1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
molecule keywords Peptide chain release factor 1
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
2B7VA 4LF6E 1IBME 3ADIA 2LJHA 1HNWE 4WYQB 1IBKE 1IBLE 1WHQA 2L3CA 1X47A 1XMOE 4NXME 2RS7A 4DUYE 4LFBE 5IWAE 4JV5E 2LUPB 1I94E 4DUZE 2LTRA 2UUBE 1YYKA 3T1HE 1FJGE 1T4LB 2LRSA 1XMQE 4GKJE 1O0WA 1RQ0A 2DB2A 2DMYA 1N32E 4DKKA 1GQEA 1EKZA 2NUEA 3OTOE 1YYWA 2JY9A 4JI6E 1XNRE 5BR8E 2F4VE 1T4OA 3VYYA 4LFAE 2NUFA 1ZBTA 4LF9E 4DV5E 4DV1E 2HHHE 4YHHE 4LF5E 1N33E 2UU9E 4DR2E 4KHPE 2L2MA 4NXNE 2B7TA 1PKPA 1WHNA 1X49A 3HTXA 4M30A 4DR5E 4GKKE 4DR4E 4X64E 2UXDE 2CPNA 3P1XA 1N36E 1YZ9A 2LUQA 4DR6E 2VQFE 1YYOA 2EZ6A 1STUA 4JI0E 3C4TA 5LMNE 2DIXA 1J26A 4X66E 4JI5E 2UUCE 3VYXA 4YY3E 2KHXA 2LBSB 2RSMA 4LF4E 1UHZA 4JI7E 1X48A 1FKAE 4DR7E 2YT4A 4JI3E 1XNQE 4LF7E 1T4NA 3LLHA 1HNZE 1HR0E 3ADJA 3C4BA 4DV6E 4DV2E 5CFFE 4B3TE 4AQYE 4X65E 3ADGA 2NUGA 4K0KE 2B3TB 4DV7E 2JVAA 1QU6A 2IHR1 3J7Yp 4OX9E 4JI4E 3ADLA 4X62E 2N3HA 3T1YE 2UXCE 4WFTA 2RTXA 2NA2A 4M2ZA 4B3RE 1DI2A 4DR3E 4X8WA 5LMUE 4JI1E 4LF8E 4DV0E 2L33A 2UUAE 4B3ME 2N3GA 2ZM6E 2VQEE 1UILA 2L3JA 2E5LE 4OOGC 2L2NA 4LFCE 4JI8E 2LTSA 1J5EE 4DV3E 4DR1E 1RC7A 4JI2E 2UXBE 1HNXE 2MDRA 4JYAE 2L2KB 4DV4E 4B3SE 2RS6A 1N34E
chains in the Genus database with same CATH superfamily
3HVWA 4V19J 4Y3CA 2R42A 1M90T 1IBMJ 2DEIA 2HS0A 4K4YA 2AGQA 4P10A 1SC3B 2ZFHA 3M2UB 1N32J 3EGZA 1KFDA 2XYPB 3CJ5A 3I5AA 1HNVA 4XTTA 4DL0C 2CJKA 2B4UA 1A9NB 2GVDA 1NUEA 3GWCA 2GGPA 3BM7A 4CT8A 2B7TA 1TF6A 1EX8A 1V3SA 1FVQA 3M1VB 3MTKA 2BKOA 2IMWP 4JB8B 4TUGA 5HATA 4ETXA 4M5DB 2WRMA 4M9VC 2Z2ZA 2AIRB 1BLUA 1HR0J 3QT6A 5J2MA 1N56A 2ZH7A 2VA2A 1X4BA 2V89A 4CLWA 3FBCA 3TVZA 2Z2MA 1T03B 2Y8WA 2BRLA 1YJ9S 1BC6A 3DRPA 2B5JA 2F65A 3TR5A 5H9EJ 2VFVA 4W4MA 2Z2YB 4UZBA 4ILLA 2XBPA 2MQLA 2NXNA 2YTIA 3IR5B 1PJSA 2X1GA 4GKJJ 3RG6A 5KL6A 3MM7A 3VTIA 1K8AT 3N4WA 4HR2A 2P9GA 1M5KC 3I96A 2J6TA 4QOTA 5IXMB 2X7IA 5I3UB 3TANA 3CJRA 3FEZA 3H2UB 3P6YC 4DV1J 3M30A 4NXNJ 2GIRA 4C8ZA 3VAHA 1YJTA 3HJVA 1HBUB 2YKQA 2M9KA 1S0OA 4F54A 4KAIA 2B5JB 4YY3E 1XNRF 4EU0A 1C4CA 2B8QA 2EN4A 2P2CB 4I6AA 1YG0A 3ADJA 3TI0A 4I4BA 3SQGB 3PY8A 2HMIA 3CULA 4ZA1A 4KSEB 3LGNA 3ZZPA 2C2RA 4F4XA 4B9UA 1T39A 4EK2A 1JXLA 4ED1A 1HNXE 3EZOA 2J0QD 4GEQB 1IQTA 2D41A 2JPAA 5KOWA 2LVHA 2N7YA 3C16A 3BKTA 2FVRA 2YSOA 4DF8A 2DH7A 4M5GA 3QRPA 1Q95G 3CWJA 4RUAA 2L9DA 2ZBRA 4U7UD 4ZKAA 2C2ZB 4AUKA 2LRSA 1SL2A 2ROEA 2B4PA 4ELTA 2MQQA 1RBOB 3LP0B 4JI4F 4WPAA 2BJEA 2XGQA 3EGVA 1VFJA 1S9FA 2ZVSA 5LSRA 2E5HA 2EE8A 4LF5J 2YTEA 4K5SA 3H40A 1W26A 3VGTA 2MSSA 2B9XA 3MR7A 3MMJA 3KLVA 1RAAB 2Z2LA 2IYGA 4I6WA 2AW0A 2GHFA 3TZYA 4JI3E 3RR8A 4NLGA 4JUZA 