EL6 A;  4DV7 E;  2YRH A;  2EM3 A;  1A1K A;  4K0K E;  3J7A G;  4Q28 A;  1A1J A;  4ZYE A;  1IQO A;  4LF5 E;  1PJQ A;  2EWL A;  4WXD A;  4M30 A;  5IV8 B;  1BBG A;  2JR1 A;  2LTS A;  3VYX A;  4KWY A;  2V86 A;  3OTO E;  3BID A;  4R2D A;  2E72 A;  2EPZ A;  2I9I A;  1UIL A;  2EMX A;  2PRT A;  1BBO A;  4DR2 E;  1YSA C;  3VYY A;  3QG5 C;  4M2Z A;  2CPN A;  2EM0 A;  1T4O A;  3HQ1 A;  1DQ3 A;  3ADL A;  2L92 A;  4LF4 E;  3BGH A;  4X9J A;  1N32 E;  2EMW A;  4JI3 E;  2WBT A;  2YTI A;  2EM4 A;  2EN3 A;  3MSW A;  2WBU A;  1A1H A;  4WYQ B;  1TN9 A;  1AAY A;  3BBG A;  2EMG A;  2ENC A;  2EPU A;  1QU6 A;  1WHQ A;  3F6H A;  2MC5 A;  4I8O A;  1FJG E;  3IWC A;  4R2P A;  4DUZ E;  3T1H E;  1DGC A;  2EPR A;  2M4I A;  3HPS A;  4AQY E;  4O4K A;  1ZR9 A;  5A6B D;  4BC9 A;  3EQ1 A;  4FK5 C;  2EOQ A;  3JTZ A;  4LF6 E;  4R2A A;  3L00 A;  1WHN A;  4F9C B;  5KL2 A;  3AV0 A;  1HNX E;  2ELZ A;  2L2M A;  4MLV A;  5IT9 C;  2UXD E;  2EPX A;  1XMQ E;  3EPK A;  1NCS A;  3T1Y E;  4KHP E;  2HC5 A;  2BBG A;  5FLX C;  2L3J A;  2L3C A;  2CTD A;  1A1G A;  1GQE A;  3THN A;  1A1I A;  4MLQ A;  4O5G A;  4B3S E;  1N33 E;  3FIG A;  4F9B B;  2EOZ A;  2YTD A;  1B69 A;  4GKK E;  4NXM E;  2MKD A;  3JAM C;  3J81 C;  1PJT A;  5A2Q C;  1JK1 A;  2L6M A;  3ADG A;  1X49 A;  2EOX A;  2ODR C;  2K4V A;  1ZU1 A;  4JI8 E;  2DMI A;  2HGH A;  1N3G A;  2LRS A;  1X3C A;  3MHH C;  4WPY A;  1ZBT A; 
#chains in the Genus database with same CATH homology
 2DIX A;  1STU A;  2JY9 A;  2LUQ A;  2B7V A;  2NA2 A;  2JOX A;  4P78 A;  3LML A;  4P7D A;  4JI7 E;  4DKK A;  4X62 E;  2VQE E;  4DV7 E;  4JV5 E;  2VQF E;  2UUA E;  4K0K E;  5BR8 E;  4R8O A;  3J7A G;  3C4B A;  4DV1 E;  1I94 E;  4Q28 A;  5ADZ A;  2V85 A;  4LF5 E;  4X64 E;  2VF1 A;  4M30 A;  2EWL A;  2L2N A;  2LMZ A;  4BMJ A;  5AE2 A;  4JI2 E;  3ADI A;  2B9D A;  1XNR E;  2V83 A;  2JR1 A;  1WXR A;  4KZS A;  2LTS A;  1HR0 E;  3VYX A;  4J8Z A;  2M1S A;  4LU9 A;  2V86 A;  4R03 A;  3C4T A;  3DJW A;  4TUI A;  3OTO E;  2KON A;  4NXN E;  2RTX A;  3ZOQ B;  2V8Q B;  4BCA A;  4JI6 E;  2B3T B;  3OML A;  1UIL A;  2IHR 1;  2RS6 A;  3J7Y p;  