1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide chain release factor 1
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
2B7VA 1N32E 1IBLE 1DI2A 4DV1E 3ADGA 2L3JA 2LTSA 1XMQE 1HNXE 4X8WA 5LMUE 2HHHE 3ADLA 2VQFE 4GKKE 4LF8E 4DR7E 3C4BA 1WHQA 3OTOE 2DB2A 4DV6E 1IBME 4LF5E 2RTXA 4JI8E 1XMOE 2JY9A 2ZM6E 1FJGE 2UUAE 2B7TA 2NA2A 4DV3E 4LF9E 4M2ZA 1X47A 1YYOA 2RS7A 4X65E 4LF7E 2F4VE 1RC7A 4LFAE 1FKAE 2NUFA 4DV7E 4B3SE 1HNWE 2B3TB 4DV0E 1XNQE 4B3ME 2KHXA 5LMNE 4JI5E 2VQEE 2LBSB 2LTRA 2RS6A 1T4OA 1X49A 5IWAE 4DR3E 4B3RE 1UILA 2L2MA 1HR0E 4DR4E 4WYQB 4DR1E 2E5LE 2UUBE 4NXME 2IHR1 1XNRE 4OX9E 4KHPE 3ADIA 1O0WA 4DV4E 4OOGC 4JI7E 1HNZE 4DR2E 5CFFE 3J7Yp 4JYAE 1ZBTA 1QU6A 1I94E 2L3CA 3LLHA 4DV5E 2N3HA 2LJHA 4DUYE 4LF4E 2RSMA 4JI3E 1UHZA 4M30A 4LFCE 5BR8E 1N36E 4X62E 4YY3E 1X48A 3HTXA 1EKZA 2CPNA 4JI1E 1YYWA 3VYYA 3VYXA 2UU9E 4X66E 4DKKA 2UXCE 4X64E 2L33A 1GQEA 4JI4E 4NXNE 2NUEA 3C4TA 4DR6E 1STUA 2DMYA 4B3TE 2UXBE 1T4NA 2L2KB 1PKPA 4JV5E 1WHNA 3ADJA 4DR5E 1T4LB 1YZ9A 2EZ6A 4JI2E 4LFBE 2UUCE 1RQ0A 4LF6E 2L2NA 1N34E 4JI6E 4K0KE 3T1YE 2LUQA 2UXDE 2LRSA 2JVAA 4YHHE 4DV2E 1J5EE 2MDRA 3P1XA 4WFTA 4DUZE 1IBKE 1N33E 2DIXA 1YYKA 3T1HE 1J26A 4AQYE 2YT4A 4GKJE 2LUPB 4JI0E 2N3GA 2NUGA
chains in the Genus database with same CATH superfamily
2UVRA 1O8BA 3W1YC 2B5JA 2ASJA 4FZVA 4LF1A 2YBVA 1JKHB 3C14A 2JLEA 1FJGE 5RUBA 2Q66A 1IR1A 1Q7LB 2JEGA 4X62F 2WVBA 3HLUA 2C2EA 5M2PA 5D4NA 2U2FA 3FBBA 2H48B 1Y5NB 4RBTA 4QWCA 2VFRA 1U2FA 2VIHA 2FZCB 4B3RJ 4LU9A 2RILA 4GC7A 1OYDA 1T9WA 1SR9A 4UQGA 3M6WA 1T38A 4HTIA 2A2DA 4NCAA 4X62E 2K7JA 3TVKA 2BM1A 2YX7A 4ED4A 4ZJOA 4HDGA 2YU5A 4LF5F 3W65A 1X6HA 2MQMA 1X31C 2XGPA 2RRNA 4NA3A 3CD5A 3OV7A 1S7HA 2RUGA 4P7TA 1ZH5A 4DFMA 1GX6A 4XK8C 5IFMA 3MR5A 4M5GA 4LF8J 3H4DA 2CWKA 2IM3A 6FD1A 4IRKA 2C1EB 3HFKA 5HO4A 3Q23A 4YB6A 1SV5B 1N33J 3TX8A 2B9XA 4LF5E 2LP4A 2QLXA 1D9DA 3AD9C 3TQMA 2EQ1A 1RT2A 4LF4F 1OWXA 2UUCF 1FO1A 4N56A 3M30A 4ZKAA 2WB1D 5C2GA 4U95A 5GAHI 3D5MA 1Z1ZA 2MY8A 2ZUGA 4MK7A 3PY8A 3RUBL 4ZN3A 4PYDA 4RL1A 4DXLA 4JV1A 2G2ZA 3TZWA 1TUGB 1TUVA 2VL1A 4LF4E 1KTQA 1U25A 2BYCA 2Q6BA 2ATCB 4TY8B 2HNDA 1NB7A 4K59A 4DL5A 2EMGA 2M3DA 2MZQA 1B4SA 3LWLA 1JLEA 1IWGA 2HRYA 1AZSA 5F3ZA 1HQ2A 3BF4A 2DIXA 4JI5F 1KRPA 2H4YB 3V4IA 1DTTA 5J2QB 3RW7A 3BDEA 4X65J 2IC3A 2MSTA 1DQ8A 5CCLA 1XBWA 4NE9C 5KFAA 5KG4A 3DLJA 2OH2A 4PAAA 5A8WB 4ZVSB 1RT1B 3UPFA 2OPPA 3OUYB 4JI5E 4RUHA 4LSNA 2YKNB 3FCHA 3LP1B 4UZBA 2ZWOA 3Q24A 4O24A 4WXCA 3Q8QB 3UW1A 3WX8A 1RBAA 4DCPB 1HR0J 1J5EF 2F8MA 2XQCA 5ETVA 1HBNB 4IR1A 4ZPWR 4OJ1A 3J81U 3BGFA 4C4WA 2B7CB 3A12A 1BQNB 1YYWA 3WIUA 4P2FA 3M32A 1FDAA 3PYGA 2YWKA 2M4MA 2M52A 2LEPA 2YSOA 1J5EE 4WFTA 5DGBA 3ZFVA 4AL7A 3ENWA 1O5JA 1XEZA 4V1Ak 2HFNA 4X4QA 4LF6J 4ZVGA 2LTSA 1Q4RA 2NREA 2HHHE 2Z0GA 3MUVP 2IIHA 3DOMA 1NAQA 1YQHA 1SKUB 1V5IB 5KFSA 4JI3F 1LEOA 3H5UA 4R8UA 4NLVA 1S0MA 5F8MA 2RRBA 1XMOJ 1WXRA 4C98A 2HBRB 2E66A 1X5TA 3M8SA 3I6PA 1TKZB 1XERA 4DX5A 2FD2A 1NJYA 4DLGA 1L3KA 5KFUA 2BE2A 2J76E 3GR1A 3K8WA 5BR8J 2H65B 2AU0A 1X4EA 1IQZA 4JI3E 1U6BA 3IO1A 2EOZA 1XR5A 3HO1A 2UXBJ 4U7UD 3ITHB 5KG1A 1GTKA 2HBYB 3R5GA 1RK8A 4YY3J 4ZDNA 1DURA 3CCWA 3MCOA 4NASA 1VHFA 2ZE2A 4RX6A 3AT1B 2ABYA 1LWCA 3LOUA 1HWLA 3LPYA 3ZTOA 3GJRB 2CZ4A 1FDDA 4X4TA 1FA0A 5IC4B 3JQKA 5CYQB 1WSVA 3E01B 4L74A 3OL7A 2Q8UA 1YWXA 1LWXA 1D8YA 1REGX 1S1VB 1TK5A 2YPNA 1RWMB 4FXWA 2IM0A 4ID5A 1YLXA 4PRFA 1AUSL 5KFVA 2EOEA 4Q2LA 4I7FA 4J9KA 2ZH6A 2VOPA 3NWRA 1FCAA 2EN1A 3PIOQ 4DV2F 2C2NA 4TU9A 3DMJA 1YZ7A 1WTFA 1ZZFA 2MDAA 3JTZA 4WIIA 3MUTP 3WZ0A 3LMLA 2MKYA 3PX0A 1GMWD 4MAKA 5D8HB 1UA1A 2FZGB 2EOXA 2L2KB 4A8KA 1T4LB 4X4OA 2OD6A 2X1BA 3J81Y 1VK8A 1EARA 3SYZA 2QO3A 5KFXA 4DV2E 1YDLA 1WWHA 4DR6J 2DNYA 2R7VA 1RDRA 4K4WA 1RWKB 3EGNA 5F8LA 2DGTA 1ZA1B 1NB2A 5EN1A 4LIWA 1GK8A 4P71A 4KGKA 1V3ZA 4MTPA 4USUA 2D41A 1JLQB 4USIA 5C42B 4F26A 4U96A 1RHRB 2GJIA 3M8ZA 2CSHA 3VR1A 1RI7A 2H9ZA 3R5JB 3G8SA 3HULA 2RVJA 3U1NA 3M2UB 3OQ2A 4TUIA 2A6MA 2LT7A 3P4UB 4KWYA 3G6XA 3QYYA 3D28A 2I13A 4UW2A 1P9QC 3T1YF 3CMQA 5AXNA 2XC9A 4ZCMA 2DPIA 1R89A 3TJ9A 3CE8A 2QE5A 4KJIA 4Y2CA 2LQ9A 2VUGA 1LOUA 1IBLF 5AASA 3TAMA 3W63A 4ELTA 1FNXH 3I55S 3I31A 4MIBA 2KN4A 4F4YA 1ELOA 3T1YE 1WG5A 4S0MA 3MPYA 3KYLA 4YQWA 2GMJA 2XMJA 1U0HB 1M90T 2E72A 1OSCA 2IJFA 5KFZA 2C42A 1M5VC 2DHGA 3F6HA 1IBLE 2ZKUA 4O3QA 2HAIA 1W2BR 5ETKA 3OL8A 1TL4A 4Y2AA 1SH2A 1WJ9A 3ZZPA 2B7TA 4M2ZA 3N6NA 4R2QA 4NLRA 2L48A 4HT7A 1F2IG 1WEXA 4WSPA 3OFFA 3D66A 3DLHA 4LF9J 1HNZJ 2Y9HA 1H7WA 1EETB 4ZCLA 1P8GA 2NXCA 1OQ3A 1B7YB 4OOGC 3VTIA 2VOOA 3W2VA 3KMSA 4F9AB 4IO9Q 2MZJA 2L3CA 3D0GE 4OYXA 2DNZA 1PJ7A 3LLHA 3H90A 3A8JA 1AW0A 5DG7A 2XEXA 3UE2A 4WFAQ 4X2BA 2W9AA 3PKMA 3RMPA 1HPZB 3JXOA 2YH0A 3QRQA 4DV6F 1STUA 3HVAA 1UVJA 4WBFA 2ZFHA 3T6JA 2L9DA 1D3WA 1BE4A 4P2XA 4LFAF 2WOMA 3IGVA 4ED6A 2XY5A 1TVRB 5KFHA 2EOMA 3C8YA 1NEIA 3QO9B 3BKTA 4KTQA 2DNKA 4DV6E 4HEA9 4EWTA 1BWEA 1CJTB 4CM2A 2ZH7A 3PRBA 4ZCKA 1H38A 4LFAE 3FNNA 4CLYA 4ZJLA 4TU8A 1U45A 4QW8A 2YRHA 1R6YA 4L3NA 4NZ7A 2A2CA 