3AB4B 1HNZJ 4UZCA 3AFGA 2J0XA 1Q0NA 4ZOSA 4ZP8A 4DV7J 3OL8A 3CB4A 2Y8YA 1LNQA 2WBTA 1CJVA 4CT9A 3TW0A 4Y2CA 2HS3A 5LXYA 1KJKA 3EVWA 4QZVB 2UXBE 1CBKA 2DH9A 2YSPA 4DQIA 2CKWA 4OHVA 1P1TA 2CQCA 2VRDA 3H25A 2EL4A 2OFGX 3O8WA 3EPLA 4EZ6A 1KQKA 2MEWA 3CJ0A 4DQSA 4TQSA 3R6LB 5ETTA 2G0IA 4NZ0A 2W9BA 4NI2B 2E1AA 2WAQD 3CT9A 2MQPA 2HHQA 5M2RA 1RTDB 2H1YA 2M7SA 1Y5NB 2W7PA 4X4UA 3P96A 3PTWA 3FMBA 2BQ3A 2LXFA 4ZYDA 5J1EB 2HGNA 1ICEB 3D1HA 4MFBA 4CNZA 4OI1A 1FK9B 2HHTA 1ZU1A 1U2RA 3B4DA 4OX9F 3PCOB 2R7WA 1NDPA 2AYBA 4FXVA 4TUIA 2D3OR 5A6BD 2V5HG 1D0EA 1TU0B 4RW9A 3TZWA 5E7OB 2XYHB 2Q1LA 3GPAA 4A47A 3P45B 4JP8A 4G3IA 3DLGB 3BBCA 3A1YG 4GKJE 1U47A 3R9LA 1K0VA 4ZP9A 1HI1A 5DDOC 3QZ8A 1RYRA 1TVRB 3ONQA 4N5SA 1VQMS 4WE1B 2XWXA 1QAJA 2K1RB 2CPIA 4YN3B 5JUMA 1KTQA 1GK8A 3D6FB 4R5PB 5K8OA 2DNOA 3K0JA 1UVLA 2JEGA 2AEFA 1Y10A 1IKYA 2K06A 4QIWD 4J90A 3VAGA 2Y3YA 2Z8QA 2ASYA 4ZVRB 1H0HB 2EPIA 2VC0A 2JYAA 4GVBA 1FD2A 5JJBA 2ADCA 3VVTA 4A46A 1SCJB 1TVRA 3CJ4A 4U8YA 3HXLA 3U7JA 1JNZB 2N8XA 2RU9A 2ZEJA 4XPCA 2IC3B 4LFBJ 5B0FA 2L3CA 1U25A 1IBLJ 1C0UB 4FXWA 3BQ2A 2IA6A 2YRKA 8RUCA 2LXIA 2R7OA 1HBNA 1FRMA 2YZTA 4ED8A 4K4UA 4YHHJ 1UWBB 5L1IA 3IG1A 1FA0A 4X64F 2HFSA 3MI7X 5ETVA 1NZ8A 2D3O1 3CW2C 4W92B 1QSSA 2YNHA 4DR4J 1QDUB 3IRXB 1X6HA 3FBFA 4BWMA 2W2PP 1YZ6A 3W2WB 1XNQJ 3PIOQ 2XI2A 4UOHA 1UVJA 1WDDA 3CDWA 1OIAA 3GIRA 3L7UA 2MKDA 1WEXA 1WSVA 4UY8T 3KXDA 3GCXP 1X8DA 2PMZD 3A8IA 1SIWB 2V0NA 3FZ2A 3IO1A 2BX6A 3Q2SC 2KRRA 3NG8A 2XMJA 1KP6A 4WSGA 4FBUA 1RAGB 2ZBQA 1DY3A 3R97A 4E0DA 2EMIA 3O2IA 4RW8B 3U1LA 2IAJB 4AL5A 2H48B 4KGMA 3KMSA 5ETMA 1H72C 2HVZA 4F67A 2MLYA 3O5TB 1VR6A 3QJJA 2V8GA 3U02A 2LEAA 4OZJA 3MEEB 2VG5A 3M32B 3C66A 2JEFA 2E5IA 2EN8A 2CPNA 2LEBA 5E3RA 3M8RA 2HBQB 3AA9A 1RKIA 3FK4A 3NKYA 4L72B 2EPKX 4B9TA 3RU0A 1D8YA 2RB7A 4AFFA 1KVKA 2E72A 1FKAE 1AAYA 2OPRB 4MK9A 3R5GA 2EFVA 2D3UA 1B69A 3J7ZT 1XEZA 4ENOA 5CZVA 2R7VA 4DV3F 2LDIA 2PI4A 4LMZA 3EPJA 1IR1A 2R4FA 3M05A 4DR6F 4YDXA 4X9JA 2EN6A 4PG6A 3VGVA 3VAFA 3V81B 1DI2A 4R8UA 3ICLA 5HL7Q 4R2QA 1NU4A 1LWFB 1MLAA 5GAGU 1Y4ZB 4DCJB 4A8SA 2CA9A 1RC7A 1RT6B 3DGPA 5GAGI 4F36A 4DN0A 3RB3A 3TVYA 2J0SD 1U1KA 1JK9B 1ZM9A 2WBMA 3GCWP 3HXMA 2BQRA 1HNIA 4DX6A 1HQUA 1SL0A 5J2NB 3J80C 4HI2A 5KFPA 2RF2A 5CYMB 2GJIA 2YWHA 1YSJA 4H4KA 2DB2A 3PYFA 3MOZA 5DQGA 1N48A 3NOGA 1NSPA 3MD3A 1X60A 1RT5A 4DPYA 1KHVA 1SH2A 4KC5A 3KLFA 3LPYA 4DN9A 3FSXA 3NBPA 4DS5A 2W7AA 5HBMA 3US5A 4YEAA 5FLXC 5CD4A 4DPXA 2MLZA 1YJRA 1EARA 3LH2S 1KVIA 3LGHA 2L48A 2CQPA 3JTZA 2OH2A 2VE7C 2EOHA 4DPUA 1Q86T 4J9OA 4IO9Q 1LWCB 2CJBA 1VLOA 3J7Yp 1HBOA 1VOMA 2E5JA 2F8MA 3MEGB 4IKAA 2GJ2A 4K4TA 2RHQB 4OHYA 4HEIA 1A1GA 1VQ7S 1T9YA 2A25A 1HW8A 3UK3C 