1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
molecule keywords Peptide chain release factor 1
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
1UILA 2LTSA 3C4BA 2N3HA 4DV1E 2N3GA 2DB2A 4B3RE 4DR4E 4DR1E 2HHHE 1HR0E 4LF4E 4DV5E 5IWAE 2EZ6A 4WYQB 1YZ9A 2KHXA 5CFFE 1HNZE 1X48A 4DV0E 2VQFE 2LBSB 2E5LE 4JYAE 2UU9E 4DV2E 1X49A 4DV4E 2LUPB 4M30A 2RSMA 4DKKA 1YYKA 4DV6E 1I94E 2B3TB 2NA2A 2VQEE 3J7Yp 2NUEA 1QU6A 4DR6E 2L2MA 4GKJE 4JI7E 4K0KE 3T1YE 4JI4E 4WFTA 4JI2E 1N32E 4JI5E 1X47A 1XNQE 4GKKE 2LUQA 1HNWE 4X64E 3ADJA 4KHPE 1STUA 2B7TA 2YT4A 1O0WA 2DIXA 1HNXE 1UHZA 4X66E 1IBKE 5BR8E 4DR5E 4B3TE 3VYXA 2UUBE 1DI2A 4X8WA 3HTXA 3ADLA 4AQYE 2L33A 1RC7A 2RS7A 1RQ0A 4NXNE 4NXME 3OTOE 4DR2E 2L2NA 1N36E 4JV5E 2L3JA 4M2ZA 1XNRE 4OX9E 4DUZE 2F4VE 4LF6E 4DV7E 2RS6A 1ZBTA 4DV3E 3T1HE 2LTRA 4X62E 5LMNE 2ZM6E 1J5EE 1EKZA 4LF9E 4LF7E 2UXBE 2UXDE 1WHQA 3C4TA 4LFBE 2RTXA 2B7VA 1N33E 2UUAE 4JI8E 4LFAE 3P1XA 4LF5E 1XMOE 4JI1E 2CPNA 2LRSA 4DR7E 1XMQE 2LJHA 1GQEA 3ADGA 2UXCE 1WHNA 1FJGE 4YHHE 1N34E 4LFCE 4X65E 1YYOA 2JY9A 2MDRA 4JI6E 2DMYA 2L3CA 4DUYE 2UUCE 3ADIA 1T4OA 2IHR1 1FKAE 1YYWA 4YY3E 3VYYA 1T4NA 4OOGC 1T4LB 4JI3E 2NUGA 1IBLE 5LMUE 2JVAA 1J26A 4DR3E 4B3ME 1PKPA 1IBME 4B3SE 4LF8E 4JI0E 2NUFA 2L2KB 3LLHA
chains in the Genus database with same CATH superfamily
3C4BA 4DV7J 3VAMA 1UETA 4G1PA 1I5OB 4OYWA 1FJGF 5F3TA 3PIPQ 1N5YA 5FDLB 1RWVB 1VMBA 1YI2S 3FSIA 2IA0A 4DLEA 5KL5A 4V1Ak 6FDRA 1I94E 3KJVB 2I13A 2D9HA 3PJ9A 2IVMA 5GMEA 1OJ4A 1CJVA 1S6PB 3HD2A 1MWQA 1N32F 1OY8A 5LMUF 2NLWA 4OI1A 4BBYA 3JTPA 4KGMA 3M7VA 3CD6S 2CA9A 4ZPBA 3F6GA 2HZAA 2LXIA 1F3FA 3G9CA 1L3KA 2B9DA 1DURA 5DETA 3OTOF 1OWXA 2EPRA 2N4CA 3H98A 1J5EE 4JOUA 4GKKF 4NHRA 3KOAA 2XMWA 4QIGA 3Q23A 4L72B 1NPRA 5FD1A 3PCOB 1ICEB 2EFPA 4RUCA 5E3CA 1NSAA 4L74A 2GJ2A 1HBNB 4UW2A 4AL6A 1WRJA 4MIBA 3DCAA 4OI6A 2FJDB 1RU2A 3BQ0A 2KM8B 2RIJA 4IO1A 3KZYA 2EM8A 1TN9A 3RRKA 4L3KA 2YNFB 4ZN3A 2V2VA 4DV2E 1HD1A 5KFLA 3FEXB 3H7HB 3QRRA 2J6TA 1MMDA 3CJRA 4USVA 3DDKA 4H4MA 4DV6E 3O6QA 3GONA 1CJKB 2O5DA 3PRVA 2IVYA 1L3TA 4I8OA 2DR5A 4IOCQ 2DY1A 1UP1A 4PQUB 2EN1A 1O6XA 4MLVA 2WBTA 2YKMB 1T03A 1RWKB 3ETOA 1MN9A 1KN6A 4RW8A 1VLOA 4MFBB 3K5LA 3I4PA 3O1LA 1NPPA 3THTA 4O4KA 1T8EA 2RQ4A 4DUZF 4Q0BB 4ZCIA 1HBMB 2RKIA 1PJ7A 4ITSA 4DQSA 4X66F 3NNHA 1RT1A 4YB7A 2FYXA 4KGVB 4OZ3A 4UZCA 5U47A 4W90B 4MKYA 3V4IB 2BQRA 1R89A 1XR7A 3K2YA 4M5LA 2HNZB 1S4FA 2VBYA 4I56A 1P1LA 2M4IA 4Z7CA 2ZOGA 5ETTA 3R7NB 1BY9A 2AV5A 4GRSA 2D1CA 1B0PA 2E1AA 2FPHX 2CPYA 2B3TB 3OL8A 5EDWA 1JLCA 2HRYA 1GTHA 4FXWA 3KLGB 3CC7S 2HRTA 4R2AA 5CYMB 5A2QC 1UWBA 2WVEA 4NXMJ 5FLXC 2J7KA 2JFKA 3M8QB 5D0GA 2MJUA 3M9MB 1RTJB 3U7JA 4DV7E 3MSWA 1FKPB 2QO3A 3D28A 4QU6A 4KV8B 5MLCV 1WKJA 3MMJA 2BABA 4LT6A 2CPNA 5B0CA 5JXSA 4UY85 1WNEA 2J6UA 2HK2A 1R6YA 3Q8RB 4G3IA 3CMQA 3HXLA 1HBNA 2IM0A 1LW2A 2ZBRA 4JYAJ 2HFOA 2CYYA 4RNHA 4RU9A 2G13A 2XEXA 3MAQA 4MAKA 2YX1A 3CGIA 3D6HB 3SFUA 3A8IA 4KR0B 4WYQB 1UPPA 4XPCA 3TAMB 4EZ9A 1FXDA 3O44A 2HNDB 2E1RA 3OTOJ 2CZ4A 1L4SA 2DNRA 1MWZA 2ATCB 2I2YA 3C46A 4DR6E 1UA1A 4OL8A 1S1VA 1I51B 2PGCA 1FX4A 3VV2B 4PQUA 1RAJA 5D4NA 4R0JA 1DGCA 2Q79A 2XCPA 3AJ2A 4EO6A 3CCTA 5L1JA 2KFNA 2YKQA 2IM2A 4P72A 4DN9A 2YTQA 2ZHAA 1HW8A 1WC5A 1GMWA 1K73T 3RB0A 1RU1A 1S10A 4O43A 1D09B 3TQEA 4ZVPB 2Y1IA 4C8ZA 2R7RA 2UXBE 1FRKA 2OI2A 5IT9C 1YIJS 2CQDA 2XGPA 1T7PA 2G2YA 3LGMA 2BVZA 4O3NA 4TKTA 1QE1B 4YFUA 3QAUA 1FNOA 1TU0B 1GFWB 1Q4RA 2C28A 4OZ2A 4K4YA 2E5IA 4KAIA 1VR6A 3PDNA 2Z56B 3W8PA 2W2QP 1HI8A 5KFMA 5GAHI 4JI3F 3OHAA 4MTPA 1WI6A 2K4VA 2PD1A 2C2RA 2BR0A 2VF3A 2YTOA 4X4PA 3OV7A 1S9EA 2KRBA 1WF0A 3SCLE 2ZH6A 1G2FC 1UJ4A 1TL4A 2NSBA 5JUMA 2QA4G 2MZQA 4YB6A 1RISA 1FKAF 3M4XA 1HWUA 3CCES 3LW5C 4F50A 1YJWS 1V3ZA 1Q95G 1S4EA 2JP9A 5DNYA 3Q8PB 1NKCA 1RAHB 4LF4F 2DTJA 3RMPA 2M4MA 2W01A 2F7VA 2MTLA 4J9SA 1N5VA 4EU0A 1A6LA 1PKUA 2L3JA 3GZ7A 3MOZA 2IBKA 2W2PP 2K1RA 3H40A 1WHVA 3H2VE 1N0VC 1B4SA 3KK1B 1HMVB 4TUGA 3P1XA 4I6WA 3QSYB 3Q22A 1MROB 1N8RT 5K14B 1YBTA 2GFFA 3QIDA 3TJ8A 2B5JA 3JSBA 1X9SA 5IV4A 3SQGA 3PR4A 4MT1A 1JXEA 2MPUA 5FLXU 1GTKA 5HQLA 4JI8J 2LQ9A 1V6HA 1RT2B 4ZVHA 3D1OA 1WC0A 3MHHC 3WHIA 5G0RB 4NLQA 3HFKA 2UV8A 2KHXA 2W2NP 1KONA 3VGSA 2AZ3A 4TQRA 2AJ4A 2MZSA 2RF2B 2OGUA 4DL0C 4X4UA 4JI1J 2UP1A 1JK2A 1KDNA 4K4VA 5GVQA 5CH7B 2KZMA 4Q2MA 3C14B 2IAJB 1CULB 1DTTA 3JTNA 5BYRA 1X9MA 1FEEA 1EETA 4TY8B 2I9SA 2L48A 4LTYA 1RC7A 3KG0A 4QU7A 4KQZA 2LXFA 2QE5A 3THOB 4DPUA 3Q8QB 2VDIA 3VWSA 3M99B 4O24A 3UPFA 1JLAA 2ZH9A 1S1UA 3OL9A 3TI0A 3GG1A 2F8MA 3A8JA 2JPAA 4NL5A 1G1XA 3QFWA 3BM7A 1VC6A 4BHCA 4NYPA 3BV8A 1MLAA 1JJ4A 1DQ9A 1WSRA 4RW8B 5C42B 2C1EB 4IUFA 1WWHA 4DFPA 2DITA 1LK5A 2FVPA 3KNGA 1SJRA 2EPMX 1CJTB 2XWYA 2RHSB 2N3HA 1VS3A 1SKUB 1Q5YA 4DR1E 4X4RA 5D4PA 2UXBF 2GC8A 1N3GA 2X1AA 2NXUA 3AQOA 4DV0E 3VAIA 2XC9A 2Z2LA 4QBUA 2RSMA 1H3DA 3J7Z5 3CJQA 4OI3A 3P3DA 3T1YJ 4JI7E 5AXMA 1TP7A 4CM2A 1CULA 1YJVA 1V3RA 1CJUB 4FXVA 3HJFA 1RHQB 2MEWA 5CZVA 4DPWA 2LMZA 4ID8A 1LWFA 5KFZA 4FYXB 4M2ZA 2YPZA 1NLKL 1VQMS 2P5VA 3J7ZT 