2I1RA 4B02A 1JXEA 2IRXA 3SDEA 1G3OA 2ZJRQ 2GJ2A 2MJUA 2JEJA 3CWJA 3EVWA 2KFYA 6AT1B 2EPLX 3PJWA 3D0IE 3SBMA 3CJRA 3OHAA 4JB8B 4AQYF 4H4KA 3NMAA 1U1PA 1A6LA 3W61A 3NMRA 4WPYA 1X48A 4P10A 2VF1A 2GLIA 2E1RA 2AEFA 4I0WA 1TZ0A 2Z58B 2YTNA 3T41A 3LWMA 2Y0BB 1J5OA 2GMLA 4I56A 1WHYA 3FJ2A 2HFZA 1YGYA 1CG2A 1QE1A 1TKTB 5L39A 3OMLA 1F2HA 4AQYE 1RTJA 3IAS9 1WOOA 5JVGQ 5IV8B 4NA2A 4C3LA 5J1EB 2BJEA 3CXCR 2YWQA 3D68A 1U1QA 1NK0A 3PRDA 2FZKB 2HNYB 2V0NA 3W2WB 3TUIC 2C2DA 3H20A 1T9UA 1N5YB 3H40A 4IDKA 3GTYX 4NXMJ 5KFLA 4O4GB 1JLCB 1EQ0A 1UEKA 3BR8A 1YKWA 4U8VA 2EPPA 1MMLA 2RSIA 3HSZA 5DLGA 1RB0A 1PJ6A 1U26A 3MM8B 3OVBA 4JV5F 3H4BA 2ZBPA 3NOGA 2V6AA 3MM9B 3GYGA 2CIMA 2NPIA 1YBUA 2M8HA 1BD6A 3PG9A 5AXKA 5KT5A 2KG0A 4N41A 3BO3A 3R2DJ 3CJSA 2KT2A 3WDOA 2EBEA 4IFYA 2R7TA 3R7BB 4JV5E 2RNEA 2UUAF 1HHSA 3KWMA 4I1TA 1FRXA 2HHPA 2EOQA 4ZVFA 3QZ8A 1NKCA 4BC7A 5A8RB 2UV8G 3K0JA 4N76A 2XMKA 3GJTB 3L09A 4A8YA 1S7IA 2FYXA 2BRKA 4RW4A 2K1RA 3QLHB 4IQMA 5E33A 2MKKA 4OI1A 1S0NA 2UUAE 4EO6A 2W8KA 1IR0A 1RC7A 2FJAB 2WBSA 3HVWA 5FD1A 3KNGA 2BX6A 4ZVTB 2H3EB 3CJ4A 1HMVA 4ELVA 1O51A 1MW7A 2FHOB 2K3IA 1YJVA 2DJWA 1T0TV 3NS5A 4CI0B 4AL6A 1F5CA 1RT6B 1TKXB 3FBCA 4LREA 2GAHC 1ZETA 4Q2MA 3BBFA 1FD2A 3GILA 2J0WA 3KJFB 2L9WA 1KQSR 2V8HA 1WEZA 5E2QA 3KK3A 3HT0A 4I4BA 4A4JA 1CULA 3KTQA 5FLXU 1UZHA 4FYDA 2XLJA 3T1HJ 1GFWB 4GVBB 1FWKA 3VGSA 1M1KT 1SQFA 2OIHA 4CLSA 3I96A 4M8LA 2JOQA 4R2DA 3AJDA 2DXDA 1VRQC 1F3FA 4ED3A 4BHQA 3CDWA 4ZYHA 2DNQA 5KL6A 1MWQA 1DJ0A 3KHGA 3QIDA 3S7RA 1FXDA 1RMDA 1RA7A 5H9EJ 2OELA 2BOPA 1LWFB 1MMDA 2AW0A 2C3UA 3I82A 3FC9A 2F4VJ 2PEBA 3QWPA 1KD1T 3VAKA 4DV7J 4P72A 4BMJA 4RUBA 3C66A 3EYZA 1WI8A 4B08A 2RDDA 1JK1A 3LP0B 4GEQB 1ZAVA 2OFGX 4IRCA 5KFRA 4IO1A 3IM9A 4M5IA 2V2VA 1EP4A 1WEYA 1S5ZA 3M9NB 2MKJA 4O44A 4XDCA 3WQPA 1YSAC 2RDJA 2W7OA 5KT7A 1NPKA 2KB2A 4TY8A 4F6NA 2KRBA 3EJMA 1K8AT 3MECA 2VJUA 4FYYB 5IM0B 1FNMA 1IBCB 1RTIB 2Q79A 3C6TB 2V87A 2P5VA 3P5BP 5E3RA 3VCDA 3RYLA 3OTCA 4DG1B 2DGOA 3O44A 2WSEC 5AE3A 1L3VA 4WFZA 4JI0J 1Z2ZA 3CJTA 5KFYA 4DL3A 5F3WA 1RT5A 4MIWA 2ZVIA 3SSQA 4EZ6A 2CA9A 3AAWB 3KJNB 4QU7A 2RHSB 4I2PB 5C24A 5KG2A 2UV8A 3RJMB 3OUYA 1OO0B 5E5NA 1RWUA 3G6VA 4F6MA 1HBUA 3LP1A 2V2KA 3NLCA 1RU2A 1N52B 4E2FB 3R3TA 3DF6A 3IP0A 3EDQB 4P7DA 2JC1A 1NK6A 5B0EA 2PRTA 2Y1JA 5B08A 2C3OA 4DN9A 1XMQF 1A1JA 3DHXA 2Z4PA 2ZKTA 4ZPDA 4HLBA 1H98A 3HHLB 5MAOA 3OTOF 2VBZA 5EX0A 1S1WB 3N79A 4OYWA 4BWJA 1NK4A 1HYSA 3US5A 1X4CA 2DSYA 4LF7F 1SQEA 2VA2A 3C3LA 3DN9A 2DIUA 4ZVUB 5GADI 4FXVA 1SIWB 1SJFA 4RW8A 3KFWX 3V6DB 1DTQB 1HARA 4DSEA 3P6YC 2NUGA 3FGVA 3FEYB 2AT1B 5HBMB 5IS2A 5FLXY 1XMQE 2CQ2A 2JR1A 4QR2A 2IJNA 2F8BA 2PA3A 3M2RB 1RAFB 1JQGA 4C8YA 3NY0A 2EOSA 3OTOE 2KTQA 2WBUA 1IJEB 4YFUA 2EFOA 1XJWB 3EPGA 4OX7A 3FZBA 1W25A 3QJPA 4LF7E 2EMBA 4ED8A 1RYRA 4WP3A 4Q44A 1P6TA 3GIIA 5AJ3J 1FKPB 3S1TA 3KG4A 5AXLA 1U48A 2HHUA 1JWWA 4C11B 1Z4UA 3DXBA 2J6SA 4DX8H 2CPDA 1Q95G 5HVFA 2JRSA 1LKZA 1TL5A 5EDWA 2XMUA 3F41A 4X66J 4QR1A 2VDIA 1PYOB 1T05B 3O8WA 2HFUA 3QATA 1WNEA 2VDHA 1ZU1A 1HA1A 3K5OA 5ITHA 2EOFA 3CULA 4WYWA 4L5NC 1R8CA 4WKYA 1EH7A 5IT9Y 3DGVA 3LP2A 2N3GA 2H5EA 3AD8C 1HHQA 1NHKL 2B7BB 3OXFA 4F0MA 1FVSA 2HHXA 3ADLA 2EL6A 1YHQS 2EM3A 1TFYA 1S1TB 3BGUA 4PXDA 4CT8A 3TX0A 3KDNA 3VAJA 1WF2A 4CLKA 2EOYA 1VQPS 4DBQA 1X5WA 5CYQA 2K4VA 2XMWA 3E01A 4JI1F 1MGTA 3AA9A 1S0VA 1REVB 4EYHB 2XWYA 5GAHU 2FDNA 2VG5A 4EGLA 2M5YA 1IVZA 1NU4A 2MC6A 2AMCB 3OLAA 1RBOB 2EI5A 2BE7D 3JTNA 1FJCA 1F2GA 2XZWA 2UUTA 3UR3C 4IYQA 5HVGA 2DKOB 2ELYA 3VK6A 5IQ6A 4JI1E 3RAQA 2XLKA 3DDKA 4LF8F 2CQHA 4I6AA 1QUPA 4PG7A 5G0RA 2YKAA 2EM7A 3K5PA 5HMXA 1H73A 2BQUA 3HT3A 2D9PA 1NZAA 2B4VA 1S9GB 2FHKA 3I4PA 4OYZA 3TUZC 4IJDA 1YYKA 2CUYA 2FTXB 1X5PA 2BV3A 1FRMA 4YHHJ 4KV8A 1ROFA 2NUUG 4LF8E 2R8KA 2Q43A 3LGNA 4GRSA 2JY9A 1VJWA 2NA2A 4OI3A 4PWWA 2IAJB 1FK9A 2LQ8A 3DOLB 1E6YB 2EOIA 2ZD1A 4PWUA 4RUAA 3RB3A 1VGYA 3RTVA 1RTZA 4CIOA 3M2UA 1FTCA 2ZBRA 3PW5A 4PXCA 4RW9B 2QLFB 1U49A 5KG7A 1R0CB 1PJQA 3ZTRA 4DF8A 1XMBA 2F65A 3MM7B 4PQAA 1XR6A 5BYRA 1UP1A 3CCES 3OPKA 4Q7AA 1RAEB 1PG5B 4YS2A 4NPOA 1S6PA 1CC8A 5E41A 1LFPA 1HKAA 2GJFA 2WVCA 1LW0B 1Q7YT 4X65F 3D0HE 2GHPA 1WC6A 3NRBA 1ZM4A 3GCXP 2DR5A 3SZ2A 2D3ZA 2D3OR 3KDOA 1WHQA 5GMEA 3KOAA 1KLNA 3QWUA 3HHDA 2CAJA 3CCRS 1RAJA 4OQJA 1U09A 4X65E 4UUWA 4ZJQA 3SCJE 5KL5A 3RBZA 1N36F 1KJKA 5DG9A 2W2PP 2MKIA 2Z2ZA 3OTBA 1UILA 3EM1A 4O3SA 2M7QA 2CJAA 2JFDA 4DR5F 1FRKA 2CJBA 5KOXA 4O3RA 4HYKA 2X1FA 1R7IA 1G2FC 3FSYA 1N36E 1PGZA 1PJTA 2V5HG 3OXGA 2EMFA 2HYIB 3KKFA 2XMMA 2YWGA 1F9FA 3AB4B 3N9UC 4P9SA 1AH5A 4K0KJ 4LFCJ 3CMES 4DR5E 4TLRA 4CM0A 5HP1A 2QN6B 1H72C 3TJ8A 3ILOA 3EWGA 1L3SA 1QUVA 1RBLA 5KOWA 3QMQA 1JIHA 2ZUAA 2B9EA 1KTVA 3BSOA 2AYMA 4RWWA 4EMDA 2EORA 2ZH1A 1ZAXA 4PQUB 3FEZA 3BS9A 4HEIA 2HS0A 4WYLA 3TA0A 3SQGB 1XC9A 1CJTA 5F8JA 5F9NA 3OSPA 4RO0A 3R5CA 4DZ6A 4TU7A 5DDQC 3WBZA 1GNKA 3QFWA 4J37A 3GG0A 1QTNB 2UXBF 3NXZA 3I4HX 1CJUB 4PABA 2YWHA 2HZCA 1IKXB 2UVVA 2IFXA 3QSIA 4ECYA 2AYBA 3H2LA 3FSXA 5BR8E 2DITA 4H4OB 2HURA 5D3GB 4J7CA 3M99B 1KYQA 