3IS9A 3FRYA 3GE9A 3FCHA 2DGUA 4JI2E 3GV8B 3VF0B 2VDIA 2ZDOA 3TOQA 4DWIA 1M5PC 3IWBA 1TELA 4OYPA 4QR0A 3VV2B 2J76E 1IM6A 4LFBE 4TU9A 3MR6A 3VVUA 1FRJA 3P8BB 2BBEA 1Q7LB 4LVNP 1HNZF 2N4DA 4PEOA 4R0EA 3DDNA 3HVAA 4DU7A 1KTVA 2ZHBA 1IQZA 1RT2A 1Z1ZA 2AYEA 2RS2A 1PGZA 1NJXA 1HQUB 2DGOA 4U67Q 3D6TB 1N36F 4M5HA 1JK2A 1UBDC 2ZH3A 1NK5A 5H9FJ 4LSNA 2E1RA 5CQGA 2HSEB 1XIQA 5F9NA 1LLMC 2QN6B 5I3UA 3CDUA 2CVEA 4LREA 1TMMA 4IJDA 3TAQA 2QMWA 2DRPA 2GCFA 3MR3A 1I51B 3MEDA 4RW7A 1FEEA 2DCLA 5A6KA 3A3PB 4DU8A 3RB6A 5E3PA 1R31A 4NXMF 2JEIA 1GEHA 4CNYA 3QQCD 5A2QC 2AJ2A 1RTDA 4HI1A 5HAOA 1KRPA 3H2VE 4Q2MA 1S57A 3VAJA 3WQPA 4DUZE 1S9GA 1VJQA 5J1EA 3UD5A 2AHOB 2DR8A 3Q8YA 4OYAA 2DMYA 1U49A 3W5YA 2EQ0A 3OTOE 2RQLA 3MZIA 4M94A 5HANA 2GO8A 2MKSA 5KG5A 1XNRJ 2YNIA 4N8OA 3GMGA 4UOCA 1UETA 4CLZA 4ZVFA 3IN5A 2C42A 2FVSA 2K7JA 1WC4A 1M1KT 2VQFJ 4C0HA 2G2ZA 2QG9B 1YUJA 2KFNA 2BJ9A 2J9DE 1T95A 1SKWA 4N76A 1Q16B 3T5LA 2FZCB 3G71S 3KJVB 5CFFE 2FGOA 2CPEA 3N28A 1N8RT 4LR9A 2RE1A 4RW4B 4KPYA 1HHQA 1UCNA 2QIFA 1SJFA 4B9SA 1F9HA 1HL6A 3HO1A 1FKOA 4FF1A 4WFTA 2COLA 5KG3A 1CC7A 5KFRA 4O4GB 3R6GB 1NH7A 3QZ7A 4DL2A 1N33F 2ODRC 4MT1A 2DHAA 2M4IA 3B78A 5KFWA 4DR4F 1JK1A 1IBKJ 3M30B 5AC5A 4YP3A 4ANEA 1IM4A 4LSLB 2E44A 5IWAJ 1AUDA 2JXPA 4RW6B 1MMLA 1HD0A 2V87A 1ZTTA 2JSXA 1FJGJ 5I42B 2DHXA 1ZYQA 4MTPA 3A3OB 2ZOFA 4BHBA 1RLDA 1U2FA 1IUJA 1S6OA 3UD4P 1UEKA 2QFIA 1Q5YA 4KFBB 2JOXA 3W64A 3UPFA 2XO7A 1YBAA 4RWXA 2HMIB 4LRAA 3HVRA 1DGCA 2CUYA 1AW0A 3DLLQ 3IGVA 4K8RA 2UUCJ 3SZ2A 2IC3A 1IWAA 1OY9A 1Y0HA 3PJ9A 2XM3A 2L9NA 5H9FK 1U1RA 1KS2A 4J7CA 2HVEA 2CSHA 4Q7AA 4K0KJ 2J5AA 4I2QB 5HJXA 2CJAA 4RO0A 2V8VA 1PC4A 1JLFA 4DSIA 5BR8F 2IMOA 1REGX 1KFSA 1NXIA 1CJUB 1S9EB 3MUTP 2XY6A 2YKNB 3I56S 2N7CA 2LMZA 3IRXA 3PRDA 4OI2A 3CDEA 3GG1A 5IZHA 1N34J 2JLEA 1JWWA 4DL5A 2O1PA 3OR2A 1HNXJ 2EMLA 4LF6E 4TNOA 2BJ8A 2GHWA 1FE4A 1ZH5A 4MKVA 3CEDA 4K4XA 2C2DA 2KXHA 1FRLA 1JNRB 2AJ0A 1ZAXA 4F25A 3UCZP 3KNGA 4OZ0A 2BKNA 1I94J 2GMLA 4PCQA 3TAMA 2CPFA 4C9DA 4O3PA 1F1BB 3TZZA 4DUYF 3W3SA 4O24A 2PMWA 4ES2A 2HZCA 3DLBA 4D3HA 2R2SA 1UJ4A 2OPQB 3DOKA 3MSWA 1B0PA 2YTPA 2AGPA 3KDOA 5B0BA 1NLKL 3BQ1A 3PX6A 4HH0A 4WP3A 4WCEQ 3GQCA 2LXUA 2ZOGA 3JU0A 4MLQA 1KDNA 5K5MA 7FD1A 2Q43A 2I2YA 4YB1P 1QLNA 3OTBA 4HT7A 2NQPA 1QSLA 1ZR9A 2XGPA 4NHRA 3K59A 1VC5A 3HD1A 4KGZB 1XMOJ 2PA3A 4J9QA 5HVFA 4ES3A 1PAUB 2EFOA 5C2GA 3QIPA 3HM9A 2WVFA 2K7KA 5DS7A 1IXKA 1N32E 1RE1B 4EBEA 2HHWA 4Y2MA 4DFPA 2AD9A 3HT0A 3DRRA 4KHPJ 4OJ1A 3LMLA 4GC7A 3MMCB 5GAEI 2OPPA 2GS8A 3N5BA 4OYXA 2DHGA 3A12A 1S6QA 4K4VA 1IWGA 2EOMA 3S1TA 1WG5A 1YK9A 3MTJA 1DLOB 3EVOA 2M52A 2G2YA 3SBMA 1SKSA 1FRIA 3AT1B 1RU2A 3CCUS 1KYQA 1HNVB 1KEKA 1KKHA 4NCGB 1FDDA 