1R31A 1VBZA 1Q5VA 1S1UB 3IMQJ 2FDNA 4QYRA 2MYFA 2GLIA 2MQPA 2K3KA 2Q6BA 5C42A 3DLKA 2YNIB 2AWZA 4DR5F 3A13A 3DU6A 4MK7A 3DHXA 2BZ2A 2M0GB 4CLWA 5HP1A 2FC9A 3FEYB 2A18A 1X4AA 1WOOA 4OZJA 1S57A 2AGPA 4RX6A 4OHZA 1LOUA 3RUBL 4O3RA 1KTQA 2AEJA 2FLOA 4MFBA 5GAEI 4ECTA 4EYHB 1NKBA 2ZZTA 4LREA 1C1BA 2YTFA 2EN4A 1ZAAC 2EBEA 2L9NA 1WACA 3MR6A 1KBRA 4NASA 2B6AB 4CH0S 4OHXA 3TYTA 2BJ9A 3LTOA 4HYKA 2L41A 1TVRB 2AP6A 4FKYA 1A9NB 1WC3A 2VG7A 1M0SA 4DFKA 2VRDA 1EH7A 2YKOA 1FWLA 3W7BA 5F8HA 3BDEA 1XWLA 5AC5A 4CTAB 4K4UA 3G8TA 2M88A 1JKHA 5F8GA 1HNWJ 2DLQA 1PDAA 5LM7E 4C0BA 3K89A 1G3OA 4K4SA 4OJGA 2Y8YA 3FC9A 3BBFA 3BBCA 3C3LA 2KYZA 2LLZA 2F9JA 1FO1A 2EN6A 4KGZB 3VGVA 2RU9A 1VHIA 4A47A 3HLUA 5HN0A 4WWSA 1AFIA 3JSMA 2V88A 3ISND 4OYZA 4ZCKA 3GSDA 4B3SE 4C3LA 3FCVA 1A1GA 1PJTA 4B3SJ 3B6BA 4B3RJ 2H5IB 2DD8S 1YG0A 1NHKL 3KJFB 3IWXA 4U8YA 3OD2A 1DZ5A 2RQKA 1N5YB 1Z2ZA 3ZTPA 1IM6A 3KK2A 2V9WA 2ACYA 3AAWB 2FLLA 1P27B 2LQJA 2AJ2A 3HPZA 2ZWOA 3FQLA 2X51A 2EFOA 1QJHA 2MMYA 3M6XA 2BUNA 2ENAA 1TVRA 3RBZA 1D9AA 2RDIA 2B7TA 2VG7B 4NLWA 5KFXA 4IR9A 3U1MA 1KD1T 1N33J 4DZ6A 2W9BB 4CO5A 2QL7B 2AGQA 1Y3KA 1GK8A 3EJMA 5DQHA 4LF7J 1HI0P 1FERA 4X62E 3HT3A 3LGNA 1EZZB 1B0TA 1REVB 5HANA 4B3TJ 2WRMA 1O8BA 2DNHA 3ZZYA 4UUWA 1Q8IA 1SJ4P 2VG5B 1HNIA 4GMKA 2WB1D 4R5PB 4C4WA 5HATA 2HQ3A 1SC1B 3M32A 1F3VA 3P6YC 4NXNJ 2VBZA 4RNMA 3V6DB 2DNPA 1K0TA 4EWTA 3N6NA 1UCNA 1XN9A 4WFZA 2WCC3 2EWLA 4I7FA 4K0KJ 3FKBA 1TKDA 4JV5J 4NLXA 2PN6A 4TQSA 4Y2KA 5KFGA 4USUA 1N0UA 2L9WA 2RS8A 2R9LA 4CTAA 3VR1A 1NO8A 4NI2A 1IM4A 4JI0F 3D7SB 2YTGA 2X1GA 3UO0A 1A1IA 4WP9A 3HPSA 2XHCA 4F25A 5KFOA 4DV4F 3VTIA 2MSSA 2RS7A 2EPCA 2BKPA 2RQMA 2JLEA 2PE8A 1Q53A 2EI5A 1F2IG 3LWLA 1HNZF 2DIUA 4C0OC 2F65A 1RZMA 2CVEA 1ZM3A 2KHDA 3MM7A 1VQ8S 1HQUA 3ADGA 1BQMA 2BW7A 4ZLLA 2OAUA 2CPXA 3K58A 2KTQA 5K5MA 3LWMA 2IFXA 1B69A 1SQGA 3JQMA 2CFXA 1AW0A 3GB0A 2ZJPQ 1UPMB 5KFIA 3KLEA 3ONQA 3CO9A 1HNXJ 1U1RA 2DHSA 1NJXA 4LIRA 3H20A 3D0HE 3VAFA 3AJDA 1LEOA 2EM7A 2CG8A 3UVJA 3VK6A 4OHWA 3QNWB 2Z30B 2VPXB 3RBXA 4OYPA 3J81Y 4LSNA 1X5SA 5F3ZA 3G6XA 2HHVA 3N9UC 2VV5A 3NCQA 4USKA 4XPEA 4WP3A 1E6VB 4R2SA 2EPIA 4LF1A 1F5CA 2C3UA 3PW4A 2MQOA 2CQ2A 3CJKB 4Y2MA 1BWVA 3CEDA 1WSVA 4OYBA 2PMHA 3OTOE 1CS4B 5JMNA 3DGVA 1RCOB 2GHVC 2KG0A 1HQ2A 2V5HG 4LF9E 5DS7A 2YWQA 4B3RF 2EFGA 3E3XA 4ZOSA 4CO2A 2EMKA 4U67Q 1NHVA 1WG5A 2ZZMA 1IKYA 2QLJB 4KWYA 3KMQA 5EWEA 1VC0A 1J5OA 2OELA 5DDRC 2CNOB 1U1KA 3MEGB 1S9GB 3C6UB 3GIKA 3T5KA 3R9LA 4X4TA 2IJRA 5AE2A 3AD8C 3U27A 1RTIA 1U6FA 1ZZNA 2YXLA 1RKIA 2FY8A 4GVBB 2E5LF 3PO5A 3W9JA 1FFWB 3HI9A 3M30A 3JU0A 3IAS9 3TEGA 3CXCR 1JLEB 4X4QA 1FRHA 2MDGA 4JI4J 1O0WA 3TJ9A 2GMHA 2QTWA 2BMBA 3MR3A 4ZP7A 4O44A 3I9ZA 4J9UE 4IRKA 1TL5A 2P6TA 2JVOA 3PKMA 3OT9A 2B6AA 1YTYA 1NK4A 2DNKA 2RD5C 2OHDA 1WHQA 2QSFA 4QPXA 3I4HX 1A1HA 1T11A 1H2VZ 4IS1C 2HHXA 1ZETA 1UJ6A 1KRPA 4F67A 1U02A 3MCOA 2KO1A 4NE9C 4X65F 3QAEA 2UUBF 4E8UA 2IRYA 1TZ0A 4CRJA 3UW1A 3BKFA 2HNYB 3E8OA 4OYAA 1N6QB 3VCDA 4DV1E 4ZYDA 3GLJA 1FWKA 4DV5E 1NZ8A 2O66A 4RW7A 3CDWA 3R5JB 4DSLA 4ALZA 3TR5A 4K2JA 5KT7A 5GAGI 4BHBA 1RMDA 1EX8A 4CQ1A 3I5CA 4ANDA 2EJ4A 2GIFA 1YKWA 2GS8A 2WVBA 1CG2A 3RBDA 4IRDA 4M94A 1Q16B 1Q8BA 4TNOA 4EBEA 4PEOA 2D3O1 1OY6A 1SJFA 2O01C 3F56A 5HMZA 2BE2A 4UY8T 2QYGA 1XBWA 2ZOFA 4F0MA 4F36A 2R8GA 2XNRA 5ETNA 2GCFA 1YLXA 4J90A 4ZPWR 1HFEL 1I3OB 3ZTRA 5BXIA 2VOOA 4PPDA 4YR3A 2I1RA 2B4PA 5A0YA 3BJYA 1CS4A 1KQGB 2WBUA 1CJUA 3KYLA 2N3GA 4FYVB 1KFDA 1FD2A 2LEBA 1PBAA 2LO3A 3MWBA 1JK9B 2QFJA 1YZ6A 5F9LA 2XS5A 4DOZA 3S1TA 4DR1F 4M30A 5D3GB 1BGXT 2FY1A 1E6YA 3TW0A 1NU4A 1YX2A 4IR1A 1QM9A 2CDQA 4RUBA 5JJBA 4KHPJ 3AD7C 2JL9A 2XZTB 2DHXA 5DGAA 4ZVEA 2PC6A 2DEIA 3NS6A 2FVSA 2D9PA 2L2NA 1EIYB 3OL6A 1BBOA 2EOZA 4OZNA 6FD1A 1Z4UA 3Q8VA 1TF3A 4CIOA 4ZS6A 1YRXA 4GKJF 2EOYA 2K7KA 3FMBA 4LF4J 2GHFA 3GIIA 5I42B 3IR6B 1XIQA 2B4OA 4HVZA 2IDLA 2EE8A 1T4LB 4OYOA 2J0WA 2EOSA 1J26A 4DR3E 2C2ZB 2V8QB 5HI7A 1C2PA 2DO4A 2C3PA 3IRXA 3KJQB 3KNAA 3P96A 2EOHA 2DBBA 3ZNJ1 2VC0A 4HL9A 4LR7A 2VQFE 2KN4A 2RB7A 4AXIA 5GMDA 3NS7B 4EBCA 3M9OB 1U45A 2LVHA 3EWGA 1VK8A 4ENOA 4DU8A 5L8RC 3OUYA 1KR4A 3UDEA 1VRUA 2QRRA 3Q8SB 1S6UA 2KXHA 2ZM6F 4DR2J 3PFOA 4IYQA 4IG0A 4Z37A 4X65J 3UR3C 3CCLS 5IXMB 4Y34A 1VQNS 4E98A 5A8RB 4O5GA 2RJZA 4DV3E 2MKYA 3OXFA 5HL7Q 1QVGR 2XSJA 4RBTA 3I87A 1VQPS 5J2NB 3OR1B 4BLGA 3P49B 3BEGB 1U2CA 2QGFB 3RB4A 2Q1LA 3PTWA 2CZVC 2CRLA 2ZVSA 2VQEJ 3R1HA 1IQZA 1X6EA 2MKSA 2HW3A 2HVEA 2OLWA 2IHR1 4M8LA 1PAEX 1S1TB 4ZK7M 1WELA 3DN9A 3CJ0A 3QGGA 2R2UA 1WDTA 1BXNA 2UUCJ 2E9TA 3HD1A 2E44A 2FZGB 2SXLA 3A8KA 4BWMA 2Z2MA 5M2PA 2F3JA 4ILMA 2BE7D 5J1PA 3D54A 2KJWA 2X3DA 2ENCA 1FRIA 2CNLB 1Z2LA 1GMWD 2E1MC 2MQMA 4KY3A 3MHSC 2IM3A 5G0RA 3J7Yp 4KRWA 3QQCD 4ECUA 3K5MA 1NB7A 1UVIA 4AFFA 2PT0A 3TX0A 2ZDOA 2KVQE 5EN1A 4TU9A 4ZPDA 2EOXA 2FHOB 1M1GA 3BPSP 3DFEA 1BQXA 2NYHA 4DR6F 5E7OB 1RWMB 4TLRA 1D0EA 1GTEA 2JC1A 1KFSA 4C8KA 1QD1A 1HWKA 3GJRB 1N6QA 3TUPA 1WC6A 2A1BA 3W5ZA 4OHVA 2KT3A 3HK2A 4RHBB 4LRAA 1RK8A 4IOBA 5I42A 4RNFA 1TKXA 4MKVA 3AD9C 4DR1J 4G6VB 