1N88A 2UXBE 3GV8B 3DLEB 1S97A 2EPNA 1F9EB 3ZOQB 2VASA 3M9OB 4QIVA 2RIJA 3HPSA 2MDRA 2H4WB 3HPOA 1YJUA 3OTDA 2JFKA 2DR9A 2VQFJ 3MEEB 4NI2B 2CG8A 4DR4F 3BJYA 5KTQA 4ILRA 5M2RA 5HLFB 4UOGA 4I2QB 2CFXA 4NLWA 2RS7A 4LUBA 2XHWA 2HNYA 1VJQA 2DVIA 5L8RC 2EPOA 3W2WA 2XSJB 1E6VB 4UY8T 3DJWA 4OZ3A 4K4TA 1SL1A 2L3MA 1N5YA 4URQU 2QZ8A 2W25A 3RW6A 2QYCA 4DR4E 1V3SA 3DGPB 1FT8A 2EMZA 4O4GA 1JLCA 3DDNA 2KRRA 2C3PA 3RR7A 4EU0A 4J9SA 2AZ1A 1YRUA 1UW9A 2C28A 2DNPA 1FFSB 2ODRD 1WF0A 1WKLA 4WE1B 3ZO7A 2IDEA 1C0TB 3KJQB 5A0YA 1YG0A 1FFGB 3QJLA 4X84A 3BIDA 2PE8A 4ED5A 2KFZA 1K44A 3V81B 4OI6A 4KAIA 4F2SA 2YKMB 3I0RB 4PG6A 1NNDA 5KFCA 3FVYA 1X4HA 3A13A 4DSIA 4FNIA 1Y7PA 2EQ3A 3CJKA 3OR2A 3PFEA 2QV6A 3S01A 3TEGA 4CTAB 4JI8J 4B17A 2JSXA 3RBDA 2CDRB 4F02A 4F4ZA 4FBUA 2IDLA 3CCJS 2K2PA 2OPSB 3TP2A 1MLAA 2XTJP 4L6V3 3QLHA 3I0SA 3PJ9A 1YI2S 3GFXA 3PFOA 2EMWA 2ROGA 3FMBA 1Q81T 1GTEA 4LRDA 2GFFA 4PYAA 5DQHA 3H5SA 4A8FA 1XQIA 4UF4A 1UJ4A 3BGHA 2X51A 3QBCA 3A8IA 3AJ1A 5DZ6A 2ZH8A 2AX1A 3MPUB 3AHPA 3RRGA 1HWIA 4ECWA 2FV4B 4ED1A 4DWIA 4OZJA 4NYPA 3PR5B 1RT6A 1TKXA 2QLBB 4ILMA 1S9EB 1NJIT 2AKWB 3FFIB 3ET6B 1PO6A 3R5BA 1OY9A 2ZBIA 1S1UB 2L33A 4BCAA 3B54A 1FX4A 2W4CA 4CLWA 1X4FA 2H5JB 2FVCA 3GONA 1GAOA 2EWLA 3IRWP 2GCFA 3CCQS 1IBMJ 5KT2A 5EUHA 5HK4A 3B4MA 2QX0A 4C8MA 3CCTA 3FZ2A 1R8BA 1HNZF 3Q8PB 1LK5A 2DNNA 2BR0A 2V8QB 5F41A 1NEEA 4DS5A 1RE1B 2K7IA 5LMUJ 1U8SA 4KYZA 4MT1A 1WC1A 2L6MA 2RQKA 4K50A 1LW2B 2PMZD 3IBFB 4L8NA 1LWFA 2F8EX 3ZNJ1 1RTDB 5HMYA 5MLCV 5J2MB 4O43A 2W4PA 4O23A 4EO8A 1HNZE 2AYGA 2WCXA 4DCJB 5E3PA 3N5FA 3HDSA 1UAWA 4FKYA 4B9NA 4KIAA 1VLYA 4ECQA 2ZNYA 3U27A 1BHNA 2HS4A 1HFEL 4DR2J 2JVOA 4NEYA 2J0XA 4QCLA 2CPNA 1FNOA 4PG8A 4ECZA 3PEHA 1HNXF 4Y65A 4A8OA 3W3SA 2RRAA 4TLQA 2VFSA 2OAUA 1N6QB 2GNKA 1T03B 3C6KA 1CJKB 4J91A 3QAUA 3MMBB 1FKOB 5KFGA 4F54A 4WCEQ 4B3OA 1HI8A 4ZIWA 2GVDB 3A4TA 1HNXE 4ZLLA 3D1QA 2GIFA 2M70A 3I5CA 2BBGA 1XNQJ 4DG1A 3CT9A 3P5TL 5LMNJ 2MMYA 3A8EA 4ZHRB 2MLZA 4IOCQ 1NPPA 2IMWP 4C8KA 5I42A 4FN5A 5HMWA 2HEKA 2LKZA 5HJYA 2UZAA 4B3MJ 2CPJA 3DYAA 4EUVA 1AXQA 3HM9A 2XCPA 3K5MA 1S6QB 3THOB 4M5DB 1EKRA 2YQ1A 1C4CA 4DV4J 3OFHA 3FDSA 2E9RX 1O6XA 4DFJA 4KGZB 2BQRA 1GH8A 1EIYB 4YMEA 2YNGB 4JUZA 1YBAA 1SI9A 1WKJA 4ATNA 3PX4A 4CP5A 3KLIB 2HSEB 1WRJA 2YTOA 4K5SA 1K1SA 3F56A 4QQBA 2QFJA 1S72S 1LLMC 3MFIA 5K8NA 2WW4A 5LJ5Y 3ZNUA 4WP9A 3MPVA 3NCPA 3KUGA 4YUDA 1JMTA 4NXMF 2JLFA 3E8OA 3T5HA 5HBMA 5CQGA 4F4KA 1X6FA 2M9KA 1UEVA 1QY7A 1YJ9S 1IMUA 2EK1A 1IM4A 4NCGB 1QAYA 5J2NB 2KU7A 2MQQA 5A6KA 1UWBB 4LRFA 1M5OC 2KT3A 3CC4S 5DJBA 3CSKA 1S4EA 3JYTA 4XPEA 5LSOA 2EL5A 3HK2A 4NXME 1VBXA 3QGHA 1HNWJ 1PCAA 2W8LA 1FKPA 1HBOA 3QFHA 4RJVA 4IG3B 2XNQA 2DHAA 3PW7A 2LXIA 1VHIA 3MDFA 1IKVB 3JS9A 4C11A 2MZSA 4R2PA 1MN9A 1KONA 4JI7J 2K06A 3HPZA 2MGZA 3UN5A 4X4UA 4ALZA 1AFJA 4WFBQ 1TL3B 2B4UA 1T05A 4K4VA 2WVFA 2JEFA 1KHVA 5K14B 2HLTA 3MEGB 5KFOA 4Y00A 2EN2A 1AB8A 1Q8KA 1Q78A 1M1GA 3UCUP 4LRAA 4DJBA 2QA1A 2EW9A 2MLYA 2YNIB 4Z37A 2EM5A 1H2UX 4DOZA 1QM9A 4C6AA 4K4ZA 2X7IA 4C0BA 2EM4A 4KC5A 4XO0A 2WTFA 3AODA 3UQSA 2QL5B 3DLKB 3HKWA 2QSFA 5H9FK 2YRKA 4DL7A 3IMQJ 1FX2A 5ETRA 3ULHA 3G71S 2YNFB 3DRPB 2CZ9A 1YSJA 4F4XA 1JLAB 3KLGB 3DC2A 2HMIB 1REVA 4QYZJ 2RD5C 3KHHA 1ITPA 2LE2A 1U1NA 2PO4A 1N4LA 1CPZA 2EFNA 3VQSA 1TAQA 2HQGA 3VF0B 4WZQA 3T1HF 2YTCA 5CYMA 2X3GA 3VZIA 2BJ1A 4R8OA 4M5JA 3CB4A 3Q83A 3MEDB 4WKRA 1CJVA 4O5GA 1IJFB 1CBKA 1TL7A 3PW4A 2CNOB 2KYXA 2YX1A 1T3OA 3BGRB 4RUCA 1JNRB 2AJ4A 5KT6A 1S49A 2ODRC 3L00A 3VAFA 2AGPA 4WXWA 4OI4A 3BSCA 3GR0A 3NAHA 4NHRA 3GWCA 3LGMA 3T1HE 1S9GA 2F3JA 4DR7J 3NBPA 4WP8A 1BMQB 2Y1RI 2VFUA 2HWHA 2F4FA 2CNNB 2V63A 2RKIB 2V50A 2XLIA 1VR6A 4RNNA 3DM2B 2N3LA 2QMUB 2ZOGA 4KPCA 3R8YA 1LNQA 3BSNA 3UD3P 2O66A 1NSKL 2PT0A 1LXJA 1Q0NA 3PO4A 4QIEA 3K7RA 3DOLA 1E6YA 2WCC3 2J6UA 2QT7A 3GMGA 5K9FA 2LJUA 4HACB 4DCOB 1CSJA 3W5XA 2RB7A 3DFEA 3MM6A 1BWVA 2WONA 4R2EA 1Q82T 2AD9A 2YTIA 4F9CB 3TVYA 2VQEJ 4QU6A 1A1IA 2DEIA 4ZPAA 3BH7B 1GEHA 2J5AA 1GX5A 4J9RA 2KG1A 2EKYA 2VG7B 4DQRA 3EVOA 1V9OA 3MMAA 4F04B 5J1PA 4G6VB 1HBMA 1TR0A 3R6GB 1QTMA 5CA5A 2HVIA 3LF0A 4KGVB 5GADU 5KT4A 4LSLB 5ETNA 3C46A 5JMNA 2D7SA 2W2NP 1JLBA 4FF4A 2KOUA 2AJQA 3ISZA 2V88A 1HNIB 4JYAF 2DBBA 2Y3YA 1RWXB 5D0GA 1KBRA 2HRUA 1M5PC 2BEFA 5G4DA 2Q1LA 3UNGC 1KFDA 5ETOA 1FJGJ 2E5GA 2B43A 3G87A 1ZA2B 3HVRA 2HBQB 3PM9A 3G6ES 1X5SA 3CCSS 4F0KA 4JYAE 5C25A 4J9QA 4IFVA 5KFDA 3HFZB 3W9HA 4R0JA 4A48A 1T3NA 1KVIA 4C48A 3CJ5A 2V8DA 3FK4A 3OR1B 2ZC3A 3HZEA 1FRIA 4OV1A 1LWEB 5DDOC 2CQDA 5JVHQ 1FERA 4X62J 1WC4A 4OJHA 2IPOB 5HQ8A 3G82B 1NCLA 1YZ6A 2JJ4D 3GJQB 2KZZA 3M1VB 2B7VA 2V9KA 1SUQB 1TTHB 1DI2A 1S1XB 5A8KA 2W9BB 2FJDB 2OPRB 3OL9A 2HW3A 5D0RA 3KK1B 1AFIA 1UCNA 4DV0J 1VMBA 5IC6B 2R7WA 2RQMA 4PQUA 3Q86A 3UDVA 4GO5X 3KXDA 2OSRA 3PHEA 3P45B 3N0VA 3SQGA 5EHHA 4O4RA 3UD5A 3BREA 1PC4A 3ZXWA 4X66F 4NXNF 1AT1B 1HQEA 1M5HA 4KR0B 5B0AA 2OTLS 1T9VA 3HP6A 1UFLA 3MMCB 2CNKB 1KSPA 1NXIA 3DRSB 2Y8YA 3TARA 2OEMA 4DMIA 4IUFA 2O5DA 1WUUA 2M9AA 1SH3A 2HHQA 4X66E 4LF4J 2UUCJ 2HRTA 4NXNE 