3Q8VA 3BV8A 2EOQA 2DVIA 2UXCJ 1U1PA 2UU9F 4BC9A 5LJ5Y 3FFIB 4IG3A 2ZM6F 4QYZK 2FHKA 4MLVA 2BJDA 3M2VB 2V9KA 3I31A 1RCXB 4LF5F 3OFEA 4L3NA 3KOAA 2RUSA 1CC8A 4OHZA 4ZYEA 1FERA 1S7IA 4H4MB 3NAHA 4ECQA 5BR8E 1EKRA 2GAGC 1OS5A 4JI5F 5DG8A 4O3NA 4RW8A 2UXDF 4OL8A 1GTKA 3K5OA 1FNOA 4KZSA 3SCKE 1YBTA 1YGYA 2K2PA 2DITA 4FYXB 3N6LA 3P5TL 5I3PA 1T11A 2RMLA 3M9MB 1Q79A 2GIQA 2EMGA 3MWBA 3N5FA 3BN4A 2VF3A 5A69A 1B7FA 1NO8A 2GAHC 2BE2B 4UF4A 3I32A 3D0IE 3ILJA 3H98A 4ZVPB 5CD4H 2YU5A 4Z37A 2CPYA 4DG1A 3NMAA 3G87A 3GJSB 2JJ4D 1ITPA 4DV1F 2ZC3A 4P7VA 2YTGA 2BW2A 1S97A 4QBUA 2EPAA 3MECB 1V6HA 3E01A 4JI6F 4FK5C 3R5AA 4HACA 2NUHA 1RI7A 5J1PA 1SJ4P 2CWXA 4LUBA 4ZHRB 1SFEA 1GT8A 4WK3A 4DR2E 5D78A 4C3KA 4RZRA 4CO0A 1BE4A 1FK9A 2LQ8A 3BGHA 1TN9A 1EP4B 3E3XA 2JOBA 3LWLA 3PACA 1PYTA 3KTQA 4QW9A 1TR0A 1LOUA 1PYOB 1V3RA 4LT6A 1FX2A 3NNAA 2DRBA 1R7IA 2KJWA 3P3DA 1D09B 3LLHA 1FESA 1BBOA 2RVJA 3KLFB 4ICLB 4ZCLA 2EG1A 2CPZA 1S72S 3MPWA 3ADAC 1N5YA 2FGCA 4M2ZA 2R7SA 2YU8A 1JLGA 3TEHB 3CD7A 2QV6A 2YTNA 3SXLA 2E5LE 2DK2A 2Y0SD 3IM8A 2AX1A 2J7UA 4NL5A 2VIHA 5IV3A 4CWBA 3DRSA 2Q8UA 5IV8B 3EGNA 2DIUA 4NXME 1HBMA 3Q89A 4NMXA 2D9PA 3WC2A 1RQ0A 1AA1B 4B3SF 1X0FA 1UA0A 1WF0A 2HC5A 3RBZA 4JV5F 4DV5F 1FXDA 1CJVB 1N5YB 5J2PB 2FTXB 4QW8A 2AP6A 4KHPE 4DR5J 1N33J 3JTOA 2EMCA 5J2MB 4I2PA 3J80Y 2RT3A 1U02A 1GMWA 1UTAA 2BANA 3THVA 3G6YA 1G4CA 3R1LA 2P5VA 2EMWA 3PYGA 3W60A 3N79A 2KDOA 2XMTA 4AL6A 4ED3A 3O6QA 3QNWB 5HP1A 4ZPDA 5K8PA 1UFKA 4ECSA 1KD1T 5ETLA 1WKKA 1EH7A 4OYOA 4I1TA 4NZ6A 2AU0A 3L7OA 4IFYA 4CZCA 2DTJA 4IOAQ 1DTQA 3H4DA 2XLIA 5LSOA 1PJQA 1HWKA 2MDRA 3GFYA 1RHMB 4I2PB 4DR1J 4IH7A 5LL6d 3PRVA 1TFWA 3NBPB 4TYAA 1UVNA 2PMHA 2H5EA 3N6MA 5E3QA 2PC6A 3T1HE 2MYFA 5AE2A 1GXTA 3ENAA 2LE2A 2EOJA 1S48A 3LAMA 1TP7A 1FNMA 2BZ2A 3D7SB 4DXLA 1G6BA 1HPZA 4X4OA 2LT7A 1TUWA 4R2RA 3SCIE 1F6TA 5HO4A 1KOHA 3BBFA 1ZM3A 4I6YA 1S77D 4RU2A 4KY3A 1RHUB 3CD6S 1UW9A 3GJQB 2DNGA 2MQOA 2AJQA 5D3GB 1N0UA 4Q0BB 1RAEB 4DV6J 5IM0A 3HFZB 5A6WA 1DTTB 1UFLA 2F8HA 2MKNA 2E66A 3T6JA 2UVUA 2FHJA 4ZPBA 2ODRD 3VWSA 4DV0E 2U1AA 4LQ3A 2Y0BB 1RA7A 4RLEA 4OOGC 4YR3A 4CH7A 4DV0F 2BYCA 3PJXA 4URGA 1OO0B 1HQEB 2E29A 3PR5B 1FFGB 3TQMA 1I5OB 1ACMB 4W98A 1HWUA 2R7XA 2H36X 4TQRA 2LTRA 1YYKA 2RH3A 2AX0A 3H09A 5D4PA 5KT7A 1EKZA 1FWPA 1TFYA 1N54B 5IM0B 3RAMA 4HTIA 4J9SA 4Y2KA 2IRYA 2AWZA 3HCXA 3V81A 3NS6A 2ZVIA 5E5NA 4PWUA 4PAAA 5KG7A 4RW7B 1VHIA 2LUQA 2EZ6A 3NGSA 2FJWA 1U1MA 5LJ3Y 4M5LA 1OJ4A 2WOMA 1C1BA 1Y3KA 3Q86A 4QIVA 2C3PA 2HLUA 3I5BA 3DOMB 2HBYB 3W9HA 4X62J 2FHJD 4RPFA 2A0FB 2CZ9A 3EE3A 3EUNA 5KL3A 3JTPA 2QA1A 4WIIA 2C3YA 3MPYA 4B3OB 4DV7F 5HBMB 1RAIB 1T9VA 3AH6A 4L3KA 2JOQA 1WHVA 4PWWA 3MMAA 1EAYC 2YKMB 