4MH8A 4HHHA 4KE5A 3MM5A 4KHPF 2WVDA 2RUSA 3RB6A 1U1PA 2CUYA 5HSPA 1RT6A 3VQSA 3EQ1A 2V4JB 3HKZD 2AW0A 4DL3A 4DR3J 2J7WA 4DR5J 2CTDA 5KFJA 2JLFA 5LT5A 3IC1A 2VPYB 2D7SA 4WFYA 1FD8A 4PG4A 4ILLA 3OW2R 4DV3J 5L1KA 3ECRA 3MI7X 3CCZA 4AXJA 4QR2A 2EMLA 4AQYE 4FS2A 4FBUA 2BBGA 3PACA 4DV6J 2ODRD 1MNEA 2Q3PA 2DVIA 1ZH5A 2RRNA 1OY9A 2ZD1B 4IH7A 1Y5NB 2E1CA 3AUZA 2CDRB 2DYAA 3TAMA 2PI4A 3Q86A 4IQXA 2P8IA 3MEDB 4HTJA 3J81U 2OEKA 2F4VF 3A4TA 5CD4A 1YYOA 1EQMA 2I0XA 4ZJOA 4KTQA 1U47A 4YY3F 3GYNA 4N5SA 1YUIA 1IBKF 4IG3A 3AA8A 3V6DA 1TR0A 3X3UA 2DISA 2NUFA 4ANEA 3C16B 1R0AB 4ED5A 4AL7A 1R0CB 1IKYB 4EBDA 1KLMA 1YBAA 3EYZA 2IY5B 5LJ3Y 1MU2B 2FC8A 4BS2A 1X6HA 3CTRA 1XMOJ 4RW9B 1SUQB 2JJ4D 1RAFB 3QPIA 3ZC4A 3HSJA 2NUEA 4F4YA 3J80C 4NRTA 3R7SB 3CJ8A 3KHRA 3N5FA 4B3MJ 1ZZFA 4KO0B 2EXUA 1AROP 1S6PA 4N56A 3RJMB 2VU5A 2QL5B 4NEZA 3OFGA 4DQRA 1HYSB 3MEDA 2XZWA 4QYZK 2GMJA 5I4MA 5HLFA 5A6BD 3W66A 4ZYEA 2F4FA 2MZTA 2EL4A 2UU9F 3UDLA 1MN7A 2KFYA 3KFWX 3NP5A 3B4DA 1Y5IB 3DXSX 4Z2XA 2WSCC 4GO5X 2LE2A 2VFTA 1N32J 5IQ6A 4M5IA 3EXCX 3W61A 1UVKA 3RU0A 4X4SA 3OFEA 3EDRB 2DHHA 2J0SD 2ASYA 3HP6A 1HL6A 2J5AA 2QLFB 4MLQA 4X84A 3NL0A 4W4MA 3PV8A 1T9TA 3T1YE 1BHNA 4LFAF 4I2QA 2HAIA 2V69A 5K20B 2JC0A 4K0KF 1RTDB 2JDJA 4Y6IA 2KXFA 1LKZA 3TA1A 2AMCB 3ENAA 5C2GA 4WZMA 2XNQA 2R4FA 1Q86T 4U9RA 1R7IA 2VFRA 3CMAS 2RS2A 2H48B 3DYAA 2NXJA 5HVHA 3EPJA 1X5TA 4Q28A 5KFSA 4IFYB 4Y2CA 2UVUA 1SV5A 3R3TA 2B8QA 2DIVA 1FKAE 2VQFJ 3EXYA 5K8OA 2W4PA 3IR5B 1PJQA 4ED0A 3PIOQ 4JBCA 1NSPA 3WC0A 2DXFA 1LQ9A 1TMJA 2WK4A 4EZ6A 3DOKB 4WF9Q 5KFTA 1ZR9A 5IWAE 3KXDA 1IKXA 1X48A 2HC5A 1HPZA 4ECRA 2N7CA 3J7AN 1ELOA 3I5AA 3ELHA 3R7BB 4K4WA 2NCKL 3M6UA 5LJ5Y 4XO0A 1X0PA 3T1HJ 1RT4A 2NUHA 2W25A 1VBKA 1L3UA 4CH1A 3OTBA 5KG3A 1SKSA 2AT1B 1XERA 1NBEB 4ZHRB 1CJTA 3PHEA 3ZZRA 3W9IA 2JEIA 3QATA 2HLUA 2YH0A 4NZ0A 2FZKB 3HHNB 1TK8A 5DZ7A 4DV1F 2M52A 4PUOA 3JAMY 4FZVA 1VFJA 3G96A 3ZZ0A 4ED4A 1XMOE 3RRHA 4DR7E 3BBGA 4Y2AA 4IFYA 3MD1A 1KJKA 1R3NA 3HFZB 1YSJA 5B09A 1GXUA 2EPAA 2VKZG 2XLJA 1YYWA 4FBTA 3MTKA 1WEYA 4HHJA 2KONA 1T3OA 3C6UA 4WFNQ 1WD6A 4P52A 4B3ME 2XWXA 1GX6A 1R0BG 3S01A 3V6KA 4JI2J 4WSGA 4B3MF 1C4CA 2DRDA 4R5PA 2XM3A 2LQ5A 2B43A 4ER8A 3EZUA 4WJBA 4ECYA 3MMCA 1Z1BA 2MY8A 2CQCA 4URQU 2QN6B 2R8IA 5IZHA 3M2RA 2BX6A 1N32E 4KT0C 1HNXF 4X64E 3HSZA 4IFVB 4K2XA 2ASLA 1EAYC 3BO2A 2HKEA 2WW8A 1K1SA 1JLEA 2MKIA 3ZZTA 3UD5A 1K44A 4YB1P 1T9YA 3KHGA 2R2SA 4A8OA 1XC9A 3DMJA 3GQCA 4Q35B 3CW2C 4QWEA 4YDDB 1T39A 2QZ8A 3E01A 3OR2A 1I6JA 4A8QA 1C0TA 5E3RA 3SEOA 1F5BA 1PC5A 2EFQA 2AHOB 1U25A 3LH2S 1LWEA 1RAAB 1FRXA 1JLAB 1T05A 4AUKA 4LF8F 2OPRA 3FSXA 2BOPA 3T41A 2AX1A 4LF2A 3M8QA 2DNYA 3RR7A 2ZHOA 1M5KC 4WCEQ 2CNNB 1VLYA 4J5OA 1SR9A 2CZ9A 2MDAA 4JUZA 2V67A 4FVMA 2CQBA 3BZQA 3SCJE 3RTVA 4DG1B 4ZVUB 1N88A 1PIEA 1O0PA 3ET6B 1NNDA 1RYSA 1XK8A 4GKJE 2MZ1A 4LSLA 2MKHA 2KVIA 2C2KB 5A8KB 2CJYB 4WZQA 3MUVP 4B3TE 2R7XA 2HGNA 4QIWD 2EPNA 2L33A 1S1TA 1N34F 2JEJA 2OFGX 3G87A 2F4VE 4FF1A 3BSOA 4F2JC 4H54A 2H3EB 5D6GA 4P7TA 1YRUA 1S1XA 2EM6A 3NXZA 4P7DA 2UXDE 5HAOA 2UUAE 1LWCB 3C6TA 4PXCA 3V81B 4G1QA 3TVYA 1K0VA 4EO8A 4P71A 2DY9A 4X65E 4GC7A 2JY9A 2CPDA 2ZC4A 3DI6A 4Y28C 4F04B 3BYRA 1FDDA 1NSQA 4HI2A 4YY3E 4C11B 1JLBA 2ASDA 2MQLA 3MM6B 2EVZA 1UILA 2WONA 1KKHA 2JEFA 5FJ4A 3H8YA 1KQKA 4NCBA 2EMGA 3AJ1A 1TL1B 1HNZE 3EMTA 2HQGA 4F3MA 1RBOB 5F0UA 2DGCA 4BWJA 5LL6d 1REVA 1U1NA 3P5TL 3PYDA 2ZH1A 4J91A 5A6JA 2GJFA 4DV7F 2L92A 4PKDB 3TUZC 1EP4A 4FYYB 5F8JA 1HR0F 2YRKA 2YWGA 3UN2A 3FQKA 3FJ2A 4NXME 3CJ4A 1OMSA 5HQMA 4TY9A 1P47A 3N79A 2QMWA 2CJ9A 5A2QY 3I32A 1B7YB 1KLMB 3GE9A 1UZHA 3SYZA 5DQGA 3WIVA 1QAYA 1QAIA 2ADCA 1MWYA 3L7PA 2B9YA 3TUIC 3VZIA 1RKJA 3AB2B 4OZ0A 1T0TV 3D6FB 2OSQA 3I9V9 5KT4A 1W7WA 2R42A 4WIIA 3T5JA 3LAKA 3OR1A 1FXLA 2WONB 1KS2A 2YQ1A 5LSRA 3MM8B 1SI9A 4I6YA 5K8NA 1NK9A 5KG5A 1CEZA 1U09A 1QSSA 3H25A 2EQ3A 2ZJQQ 4B9SA 3ZTOA 4ZCLA 2XGQA 1RWPB 1U1QA 1B7FA 1IVZA 2VJUA 3CT9A 4RZRA 4DCJB 4DL6A 1OQ3A 2Z2YB 1VQ5S 4F0HA 2LQ8A 2IA6A 3T5LA 4C2MA 3G2XA 4F3QA 1YQHA 2CQGA 5LMNF 3VYXA 4CM0A 1VJWA 5A69A 2KU7A 4NXNE 2MKDA 2M1SA 5K9FA 3VAHA 2RS6A 1C0UB 2CKWA 4DR4F 4LFBE 2WBRA 3FRYA 4A8XA 1YZ7A 2DGSA 4GVBA 2B0GA 1VRTA 2KM8C 3VGUA 3B4MA 3QFHA 4HR2A 4IOAQ 2L3CA 4N7TA 2DO0A 3CCJS 3N6LA 2W4DA 3HHLA 2C42A 2EW9A 4I2PA 3UNYA 1VISA 2U2FA 1SL2A 1RI7A 3GFYA 3C16A 2DXEA 2YWKA 5IQQA 1KHVA 2XMKA 1NSKL 1WKLA 1FCAA 2ZWPA 1RTZA 3UI3A 3K59A 1R6VA 5DDOC 4LBPA 2XULA 4DPXA 1QAJA 4RJVA 2ALYB 3R5GA 2VODA 3HXMA 2YPNA 2UUCF 1Q81T 1X47A 3CWJA 1N4LA 5K8PA 2VF1A 2OEMA 2ATLA 4KC5A 2BKOA 5E41A 3RR8A 3QYYA 1S9GA 4UOFA 2NXNA 2UXCF 3K5PA 1PJSA 2OD6A 3UDCA 1UZDA 2YZTA 4DX7A 1N5TA 5ETPA 3OSNA 3DRXA 3L7UA 1JJ2R 3MMBA 3AV0A 3ILIA 1PBUA 3SMZA 1FJGE 4YHHE 2FJVA 5M2UA 5KL3A 2XB2D 4R2PA 4H4KA 2DR6A 3THPA 3PW5A 3FEZA 3JS9A 1RCXB 2K7JA 3W64A 2VOPA 2RRAA 2VASA 4PG7A 1PKPA 4A8KA 1FFSB 4ID5B 3V4MA 5DLFA 4NMLA 4CO3A 4J9RA 1KEKA 3JSMB 1NJYA 2A6OA 4HH0A 2EOIA 3ETMA 2DGOA 1TELA 5ETKA 4EMDA 1FKOA 4Q8FA 3QGHA 1LXJA 4DFMA 1SIWB 4NX9A 4NPOA 1HNWF 2DNMA 5G4DA 5H9FJ 