2PFDA 3DRYA 3GSIA 3HVTB 4LF2A 1YRXA 3GCWP 5KFTA 3DLEA 2C2MB 1TQLA 3HCXA 4CWBA 4RNMA 3PHTA 2IYGA 2DD8S 3SCKE 4UQTA 2VZ9A 3MAAB 3MEEA 4JV0A 2RU9A 3A8KA 1QSLA 5CXTA 1SC3B 3R6LB 5HLFA 1U1LA 1SQGA 3G6YA 3OJUA 1IXKA 1IN0A 3RGIA 2KT5A 3DU6A 4FF2A 2ZH2A 3AQOA 3QQCD 1LFWA 2M4IA 2OEKA 3KG0A 1VOMA 4JI5J 2N4DA 4DQQA 3DGPA 3BO4A 3J7Yp 1QU6A 5F3TA 1SL2A 3RAMA 3V6HA 1Q8BA 5EX3A 1SJQA 2UU9J 4Y28C 3R1HA 3B6BA 1C1CA 1VLOA 1RHMB 2Q6CA 2H5IB 1NK8A 4EZ9A 5T7LB 4X4VA 3C15A 3V81A 4YR2A 4J8ZA 2V85A 4W4MA 4MFBB 3VHQA 2A25A 4I64A 1N0UA 2R2SA 1R8PA 2VHGA 4AFFA 2QLWA 2GIRA 4Z7CA 1FHTA 3KZZA 2GS8A 4OYMA 3MWBA 2OPSA 3HFVA 2ZEJA 2F9JA 2Z2MA 3MOJB 3RRKA 2R9LA 5T41A 3DOKB 5J2PB 5DM7Q 4OLPA 4CO2A 3BQ1A 1RAAB 4JI4F 2PIIA 1MG7A 2PMWA 3CDUA 2ELZA 1IKYB 3CDBA 3VAHA 2V69A 4XPCA 4U6PA 1Q79A 3KJVB 2LJHA 4DSFA 4M95A 4KSEB 4ZVQB 1NMEB 2DT9A 1M1HA 4WWSA 4A47A 4LFBJ 5KG5A 4JI4E 4JI3J 2XSFA 1F6TA 2V4RA 1JJ2R 3GPAA 2CVIA 2ENAA 4Y0FA 3MM5B 1S1UA 2I9IA 2RF2A 4ZYEA 3C2PA 1ZZNA 5K5MA 2B6AB 2QA4S 1HIYA 2V4QA 5K20B 1HL6A 2P2CB 2ZM6J 1XNRF 3BKUA 1BC6A 4FF3A 5F8GA 2CXEA 3KUEA 1UTAA 5LSLA 5IZHA 3D6TB 5KG0A 1YYOA 1C4AA 3VAMA 2EXUA 4LRCA 1N8RT 3CGIA 1KQKA 3MF5A 2B5JB 3DXSX 4FP9A 2B9DA 4ELUA 4YN3B 4DFKA 2RQLA 1FD8A 4F7VA 4R2RA 2BM0A 3EGWB 4WFYA 1LW2A 2HNZA 1XNRE 3CJ8A 3TZZA 1YJRA 4OZ2A 2YRMA 4CLUA 3AOAA 3GSDA 5J2MA 4K0KF 1DARA 4ZVPB 5KFPA 2EC0A 2LVWA 3SI8A 1DQ9A 5A2QY 4USTA 4RNHA 3K17A 5B7WA 1DAXA 1DHMA 3NGTA 2HWIA 5HROA 2AJFE 1UWAA 4DUZJ 3PZPA 4KH1B 5TSEA 1QVGR 4I6YA 3TOQA 4MYUA 5KFIA 2XGQA 4K0KE 3DHWC 3HMJG 5FIIA 3I9V9 4B3SF 4EBCA 1YUIA 1FXLA 2E1AA 3I5BA 2LYVA 1KS2A 2DNHA 5D0EA 3R5AA 2DIVA 1D1UA 1CJKA 2CQ0A 1NJZA 1FKOA 4KHRA 4QIWD 3M2VB 4DV2J 4CLFA 3Q8UA 3CVKA 3VVUA 2J0SD 4A8SA 4ICLB 1VQ5S 2VBWA 1T02A 4LR8A 3W60A 1Q5VA 1BBOA 4B3SE 2AJ2A 2YTQA 3RB6A 4ZHRA 1RT2B 1VQ7S 4Z2XA 4NWBA 4EFAC 1I94J 4C3MA 2DGQA 5E3AA 4LQ3A 3M30B 2HHHF 4UOCA 3ICLA 2NS1B 3E2EA 3C19A 3LANA 4OYAA 1X8DA 1G4CA 2XBPA 2J8AA 1S6QA 2O1PA 3CO9A 2BB8A 5KFKA 4YOEA 4A8MP 1H74A 3JU0A 1FFWB 4NZ0A 5A76A 2VQFF 2AF6A 3GP9A 5CABA 2BA9A 2ENCA 3UNYA 4NLYA 2GHWA 1RQ0A 2HNDB 4LTYA 3BDPA 3ZZ0A 3IWNC 2AP6A 2AGQA 1J26A 1KFSA 3NWGA 5D15A 2JXPA 4WXOA 2GVZB 3QT7A 3T1YJ 2OD4A 1BLUA 1X4GA 3GZ7A 2VQFE 3ZTPA 4KKOB 4DV3J 1AZSB 2RDIA 2XMVA 2GGPA 1C2PA 1IBLJ 2VG6A 3BYPA 4BHBA 4M63A 2PI4A 3QGIA 1PJ5A 4ECSA 2YY3A 2NLWA 2IC3B 2LLZA 3R27A 2AEJA 1YPNA 1YBTA 3EXYA 4X4RA 3KK2B 3M6XA 4RNFA 2WBTA 2YTJA 3IR5B 4FK5C 3VVTA 1TFWA 4U8YA 5CZVA 2ACYA 1B64A 4FVCA 2EJ4A 4ILLA 2POKA 3IXQA 3CJ2A 3KUHA 3GIJA 3EPKA 1X4BA 4QWAA 3LW5C 2A6OA 2GHFA 1GQEA 4F3QA 2P6SA 1RT7A 2ILYA 2XMTA 1TL3A 2DLKA 2FGCA 4OI0A 1VQ9S 5K14A 3MEGA 3VAGA 2C3MA 4Q0BB 2VPWB 1P1TA 2DYAA 2AJ1A 2DGWA 3Q2TC 2M1SA 4MIAA 2RH3A 3CJQA 1QDUB 2DB1A 4MJKA 4F67A 2VF3A 4JI8E 5KL3A 5B0FA 2DXEA 3ZZRA 1S6UA 3V6JA 4LBIA 3HI9A 4DV6J 1R43A 4LVOP 4KHMA 2HFSA 1R0AB 2I5JB 2LFVA 4YP3A 3ILIA 4X64F 1JJCB 2DH7A 1NSQA 2Y1LB 3DRPA 4B9SA 2EN4A 1UBDC 3ISND 4R8UB 2BDPA 3KLGA 1RAOA 3WC2A 2QLJB 4NRTA 1N34F 4RLEA 2UVUA 1ZS6A 5CYJA 2EQ0A 1NM2A 4URSA 2R8HA 4R5PA 5HAOA 2VICA 4X64E 2C2ZB 5LOQA 3MEDA 1IBMF 3SIPB 1FI4A 5A6JA 1U02A 3BGOP 4G1QA 5B0CA 2OKQA 3TZYA 1CQNA 1N34E 1EAYC 4PWDA 4RWXA 2ZH9A 1M5SA 3PV8A 3C16B 5ETTA 1KEKA 3KMQA 3TANA 4OZLA 2BJDA 4PG4A 4DF4A 2IA0A 3ADGA 3DI6B 2ZOMA 1VBKA 4Q43A 4CYUA 2ZE2B 4AQYJ 1IBME 2JZ5A 2RTXA 3PNIA 3KZYA 3DM2A 1NLKL 2V34A 5IWAJ 4CZCA 1B0PA 2LDIA 2GHVC 4RW6B 2ZBQA 1QAIA 1TU0B 2EPZA 4PUOA 3UVJA 4QWDA 1FDBA 1T8EA 2L2MA 1KWMA 3ONQA 2M7SA 4WSGA 4B3TF 2D9OA 3J80C 3T5LA 1N0VC 1UPPA 3H59A 5A6BA 1C0UB 2MHEA 4IH7A 4U67Q 2KYZA 4ID5B 4KBIA 1JB0C 4L73A 2H36X 4Y3CA 4I7FB 4USJC 4ZLNA 2JP9A 5DS7A 4DL0C 4DMZA 1VRUB 3VYYA 1WJPA 2CKWA 2XZTB 1DQ3A 2XM3A 1HQUA 4B3TE 5D0HA 1JJHA 2PGCA 2KJVA 3I32A 4OYPA 5AE1A 4IG0A 1KVKA 4G3IA 4OHYA 2JVAA 4OYIA 3R7NB 1XNQF 5LMNF 4JV5J 3NGSA 4NLPA 1XIQA 2LA4A 1DZ5A 2PC6A 2E9ZA 3ILJA 1U1KA 1A1LA 4LSLA 5K8PA 3DRRA 2XY7A 3IGNA 1TL1A 2EPRA 2N3OA 3MHHC 1HNIA 2V8GA 2NUFA 5CAAA 2EWHA 4QIFA 1XNQE 1Y3JA 2WZ1A 4HHUA 5LMNE 4USMA 2UUAJ 2LTRA 4JBCA 2DGSA 3Q89A 4FYXB 2HVZA 1HI0P 2HGMA 2YH1A 4RW7B 4OL8A 4RKUC 1TV6A 3UO0A 3FQKA 4ZITA 1Q5YA 2N3HA 4P6QA 1LV5A 5D6GA 3HSGA 3TAQA 5HVHA 3ZTQA 2KXHA 5HMZA 5EWFA 5HSPA 3TEHB 2ROEA 1U1OA 2EOJA 4LSZB 2KKHA 1N5TA 3LAKA 1VBZA 2DMYA 1SJ1A 2YWWA 3FQLA 1JNZB 1BXNA 5E3QA 3S6EA 5ETMA 3TAMB 3IM8A 1EKSA 3KNAA 1U6ZA 4F2RA 1BB8A 1WF1A 4OJ3A 3KLFB 2R3VA 4UUXA 2XS5A 4F4AA 2W01A 4DR3F 3IWLA 2HK3A 1EQMA 3G4SS 4K2JA 4U7CA 3I56S 2I38A 1APSA 5D4PA 3M1VA 4RU2A 1YJTA 1SUQA 2DHSA 1S1XA 1VQSA 1HWUA 2P8IA 4BHCA 1KP6A 2W9CA 4PKDB 5JXSA 2MZTA 3MURP 4ECUA 2RQ4A 3KK1A 1TK8A 1U7LA 4ED2A 2EN3A 3SV3A 2XWXA 1AUDA 2LV2A 2YTPA 4LQ9A 3MOZA 3J7A1 4DR3E 4F36A 3P96A 4HKQA 2ZZNA 3SEOA 2V8PA 3AXMA 3KHRA 1IWAA 3ELHA 2CTDA 1R6VA 2CQCA 2DHHA 1QLNA 5IOLA 1KQFB 3DRSA 4HHJA 3GG1A 1RJJA 4CDIA 4IOBA 4R2AA 1S0OA 4DX7A 2LXUA 2XZDB 3R2CJ 4ZP6A 1T9XA 2IBOA 3AQPA 2HHVA 1N5SA 3ENAA 5U47A 3UN3A 3PDNA 1RSCA 4LT6A 1KC8T 2ALYB 4ZOSA 3O3LA 3FSIA 3HVTA 3JSBA 2J7JA 4N8OA 4GO7X 