4B9LA 3CO9A 1OQ3A 1MEYC 3D0HE 1UAWA 4LVOP 3KK2A 2DHSA 1QTNB 3J7A1 4WXCA 2FHMA 2Z0GA 2ZE2A 1Q4RA 3C8YA 4P71A 4GMKA 1FRXA 3EDRB 5IOLA 1T05A 1YQHA 3KHRA 1JIHA 1FKOB 3QGGA 1RWPB 3T1HF 4DF4A 1QVFR 4ID5B 4DR6J 2GW8A 4QWCA 2M5YA 3M2UA 4CLLA 5E33A 2GLIA 4N7TA 3L4BC 4URQU 2LV2A 5D0EA 4X65E 4ED0A 2KZMA 2JWNA 4CM2A 1VYAA 2ZBPA 4AE5A 5AC4A 4I7FA 2W2NP 5CXTA 2ZWOA 2C2MB 1E6YA 4QWAA 2J6SA 2RRAA 1JJCB 3THPA 1XTZA 3M1VA 2MHNA 5D0RA 2VQEJ 4GVLA 2NUUG 2Z58B 4C48A 2MZTA 3M9OB 4KFBA 1ZETA 2EFNA 2MZ1A 2CPHA 1QUPA 2BA9A 4UW2A 1SJQA 1FKPA 4WWSA 2UUBJ 2GX8A 2XMWA 1R43A 2WVDA 1RT3A 2YXLA 1WEZA 1VQKS 3ISNC 1ZZFA 3R7SB 4KB7A 4FYVB 3BIDA 3K6QA 3SFUA 2CQGA 1UMJA 1AXQA 5KFJA 3MMAB 2UXDJ 3DGPB 3T19A 4M8LA 4DR4E 3P1XA 5AJ3J 1CULB 2V8HA 4JI5J 1RDRA 1U7LA 1LW0A 2WCXA 2NXEA 4X66J 3RRKA 5CYMA 3DN9A 3BQ0A 2DO0A 4EYHB 5HLFA 2AJ4A 1ZA1B 3OR2B 2E1MA 2HS4A 3HHEA 3M6WA 1K1QA 3HDSA 1MU2B 2KT5A 2RTXA 2HJJA 1BQNA 1CJTA 3TX0A 2R3VA 3WX4A 5CCMA 4B3MF 4CO4A 1QD1A 4JI8E 2OIHA 4F4KA 5EN1A 2AZ1A 1UEUA 4MIBA 1JLAA 2HHVA 1FJEB 3EJMA 5F41A 4R2PA 1LWCA 3DGVA 2UVRA 4C8KA 4O44A 4KGXB 5IC6B 4IG3B 1A6LA 4LF9J 3CCSS 4DR2F 1RAOA 1VRUA 4QPTA 3SIPB 1U26A 1J2VA 2JVRA 3N01A 1P47A 4ZVOB 4ZLLA 2HAFA 3I87A 1FKPB 1FVSA 4LF2A 4OLPA 3E51A 5CH7B 1CQNA 4Y28C 3WIVA 4CLYA 1IBMF 3HPZA 5G0RA 3B8HA 4C8YA 4KYZA 2CQBA 4KRWA 2JVAA 4TLQA 1XK8A 3RRGA 2IAJA 1WF2A 3SQOP 1FWKA 5HQMA 1QE1A 1T02A 3WBZA 1S49A 3KG1A 1ZPWX 1RWOB 2RIJA 3PW2A 2NPFA 3J81U 4AXJA 1Y5LB 4DR3J 1X5OA 1LK7A 2EWLA 2RQKA 1JJHA 4NE9C 2VOOA 1F5AA 5KFGA 4LFCE 2GZOA 3VHQA 1B0VA 3JYTA 4EO6A 3MURP 4H54A 4A8QA 1AFIA 1TL3A 3F6GA 3MMBB 1S6QB 1F5CA 1YX2A 1RP5A 3FSYA 3CGIA 5AXMA 3PFEA 4ZP6A 4NX9A 1JLCB 2KT2A 2BJ1A 2HGHA 4P72A 3POTB 4J8ZA 1FXLA 3EPKA 3C6MA 3K2YA 3FCWA 3CCES 1NJWA 2YKPA 3PKYA 1XR5A 4M5MA 1LWEB 1MGTA 1NK8A 2VC1A 2E9ZA 2E7VA 2AYMA 2J7WA 5GMKa 1VJWA 2ABYA 2OP5A 1RT4B 1EETA 1T4NA 4ANDA 3DLHA 4TU7A 1VRUB 4DUZF 5KFXA 2MC5A 4Y00A 1RYSA 1RHKB 1VQ6S 3BBBA 3MM9A 1Q53A 3O3LA 1JLCA 4ZPCA 4DSKA 2CG4A 2RUGA 3HPSA 1LWXA 2AZ3A 5A6AA 3SYZA 5J2QB 2I8EA 2AV5A 2XZWA 3S6EA 1WC3A 3SMZA 3MHSC 3VZIA 3C46A 3TJ8A 3NGDA 3OFGA 3MHYA 1RWUA 5GAEU 1F2IG 2W25A 4ZDNA 4NLYA 4YQWA 4Q0BA 3W9JA 5HMXA 1KVJA 2J0WA 1X3CA 3GV7B 1WKLA 2IBKA 3M6XA 5HMWA 1X5PA 1UVMA 2HHHE 1CS4B 5KT4A 2Z57B 1IKVB 2ZITA 2Y1LB 3AQOA 2GPIA 4KBIA 1IR0A 3K17A 5C24B 4M30A 2QLBB 4OI4A 4FF4A 4ZPWR 2KTQA 3JSBA 5EUHA 1UPMB 2DIXA 2MKKA 4ATNA 3DI6B 3OVSA 3QRQA 3DLGA 5EWEA 1XNQF 2W8KA 2OSRA 4L8NA 1FJGF 1RWXB 4LF7J 1TK0A 3A8EA 2F8BA 2NUGA 3DHWC 1SQFA 4PABA 6AT1B 3CCTA 1U0SA 2CG8A 4HDHA 1VDHA 5A2QY 4X4VA 2V2VA 2WVEA 2GMHA 1T38A 4OYMA 2HVHA 3HJFA 4WX9A 4ZVEA 2K1RA 2YX7A 3RW6A 4FYWB 2GQQA 1C1BB 1J5EJ 1V3ZA 4KGKA 