1V5VA 2R7VA 1U0HB 1RLCL 7FDRA 2E5JA 2DNGA 3L4BC 2GQCA 2W1BA 1S6QA 2FLNA 3NWGA 4K4XA 2IMOA 1QTMA 2GIRA 3NGSA 2EMCA 4ZLPA 4JB8B 1NEEA 4A8MP 2IYIA 2YX4A 3GFZA 2ZBIA 3C15A 5KFYA 1FNMA 2WVCA 3W5XA 4I67A 3HT0A 4LFAE 1QAXA 4LF5E 4Q0BA 1X31C 2ZNZA 2DB1A 5IXUA 2RE1A 2BV3A 4DL4A 1UBDC 2PMZD 2YNGA 2MHEA 4WE1B 3GTYX 1SC3B 3KLHB 1R8AA 4OZLA 3MCMA 4DR4E 2PFDA 1R8BA 3M8PA 1JJHA 3DLHA 3QT5A 2RRBA 1FKOB 3E51A 3D6MB 4C7QA 1ZBQA 1PCAA 4Q45A 4HI1A 3LGHA 2RDJA 4LVOP 1YSAC 1U24A 3ADJA 4KO0A 4K5SA 2D3UA 4L5NC 1SH3A 3GV8B 1KQSR 4DEZA 4B3TF 3C14A 4ZHRA 4JV5E 5HMYA 4YHHJ 3W2WA 1OO0B 3QG5C 3ZTQA 2YU5A 5GADI 2JYAA 3CC2S 5FDLA 4TXSA 1WUUA 1JLGA 2ZZNA 2X3GA 3M1VA 4DPOA 3DDIA 1IN0A 5D15A 5IT4A 3EGWB 1O51A 2DMYA 2EL6A 4LUBA 2W24A 2O1PA 3BGLA 1RHRB 3P5BP 3TA2A 2M9KA 1HWLA 3WIUA 2UVRA 1NCLA 3D2WA 2LU1A 1IBME 4IFVA 2Z4PA 2J9EA 1TFYA 3DJWA 3K8WA 4JI0J 2PI5A 3HFVA 2DPIA 2JOBA 2OP5A 2F4VJ 4N77A 2EC2A 3KZZA 2I5JB 4PXEA 2FLPA 3GIRA 1S79A 1FDNA 2WOMB 2UUAJ 2ROPA 3K5OA 3D1HA 3CE8A 5EUHA 2HBZB 3ILJA 2XHWA 1PJ5A 2PEHA 2MZRA 3TVZA 1KNZA 4K50A 4UTGA 3F0NA 2R7SA 2VHGA 5KFHA 2KT2A 2F8BA 1R27B 2LUQA 4LF9J 5J2QA 1STUA 1BLUA 3NRBA 1V5IB 4OLPA 2ELYA 2C2NA 1K1QA 3T1AA 2V8DA 1I94F 5IV8B 1VQKS 4R2RA 4FNHA 3SIPB 5E3PA 4JI5F 1SBRA 3IFEA 2EPUA 2GGPA 3C8YA 5HBMB 1NEIA 1S1WB 4DQQA 4X4NA 3D3CJ 4USHA 4DZDA 1XEZA 2EPPA 2RPCA 3EVMA 4IQMA 2ADBA 4DF4A 2H1YA 3M8YA 4CZCA 1CLFA 1XMQE 2G1HA 3CMES 3POTA 2YWEA 1VYAA 1F5AA 4QQBA 4NCAA 1JLQB 3ZZPA 5A6KA 3AH6A 4CLTA 3BGUA 3PXGa 1GMUA 4FYWB 3DOMB 4RH8A 4FPRA 1F0XA 4NLSA 4B3RE 3POTB 2ZEJA 4K4ZA 3T9NA 3MUMP 4PYAA 2IAJA 3BGRB 1Y4ZB 2QL9B 4P73A 2BYCA 3DYAB 4JV0A 2ALZA 4P2SA 1HNVB 1Y11A 5I3QA 4ZJQA 2PO4A 5CAAA 1S6OA 4FDFA 4X64J 3R8YA 2FGGA 2BANB 4D3HA 3N5BA 1XTZA 5DQIA 3N0VA 2DNLA 5KFFA 2OMOA 3QIPA 1VDHA 3RRGA 1RAGB 3B78A 4P75A 1NM2A 1SQEA 1JLGB 2MLZA 4XTTA 1L3VA 5HLFB 2YX7A 1IWAA 1RWNB 2IDEA 4ERDA 2G2OA 2OPPA 3DI6B 2HHTA 4Y65A 1N54B 3J7YI 3BO3A 4I2PB 4ZIWA 3BF2A 5CYMA 1X60A 2B9XA 3AOCA 1D3WA 1SH2A 3SCKE 3BYPA 3QZ8A 4LF4E 5AE3A 2B8PA 2YTDA 2XTJP 2LVWA 4QW8A 3OFFA 4DV4E 2QMXA 3PW0A 1VQ4S 3M2RB 2POKA 2DPJA 3C15B 2FVCA 3ZXWA 2FB0A 2YRHA 2CQIA 2YSPA 4M1KA 5A6PA 5A6BA 2B7BB 3R1LA 1JLCB 1M1HA 4HACA 4DF8A 3ZZZA 5A6AA 1P9YA 2OPSA 3AQPA 2P6SA 1IQOA 1TL1A 3H0PA 4CI0B 2W2OP 4ELVA 2VIHA 2OPPB 3CCWA 1M90T 4G65A 3C6TB 3V81A 2G9OA 2DK2A 3HSDA 4ED7A 1PO6A 1A1LA 5E2QA 2MDRA 1AZSA 1EKSA 5E33A 3ADIA 4N8OA 4FS1A 4QWBA 2R7WA 4WU3A 1T4NA 1YJUA 4EK2A 4HKQA 1Q8LA 4LU9A 2C3OA 5LMUE 1HNIB 1RACB 3TEHB 5F41A 4CO0A 4KBIA 3OJUA 2HS0A 5A0YB 4QR1A 1W26A 2VKRA 2EZ6A 4FYDA 1NK5A 1HQEA 3PYEA 2DNOA 1H7WA 2U1AA 1DTQB 4NCGA 1UEVA 2PA8D 4Y00A 3FFIA 4TVAB 4LF8J 1XMQJ 3F6HA 1FEHA 4BS9A 2VG6B 2DRPA 1VRQC 4NLGA 1RT2A 5KG4A 1RT7B 1MMNA 2YWHA 4A8SA 4LQ9A 1U2FA 3IBCB 1RHMB 4OYMA 3HZGA 1T9XA 2AF6A 1T9WA 2L08A 3FUYA 4BC7A 3FBFA 5ITHA 4DUTA 2XMAA 3MMAA 3BQ1A 2J7UA 3DM2B 2C2OB 3HZEA 3W5YA 3JB9k 2D74B 1RA7A 1GXTA 3G82A 1RB0A 3DLKB 3OLAA 3DRYA 3RAMA 5J1EA 3R5DA 5J2NA 4ES1A 3AB4B 3FDSA 1R8PA 1GXLA 4JI3E 1IBLE 2D41A 1MEYC 3M6VA 3A12A 2L2KB 4U96A 3UK3C 2V89A 1OPIA 1I1GA 1YZ9A 3SI8A 1AB8A 2E5LE 4EUVA 5CXTA 3HHDA 3ENQA 4UF4A 4R2DA 4CT9A 3D4JA 1IKWB 4DI6A 1SQFA 2QLXA 3R97A 3J7YU 2ZC3A 1IKVB 2CQ4A 5KT6A 1IXKA 2RH3A 2RNEA 4MYUA 1HWJA 1WJPA 3I82A 1OPZA 4DSEA 2DGTA 2EM0A 3FBCA 1B99A 4CLZA 3DRSB 4DSIA 5AASA 4ES2A 4JI6F 1HPZB 2V63A 2I6WA 2EMWA 2HK3A 2DMIA 2EOOA 2OH2A 4ICLA 4JI6E 3D0IE 5KG7A 1HNZJ 1S7HA 1REGX 3ISZA 2AD9A 2VBWA 4NA1A 2CADA 4KFBA 1Y7PA 4ID5A 4OJ3A 3AXMA 4A4JA 5H1SV 3QJPA 4CP5A 2DB2A 4ZYHA 2QX0A 4U7CA 2OPRB 2GVZA 4BMJA 2YKNB 5IV3A 1X5WA 3ITHA 4NXMF 1YRTA 2MLXA 1IQSA 1Q8KA 4ZPAA 4KZSA 4WTYA 4JI5E 3HDSA 3UQSA 2APOA 2F63A 4QW9A 2DIXA 4WFAQ 2IRUA 3ET6A 4B08A 1RDRA 4WP8A 2FQQB 4QZVB 4HTGA 3US5A 4MMOA 4F26A 4M5JA 1DY3A 1TKZA 4F4KA 5GMKa 3ILLA 5IC6B 2LQBA 2BJ1A 1VC5A 1NUEA 2OFHX 2QC3A 1RAEB 1JJCB 4YMEA 1AZSB 1XNQF 3K0JA 1X4DA 3DHWC 2XSJB 4QJVA 3TA0A 2M7QA 2XI3A 3T6BA 3WC2A 3TQ1A 2HHPA 2Q43A 3NG8A 4QPTA 4MKBA 3BIDA 4OV1A 2HFSA 4YDXA 2A10A 1JXLA 1SXLA 2V34A 3HHLB 2RSQA 3NBPA 4F6NA 4JYAE 3GCXP 1B64A 3HVRA 1IBLF 1YK9A 3QJLA 2R7UA 3QWUA 2BJ3A 2ILYA 3L9ZA 1SCJB 4Z7YA 2ZBCA 2MKJA 4DX8H 2L2MA 2CWKA 1CSJA 1MG7A 1D8ZA 1X5OA 1EQ0A 2QEXS 4KHPE 2NPIA 1S59A 2DR9A 3EM1A 4ZVTB 1E6VA 3UD3P 2VPZB 5KFPA 4CCHA 2K06A 1N36E 2FGOA 4ZVSB 1HBOB 2M8DB 4F9BB 1Y00A 1D9FA 3Q83A 3LP2A 4X4OA 5A8WA 3QMQA 3PVXA 1RHKB 4RR5A 4OV6A 3OTCA 2LJHA 1N34E 2FV4B 4LF6J 4LR9A 2V8HA 3G86A 4HHUA 2M8HA 2V2KA 1JNRB 2W2MP 4ZKAA 2FHKA 3O2IA 3IXQA 1F6TA 4DR3F 1H73A 5FIIA 4KFBB 1UVLA 5KOXA 3ADAC 3W9HA 2E72A 2NYIA 5KT5A 1JKHB 4DUYJ 2KG1A 3U02A 2ROGA 1NJWA 3W2WB 3CD5A 2ZH5A 4DV3F 4OIXA 2RAQA 2V8GA 1VQOS 3B54A 1PJ6A 4DV1J 2LFVA 4ED3A 4DBQA 1YVFA 3HHEA 4ECQA 1KP6A 4JI6J 2WCXA 4WXWA 5MAOA 1DI2A 4PCQA 3THVA 1TV6A 4PWDB 1HBUA 1CQNA 4DR2E 3DKDA 1DTQA 4O44B 2BA9A 1HNVA 2DNQA 1NK6A 2B5JB 2OD4A 3KJVA 1J5OB 2W7PA 3K57A 2GQ2A 5LMUJ 1H0HB 2CNKB 1YGYA 1ZA1B 1NH8A 2X1FA 2YPYA 4F6MA 2B4UA 3AODA 2E7VA 2E1PA 4ELTA 3BO4A 4FF2A 4P2XA 1S77D 