4PCQA 2K7KA 5I3QA 1W7WA 3M8WA 3K57A 3H2VE 1NK5A 2V67A 2JOBA 3IRXA 1UFKA 2E5JA 1GMVA 3NGKA 1G6BA 4KGMA 4EBDA 4AXJA 3MAAA 5DDPC 2IY5B 2CJYB 2FHJA 1W2IA 3SCLE 3R5DA 2VKZG 2EVZA 4XIUA 4WTOB 3X3UA 1KKHA 2RMLA 2DR6A 2B9WA 4EBEA 4KQZA 2DK2A 3EMTA 4P52A 3T5JA 3F6GA 2PA8D 2NYHA 1GXTA 4Q28A 2AV5A 1FRJA 3MEKA 4DLEA 3UR0A 1NHUA 3UDLA 5A6PA 1U2RA 4K4UA 2EE8A 4HHHA 4E8UA 2FY8A 2NYIA 4ZVHA 4DR7F 4C0OC 1NRKA 4H54A 1OPZA 3LUYA 2KHDA 3ZZYA 2ZBCA 3LO3A 2MPUA 4MKVA 2GQCA 7FDRA 3O5TB 4DPOA 3D3CJ 2J6TA 2OFHX 5KL2A 1JKHA 2DNMA 3N4WA 4MFBA 3PR4A 1J5OB 3BO2A 4QOTA 1WORA 2Y0SD 1BQXA 2JOXA 2BABA 1RISA 3NS7B 3G8TA 2KVQE 1QE1B 4DR7E 1SKRA 3ADAC 5DDRC 3BF2A 1FJEB 1RCXB 2MKSA 2I2YA 1WC0A 1PAUB 1Y4ZB 3GJSB 3PKYA 1UZDA 1A7GE 1FE0A 2BRLA 2GMHA 1X47A 1GXLA 2MJNA 4KT0C 3QT8A 2ILZA 3MR6A 3NCQA 2EMCA 3HJFA 2KHXA 1MWYA 3VALA 5D77A 3SV4A 2PEHA 3UI3A 4LF7J 3CUNA 4DPTA 5CFFE 4K4XA 3D1HA 4B9TA 1S48A 2HVHA 2BW7A 3POTB 2WSFC 1AROP 1X6EA 3KJVA 1BBGA 5KFFA 1FESA 1MWZA 4AD6A 1F1BB 4QWBA 3H5YA 4C7QA 5SZTA 3OVSA 3D6MB 3ZZZA 1EX8A 2EFPA 1RAIB 1KOHA 2ZJQQ 5L38A 1SV5A 4AT1B 4IFYB 4K5RA 4Y2IA 1HLWA 3MUMP 2KJWA 4J5OA 3JSYA 2ZNZA 1SB6A 1UJ5A 5IT9C 3RU0A 3ENVA 8RUCA 3D1OA 2G0CA 1BGXT 2YTFA 2L41A 1NBEB 4EEYA 4TYAA 4USKA 2AGOA 1JK9B 3L95X 2ADBA 4X4NA 2L92A 2FTRA 1I1GA 3JQMA 1R3NA 3LTOA 1WD6A 2NCKL 4RW4B 2K1RB 4OX6A 2E5LJ 1YTYA 2DPJA 3MCMA 2ASDA 2UXCF 2HHWA 2IVMA 2EMHA 3L7OA 4DPUA 3TRGA 2CQ3A 3IBWA 2PFFB 3K6QA 4JI6F 4ZPBA 2UXDF 1T7PA 2B9YA 3MMJA 2KM8C 4MKAA 1HMVB 5KFBA 2EMIA 2EPXA 1Y00A 2GA7A 2WBMA 3TQEA 3T6BA 4OHVA 4N4RB 2UXCE 5KFJA 2FVQA 2DGCA 2R8JA 4QR0A 2HLUA 2KFNA 2D1CA 1GT8A 2EC2A 4PZVA 4MK9A 2HAFA 2EMLA 4FS1A 4JI1J 5J2QA 2JPAA 3V2UC 4JI6E 1WHWA 2UXDE 2BKOA 4DV0F 2CPZA 3KK3B 4ZLJA 1JLGB 1CULB 3GLJA 4OFZA 3EICA 1NJWA 3FCVA 2XCAA 1YX2A 2P6TA 2WRMA 4DX6A 5A8WA 1RT1A 2CJQA 3CCZA 3MZIA 1X9SA 3Q22A 1Y0HA 3M2VA 3ZZUA 2YKNA 3IWCA 2AWZA 4P75A 1GTHA 4ICLA 1IQTA 4DV0E 2VKRA 3VQTA 2FJEB 1RHQB 5T6JA 1WELA 2CPIA 2FLPA 4R2SA 3AXKA 3D9BA 4Q8EA 1RT4B 3I87A 1HBNA 3CC7S 1YIJS 4L75A 4DPYA 4DI6A 2WW8A 3Q8YA 3NGRA 1BQNA 2MQ8A 5CCMA 3J7YU 5BJRA 2VPZB 2R8GA 1UMJA 3OVAA 1NO8A 2HQCA 3IA0A 3CMAS 3AFGA 4QPXA 4OZ0A 5GAEI 2FLOA 3R9LA 3BQ0A 2CQGA 1XWLA 4ANEA 3BYRA 1RAGB 4CO3A 2LQBA 1EP4B 2UUCE 4E98A 4TNOA 2QG9B 4O44B 5EWGA 2F8HA 4BWMA 2LO3A 4P2SA 1FKAF 4LBHA 3PXGa 1IKWB 2AJ0A 4OHXA 3MECB 1QAXA 5HQLA 3LPEA 4N8NA 2WVEA 3PJXA 5CH7B 4ZN1A 2VA3A 1FJ7A 2GVZA 2KL8A 5A6BD 1U0SA 1S10A 3MTKA 4KKOA 2YWFA 3C6UB 1UVLA 3AV0A 3D4JA 1EB0A 3HXMA 1QAJA 1ZM9A 1TKZA 1FKAE 4BC9A 4JP8A 2VBXA 5D4OA 2YQ3A 1OJ4A 4R0EA 1H0HB 1QSSA 2G2OA 5I3UB 4KHPJ 3AB2B 2RHQB 4F2JC 2M0GB 2UU9F 2MC5A 1S59A 1RT5B 2IHR1 3ADIA 4A8WA 3LH2S 2PD1A 3KK2A 1UFWA 3ITHA 3QGPA 5C24B 3R7SB 3J7ZT 1KN6A 2PSZA 1HBUB 3FRYA 3M8QB 2IRUA 2UU9E 4NLSA 2HIQA 1T9YA 3D67A 3NP5A 3PTWA 1N36J 1K9MT 5LXRA 1ZAWA 4Y6IA 5IQQA 3HSDA 2LQJA 2YU8A 3MXHP 4CT9A 4AUKA 3PW2A 1KQGB 2GO8A 1FWPA 3CIZA 2OTJS 4GKKJ 4M0VA 3IAM9 4DR5J 3UWTA 1RWNB 4B3RF 1HYSB 2ZDOA 3EZUA 1QD1A 1VQ8S 4Q0BA 1F9HA 3FEXB 3HHEA 1N5VA 1D9FA 1RTHB 5AE2A 4RW8B 4EI2A 3E51A 1S1VA 4ZVRB 4NX9A 4Y2KA 3BV8A 3GFHA 2RAQA 3IWXA 3TVZA 4DR1J 4ED0A 3SFGA 4B3RE 2R7RA 2BXJA 2QGFB 2R2TA 2MDGA 1R0AA 2I5JA 4ZMMA 2OGUA 2EPUA 3MD1A 4LFBF 5CD4A 3IN5A 3HZGA 1N33F 2N7CA 2BW2A 1HW8A 4CNYA 1NH7A 5DGAA 3B78A 4DQSA 3NNAA 2QC3A 1UVKA 2NXJA 4M5MA 2DISA 2ZM6F 2ERRA 1PKPA 2MYFA 3GFZA 1IBKJ 2EN6A 4LFBE 1YK9A 3AA8A 1MROB 2VV5A 3M4XA 4X4PA 4ECVA 1N33E 1H2TZ 1JLQA 2J9EA 4ER8A 5C42A 3D7SB 2OO4A 4MK8A 3C16A 4DHVA 1O0PA 3NGDA 1H6KX 5DETA 3U02A 5CHCB 3AH6A 3P49B 3DI6A 3BSAA 2ZM6E 1N5QA 3LA0A 3LP2B 4F8RA 2YPYA 2WBRA 3Q2SC 1F0XA 1FRHA 3DLLQ 1NDLA 1TUWA 3PCOB 4W90B 3W9JA 2ZITA 2EM2A 4RW6A 4KB7A 4MLQA 2D3O1 3FIGA 3H42A 4XDDA 5M2UA 4DUYJ 2E1MA 2QL9B 4DL4A 5I3PA 3FRZA 3B82A 4DR4J 4TQRA 4DUZF 4PXBA 4NLOA 2J7UA 4NMLA 1RWVB 1RHKB 4YR0A 1C0UA 2VG5B 3KG1A 4CO1A 2OSQA 4OZNA 4BS9A 1PBUA 2J7WA 3JTOA 2EP3A 3WX4A 3CCUS 4DKKA 2JHEA 4CO0A 2W1BA 1RWWB 1U0HA 5D78A 1DBDA 1VRUA 2FHJD 2YVSA 1C1BB 5L1LA 5A69A 3ILLA 2LECA 2DNOA 4NZ6A 1L5UA 4FYWB 3CD6S 3P1XA 4DUZE 1TF6A 4C3KA 2DLQA 5G0RB 3OJSA 3HHNB 4NYOA 3H7HB 5LSRA 2OLWA 5KT3A 2XYHB 1RKJA 1HR0F 3IG1B 4C97A 3EGVA 4P7VA 3DU5A 1I94F 3C6MA 2LCEA 1EETA 1BUXA 2MZRA 1DY3A 1U4BA 1VQYA 3QG5C 4KV8B 4W92B 1VI7A 1EJ7L 2HS3A 4Q8FA 2DGUA 1LK7A 4WX9A 1HR0E 1FK9B 2ZD1B 4DV5J 4JOUA 1BQMB 5KFWA 3EPIA 1HPZA 1ICEB 4LF6F 3KWRA 4F50A 1I94E 1VC5A 4RW7A 3THNA 3OD2A 3CCVS 2I9SA 1S4FA 1VC0A 3OFGA 1RT3B 5E3CA 4ZA1A 4ZVEA 1XMOF 5B0DA 1TVRA 1B7FA 4DV3F 4LF6E 3G2XA 1TAUA 3QO9A 4DS4A 1S9FA 1VC6A 1VQ6S 1S6PB 5F8HA 2YPZA 1XN9A 2XYGB 3K59A 4C8NA 4DQIA 4WK3A 4J9NA 2Z2LA 2O01C 5BR8F 3PO5A 3KLFA 2GW8A 2ZDPA 3BBCA 1UETA 2EPMX 4N77A 1NZ8A 3ZZTA 1XMOE 1K47A 4IH6A 2EFGA 2HQIA 2YTDA 1D8ZA 4DV3E 3TA1A 4CLTA 5KL7A 4E0DA 4YY3F 4J9VA 1RHUB 2BVZA 4WFNQ 1X49A 5ETSA 5KFNA 2APOA 3GB0A 2DNLA 4P2MA 3J80U 3SXLA 3B8HA 2XO6A 1UA0A 3D6FB 2LXFA 3NG8A 4NLTA 1Y5LB 5GMDA 4YB7A 2EM9A 1NK9A 2LMZA 2ZH5A 4NLQA 2JEIA 1VDHA 4NRUA 4M30A 1X3CA 1WKKA 1CVJA 3JSMB 