4IO1A 4J9PA 2NCKL 5JXSA 3HSGA 1TL1B 1U1NA 3W1YC 4NLPA 1S9EA 1DTQB 4O0NA 1VQPS 3DCAA 2FJDB 3MCSA 2FVQA 4USIA 3DXBA 4D3GA 2XS2A 9RUBA 5CYJA 1RLCL 2PEHA 4I64A 1BD6A 1DAXA 4B9NA 1URRA 4NLXA 2ZBCA 4OZLA 4ZYGA 4CP5A 1U6ZA 3QMQA 4KR0B 3IC1A 3F6HA 3GP9A 1DBDA 4NA2A 1K47A 3WDOA 2IPOB 5LT5A 2W1BA 4MK8A 2AQ4A 1VQ5S 1H98A 2AGOA 3KNAA 1Z1BA 5MAOA 1FWLA 3CCZA 1GXUA 4NI2A 3ETOA 4P7TA 2AYGA 2DSYA 4DV4F 5ETRA 1S0NA 2QE5A 2YPNA 3UDLA 1WTBA 2UUAE 4M5IA 2BW7A 2V2KA 3DRYA 2RDDA 2ZBIA 5F3WA 4QR1A 2AJFE 2PA8D 1NJYA 5DG9A 4DV4E 1QSYA 1NBEB 4LRFA 3T5HA 1S0VA 3NP5A 4KJIA 1WSRA 2XZTB 2R7TA 2Q6BA 2IRXA 2ROGA 4Q28A 1HFEL 4LJMA 4PG7A 2A2DA 1Q8KA 4JI6E 2QLJB 3NCPA 4Q43A 1D9AA 4J9UE 4IOBA 5HROB 2XLKA 2YY3A 2DYAA 5CYQB 1MW7A 2E5LF 2UU9E 4RW4A 3PIPQ 2B4VA 4RNOA 1VI7A 3HTXA 3ECRA 5HVGA 1KHWA 2NYHA 2BOAA 1OYEA 4FS2A 5D0HA 1G2DC 2WVCA 1SC4B 3JXOA 3I9ZA 4DL4A 3QIDA 2YX4A 2R2RA 3RW7A 4PUOB 5A8WB 3QJPA 2Y1IA 2ZOMA 2IHR1 4A8KA 3T1YJ 3DRRB 1FDBA 1P1LA 3U1NA 4AXIA 4BWJA 3CCWA 3CTRA 4CRJA 1BWEA 1V5VA 1G7CB 3R5DA 3DDKA 3DHXA 3KK3A 4DV3E 2DO4A 2EPCA 2CTDA 2MKJA 1S1TB 3TQEA 8ATCB 1EB0A 4DPTA 2WB1D 2MZSA 3MM5A 4WIQA 4CLUA 2A6OA 2ROPA 1KWMA 1RWNB 2EWHA 2IJFA 4F2RA 1YI2S 2F9DA 2FLOA 3TVKA 4ZS6A 3QGPA 1HI8A 2FGGA 2VKRA 3OD2A 2W9AA 2ADRA 4LF5E 4MH8A 2GA7A 1B0TA 6FDRA 1KLMB 1H2TZ 4JBCA 1U1QA 2V94A 1WC6A 5K9FA 3BB5A 2W8LA 3I6PA 2KYXA 4LBPA 4WFXA 4QQBA 3GILA 3ZOQB 2MPUA 3LP2B 5LXRA 4USTA 1WOPA 3RAXA 2LBSB 4QIGA 1NDLA 5FLXY 1WRJA 3E2EA 4DV2E 5IXUA 4V1Ak 3B54A 3HVTA 1YZ7A 2HVIA 4DX7A 3MAHA 2F7VA 3RMPA 4F2SA 2OMOA 1AFJA 5C42A 3BSAA 1RBAA 3UN5A 5ETQA 2KOUA 2OLWA 5J2PA 3PV8A 2HNDB 4DUTA 5FJ4A 3QT8A 2R8KA 4IFVA 1IBME 2X3GA 3L00A 5HVHA 3IRWP 5ETPA 3KZYA 2BQUA 3C6KA 4CCHA 3TA1A 1FJCA 1CJKA 1X4DA 1S7HA 3ZZRA 2V2ZA 2BOPA 4QWBA 4UUXA 4NEYA 4OHXA 3K7RA 2G4BA 2DISA 1WORA 5ITHA 1X49A 5K20B 1IKXB 1W2BR 1NKEA 4BCAA 1KNZA 2CJYB 2HEKA 1R6VA 1H6KX 1ZAVA 2XY5A 1UW4A 4LF4E 2RSMA 1RJJA 4YR2A 3FEXB 3HULA 4P2SA 2U2FA 4KWYA 2DR9A 4JV0A 1B64A 2WONA 5LMNF 2YWEA 3POTA 1KLMA 4FPIA 3I5CA 1CULA 1D9FA 4IH6A 2OKQA 4O3RA 3GFZA 3IWDA 1D1UA 4WTYA 3LANA 4FS1A 1HBNB 5FIIA 3GB0A 2UUAJ 2OPRA 2VPZB 2FDNA 4B3SE 5F0UA 3T9NA 1MWYA 3TO8A 3BYPA 3WIUA 4KH0B 4MIAA 3BGUA 2ZZTA 4C11B 1CLFA 3BGLA 1T03A 3AB2B 4LU9A 5BR8J 2QL7B 4DV5J 1IJEB 2LA6A 1YRUA 3UNGC 4RBTA 2B4OA 3D5MA 4ZPAA 1HNWF 2V63A 2XHWA 4X64J 1QUVA 4USWA 4EGLA 2HWTA 2PGCA 2VQFE 4LF9F 1CVJA 4X66E 4O44B 1A1KA 4USMA 1T9UA 2M0GB 1GMVA 2FVCA 3GR0A 1WC0A 4PYDA 5KT5A 1R0CB 2UUTA 1ZM4A 2VBYA 1A1JA 5HQ8A 4OZ3A 2WZOA 4OX9E 1KC8T 1EZZB 4CO3A 1U8WA 5ETSA 3UVJA 2LCWA 3DOLB 3TA2A 2VZ9A 4FPRA 1TMJA 5IWAF 5LMUJ 3MDFA 3RJMB 5DETA 2ZH4A 4RNFA 1G2FC 4X65F 4XO0A 3MEEA 1X9SA 2WONB 3TARA 