3RMP A;  2UUC E;  5CFF E;  2FV4 B;  4GKJ E;  2V87 A;  2UUB E;  1ZBQ A;  2E5L E;  4WFT A;  4DR2 E;  4M0V A;  3VYY A;  5DNY A;  4OX9 E;  3AUZ A;  2HHH E;  4M2Z A;  2ZM6 E;  2JWO A;  2CPN A;  4JI1 E;  2LBS B;  1T4O A;  3HQ1 A;  2N3H A;  1DQ3 A;  2LE2 A;  2V88 A;  4LTY A;  3JU0 A;  2L92 A;  4JI5 E;  3J80 C;  3ADL A;  4OOG C;  5AE3 A;  1EKZ A;  2MC6 A;  4LF4 E;  1YYW A;  1N36 E;  4DR1 E;  1N34 E;  1N32 E;  4JI3 E;  2E1M A;  4L5N C;  4JYA E;  4BC7 A;  4DV3 E;  2ODR D;  4LF7 E;  4F9A B;  2UU9 E;  3MSW A;  2KHX A;  3HXL A;  2NUE A;  1IBL E;  2UXB E;  4WYQ B;  1YYO A;  2VE7 C;  4F54 A;  1UHZ A;  5F3W A;  2NUF A;  2MDR A;  3KWR A;  4BS9 A;  1YZ9 A;  1QU6 A;  2F8B A;  2YZT A;  1SR9 A;  2DMY A;  4X8W A;  4LFA E;  1WHQ A;  4JI4 E;  2L2K B;  1HNZ E;  3F6H A;  4DV5 E;  1J26 A;  2MC5 A;  4I8O A;  1FJG E;  4B3T E;  3F6G A;  3IWC A;  4L8N A;  4DUZ E;  3T1H E;  5LMN E;  4B3M E;  4X65 E;  2M4I A;  2LJH A;  3HPS A;  4AQY E;  1PKP A;  1IBK E;  5AAS A;  4WSP A;  2NUG A;  4BC9 A;  5T6J A;  2F4V E;  3K6Q A;  3HTX A;  4YY3 E;  2RSM A;  3JTZ A;  3P1X A;  4DR3 E;  4LF6 E;  2B7T A;  2FTX B;  3ADJ A;  3LLH A;  1RC7 A;  1XNQ E;  3H09 A;  2M7Q A;  1FKA E;  1WHN A;  5LL6 R;  4LF9 E;  4F9C B;  2DSY A;  1O0W A;  3AV0 A;  1HNX E;  1DI2 A;  4DV0 E;  4DV4 E;  2JVA A;  4X66 E;  4JI0 E;  2L2M A;  5IT9 C;  4DR7 E;  1XMO E;  2UXD E;  1XMQ E;  4KHP E;  3T1Y E;  4DR5 E;  5LMU E;  5FLX C;  2L3J A;  1RQ0 A;  4LF8 E;  2L3C A;  1X48 A;  1GQE A;  4DR6 E;  4DV2 E;  2EZ6 A;  3IWB A;  2LUP B;  4B3S E;  1T4L B;  2JOB A;  3FIG A;  4F9B B;  4GKK E;  1N33 E;  4B3R E;  1T4N A;  2DB2 A;  2G7H A;  2H36 X;  4NXM E;  5AE1 A;  1J5E E;  4YHH E;  3JAM C;  2V89 A;  5A2Q C;  5IWA E;  3J81 C;  2KOU A;  4DR4 E;  1X47 A;  4LFB E;  2L6M A;  3HPZ A;  4BBY A;  4LFC E;  3ADG A;  1X49 A;  2L8T A;  2N3G A;  2RS7 A;  2LTR A;  2WZO A;  2ODR C;  4TUG A;  2K4V A;  4DUY E;  3VK6 A;  4GEQ B;  4JI8 E;  4DV6 E;  1IBM E;  2L33 A;  1GZ6 A;  2YT4 A;  2UXC E;  1YYK A;  3IWD A;  2LRS A;  2FGG A;  1HNW E;  4WPY A;  4DMI A;  1ZBT A;  3DF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...