1JXLA 4YY3E 2RPCA 1XTZA 2R7QA 2CT1A 4IR9A 1TKTA 2VC0A 4MKBA 4G65A 2NXEA 1IQOA 5J1EA 2R4FA 3OFEA 5IT0A 5HP1B 4I69A 1OY6A 2DRPA 4QZVB 2MKCA 4F9BB 3PRVA 2MSSA 3EXCX 5C7PA 5L9XA 2MLXA 2GZOA 3LGHA 4FDFA 4DDFA 2K3KA 3W9IA 1HNXJ 1G2EA 3M6UA 3MM8A 3WIVA 4ES2A 5KAKA 3EX7B 5GAGI 3QT6A 2UUBJ 4G1IA 1UN6B 3D54A 2MQOA 3MM9A 4DR6F 5F8NA 2QA2A 2GPIA 4WFXA 2WSCC 2CPXA 2QMXA 2CJKA 3JAMC 2OHDA 2CADA 1VCTA 3IWBA 2LVHA 2G1HA 1URNA 4O0IA 2EN8A 2RSMA 5K8MA 1Q1KA 2BBEA 2JNJA 1Q8LA 1OIAA 3UN2A 1S6OA 5A8RA 4DR6E 1ZTTA 3ZTSA 4M94A 4HTGA 2XI2A 4DL2A 3GV7B 2V4JB 2A3JA 2CJXB 1VFJA 3SSRA 2AQ4A 1WOSA 1DGCA 4FPIA 1P27B 1SPBP 1I51B 2FC8A 1SVDA 4DZDA 2H54B 4CLPA 3JB9k 2CNLB 4O3OA 2AHOB 2JWOA 1TF3A 5IWAF 3F73A 5GMKa 2R7OA 5F8IA 1RLCL 2E7XA 1SBRA 3UDCA 3GYNA 4KH0B 1B70B 4OMFG 3L3CA 2CQBA 2HJJA 1Q53A 3PIPQ 2QEXS 3RB0A 3PX6A 2RS2A 5IWAE 4ITSA 2W24A 2IMOA 2DR7A 4I8OA 3SSSA 4KO0B 4CH1A 2EM6A 1RAHB 2R42A 1SC4B 2YNHB 4NOHA 4OYOA 1LQ9A 3J80Y 1ZM3A 2ASYA 3A3OB 1VQMS 1ZTWA 1MNEA 3IBCB 2HZVA 3VWSA 1IUJA 3POTA 4MYTA 4GVBA 1NSPA 2P9GA 4TKTA 2LQ5A 2YX4A 3TWZA 3RZAA 1A1HA 1U6FA 3HKZD 4LF9F 2QJ3A 4DU8A 5A0YB 3UCZP 5LJ3Y 1J27A 2FJBB 4TYBA 2OPQB 5DLFA 2ZZMA 1TN9A 2RQCA 3W66A 1T94A 2VB6A 2FLLA 2V2ZA 2E7WA 2EM8A 3CJKB 3OR2B 3QSYB 4ZPCA 1M5KC 3GE9A 3T19A 1T9TA 2EBGA 2GX8A 1R31A 4LF9E 4P74A 3PACA 4ETXA 1FF2A 4H4KC 3T3FA 3D2WA 3W7BA 1TK0A 2VU5A 4YDDB 4WTYA 2K8GA 3LP0A 1B0VA 2EK6A 3Q8VA 2VPYB 3BM7A 3I0SB 2C3YA 1EH6A 4Q35B 1VK3A 2VD3A 3V5RA 4D3HA 1SH0A 2CZVC 4J9MA 2RUSA 5DG8A 1NKBA 3N6MA 4FF1A 2DO0A 2FPHX 3BH6B 4DSLA 1RKIA 5IM0A 3ZC4A 3VYXA 1RTIA 2KDOA 4MMOA 4ERDA 2GV1A 3C6TA 2EMKA 1YRTA 5B09A 2FQQB 3Q8SB 4RHBB 1Z2LA 4G1PA 1FE4A 1A1FA 1X0PA 1B3TA 1K0TA 5KG6A 5DNYA 3RR8A 3MD3A 4EYIB 4DQPA 1OQ6A 1UVNA 4IH5A 4ZP7A 1JLGA 1AYEA 2E9TA 1WC3A 2Z2YB 2HGHA 1OPIA 1PBAA 1KLMB 5L1JA 2I0XA 2EMAA 4O3NA 3AJ2A 4I2PA 2ADRA 2LCWA 4J9UE 1F60B 4UTGA 2AEMA 1SC6A 4WPAA 2IM1A 1OY8A 4QPTA 5E7OB 1HNVB 4ZS6A 4TY9A 4Y2MA 3THTA 1HD1A 1T95A 2EM0A 4ZIVA 4RNOA 4D3GA 1CS4B 3NNCA 1RT4A 3T5KA 2MZ1A 3HHLA 4CO5A 2ZH4A 1S1WA 2JC0A 2JYAA 2KONA 2B51A 2KXFA 3MR2A 2CPFA 4J9LA 1WOPA 3HQ1A 4WU2A 4DUTA 3CD0A 2F9DA 5H9EK 2DEJA 4NYZA 2KVIA 1DTQA 4Z7YA 3V6DA 2XHCA 1X9WA 2OUGA 2YKQA 3U1MA 4R25A 4JI2J 1X7VA 3M2RA 4K7QA 4LMZA 1JK2A 1G2DC 2Z30B 1M0SA 2WVDA 1NPRA 3EE3A 1IKWA 1R27B 5IT9U 4ZVOB 4YB5A 3NOCA 1I3OB 4IKAA 3TA2A 1RADB 3K5LA 2NSBA 2FY1A 1UVMA 4P73A 4B3OB 1QVFR 3Q8RB 1RLDA 3O1LA 3H2UB 4IQXA 3V6KA 3C6UA 2SXLA 2CWXA 2B3TB 4MKYA 4DU7A 4OX9J 2EMYA 2XS2A 2KO1A 5IXMB 2R2RA 3HX9A 8AT1B 2N4CA 1VIXA 2FJVA 5I3UA 4ES1A 4I67A 1NDKA 2L8TA 5I42B 5DO2A 5I4MA 3HF5A 2N8XA 1R8HA 3QNWB 3AY0A 1K1QA 4HH1A 3L7UA 4F4WA 3NKYA 2QMWA 2QTWA 3W5YA 2HWTA 3DYAB 4JYAJ 2F40A 4DEZA 3BKFA 4ZPVR 3M8QA 5H9FJ 2NSCA 1PIEA 2BKNA 3K58A 1MN7A 2V86A 4GMKA 4XTTA 3MPDA 1NH8A 2VODA 2CPYA 2YZTA 2PI5A 1N32J 3TW0A 2HQ3A 2B56A 1S1TA 2WHOA 3G9CA 3NCRA 3CEDA 5LL6R 5FDLB 4ENOA 4ZLPA 1L3UA 2RSQA 5ETPA 4FYVB 1RTHA 3T9NA 2E5IA 1NUEA 2R7XA 4R03A 4BS2A 1VBYA 2PMHA 2J9CA 1K0VA 1TKDA 2OJ3A 1T4OA 1WACA 4FPRA 3O2IA 3NL0A 2EG2A 2ALZA 1I6JA 2RE1A 1HD0A 3JYTB 5LL6d 2V68A 5LXYA 4QJVA 4X9JA 3TR5A 2UP1A 1HBOB 2H51B 1EHWA 4HL9A 1JX4A 3EPLA 4HT5A 3LQVA 4BLGA 2HVDA 1B99A 4N7TA 2MHNA 4KFBB 4OZ1A 2VH7A 2MGZB 1TMJA 2F4VF 4F0HA 2LRSA 5DM6Q 4DV7F 4NXNJ 2MEWA 4DV1J 2V83A 4C8LA 1AAYA 1MROA 1ULRA 2YTEA 1JLFB 3JSRA 2IAJA 1J2VA 3GIRA 2E5LF 2DRDA 1SC1B 2LU1A 3MSWA 1ZOTA 3R1LA 2DCLA 2YSPA 4PG5A 3ECRA 1R0BG 1VQKS 2YWEA 1UPMB 1L3TA 2F4VE 1X5OA 4PPDA 4DV7E 2XI3A 4RW9A 3ZZOA 2H1YA 2M2BA 1S99A 2A1BA 5KG3A 2P9EA 3QZ7A 5ETQA 2E1CA 3MM7A 2CQ1A 2E5LE 4OHZA 3TYTA 3D6HB 2XG8A 3QRRA 1S77D 3LAMA 2LDYA 4N47A 1UKUA 3NGUA 3RBXA 4ES3A 2Z56B 4JI0F 1LW0A 4LRBA 1YJ7A 3KLHB 5BYSA 5GAEU 2HIYA 2R8IA 5CYMB 3ADJA 1KOOA 2OP5A 3N5BA 4TN2A 2JWNA 3KLEB 2J9DE 4GKJJ 1RA6A 3QAEA 1CJVB 4M5HA 4KE5A 1OYEA 1TL7B 2J0QD 1C1BA 5AT1B 1EH8A 4JI0E 3ENQA 2F5GA 2XB2D 2M8DB 1UEUA 1FEHA 3K2YA 4X8WA 2E44A 1R8AA 1L4SA 5E0OA 3J7AN 2ZWPA 3IG1A 4KPYA 3NBPB 3QIPB 4ZPTR 3G86A 3BPSP 4USWA 2CRLA 1F5BA 3CJ0A 3CJ3A 1DFDA 5HATA 4GZNC 3SFUA 2E29A 4OZ5A 1SKSA 2NZ4A 4ZP9A 2ZHAA 4DL6A 2CDQA 1O0WA 4OV6A 3TZXA 3BQ2A 2C2KB 4U7UK 1BY9A 1ZBTA 5IT4A 4AE5A 3IWDA 3GIMA 2EMXA 4FNHA 4DN0A 1BQMA 5L46A 1PILA 3EPHA 1OSDA 3MM6B 1VIOA 2WONB 1SXLA 1GMUA 4O0NA 4RBVA 2EL4A 4AXIA 1ZR9A 3HJVA 3VZHA 3Q0AA 3C4TA 2HG4A 3N6LA 1RT3A 4YDXA 2MY7A 1WC5A 3N28A 3DLBA 4O3PA 1YZ9A 4W98A 4UZCA 5AJ3F 3DLGB 4JI4J 1NHVA 2NZCA 2MXYA 3MMAB 4LF5J 1MMNA 1Y3KA 4CQ1A 1NDCA 1Z1BA 4RBUA 1HBMB 3NEKA 5JUMA 5A6WA 3QPIA 4KHPF 2C22A 1VQOS 5IV4A 3H5XA 4P78A 2BACA 1FRLA 4CCHA 4QWEA 3W8GA 4YB1P 3FBFA 1B0TA 1JLBB 1CJUA 1WDTA 4A8XA 1DRZA 2OEJA 4ECTA 4OI2A 2NXNA 1IKXA 5H1SV 2EKNA 4H4MB 4KHPE 1RACB 2V9WA 2CJ9A 4H4OA 3MTJA 5D3GA 3D3BJ 2V94A 3AOBA 1NDPA 2LEBA 3MAQA 1XNRJ 1V5VA 4U9RA 5BXIA 3CPWR 1ZBQA 5C25B 4IFVB 3JSMA 4GKKF 1RABB 3U7JA 5A2QC 2ZHOA 4NI2A 4V19J 4V19X 3HHKA 4UT4A 1SJ4P 1FDNA 3T9ZA 1D9AA 5LM7E 3VGVA 3FBEA 4EK2A 2DO4A 1WHVA 4I2QA 4DR1F 3H8YA 2BUNA 3K8VA 4GKKE 2W4DA 1PJSA 