1NCSA 1FKAF 2WB4A 1HBOB 2WHOA 5GAHI 4WYQB 3KJVA 3TAPA 3M99B 3QRRA 3KK1A 2MC6A 2MQNA 2WOMB 1A7GE 3VZHA 4ED2A 1F9EB 3HMJG 3H0PA 2M4MA 4M5NA 1PJ7A 3PG9A 2V34A 4DL6A 4PKDB 4CH0S 2AJ1A 2L2MA 2ZNYA 5F8HA 2VOPA 2HHHJ 2RDIA 2LLZA 4G1PA 3SCLE 1U4BA 4OFZA 2F1FA 2EI5A 4U9RA 1LWFA 2GNKA 2QSWA 3I0SB 3OLAA 2K7IA 2ZKTA 2UUBF 3QSYB 5HJYA 1VBZA 2N3LA 3RTVA 2H65B 1VIOA 1O6XA 2ZUGA 1NPKA 3A8KA 4ZP7A 2ZD1A 1LWEA 4JI1F 4PPZA 4XIUA 4JI1J 2H4YB 5I3QA 4F3OA 2EQ3A 4X8WA 4HTGA 3MAAB 5A8KB 1VQ9S 1YBUA 2W24A 2EW9A 4YB6A 4ZITA 3UR3C 1X4EA 3I9V9 4DPOA 2OPPB 3LPEA 4WSPA 2VA3A 2QT7A 2PRTA 3Q8RB 1N4LA 3ISND 1N34E 4QCLA 2XS5A 2RRNA 2W2MP 2WVBA 4U7UK 3L09A 1MSWD 3MM8B 4Z2XA 1DLOA 1NJIT 1YIJS 2ZZMA 3H20A 2WTFA 2EKYA 1H38A 1Q81T 3V6KA 1D8ZA 3HSZA 1PIEA 4U6PA 2PO4A 1RTZA 4F4YA 2ZKUA 3D6HB 2XS7A 3HHLD 4ZPVR 2CPXA 2FV4B 2MQ8A 4NLWA 4WJBA 1NEIA 3GTYX 3BKUA 2NREA 3R7NB 1L3VA 2MB0B 5MLCV 2HBRB 2QMUB 2Q6CA 2C3MA 4USUA 2W4CA 2MJNA 2YQ1A 2HQIA 5F9LA 2FLNA 1LFWA 2M8HA 2MSTA 1KQGB 5HROA 1TZ0A 1T9XA 3OQ2A 1HBMB 1FI4A 3NCRA 1N5VA 4OZ5A 4ZLJA 2X1AA 1FTRA 2H5JB 3DOKB 2KG1A 4ID8A 1MROB 4P74A 1NAQA 1T0TV 2C1EB 3KJNB 3MFIA 2WW4A 3ZZTA 3OPKA 3DXSX 2DIVA 2KH9A 3DRXA 1N5QA 3LOUA 4TXSA 1W25A 3CCLS 1PJ5A 1N3GA 3H5SA 3C15A 1S1WB 1V9OA 4RUHA 4TKTA 1S10A 3QWPA 3PEJA 4ILRA 4A48A 5KFOA 4NXNE 5HP1B 2IDLA 5KFKA 2PD1A 4CLTA 1BQNB 1CJTB 3MM9B 1O0PA 1S1TA 2DNNA 2XZDB 4ALZA 5IQ6A 3VYXA 2YNFB 1JLBA 2HBZB 3M8ZA 2IYIA 2ASDA 2BVZA 3NWRA 1RAHB 4B3TF 3RYLA 1GX5A 4DR7E 4DDFA 2HHPA 2MMYA 5D4OA 1VCTA 3MUVP 4LR8A 4O3SA 1NB7A 5F3TA 4XAKA 3IWXA 2IY5B 3K5NA 3T1YE 2JH3A 3GONA 1RT1B 3VHTB 3ET6B 5EX3A 3EXCX 1R6YA 3OUYB 1Q1KA 5L9XA 1RSCA 2YNIB 4RX6A 1HWJA 2HQGA 2HFNA 3MD1A 5A8RB 1XR7A 4Y65A 4ED4A 2BABA 3NS5A 3PW7A 4RNNA 2W9BB 2KZZA 4FKYA 3RR7A 3EWGA 2V69A 2R2UA 2OFHX 3D3CJ 4A8OA 2MKHA 2FIUA 1FJGE 4GVBB 3D9BA 3RBEA 4MK7A 5G0RB 4ZVTB 1N6QA 1GQEA 3L9ZA 5DM7Q 1I6JA 5DLGA 4ELUA 3FFIA 1BBGA 1HKAA 1RWVB 2DHHA 5B09A 2KM8C 1PBAA 4DR7F 2UXDE 2YKAA 2W2OP 2H4WB 4HYKA 2O67A 3NOCA 1RGVA 1RT7A 4JI5E 1NK4A 4R2DA 3GJTB 4FVCA 2RQ4A 4QWDA 2V50A 2EFPA 4B3TJ 3QSIA 1XBWA 1CJKB 4QIEA 2F3JA 4FKXA 4K0KE 5ETNA 4RW9B 3ZO7A 4R2SA 1F2GA 5SZTA 2R7UA 2YNHB 4B3RE 1WI6A 1JXEA 2BXJA 4DR3E 2JRSA 2F63A 4Y0FA 3RRHA 1NHKL 4LF8J 4NEZA 3PEHA 3BGFA 2EXUA 1U8SA 4WU3A 4OLOA 4QU6A 5D0GA 1R8CA 4ZCIA 2L2KB 5T41A 5D15A 2FJXA 3LAKA 1ZS6A 2PFFB 5EX0A 2OSQA 2EPMX 4N4RB 1WXRA 3DF6A 5KFYA 3VGSA 4C6AA 3KHHA 1XMQE 2GQCA 2CNOB 1YTYA 3ET6A 2EFGA 1YDLA 3G82A 1J5EF 1XNRE 2Y1RI 2J9CA 5F8GA 5KFSA 4R8OA 3VALA 3CJSA 2BE2A 4G65A 3GIIA 1N5SA 3FQLA 4DR5F 2RSIA 2Z30B 4DX5A 5HI7A 3OFFA 3BEGB 4R2EA 1IBKF 1YJUA 3PX4A 1TKTB 2IJNA 4NYOA 2CQDA 5IT0A 5DO2A 2DY9A 3MECA 1JMTA 