2IVFB 1UL3A 2BQ3A 4J9OA 5LXRA 4JI1F 3QGPA 3N6MA 4DR7J 1HLWA 3PJXA 2VUGA 4DDFA 2AU0A 1VBYA 1Q0NA 1B0VA 4DX5A 3TARA 2B56A 4I68A 3G82B 2ZKUA 4P78A 4WKRA 4PUOB 2EC0A 1X5PA 1RTDA 1BQMB 3H5UA 3MD3A 4ILRA 2N7YA 2B9WA 2AYEA 3NAIA 1FHTA 2GAGC 4N76A 4AT1B 5TSEA 1EARA 4YR0A 1VQ9S 1SUQA 2G0IA 1TV6B 3MOJB 2RDDA 2K7IA 1AUDA 1VQ6S 4ETZA 2R8HA 3V6JA 1EH6A 1RT4B 5LL6R 4LF6E 5L39A 2JR1A 2EBGA 2UU9J 3GWCA 3I56S 1Q82T 2C3YA 1RA6A 1T38A 2CVIA 5KFNA 4YP3A 3BGOP 3TOQA 2FJWA 1H2UX 1BB8A 2GJIA 2N82B 3MM5B 1YFHA 2EN7A 3H5XA 2AJ1A 1PG5B 1S1WA 5KFRA 5C24B 2QIFA 4RL1A 2Y3YA 5KL6A 1J27A 3MEGA 2ABYA 2KDOA 1CJVB 3Q89A 1U1MA 2O3DA 4L6V3 2HWTA 2MXYA 3GIJA 3K5NA 5EWFA 2KRRA 1RYRA 1Y10A 3S6EA 2YNGB 4X66J 4C6AA 3QIPB 2XY5A 4HT5A 3BS9A 1RUSA 3WQPA 1QUPA 2D3OR 9ATCB 1DQ8A 4C8OA 4DL5A 4KH1B 4P6QA 1KC8T 1WEXA 3BGFA 2HHHF 3Q2SC 4DL2A 3T3FA 4B3OA 1IR0A 3X1LB 2A6MA 3LP1B 4I69A 4PAAA 3TX8A 4AQYF 3I6PA 4YQWA 2DJWA 4DQPA 1PC4A 1AXQA 4TY8A 1BQNA 2BW2A 4OJHA 2V9KA 4NZ6A 4LR8A 2BBEA 3I5BA 4KYZA 2HQDA 3DRRA 1A1FA 4NOHA 3DF6A 5LOQA 3M32B 2Z57B 4NRUA 3FK4A 2BRKA 4DUYF 2B7VA 3I55S 2V68A 4W92B 4DR2F 1SVDA 1Q1KA 3UD4P 3IRXB 2YH1A 5CABA 1X4FA 4ZLJA 1F60B 1YBUA 1RT6B 5B0EA 3KLFA 2XYGB 1D8YA 4WYWA 4Q5VA 3J7A1 5DDPC 2GGPB 3A3NB 2CIMA 4FK5C 1LFWA 3CNQP 3MFIA 4X9JA 2K8GA 2HFUA 3AFGA 4N47A 3RW6A 4OX7A 2VL1A 5F9NA 2MKKA 1UEKA 4D3GA 4IH6A 4Y2IA 5L1IA 2NREA 5BR8F 3CO0P 4CO1A 3UVJB 2F8HA 1TAUA 2PSZA 2W4CA 3MMBB 2WZ1A 1DLOB 2HS3A 1WEZA 3MECB 4DWIA 4HEIA 2N4DA 3BH6B 1UW4A 4L76A 4BCAA 3QRQA 3D9BA 4PG6A 5CYQB 5ETRA 1QTNB 1QSYA 7FD1A 4WXOA 4OI0A 5A8KA 4AD6A 3CCQS 5KFQA 2JVRA 1J5EF 3GPAA 3DGPB 1BBGA 2LDIA 1I94J 2LRSA 4X64F 3TQMA 2E7XA 3JQKA 3T19A 4H4OA 2EN3A 3LA0A 3PX4A 1VIXA 2HEKA 2WSFC 4GVLA 3TZYA 1NB2A 2YTNA 3MURP 3EVWA 3RAQA 8AT1B 3HX9A 3J7AG 1H6KX 1PILA 4K5RA 2MJNA 4DV0J 4R2EA 1U49A 1S49A 3A3OB 3QT7A 3QT8A 4PWDA 5IFMA 1N33F 3KUGA 4V19X 3J80Y 2VZ9A 4L73A 1RT3A 1S5ZA 3NGRA 4YEAA 1MMLA 4DQIA 1WTBA 1IJFB 4YR2A 1ZAXA 1RWUA 3PYGA 3KG4A 2EMYA 1U26A 1IUJA 4FKXA 3M8RA 4FPIA 1EB0A 1TUGB 2YKAA 3ISNC 3QO9B 3IP0A 4CLKA 4NYZA 4ZVRB 3GYXB 4RUHA 2IBOA 5BJRA 1Y9OA 4O3PA 2JNJA 5ETSA 5HP1B 2E7WA 4RWWA 1PSDA 3CUNA 5KFBA 2ZH8A 2YTJA 3M05A 3SXLA 4JV5F 3P4UB 2W8KA 1HHSA 3CSKA 2DGUA 2GO8A 3NOCA 9RUBA 2XO6A 5CD4H 3C6KA 1X9WA 3DOLB 3K8VA 1RSCA 4U7UD 5KL7A 2JVAA 4LRFA 7AT1B 2ASJA 1YHQS 3MECA 3KDNA 4NZVA 5IWAF 3KK3B 1FK9A 2R7TA 3DLEB 1LW0A 5D8HB 4FF4A 2RT3A 3GP9A 1FWPA 1UFWA 4M5DB 3PG9A 3D1QA 2W8LA 1DFDA 1BD6A 2R8JA 2AJ0A 1H72C 3K7RA 4DSFA 1KLNA 1WC4A 2FHJA 2GHWA 3VALA 1WJ9A 5ETMA 4TU7A 1W2IA 2QLBB 2VE7C 3EGVA 4DSJA 4C0HA 4A8WA 2RF2A 2Y9HA 3BPDA 2PDAA 2MSTA 3GCWP 2FJAB 1PYOB 3SV4A 4F2RA 2YBVA 5F3WA 4UT4A 3EZ5A 4ED2A 1WTFA 2EOFA 5I3UA 3H59A 2JOQA 1LWXA 1AYEA 3EICA 3CC4S 4XAKA 1TKTA 1U8WA 5KG1A 5FLXY 5KL4A 5BR8J 2LDYA 2AQ4A 4V19J 1NK7A 2VPWB 1ACMB 4RNOA 4WPAA 4ECSA 2JSXA 3M8ZA 3MXHP 1TL3B 4J9MA 3IS9A 3GJSB 1W2BR 3D68A 2CPHA 2FJBB 3LANA 1WHXA 5IM0A 2NQPA 1P8GA 3D5MA 4MK8A 5D4LA 1H2TZ 3GR0A 1QLNA 4NLDA 5EHHA 1U48A 5A8RA 3V6HA 2YU8A 1WKKA 1XNQE 2UXBJ 2XY7A 2HFVA 3CJ5A 1IWGA 2OUGA 4NYOA 1AAYA 2LP4A 3W2VA 1V9OA 3GMGA 3MM6A 4RBUA 2B7CB 3H4BA 1X0FA 3CULA 1U6BA 5H9EJ 3I96A 3OXGA 3ZNUA 1SL0A 1F1BB 4KSEB 3F44A 2KZZA 2RUGA 3NCRA 1NK8A 2J9DE 1YJNS 3R2DJ 1DBDA 2J7JA 1HYSA 1HQUB 2PMWA 1N56A 5AJ3J 1AA1B 2E5LJ 2CWXA 1M5PC 3SFGA 4F4WA 2UUTA 3NOGA 2DGXA 4RBVA 1WHYA 3Q8YA 2CJAA 2MLYA 3MEEA 2HHHE 4O4RA 2H9ZA 4A46A 5K8MA 1YPNA 2VQFF 3IR7B 4RUAA 1FKPA 1X3CA 1NZAA 3UNGC 3DRPA 5J2PB 2MQNA 2VQEE 1CVJA 2BM1A 1JX4A 1RT7A 5RUBA 3IRWP 1WG4A 3QWPA 3ITHB 2XO7A 1T02A 4CYUA 3SQOP 3NBPB 2PFFB 2UUBE 4LRBA 5D0RA 3TO8A 5ETLA 2QA4S 1TFWA 3HPOA 5B0DA 3IWLA 2VH7A 3VZHA 2FHMA 2EOQA 2DNNA 2RTXA 2YTEA 4ZPVR 4J8ZA 3R27A 2OTJS 5KFCA 2JRSA 3I0SB 4B9MA 4OX8A 1JLBB 3WX8A 3S8SA 2EMHA 3CB4A 3KLHA 3FCHA 4OX9J 3FIGA 3FBEA 2DHAA 3KUEA 2W9CA 2H54B 2PEBA 5HQ8A 4I6AA 2LMIA 2IJNA 4K8RA 1G2EA 3PO4A 4C48A 2ACMA 3K17A 5CFFE 3IG1A 4OHYA 1XNQJ 5BYQA 3GR1A 2RQCA 1W25A 3CJTA 3C66A 2XS2A 2Y0SD 3HVWA 2V2QA 4RNNA 2EM9A 3OBIA 5E3QA 1QU6A 2YKNA 3EZOA 1JQGA 4JI8F 2EEYA 2WBMA 3M2UB 3PRBA 1FRMA 1TL3A 2BQUA 2Q6CA 5LSOA 4CWBA 2HGMA 3ZOQB 4F3OA 1NAQA 1LXNA 2QJ3A 1LNQA 4NLVA 4S0MA 1ZM4A 4PXDA 1EKZA 1PYSB 2E5GA 4B02A 1WC1A 4P2FA 3KWRA 3H42A 2FVRA 4ZPTR 4C11A 3G6ES 3FGVA 4YUDA 3RYLA 2HIYA 3HMJG 4X62J 3E2EA 1P9QC 2XS7A 2K1RB 4CLUA 4J9NA 3VF0B 1IQTA 2DH8A 1X4BA 4LFBJ 2F5GA 4LF8E 2IYGA 3CDUA 1OYEA 5SZTA 4WK1A 2H4WB 2KT5A 1N5QA 2YY3A 3PY8A 2C2MB 3HQ1A 4ZYGA 4LF6F 1OYDA 3LQVA 4BC9A 2BJEA 4NXNF 1KHWA 1SH0A 2X1BA 3H2LA 3BKTA 3ICLA 3IWNC 3NNCA 1KSPA 3HJVA 3MDFA 2FTXB 2WB4A 4ECZA 4JI4E 2JXPA 1WOPA 4P74A 4TYBA 2OIHA 1OSCA 5D0EA 3DLEA 4WBFA 1ZAVA 4RPFA 2UXDJ 2NZCA 4M5GA 4URGA 1RTJA 3JAMU 1UJ5A 4JV1A 4GO7X 1TKXB 5AJ3F 1KVJA 4NMXA 1NCSA 2W9CB 1TQLA 2XMJA 4ZVOB 4WKYA 4CH7A 1TAQA 3BR8A 3B8HA 1FVSA 4C98A 1U2RA 3FVYA 2A0FB 5THWA 4DUYE 2V87A 1EKRA 1FJ7A 4WSPA 4N41A 3OTDA 3IGVA 1RHJB 2BM0A 2OMLA 5D78A 1FA0A 3PX0A 2WAQD 4DV5F 3DGPA 5HMXA 1S9FA 1IKVA 1VGYA 3MPUB 3BSCA 5AE1A 3TNVA 