2BANB 1ZAAC 2XSJA 1E6VA 5DRKA 5ADZA 3MHYA 1U1MA 4Q5VA 1RGVA 3J7YI 1N56A 5A8KB 1MU2B 1VRTB 2LEAA 1YJNS 2JVRA 1IM6A 2J8SA 2X1AA 3E3XA 2IM2A 2E1MC 5C2CA 1P1LA 3PYDA 4C2MA 4DR1E 4WE1A 1OMSA 3PVXA 5CZXA 4B3SJ 1JJ4A 4F25A 1C0TA 4M9VC 3VAIA 1S57A 3UDEA 3CTRA 4YHHF 4HR2A 3GQCA 1IBKF 4HDHA 1HQEB 2ACMA 5LLQA 2YKMA 1EKZA 3I0RA 1NCSA 4AYBD 2Z8QA 2CQIA 3CF5Q 1G1XA 2YXLA 4WJBA 3H09A 1J5EJ 4Y34A 2EPIA 4CTAA 4ZCIA 1EZZB 2ATLA 2KXNB 4C9DA 4MLVA 2O3DA 1RWPB 2KM8B 2V4JA 4YHHE 1IBKE 2OMLA 2WAQD 4WXDA 2KH9A 2HHHJ 7FD1A 3BBGA 1RU1A 3VGUA 3RBEA 2XS7A 2FUG9 3IS9B 2L3JA 2XY6A 3GYXB 5THWA 1XK8A 3M8YA 1DLOB 2W7PA 3HHLD 4PR6A 4CLLA 4GVLA 4RU9A 3MCNA 2OMOA 4DUYF 4K8RA 1DQAA 2WZOA 4USVA 2C2OB 2EEYA 2A0FB 2DH8A 2LBSB 3P3DA 2QL7B 1MSWD 3BR9A 1KDNA 4DSJA 2B8PA 4LR9A 5LT5A 3MGJA 4N5SA 3JTPA 3M8PB 3TO8A 2MQPA 1KNZA 1S9EA 2GQ2A 5AXMA 4KO0A 3FFIA 3ET6A 2UVWA 4DUYE 1JXVA 3CC2S 4ED7A 2RT3A 2YNHA 2DRBA 5L9NA 3K89A 5HJXA 5L1KA 3QGGA 2QIFA 3HSJA 2BOAA 1URRA 3G96A 4ZP8A 2ZHBA 2AX0A 1T4NA 3K5NA 1F3VA 2HBZB 1D09B 2CVEA 5C5JA 2L2NA 2VPXB 1C1CB 2FHMA 2D3UA 1VS3A 2N82B 3DKDA 1H3DA 2EFQA 5A6AA 5KFMA 2OPQA 3C15B 1PSDA 3C14B 3RB4A 1CC7A 1QNTA 4IS1C 4BDPA 3GFYA 2IJRA 4DV5F 3FCWA 1RTDA 2HZAA 4USHA 1F5AA 4LFCF 3MPWA 3CDEA 1U47A 4QBUA 1TMMA 3QRPA 2V8VA 4GC6A 3JAMU 1VYAA 2MB0B 4CO4A 2GO9A 2GQQA 2CQPA 1SJ3P 3SQOP 5D4LA 1YITS 4DV5E 5FJ4A 1T39A 2YTGA 2HFOA 1A1KA 1WI6A 4LFCE 4QYRA 2MKNA 2F1FA 2BQ3A 5HN0A 4UOFA 3V4MA 3J81C 1N6QA 3LALA 2VBYA 1T03A 2GC8A 1HWKA 3MMBA 1IQSA 2O67A 1S12A 2Q3PA 1Q8IA 2GVDA 1CEZA 2MQLA 4X64J 3OXLA 2FIUA 1WDDA 1H2VZ 2FGGA 3TAPA 3CD7A 4MH8A 3S8SA 1N34J 2RF2B 1Y10A 2FB0A 3F44A 1YFHA 1N54B 2G13A 4LIRA 4NLUA 3TNVA 4URGA 2BJ9A 5HANA 2W2MP 4YEAA 1KLMA 4ECRA 1S79A 1CLFA 3O6QA 3FMWA 1Y11A 4C8ZA 3VGTA 1KVJA 5GAGU 4M5DA 2NQPA 1HNVA 1P9YA 2CG4A 2HQDA 2W2QP 2VFVA 3DNCA 2IRYA 4OX8A 3EUNA 3OBIA 1RUSA 1QJHA 2JLGA 4C0HA 2BJ7A 2YNGA 2DHXA 1CS4A 3IC1A 1UHZA 4CRJA 2HNZB 1YVFA 2E5HA 3MR3A 3KLIA 2G4BA 2RU3A 2Y8WA 4ETZA 2E1PA 3X1LB 2NUEA 2R1FA 1QSYA 4FVMA 3UFCX 4M5NA 2FLNA 1WHNA 1JLEB 1WG4A 2XULA 4NA1A 1K73T 2YKOA 2LUQA 2BZ2A 3J7Z5 3V4IB 3BZQA 4B3TJ 1DTTB 4KY3A 5HROB 3U1LA 2VC1A 4NCGA 2ZJPQ 2YKPA 5J2NA 2UUBF 1UWBA 3F0NA 1RWOB 2AIRB 5IXUA 5JJBA 2OPPB 2UUWA 4LSNB 5F0UA 4IG3A 3DCAA 1IKVA 1MEYC 2QYGA 4WK1A 1SJRA 2GIQA 4DSKA 4OJGA 2UUBE 2BMBA 2N7YA 2DMIA 4JV2A 4HH0A 2FVPA 2B4OA 2X1GA 4JI8F 2X3DA 4X4SA 2KZMA 3IR7B 4LJMA 1FEEA 2IA6A 4DFPA 4B9LA 2MQNA 2V2QA 3M32B 4BBYA 1PDAA 3JAMY 2G0JA 3CO0P 2F7VA 2DRAA 2L08A 1I5OB 3AUZA 1ACMB 2YNIA 3T1AA 3THVA 2JH3A 3L9ZA 1U24A 2ZC4A 4WZMA 3EPJA 4OHWA 2XYPB 2NPFA 4A8QA 5J1NA 2WK4A 3EGZA 3DLKA 1RHJB 3MAHA 3BN4A 3DOMB 1V6HA 3DDIA 2CQ4A 2J9DA 4LVNP 5FDLA 4LFAJ 2HKEA 2EG1A 2YNFA 2R2UA 2ZH3A 4LBPA 3DRXA 3RAXA 2NUHA 2LA6A 1JLAA 5F0WA 5DZ7A 2HMIA 2D69A 2BKPA 5F9LA 4XAKA 2VFTA 3THPA 2GGPB 3W5ZA 2ADCA 2HHTA 4O4KA 2VG6B 1ZM2A 2EFVA 4RZRA 2BE2B 1D0EA 1N3GA 3IFEA 2GAGC 4ANCA 1P47A 3H0PA 4J9PA 4DR3J 2DGXA 2I8EA 1V3RA 3MHSC 1X0FA 4F3MA 3BGRA 2VJVA 3BN7A 1X4DA 4K4SA 2ROPA 5LMUF 2DXFA 4NCBA 2D9HA 4R2CA 2AZ3A 3HD1A 1U1RA 4ID8A 1A1GA 2A10A 4KFBA 1LWCB 2HPUA 2RKIA 4WF9Q 1UVIA 2MKHA 3A3PB 3KLVA 1Y5IB 1RT7B 3TUJC 1RCOB 3TUPA 5L1IA 3CNQP 2LMIA 2DCUB 2WB4A 3G8QA 4ECXA 5LMUE 1JLFA 3M9MB 4CLZA 2DNRA 4AL5A 2ENHA 4DR2F 2ZZTA 4HACA 2EPCA 2FVRA 4PPZA 3B4DA 3OW2R 1W26A 1Q86T 4OLOA 9ATCB 2YQ0A 2XNRA 3M8RA 3VHTB 4IOAQ 4HVZA 2R7SA 3I5AA 2CPHA 2NABA 4NLGA 4RR5A 1KHWA 2QSWA 1UJ6A 3HHLC 4DR2E 3DMJB 6FDRA 2MTLA 3OTEA 2VG7A 4CNZA 1YUJA 1YJWS 1HWJA 2D74B 2MKDA 3HTXA 4DPXA 4F3OA 2HVEA 1RZMA 3NNHA 1PYTA 2JX2A 4L72B 2DGVA 1HI1A 3I9ZA 3AD7C 5CD4H 3KLHA 4J90A 2BJ8A 2EZ6A 2B4PA 3EVMA 3EZOA 4R5PB 3MFHA 4KZSA 1VQ4S 1RXOB 4WU3A 4B3MF 3H98A 1IR2A 3KLEA 4QYZK 3WHIA 1VQNS 3MCSA 1FVQA 2G1DA 4G1QB 1SL0A 4PWDB 4DV4F 4ZYDA 3NAIA 2DB2A 2HHSA 3FKBA 1U2CA 4YR3A 2IYIA 4NL5A 2EN7A 3CCMS 2DTJA 2AYEA 2LU2A 4CYUB 3QIPA 4OIXA 4RPFA 3PW0A 1A9NB 1ZPWX 4L76A 4B3ME 4K4YA 5EWEA 2VRDA 1HW9A 5EGYA 4WYQB 4FBTA 1WSRA 4DV4E 4FXDA 2L9NA 1PAEX 3OR1A 3OL6A 3FUYA 1WHXA 4PUOB 1LWEA 3UVJB 1UL3A 3GIKA 1NKEA 2CPEA 2RS8A 1XR7A 2P9CA 3BB5A 4K2XA 4NLDA 4JI2F 3EZ5A 2VONA 5T14A 3A1YG 2G7HA 4TQSA 3CIMA 3G82A 3EDRB 3UCGA 2V89A 2XO7A 3CDAA 3NS6A 5DQIA 3M7VA 2DY9A 4TVAB 2W9BA 2FVSA 3R97A 2OPRA 1HNWF 1T11A 4C8OA 5SUHA 4TUGA 4A46A 4PEOA 3BPDA 1HQUB 2G2YA 2W2OP 2LUPB 4JI2E 3DLGA 2DNGA 4HI1A 5B0GA 2Z57B 5KL4A 2DH9A 3TQ1A 4WIQA 3MI7X 2EOHA 4IG0B 3SCIE 4OX9F 3SMZA 4JI7F 4DPWA 2NR0A 2DY1A 3KHLA 2E7VA 4M5LA 7AT1B 1FXRA 1HNWE 5IV3A 1SCJB 3DRRB 3MMCA 5ETLA 3J7AG 3BGLA 1TL1B 2EPKX 2COLA 4UY85 1TP7A 2F63A 3W2VB 3AOCA 5DQGA 4OX9E 1U8WA 3VV2B 1SFEA 2HC5A 4JI7E 3ETMA 3JQJA 1SKWA 4H4MA 3GV5B 3P8BB 2IBKA 4B9UA 1B69A 1X60A 3CW2C 1NJXA 1FWLA 3H25A 1N32F 1TV6B 3PEJA 4M1KA 1VQLS 4HI2A 3M6VA 2IVFB 2B8QA 4B9VA 4Q45A 3CCLS 1FTRA 4ZK7M 2WOMB 3UD4P 2Y1IA 8ATCB 1Q16B 2EOOA 2UXCJ 2XMAA 1VISA 3BBBA 4NEZA 2HQFA 2W7AA 2KI2A 5GVQA 4LR7A 1N32E 1SIZA 4JI6J 2R76A 4L3KA 2UXDJ 1LXNA 3IR6B 2HGNA 1X9MA 3C4BA 3UK3C 1GMWA 2U1AA 4TXSA 2HK2A 