1SKWA 3KMSA 3CJ2A 5T7LA 4MJKA 3OMLA 2JH3A 2E1MA 1XNRF 1TTHB 4MK9A 5KTQA 2HNDA 2PIIA 2JFDA 1SL1A 2GO9A 2D9OA 3TZWA 4IO9Q 2ERRA 2HVZA 4O4GB 4YHHF 2NXCA 4Q43A 2VD3A 2UZAA 4H4KC 2LA4A 1IBMF 4DR7F 1Q78A 5HROB 4FP9A 1S0OA 3PNIA 2BJ7A 3SCIE 3DOKA 4NA3A 2ODRC 4USIA 2CT1A 2CQ3A 3VHTB 3PM9A 5DG9A 3MPDA 4PRFA 3JSYA 4IG3B 2WW4A 1OSDA 3FSYA 2GW8A 3PW2A 2GHPA 1URRA 2CJXB 2HBQB 3EDQB 2IC3B 2Z8QA 3PW7A 3LMLA 4DN0A 1NKEA 4CLLA 4KV8A 3PZPA 5JVHQ 2ILZA 5KG2A 5A8WB 2YTIA 1TF6A 1HMVA 1XMQF 4M63A 4LFAJ 2YKMA 1FF2A 2ZNYA 4RO0A 4O0IA 2VICA 4LF9F 2EPKX 4QIVA 3MUTP 2XG8A 2BXJA 5C24A 4TUIA 4AL5A 4JV2A 3QSIA 2R8KA 3KUHA 2EPLX 3JAMC 3C6MA 2XLKA 2BKNA 1S7IA 2CJQA 3WDOA 1OIAA 2YNFA 4OI4A 2FUG9 3KK3A 3CIMA 2BJ8A 4B9VA 3BGRA 3CJKA 3R5BA 3HSGA 2XMMA 1JXVA 2EQ1A 2ZOMA 1U0SA 3FFIB 5HJXA 1YJTA 4ZMMA 3WZ0A 2CG4A 4ZP9A 5KT2A 4B3OB 1GMVA 3IWBA 1ZM2A 2V50A 4O0NA 4P10A 3MMCB 3DLLQ 2M7SA 2JWOA 3N01A 1RXOB 1F2HA 2CAJA 1X7VA 4LFCJ 2K2PA 2EMFA 2CJBA 5AXLA 3OLBA 3LALA 1FRJA 2ZH3A 2B9EA 1S72S 5DDQC 3LPEA 2V4JA 1RGVA 2YRMA 4WIQA 4OOGC 2YQ0A 1SV5B 8ATCB 4J9VA 4CNYA 1T05B 2QA2A 3DDNA 3FMWA 1UA0A 4C8NA 4IDKA 4OZ5A 2CXEA 3W2VB 1R8CA 3NGUA 1SKRA 2Z2ZA 2W9BA 3PEHA 1S76D 2UXDF 2ELZA 2HHWA 2MKCA 3CJ3A 3R5CA 4WX9A 6AT1B 1TKTB 4KGXB 3J80U 2EMBA 5IT9U 4U95A 4I4BA 3DC2A 3JTZA 3CCUS 2IJFA 2NS1B 1TK0A 1QVFR 1H74A 4DR5E 4MYTA 1NK0A 3TP2A 2EG2A 2LKZA 4DPYA 4DS4A 3CJSA 4M95A 1XNRE 4OX9E 2WSEC 5DRKA 3RG6A 2XLIA 1NJZA 3T1HE 1IBCB 2HNZA 2YSOA 3SSSA 2QG9B 5KG0A 5DZ6A 3C4TA 1VI7A 2DCUB 2J8AA 2ZBPA 1C1BB 5B0FA 1GQEA 1VQ7S 2DRAA 2R7QA 4A8FA 2UXCJ 5AT1B 2CSHA 3KK1A 2QSWA 3BF4A 2EM3A 3SDEA 2NUUG 3D3BJ 3PEJA 2OJ3A 3ENWA 2M9AA 1XMBA 1XMOF 4IJDA 2CQ1A 2IIHA 2IC3A 1IBMJ 4ICLB 2X7IA 1HA1A 4WFBQ 3A1YG 1UWBB 1HR0E 5CQGA 5EWGA 2DGWA 4R8OA 4XDCA 1C1CA 1BC6A 1MGTA 4NA2A 4B9UA 3DM2A 2NR0A 3CCVS 4A8YA 4J37A 3GILA 4A48A 2KYXA 2JHEA 3NNAA 3MM7B 2IMWP 1EJ7L 3PRDA 3R2CJ 2GX8A 2ZH4A 4MKAA 3OVAA 2HJJA 3U1LA 3V5RA 1IKXB 2GZOA 3HTXA 4F4ZA 3TZXA 1UFLA 1TL7B 3AOBA 4NLOA 1QDUB 5IT9Y 4M0VA 3VHQA 3VVTA 1F9EB 4FNIA 5T41A 2NPFA 4DV2J 4RU2A 5LSLA 3PFEA 2P9CA 5HVGA 3DRRB 4GEQB 1J2VA 5CA5A 3NGDA 4RLEA 1XJWB 3MMAB 1WORA 3CD0A 3CIZA 2EPOA 1RWXB 4PXBA 3I0RA 1RWWB 4I7FB 2EN2A 2P9EA 3MR2A 4JI7F 1LWFB 4Q2LA 2V4QA 4QYZJ 3GV7B 3SQGB 3WBZA 1U7LA 2HVDA 4Q8EA 2DT9A 4LF5J 4ECVA 3PHTA 4OYXA 1G2DC 1APSA 4EGLA 4LMZA 3M6WA 1N36F 2ZHBA 2DRBA 2QMUB 4F4AA 5B0AA 4PWUA 2MY7A 4X8WA 1IJEB 4WE1A 4G1IA 1M5HA 1X4GA 3F41A 1JMTA 4MIWA 1S6QB 4F02A 2EOMA 4URSA 3MEEB 2GVZB 2LTRA 1U1OA 3G6VA 4LF7E 4F8RA 1GT8A 4HH1A 1UWAA 5EX0A 3M2VB 2XQCA 1DARA 4ZN1A 4PZVA 2EMIA 2ZKTA 3GFHA 3BQ2A 3VYYA 2BDPA 2EP3A 1ZA2B 3P8BB 2Q8UA 4LSZB 4R2CA 3MR5A 2R76A 4RKUC 3F73A 3RBEA 1PGZA 3G8SA 1ZTTA 3BN7A 2LJUA 3T1HF 1NRKA 2MHNA 2GNKA 3RB3A 1YJ7A 5J1NA 2HWIA 1FDAA 3J81j 2XMTA 2KHCA 3R5AA 2P9GA 4AE5A 2XY6A 3U1NA 1SFEA 4PWWA 4RW4B 5IS2A 2V94A 1ZYQA 5A76A 2I9IA 5F8IA 1UVMA 5IWAJ 2JOXA 2NA2A 2JLGA 4PR6A 1KVKA 1JLFA 3QLHA 2QYCA 5D4OA 1FVQA 4C3MA 2CQ0A 3H5SA 1RBLA 1SJ3P 1VQYA 3Q2TC 4QWCA 4J9PA 4UQTA 4ZJLA 2B4VA 2HG4A 2KB2A 2BANA 1NDPA 2ZE2A 2UUWA 2PRTA 3UE2A 3IS9B 2D69A 4O3SA 4NCGB 3NEKA 5KFWA 2N3OA 2YKPA 3BSAA 1KVIA 4JI8E 1HIYA 5IC4B 2HHQA 1WHNA 2JEGA 5KFDA 2DR7A 2MKNA 1A0OB 3MPYA 2LEAA 2J0XA 3HO1A 4E2FB 3IBWA 1EHWA 1RABB 3OVBA 2J9CA 4QWAA 1UVJA 5KFEA 5L9NA 5C5JA 3A8EA 1RLDA 4GZNC 2GA7A 4GKKJ 2WZOA 2ZVIA 1NDLA 4G1QB 1UN6B 1TK5A 3H2UB 1ZOTA 4UOGA 2F8EX 3EPIA 2BE2B 4RW4A 1VQSA 4JI3J 4QIEA 2HRUA 2H5EA 1YYKA 4KHRA 3DMJB 4P7VA 3HHKA 4DV2F 5LXYA 2W9AA 3EPLA 1OQ6A 5CCMA 2R2TA 3QBCA 2DH9A 1K8AT 4BDPA 2EOEA 4NLPA 3EPKA 4DHVA 3KLFB 3MCSA 1T94A 3IBFB 3T6JA 4CLPA 2EKNA 2HNYA 1QNTA 2V85A 5K14A 1S0MA 5LMNE 3IWCA 3SV3A 3BR9A 3FRZA 4PQAA 1N33E 4DMZA 4KKOA 3BB5A 1LW2B 4USMA 2FVQA 1FI4A 4W98A 4PG8A 4B9LA 2G7HA 3W65A 1JWWA 4ZITA 5J2MA 1N48A 5E0OA 4WU2A 2ROEA 2E9RX 3VVUA 1HQEB 1IBLJ 1T9VA 2XCAA 4ES3A 4PPZA 4C9DA 4JI0E 1N36J 2EN8A 2OPQA 2DXDA 5H9FK 1ITPA 3NMRA 2J76E 3QO9A 1N52B 3UN5A 4GKJJ 4X4VA 2LCEA 2UVWA 1ZM9A 3VQTA 3M1VB 1IBKJ 4QR0A 2L6MA 2BJDA 2LUPB 1SC4B 3M30B 2BOAA 3GIMA 3BH7B 2VDHA 5ETQA 1WI8A 4QWDA 5GAGU 1B70B 2EORA 4DMIA 1CC8A 2HMIA 2WBSA 1FT8A 1FTRA 1VHFA 3HHLC 5GAHU 3UWTA 2A3JA 3SZ2A 3W63A 4B9TA 1LV5A 1S1VB 1QSLA 3NWRA 1DJ0A 2HGHA 2Y1RI 3M2UA 1QE1A 4ED6A 1XR5A 2DSYA 1HHTP 2HYIB 5B0GA 1HI1A 2VFUA 3NAHA 2M70A 4H4OB 2V4RA 2EK1A 2F40A 1CPZA 5J2MB 4AYBD 1IR2A 4X2BA 2VG5A 1G7CB 3BBBA 3OSPA 1P6TA 2DR8A 4EI2A 4YB5A 3HVAA 5ETVA 1VBXA 1UW9A 1S1XB 2AKWB 1YUJA 3RW7A 3NMAA 1TMMA 1HBOA 2MZJA 5F0WA 3KG1A 1RT1B 1X6FA 1EP4B 2QLWA 2MQ8A 4J9KA 2EOJA 2G4BA 1K47A 1CC7A 3N28A 1ZS6A 3ZTSA 2FJEB 4ZVQB 3D6TB 4USTA 1RT5A 4NLYA 2Q66A 1MROA 3NCPA 3RAXA 1S12A 4WK3A 1FESA 2Z58B 3EPHA 4K7QA 1HNWE 2E5HA 2A25A 2CPZA 3MFHA 4C3KA 1RQ0A 3O8WA 2EM4A 1WDDA 1LK7A 1MW7A 2IM1A 3T1YF 1H7XA 4LRCA 2CJKA 2XMVA 5DLGA 5KFVA 2JZ5A 3UR0A 2FIUA 2HHUA 2K3IA 2DCLA 5IT0A 5A6WA 2CPFA 3OTEA 4DV0F 2MC5A 2I5JA 5C25B 4NI2B 1GEHA 3AA9A 1T4OA 2QA1A 3EE3A 2BEFA 4QIFA 4KHMA 3ULHA 3QJJA 1UEUA 4IDKB 1NDCA 5A2QU 4ED1A 1FJEB 2MGZB 1KYQA 3BKUA 4KKOB 5C7PA 1WOSA 3T9ZA 3GSIA 1SJ1A 4X62F 2LXUA 4KH0B 4KGKA 2GAHC 5LMNJ 3LP1A 2HHSA 4C8MA 4LFBF 5D0HA 5HO4A 3Q24A 4Y0FA 2LYVA 5HJYA 1SC6A 2HAFA 1GZ6A 4XIUA 3OHBA 2F1FA 1H38A 4DR4J 2YT4A 1G6BA 3D67A 4M5HA 4R03A 4QCLA 3MM9A 4IKAA 3MAHA 4FVCA 2BRLA 3VAGA 5I3PA 1G4CA 4WFXA 4B9NA 4WYLA 3K6QA 3O3LA 3CDEA 3N4WA 1ROFA 1HBMA 2RKIB 2KOUA 2KJVA 3JYTB 1VOMA 3L95X 2ZM6E 2HMIB 3AXKA 3DOMA 1D1UA 1C0TB 4ZVFA 1HD0A 2YWFA 1P1TA 1U6ZA 2UUAF 5ADZA 2B51A 1NMEB 1AT1B 2QT7A 1X4EA 3MTJA 3JQJA 5B08A 4LQ3A 2GIQA 1KTVA 5BYSA 3LLHA 4I2QB 2FHJD 1F9FA 3TRGA 3DU5A 2GMLA 1CJKA 2ZUAA 1NXIA 1T95A 1PYTA 3KDOA 3MPVA 2GVDB 2LV2A 2L3MA 2ENHA 2RHQB 2V83A 1QUVA 1Y0HA 5CYJA 3C19A 4O3QA 5L46A 4F4XA 2AEFA 4OZ1A 2DGVA 4TLQA 5L1LA 4JI2F 4J9LA 3UCZP 4C97A 3GJTB 5T6JA 5BR8E 5DM7Q 3PYFA 1U1LA 4R8UA 4NWBA 4C8YA 4ECWA 4TN2A 1RP5A 2QV6A 3HULA 4DFJA 5F8NA 2EM2A 4ECXA 1OS5A 3OUYB 4PYDA 4O23A 3TZZA 3KLEB 2JX2A 1X8DA 3IO1A 2OSRA 1R43A 2ZUGA 4JI1E 2VONA 1HKAA 3KLVA 1AH5A 3BSNA 3HKWA 2LU2A 1RAIB 3ZZOA 5DGBA 3GU0A 1BUXA 1S48A 3MAAB 1FK9B 2MQQA 4HACB 4DCOB 1A1JA 1UAWA 3SSQA 3GFXA 2E66A 2LCWA 3RGIA 1RBAA 3OR2B 3NGTA 4RWXA 3A3PB 1HARA 2KI2A 2VA3A 1YJRA 1TUVA 4LBHA 4OMFG 4LFCF 2EFNA 3ZO7A 4EEYA 2KH9A 4R25A 2G1DA 1Q7LB 3KHHA 4WXDA 3DLGB 3HCXA 3KJNB 3LP0A 1UTAA 2GPIA 1X4CA 1R0AA 2E29A 1FXRA 1BMQB 2XMUA 3Q8UA 4OLOA 1R8HA 2DGQA 4N4RB 1RT3B 4IG0B 3AOAA 3I0RB 2W7OA 4KB7A 2HBYB 3JTOA 1DQAA 5B0BA 2OEJA 3VAKA 2ZH7A 3TAQA 2GQQA 2IRXA 1K9MT 3G8QA 4HDGA 5T7LB 3OPKA 3ZFVA 5F8MA 5KFAA 4ZP8A 5GADU 1XQIA 5EGYA 4DV4J 4LJMA 4ANCA 2EMXA 2V86A 2YQ3A 4KPYA 5KFKA 1LW0B 2GVDA 2DH7A 4L8NA 4OX6A 3IWDA 1FFGB 1GAOA 4OYIA 3TJAA 2YNIA 4USWA 3BGHA 3CCSS 2EPZA 3DRSA 3HM9A 2ZE2B 3H5YA 5CHCB 5D77A 2N3LA 1VQLS 3FZ2A 3H90A 5E5NA 3CPWR 3OL7A 4CO4A 4HEA9 3IAM9 2ZFHA 1L3SA 2EL5A 4CLFA 2VBXA 4F9AB 4DUZJ 4ED8A 3W62A 3KK2B 2EG1A 4R0EA 4R8UB 4OX9F 3TANA 4K4TA 3FZBA 3THNA 3O5TB 1NDKA 4QOTA 3QT6A 4CYUB 4OFZA 4DU7A 2CQPA 3IA0A 4XDDA 4HDHA 2BB8A 2RQLA 3IM9A 3SSRA 3DRPB 2AZ1A 3W8GA 5D3GA 3HVTB 3MEKA 3KTQA 3AY0A 2YNHB 2HPUA 5DG8A 3CF5Q 1A1KA 4ZCMA 3QZ7A 5DG7A 1AUSL 3P45B 3DLBA 3OJSA 1TKZB 5AC4A 1NJIT 3IGNA 4LVNP 1YJ9S 1S99A 2KL8A 1SPBP 4F7VA 5EX3A 1X49A 4ATNA 3MF5A 2NXEA 3M8PB 2XYHB 3H09A 2XBPA 4RW9A 2EWHA 4DXLA 4L3NA 1BWEA 2L8TA 2VJVA 4FF3A 3FBBA 3AHPA 2H4YB 3CDAA 3JSRA 2CPIA 2W7AA 4NEYA 4GKKE 1RTHB 4B3SF 2OKQA 2V8PA 1HNXE 3UFCX 2HVHA 5HK4A 3EUNA 2ZBQA 2PA3A 2VG6A 4UOHA 5M2RA 1FDBA 2FJXA 2ZJRQ 2A2DA 4JYAF 3OVSA 4NLRA 3I0SA 1RHUB 1XR6A 1FRLA 1UKUA 4LF5F 2Y1LB 3IG1B 5DM6Q 4CLYA 1JIHA 1FE4A 1Y3JA 4P2MA 3CVKA 5KT3A 3HVTA 2Y1JA 4LFCE 3MAAA 1IR1A 1T3NA 2HZVA 2ZD1A 2BE9B 1RWOB 3WX4A 4CLSA 4YS2A 2RMLA 4M5KA 3MM8A 4WPYA 3GG0A 2V6AA 3AT1B 1LWCA 2G2ZA 4P9SA 1WF1A 1O5JA 3R6GB 3VGTA 4Q44A 3GJQB 4KJIA 4UUXA 2UUBJ 4DPTA 2ZH2A 2LECA 2C22A 3SBMA 5DJBA 3D66A 4CNZA 4YOEA 4XK8C 4JI7J 3MR7A 5IM0B 3CDBA 3DLJA 3IN5A 1M1KT 2RILA 2LEPA 5ETOA 4UOCA 2XI2A 1TL7A 3L3CA 5J2PA 1SB6A 2I8EA 2IPOB 4U8VA 1HBUB 5KFUA 1HW9A 1FTCA 2HHHJ 4DUZE 4PG5A 4YY3J 1ZBTA 4DV5J 2CQHA 2WVFA 4AQYJ 1VRTB 1NH7A 1UFKA 5KL2A 2J8SA 4J7CA 2UXCE 1ZAWA 3KHLA 3OFHA 3DXBA 2BACA 1C4AA 2D3ZA 3G71S 4LBIA 3CCMS 2EQ0A 4DS5A 2O67A 2J6SA 2AYMA 2WOMA 1VK3A 1T03B 3BDPA 1UMJA 2C3MA 4M5MA 2OPQB 2UUCE 1D9DA 1WHWA 2HSEB 4C8LA 2VFSA 1E6YB 3H4DA 3CCRS 1RT5B 2R1FA 3MCNA 2KKHA 4F54A 2RVJA 2H36X 4DSKA 2EFVA 3ZZUA 1A7GE 4DL7A 1GNKA 3W1YC 4JI2E 4DJBA 3V2UC 3LP2B 4J9QA 4Q7AA 4ZIVA 4HTIA 2CPEA 1B3TA 4F2SA 3MPWA 5L9XA 2DNZA 5C2CA 2OTLS 2EMZA 1YDLA 3UCGA 1DRZA 1Z1ZA 3QRPA 2MGZA 5CZXA 3UCUP 3JXOA 5KOWA 2XSFA 3T5HA 4IH5A 3LAMA 2NSCA 1HR0J 3S7RA 2M3DA 1ZPVA 1GX5A 2VC1A 1H98A 1J5EJ 3RZAA 3QGIA 2OO4A 3GYGA 3M2VA 1VCTA 2H65B 2NZ4A 2Y0BB 4FXDA 1Q7YT 1CQMA 5HMWA 2EMAA 2KXNB 3TWZA 3ENVA 5AXNA 1L5UA 4ZLNA 2FD2A 1YITS 4DKKA 1JLFB 3QLHB 8RUCA 4WXCA 4OQJA 2HIQA 4M5DA 4ELUA 4LSLB 2DEJA 4K0KE 1GH8A 4JP8A 3ILOA 4ETXA 1DHMA 2HFZA 2AJFE 4BHQA 2YWWA 4Y3CA 1M5VC 5KAKA 4U7UK 5IOLA 4O4GA 3L00A 1EETB 2HVIA 1LLMC 5LLQA 5B7WA 2KFZA 1NHUA 2M5YA 1S9EB 2DKOB 2AIRB 3NS5A 3G4SS 3KWMA 2YTPA 2YVSA 1JK1A 2WHOA 2M2BA 2EPXA 1S0NA 1FX2A 4LSNB 1RJJA 4JI4F 4DG1A 2UV8G 5C25A 3PJWA 4M9VC 3W3SA 2HBRB 4K59A 4NLTA 2R2RA 5J1EB 2H5JB 1VJQA 1QY7A 3TUJC 1FJCA 2AGOA 3LO3A 4DCPB 4NLUA 3I31A 1URNA 1DQ3A 2YTCA 3EGNA 5KG6A 2VQEF 1PAUB 4RW6B 1LFPA 1Y5LB 1LWEB 5H9EK 1M5SA 5CCLA 4LRDA 2AX0A 1Q79A 1JB0C 5JVGQ 3KLIB 4O3OA 2MC6A 3TVKA 4YN3B 2AJQA 1ULRA 2ADRA 2N8XA 2V2ZA 2EKYA 1IBKE 1JNZB 4WTOB 3ADLA 5CYQA 1FJGJ 2FTRA 1IMUA 3PKYA 1BQNB 2RU3A 3LOUA 1SJQA 1U8SA 2CPJA 4H4MB 5F8LA 2DHGA 2AYGA 1WXRA 2AYBA 3OXLA 4ZVGA 3IM8A 2YNHA 3NGKA 2AEMA 2FZCB 2VB6A 4R2QA 3KKFA 4JI5J 1JLQA 1SIZA 4U6PA 1T9UA 4TU8A 1HHQA 4UZBA 1XNRJ 4DR6J 3LPYA 3MZIA 2OPSB 4ZPCA 2HS4A 4B17A 3PX6A 2EM5A 4F9CB 2HURA 2C2DA 2UVVA 2P2CB 3MGJA 2JWNA 1DAXA 1AFJA 2LTSA 1EH8A 4EFAC 4OJ1A 2HWHA 1WF2A 2XYPB 4PABA 2A2CA 2HQIA 3M8WA 2LBSB 2UU9E 1S0VA 3KLIA 3D0GE 1CBKA 4ZP6A 3EX7B 1RAOA 4LIWA 3W60A 1RADB 3FNNA 4CT8A 5L38A 4DLGA 2DLKA 2Z0GA 3R6LB 5J2QB 2XZDB 4RW7B 1U0HA 