3PYEA 2JDJA 2BANA 3M05A 2ZOFA 1OS5A 4B9MA 1ZYQA 1RYSA 2R7UA 3OHBA 5HQMA 3RRHA 4CH7A 2W9CB 4UOHA 2J7KA 1WG1A 1MU2A 3SDEB 1VRTA 2KHCA 2HFVA 2BJ3A 2A18A 1N48A 4CH0S 4IRDA 2PDAA 4OYBA 3EQ1A 5BYQA 4QIGA 3N01A 3QT5A 2OI2A 5KFEA 1S76D 4KRWA 3BEGB 4I6WA 2QA4G 3HD2A 3L4BC 9RUBA 5T7LA 1WTBA 4DV1F 1X4AA 3TJAA 2G0IA 1PC5A 2FC9A 4RH8A 2C2RA 5FLXC 4HTJA 2FJXA 1RTJB 4NLXA 4ZYGA 4NZVA 1H7XA 1XMQJ 4FS2A 2VQEF 3J81j 3W62A 3OTOJ 2ZVSA 2DR8A 4DV1E 3MR7A 4NMXA 3RG6A 5AC4A 4ANDA 2ASLA 1RP5A 3IS9A 1TELA 5AC5A 1A0OB 3OSNA 2NXUA 3OT9A 1NK7A 4QW9A 1Y9OA 3DOKA 5J2PA 4PXEA 2IVYA 5KFQA 1CQMA 4IDKB 2CYYA 2I6WA 1DLOA 3IRXB 2JL9A 3PYFA 1GZ6A 1UW4A 2BE9B 2VE7C 3ETOA 1IKYA 3A3NB 2FJWA 4KGXB 2QRRA 1AA1B 2VQEE 2RS6A 2M88A 4FKXA 4I68A 2FGOA 4M5KA 3OLBA 2EPAA 3ISNC 3TI0A 4J9OA 5HL7Q 3M8PA 1GXUA 1PYSB 5HI7A 3W8PA 4GKJF 3HXLA 3MM5A 1G7CB 3L7PA 1HHTP 3WC0A 1KR4A 2RJZA 2G9OA 2B6AA 3GU0A 5A2QU 1ZPVA 1FJGF 2B0GA 5K8OA 2HGLA 1NSAA 2PN6A 3QJJA 2QFIA 1PKUA 3W64A 2YT4A 5B0BA 4GKJE
chains in the Genus database with same CATH topology
1IKWA 1R27B 5KOWA 3QMQA 2UVRA 2BJDA 4PG4A 1JIHA 4DF4A 2IA0A 3ADGA 3DI6B 2ZOMA 1KTVA 3BSOA 2AYMA 1O8BA 4RWWA 4YB5A 4Q43A 2B5JA 2ASJA 4FZVA 2ZE2B 4IKAA 3TA2A 1IBME 2JZ5A 2ZH1A 1ZAXA 2RTXA 3K5LA 1JKHB 2NSBA 2FY1A 2JLEA 1UVMA 4PQUB 1FJGE 3FEZA 4B3OB 3BS9A 1QVFR 3PNIA 3Q8RB 3O1LA 2HS0A 4WYLA 2Q66A 3H2UB 3TA0A 4IQXA 3SQGB 3DM2A 3V6KA 1XC9A 5F8JA 3C6UA 1Q7LB 4CZCA 5F9NA 3OSPA 1B0PA 2SXLA 2JEGA 2B3TB 2LDIA 4X62F 2GHVC 3R5CA 4RW6B 4MKYA 3HLUA 1QAIA 4TU7A 2C2EA 5M2PA 4PUOA 5DDQC 5D4NA 3WBZA 4QWDA 2KO1A 2XS2A 2U2FA 1FDBA 3HX9A 2R2RA 1T8EA 1GNKA 2N4CA 1VIXA 2L2MA 4J37A 3GG0A 3ONQA 2FJVA 5I3UA 4ES1A 2M7SA 4I67A 4B3TF 2D9OA 2UXBF 3J80C 1Y5NB 3T5LA 1N0VC 3I4HX 4RBTA 4QWCA 2YWHA 2VFRA 1U2FA 2HZCA 2L8TA 5I42B 4LU9A 4TUGA 3H59A 5DO2A 2RILA 4GC7A 1C0UB 5I4MA 1SR9A 2MHEA 4IH7A 3HF5A 4U67Q 3M6WA 1IKXB 2KYZA 1R8HA 2IFXA 4UQGA 4ID5B 2UVVA 4KBIA 1JB0C 1K1QA 3AY0A 4HH1A 4ECYA 4HTIA 2AYBA 4F4WA 2A2DA 3H2LA 3NKYA 3FSXA 2QMWA 5BR8E 4NCAA 2H36X 2DITA 4Y3CA 4I7FB 4X62E 2K7JA 2HWTA 3DYAB 4USJC 3TVKA 4H4OB 2BM1A 2YX7A 2F40A 5D3GB 5DS7A 4DEZA 4DL0C 4DMZA 4HDGA 1VRUB 3VYYA 2CKWA 1DQ3A 1N88A 4ZPVR 1HQUA 4LF5F 3M8QA 5H9FJ 2NSCA 4B3TE 2UXBE 3GV8B 3K58A 1JJHA 2MQMA 3DLEB 2PGCA 2XGPA 1S97A 2V86A 2KJVA 4GMKA 3ZOQB 2VASA 2RRNA 3I32A 3M9OB 5AE1A 4QIVA 1NH8A 4NA3A 2VODA 4IG0A 2RIJA 2CPYA 3CD5A 4G3IA 2YZTA 3HPSA 3OV7A 4OHYA 1S7HA 2JVAA 2RUGA 2PI5A 2MDRA 4P7TA 1ZH5A 3TW0A 3HPOA 4DFMA 1YJUA 1GX6A 1XNQF 3OTDA 2HQ3A 4XK8C 2B56A 2JFKA 5IFMA 5LMNF 3MR5A 2DR9A 1S1TA 2WHOA 3MEEB 3H4DA 4NLPA 3G9CA 2IM3A 3NCRA 6FD1A 4IRKA 3CEDA 3HFKA 4DR4F 5LL6R 2LA4A 5FDLB 1DZ5A 5HO4A 2PC6A 3BJYA 3Q23A 2E9ZA 1U1KA 4YB6A 1SV5B 4ZLPA 3TX8A 4LSLA 5KTQA 4ILRA 5K8PA 2B9XA 3DRRA 5M2RA 4LF5E 2QLXA 1D9DA 2XY7A 1L3UA 5HLFB 2RSQA 3IGNA 1TL1A 1RT2A 4I2QB 1RTHA 2N3OA 2CFXA 2E5IA 4NLWA 3T9NA 2RS7A 4LUBA 1OWXA 2XHWA 2UUCF 4LF4F 2R7XA 1HNIA 1FO1A 2V8GA 4R03A 2HNYA 4BS2A 2NUFA 4N56A 2DVIA 5L8RC 2PMHA 1VBYA 3M30A 2EWHA 3W2WA 4QIFA 2J9CA 2XSJB 1Y3JA 1E6VB 1K0VA 1XNQE 1TKDA 4ZKAA 4UY8T 5LMNE 2WB1D 3DJWA 4K4TA 1SL1A 2OJ3A 2LTRA 2L3MA 1N5YA 1T4OA 5GAHI 4URQU 2QZ8A 2W25A 1WACA 3D5MA 1Z1ZA 3O2IA 4FPRA 4JBCA 3RW6A 2DGSA 2QYCA 4DR4E 1V3SA 2MY8A 1FT8A 2HVZA 1HI0P 3NL0A 2HGMA 1JLCA 2ZUGA 4O4GA 3DDNA 2EG2A 2ALZA 2YH1A 4MK7A 2KRRA 2C3PA 3RR7A 4RW7B 3PY8A 4OL8A 4RKUC 4EU0A 4J9SA 1TV6A 4JV1A 1YRUA 1I6JA 3FQKA 2RE1A 1HD0A 2DNPA 2C28A 3JYTB 5LL6d 5LXYA 2ODRD 1WF0A 2N3HA 1TUVA 4QJVA 2VL1A 4P6QA 1LV5A 4LF4E 4WE1B 1KTQA 5D6GA 1U25A 3TAQA 3TR5A 2UP1A 1C0TB 2BYCA 1HBOB 2Q6BA 2KXHA 4HL9A 1JX4A 5A0YA 4TY8B 5HMZA 4HT5A 1YG0A 5EWFA 2HNDA 3QJLA 3LQVA 4X84A 2ROEA 1U1OA 1NB7A 2KKHA 1N5TA 3LAKA 4K59A 2PE8A 1VBZA 2MHNA 4ED5A 2DMYA 4KFBB 4DL5A 2KFZA 1SJ1A 2M3DA 4OI6A 3V81B 4KAIA 3FQLA 4F2SA 2YKMB 4OZ1A 2VH7A 3I0RB 4PG6A 1JNZB 2MZQA 1NNDA 2MGZB 5E3QA 5KFCA 2F4VF 3S6EA 3TAMB 3LWLA 1JLEA 2LRSA 5DM6Q 3FVYA 4DV7F 2HRYA 3KNAA 1X4HA 4DSIA 1U6ZA 4FNIA 4F2RA 1Y7PA 5F3ZA 2V83A 1WF1A 3CJKA 3BF4A 2DIXA 3OR2A 3PFEA 4OJ3A 3KLFB 2QV6A 4C8LA 4JI5F 1MROA 1ULRA 1KRPA 3S01A 4UUXA 3V4IA 2XS5A 1JLFB 4DR3F 3IWLA 3JSRA 4CTAB 1DTTA 2IAJA 5J2QB 1J2VA 3RW7A 4B17A 2JSXA 3G4SS 3RBDA 2E5LF 4U7CA 3I56S 2LU1A 2I38A 4F02A 1APSA 3MSWA 1ZOTA 3R1LA 4F4ZA 5D4PA 3M1VA 4FBUA 4RU2A 3BDEA 3KOAA 2DCLA 1YJTA 1SUQA 2DHSA 1S1XA 3CCJS 2K2PA 1VQSA 2OPSB 4PG5A 3TP2A 4L6V3 1HWUA 1VQKS 2IC3A 2W9CA 2MSTA 1DQ8A 3QLHA 4PKDB 2YWEA 5JXSA 2MZTA 3MURP 3I0SA 4ECUA 5CCLA 1L3TA 2RQ4A 3KK1A 1XBWA 1TK8A 2F4VE 1U7LA 5KFAA 1X5OA 5KG4A 4ED2A 3DLJA 4PPDA 1YI2S 2OH2A 3GFXA 3PFOA 4DV7E 2ROGA 2XI3A 5A8WB 1RT1B 3UPFA 3FMBA 4RW9A 2OPPA 3SV3A 2XWXA 3ZZOA 1Q81T 1AUDA 3OUYB 4JI5E 4RUHA 1GTEA 2M2BA 1S99A 2GFFA 2A1BA 2YKNB 4LSNA 4LQ9A 2P9EA 3FCHA 3MOZA 5KG3A 3J7A1 4DR3E 5DQHA 3QZ7A 3H5SA 4A8FA 2E1CA 1UJ4A 3MM7A 3P96A 2CQ1A 4HKQA 2E5LE 2X51A 3LP1B 4OHZA 3TYTA 3Q24A 3AJ1A 2ZZNA 3SEOA 3KHRA 2XG8A 2ZH8A 3Q8QB 2AX1A 1S77D 3LAMA 3UW1A 3AHPA 3RRGA 2LDYA 4N47A 1HWIA 1UKUA 1J5EF 4ECWA 2F8MA 2CQCA 2FV4B