3MM9B 4WFTA 1IKWA 3LUYA 4HLBA 1V3SA 1KWMA 3OQ2A 1HWIA 1KQFB 5T14A 1KOOA 3C2PA 1DTTB 2FGCA 3MHYA 5GAEU 2HLTA 2J9DA 3BN4A 2ZITA 1WG1A 3L09A 5HROA 1YWXA 4CDIA 3EPGA 2VA2A 4FN5A 3M8SA 2WTFA 4GC6A 3M9NB 3SDEB 1MU2A 5AXKA 4IRCA 2V8VA 2R7OA 4OI2A 5E3AA 3NY0A 1N5SA 2MB0B 4DV6F 2R3VA 1M5OC 1KOHA 4N8NA 4USJC 2G0JA 3LF0A 2J0QD 2LT7A 3HHLD 1RTIB 3B82A 2RSIA 2QFIA 4MIAA 4KPCA 2G0CA 3L7OA 1DLOA 3FCWA 3CD7A 4ZA1A 2VFVA 4I64A 2C2EA 4NZ7A 3VAJA 2HGLA 3EVOA 2L9DA 3JYTA 1F2GA 1FE0A 1VRUB 1TUWA 1N34J 2Y8WA 1NPKA 5HBMA 4LF7F 4M5NA 5HVFA 3DLGA 3LP0B 2NABA 2HQFA 1MSWD 1X4HA 4RW6A 1C1CB 4HT7A 3TAPA 3EGZA 4I1TA 1UHZA 1BE4A 4X66E 2HQCA 3HF5A 3DNCA 5DO2A 3KLGA 4EYIB 4KIAA 1S97A 3Q0AA 2ZDPA 4TYAA 4I0WA 4E0DA 4L75A 3J81C 2COLA 1ZPWX 3BREA 3E01B 4UQGA 1RTHA 1VIOA 1F9HA 1RE1B 3V4IA 2F9DA 3GV5B 3G6YA 2E9ZA 4DX6A 3PR5B 2GV1A 5I3UB 1UVNA 5SUHA 1FNXH 1ZTWA 1U4BA 3UN3A 2ZM6J 2EK6A 2H51B 4F0KA 1C0UA 2I38A 3UDVA 2HZCA 2LA6A 1ZU1A 3NKYA 2V0NA 3NLCA 3DOLA 2NUGA 4ZDNA 2HFNA
chains in the Genus database with same CATH topology
4A4JA 3MR2A 5H1SV 4JI7F 3QJPA 3C4BA 1LWFB 4Q2LA 1U1PA 2DB2A 2V4QA 3VAMA 4U7CA 1UETA 4G1PA 3GV7B 4QYZJ 1RT6A 2OPRB 3SQGB 3VQSA 1FJGF 4BMJA 2YKNB 3WBZA 2V4JB 5F3TA 3HKZD 2AW0A 3ITHA 4DL3A 3PIPQ 1U7LA 2J7WA 4Q8EA 1N5YA 5FDLB 4NXMF 1YRTA 2DT9A 1VMBA 5KFJA 1YI2S 3FSIA 2IA0A 4DLEA 2JLFA 6FDRA 5LT5A 1I94E 3IC1A 2VPYB 4ECVA 3KJVB 2D7SA 4WFYA 4ZPAA 1FD8A 1APSA 4EGLA 4LMZA 2IVMA 4PG4A 4KZSA 4WTYA 4ILLA 4JI5E 3M6WA 3HDSA 1S6PB 3UQSA 2ZHBA 1N36F 2DRBA 3OW2R 2APOA 4QW9A 2DIXA 1N32F 5LMUF 5B0AA 4WFAQ 4PWUA 2NLWA 2IRUA 5L1KA 4OI1A 4BBYA 1RDRA 4B08A 3JTPA 4B3ME 2MY7A 4KGMA 4X8WA 1IJEB 3MI7X 3CCZA 4WE1A 4QR2A 4AXJA 4AQYE 3CD6S 4G1IA 4FS2A 4FBUA 3F6GA 4QZVB 4ZPBA 1M5HA 1X4GA 2LXIA 3PACA 3F41A 1JMTA 3US5A 2ODRD 4MIWA 4MMOA 1S6QB 1MNEA 3G9CA 1L3KA 4F26A 2Q3PA 4F02A 2B9DA 4URSA 2DVIA 4B3SF 1ZH5A 1DURA 2RRNA 5DETA 1TKZA 3MEEB 1OWXA 3OTOF 2LTRA 2N4CA 2ZD1B 4IH7A 5GMKa 4F4KA 1U1OA 3H98A 3G6VA 1J5EE 4LF7E 1Y5NB 4F8RA 2E1CA 1GT8A 4JOUA 3AUZA 2LQBA 4HH1A 3TAMA 2PI4A 1VC5A 4GKKF 2OFHX 4IQXA 4YMEA 3MEDB 3KOAA 4HTJA 5EX0A 3M2VB 2XMWA 4QIGA 1XNQF 2F4VF 3Q23A 3K0JA 4L72B 5FD1A 1DARA 1YYOA 2EFPA 4RUCA 1X4DA 3DHWC 2XSJB 2I0XA 4QJVA 5E3CA 3TA0A 2M7QA 2XI3A 4KTQA 1U47A 2ZKTA 3GFHA 4YY3F 3T6BA 3GYNA 3WC2A 3TQ1A 3BQ2A 2HHPA 2GJ2A 3VYYA 2Q43A 2BDPA 4N5SA 1HBNB 3NG8A 4QPTA 4UW2A 4IG3A 4MKBA 4AL6A 1IBKF 3AA8A 3V6DA 1TR0A 4MIBA 3X3UA 2DISA 3MR5A 3DCAA 2NUFA 4OI6A 4RKUC 3F73A 3RBEA 4OV1A 1PGZA 4YDXA 1R0AB 2A10A 3G8SA 1ZTTA 4ED5A 4AL7A 2FJDB 3BN7A 2JR1A 3T1HF 1NRKA 3BQ0A 1IKYB 2MHNA 4EBDA 2GNKA 1JXLA 2KM8B 2RIJA 1KLMA 1YBAA 4IO1A 3RB3A 1SXLA 3EYZA 5J1NA 2HWIA 3HHLB 3RRKA 1FDAA 5LJ3Y 2RSQA 3NBPA 1MU2B 2YNFB 4JYAE 2FC8A 2XMTA 4BS2A 4DV2E 1B64A 3HVRA 1HD1A 5KFLA 1IBLF 2KHCA 3CTRA 3FEXB 3QJLA 3R5AA 2J6TA 2R7UA 1MMDA 2P9GA 3QWUA 4AE5A 2XY6A 3U1NA 4RW9B 1SUQB 2ILYA 3DDKA 4H4MA 2JJ4D 3O6QA 3QPIA 4RW4B 3ZC4A 5IS2A 4DV6E 2V94A 1ZYQA 2ZBCA 5F8IA 1UVMA 2MKJA 2O5DA 2NA2A 2JOXA 2NUEA 4DX8H 2JLGA 2L2MA 4PR6A 2IVYA 4F4YA 1CSJA 1JLFA 3QLHA 3J80C 4NRTA 1L3TA 1D8ZA 2QYCA 4I8OA 5D4OA 2DR5A 1X5OA 1FVQA 4IOCQ 2QEXS 4C3MA 4KHPE 1UP1A 2CQ0A 4PQUB 2NPIA 3H5SA 3KHRA 3N5FA 1SJ3P 1VQYA 3Q2TC 2DR9A 1ZZFA 4QWCA 2YKMB 4J9PA 1E6VA 4KO0B 4UQTA 3UD3P 2B4VA 2VPZB 1T03A 3ETOA 2HG4A 5KFPA 4CCHA 2KB2A 2BANA 1KN6A 4RW8A 2ZE2A 1AROP 1N36E 2FGOA 4MFBB 1HBOB 2UUWA 1S6PA 3K5LA 3UE2A 2M8DB 4F9BB 3IS9B 1Y00A 4N56A 3I4PA 1D9FA 4O3SA 4NCGB 5KFWA 2N3OA 3O1LA 3OFGA 3THTA 2YKPA 3LP2A 1T8EA 4X4OA 5A8WA 3BSAA 3QMQA 1KVIA 4DQRA 2RQ4A 1HYSB 4JI8E 3MEDA 4DUZF 3PVXA 4Q0BB 4ZCIA 2XZWA 3OTCA 2HHQA 2LJHA 1HBMB 2GMJA 2RKIA 5I4MA 5KFDA 2JEGA 1WHNA 5HLFA 2FV4B 1N34E 2DR7A 2V8HA 3MPYA 3G86A 2LEAA 2M8HA 4ITSA 2V2KA 2J0XA 4DQSA 2MZTA 1JNRB 4X66F 3HO1A 3NNHA 1RT1A 3IBWA 4YB7A 4ZKAA 2UU9F 2FHKA 3O2IA 3IXQA 3OVBA 4DR3F 3UDLA 5U47A 4W90B 5FIIA 4KFBB 4MKYA 1UVLA 3V4IB 2J9CA 2BQRA 4QWAA 2KFYA 1UVJA 5KFEA 1R89A 5KOXA 3KFWX 5L9NA 1XR7A 3NP5A 5C5JA 3B4DA 3K2YA 3A8EA 1Y5IB 2HNZB 2NYIA 5KT5A 1JKHB 1S4FA 2KG1A 2VBYA 2GA7A 4I56A 2ROGA 3DXSX 1P1LA 3U02A 2WZOA 4G1QB 1NJWA 3W2WB 2WSCC 4Z2XA 4GO5X 2M4IA 2LE2A 2VFTA 2ZOGA 3CD5A 2ZH5A 4DV3F 4OIXA 5IQ6A 1TK5A 3H2UB 1BY9A 2AV5A 3EXCX 1ZOTA 1UVKA 2F8EX 3RU0A 4X4SA 3OFEA 2D1CA 3EPIA 2BE2B 4RW4A 1B0PA 1VQSA 2V8GA 4QIEA 2HRUA 1VQOS 2E1AA 2J0SD 2ASYA 3HP6A 1HL6A 2H5EA 2FPHX 2J5AA 2CPYA 4KHRA 1YYKA 2B3TB 4ED3A 4DBQA 1YVFA 3HHEA 4X84A 3OL8A 3NL0A 3DMJB 4ECQA 4P7VA 3PV8A 3HHKA 3T1YE 5EDWA 4DV2F 4LFAF 4I2QA 2HAIA 2WCXA 4WXWA 5LXYA 1JLCA 2W9AA 2HRYA 2JC0A 1OQ6A 5CCMA 1GTHA 4K0KF 4FXWA 2R2TA 2DH9A 5MAOA 3KLGB 1RTDB 1K8AT 1DI2A 3CC7S 2JDJA 4BDPA 5CYMB 4PCQA 4Y6IA 3THVA 5A2QC 1UWBA 1TV6A 5FLXC 4NLPA 4PWDB 2J7KA 4DHVA 1HBUA 2JFKA 3M8QB 3KLFB 2MJUA 1CQNA 2KXFA 3MCSA 4DR2E 1LKZA 1DTQA 1T94A 3TA1A 3M9MB 1RTJB 4O44B 3T6JA 4WZMA 2BA9A 1HNVA 2XNQA 2HNYA 2DNQA 2R4FA 3U7JA 1Q86T 1NK6A 4DV7E 2V85A 3MSWA 2B5JB 2OD4A 5K14A 4U9RA 1FKPB 2QO3A 3D28A 1S0MA 4QU6A 1R7IA 2HVHA 3KJVA 3IWCA 4KV8B 5MLCV 3SV3A 2VFRA