2DXDA 3ZZUA 2AEJA 2ZDPA 2V4QA 3QPIA 5E3AA 1VRTB 4L74A 2A3JA 3W65A 2YQ3A 3MHHC 3V6DA 2EL6A 2BB8A 3ILLA 1U2CA 3SCJE 2CQ2A 2L33A 4A8XA 2UUAF 4Y34A 3L7PA 4PQAA 2KFZA 2FVPA 3MPVA 4NYPA 1L3UA 4KTQA 2XLJA 3SEOA 1L3KA 3C6UA 2MY8A 2ZH8A 1EJ7L 2EM3A 1RZMA 2IRUA 3J81C 2OPQA 5F8LA 3UN2A 2I6WA 3FGVA 2QA4G 3OFHA 2QGFB 2V2QA 1OY6A 4LF8F 3GYGA 4URSA 4NLDA 3NNHA 5KG2A 1WC5A 1FXRA 2UUWA 2EN1A 5T6JA 1QAYA 4Q8FA 3V5RA 3TX8A 4YB5A 3DRSB 2D69A 1RTJB 3FNNA 5KFMA 3HHDA 3UW1A 3NMRA 1UHZA 4A8MP 1HQEA 3OJSA 4DR7J 5ETKA 4ZVQB 3HK2A 5DG7A 2HFOA 4QYZJ 1WACA 2KRBA 1AZSA 3M8QA 1GFWB 3IG1B 4M63A 4DMIA 3PXGa 4JYAF 5KFDA 5DM6Q 3OBIA 5M2UA 3P5BP 3K5MA 1IQSA 2MKCA 4NZ7A 4ELVA 2XSFA 2GV1A 3W66A 1HHTP 2A6MA 5C5JA 3MMCA 2WSEC 1X9MA 1APSA 3BO3A 4OYBA 1HNWE 5G4DA 1XWLA 1A1IA 4ECTA 3KG0A 2ZH6A 1S1UA 1HMVA 3NGTA 5U47A 4OYIA 1WHWA 3TUPA 2ENCA 4KH1B 2M8DB 3VYYA 4J9LA 4L75A 4JI0F 4TYBA 3C6UB 3H5YA 4DR3F 2C2OB 4NCGA 4HL9A 3MR2A 2R8GA 4PWDB 3NNCA 1RHQB 5A2QU 1RBLA 1C4AA 4MMOA 1DRZA 1RTIB 2DNPA 4AT1B 4JI0E 1MN7A 2J8SA 3FDSA 5C7PA 1Y3JA 1L3TA 2CQ4A 3I4PA 3GSDA 2CQIA 2JLFA 4V19X 1X48A 2OPSB 3X3UA 1RT6A 5DGBA 3AXKA 4ZHRA 4K4SA 3ZTQA 4UOGA 4G1IA 1GNKA 4X62F 4KKOB 1C0UA 1VK8A 3Q8PB 3ADLA 2V68A 3BZQA 4RHBB 3ENWA 2RQCA 2EBGA 3CC7S 2RF2B 1JLQA 1HIYA 4B3RF 1F2HA 4B9VA 2HRTA 3LUYA 4IR9A 1F3FA 3HFVA 3OXLA 4YMEA 2KVQE 2JNJA 1KR4A 2DNRA 2AKWB 4U95A 1JJ2R 3D28A 1RISA 3J7AN 4FXDA 3Q8SB 4EBCA 3CJKA 3M6VA 4R8UB 6FD1A 3OLBA 2LJUA 4LF9E 2KO1A 2BE9B 1MROA 1N33E 1WHNA 3V6JA 4GKKE 3BREA 1S6PB 4B17A 5LMNJ 2DNYA 3PYDA 1HMVB 1S9GB 1UFWA 3I4HX 1AUSL 1JKHA 5B0DA 2BR0A 3ELHA 4WBFA 2LCEA 3HHLB 4DL3A 2V6AA 2BDPA 4DG1B 2PN6A 5D8HB 3JQKA 3VR1A 2VFUA 3IBFB 1R3NA 4EZ9A 4C3LA 3GU0A 4BHCA 3ZZYA 2V8PA 2DPJA 2EM4A 3SSRA 7FDRA 2JFKA 3AV0A 3UCUP 2KJVA 5RUBA 3KLIA 2HQ3A 4N8NA 2F8EX 4EMDA 1RTHB 1X4HA 2JDJA 2YPYA 3JTNA 5L38A 2QLWA 3P49B 3FSIA 2XSJA 4DV4J 2VKZG 3ADIA 2P6SA 5A0YB 1XMOE 1X47A 4CQ1A 4MIWA 4DLGA 1FEHA 1KSPA 2LEPA 2RU3A 4WYWA 2XTJP 2LP4A 5A8KA 1OSCA 3I0RA 1R8HA 1BB8A 2P8IA 1RT4A 4Q45A 2VDHA 3J81j 2DGQA 2XCAA 4F6MA 1FT8A 3PW4A 3QG5C 3ITHA 4JI2F 1U0HA 2OI2A 1RTHA 3FKBA 3KK2B 3CJKB 3J7YI 4IFVB 3TNVA 3T1AA 2CYYA 2DGWA 2GC8A 4KV8B 2PE8A 1K44A 4NLSA 3JAMY 2EMKA 4X4PA 4WKRA 2EN2A 1KQFB 1JKHB 1RT5B 2DGTA 4F9BB 2P6TA 2EPUA 4WFAQ 3MCMA 2H51B 2NYIA 4GC6A 4LSNB 4MYUA 2I1RA 1JLFB 2CNNB 4PUOA 3BF2A 2MKIA 4JV5J 3K8WA 2XG8A 3HF5A 2CDQA 2JC1A 3Q23A 1WF1A 3QLHA 2KI2A 3PRBA 2XYGB 4K0KF 5L1KA 4J9RA 3HP6A 3Q24A 5K14B 3OSPA 4LF7F 2EORA 3MEDB 3BN7A 1MNEA 4PPDA 4KV8A 4DR2J 2CRLA 3F56A 3DLEA 3QT7A 4Q5VA 4QPXA 2LQ5A 3HZGA 3LA0A 5F3ZA 3PR4A 3Q0AA 3T1YF 2HRUA 3MAAA 1J26A 2JLGA 3MF5A 4O4KA 1ZOTA 5CZXA 3PW0A 3GV5B 3VAMA 2V88A 2GVZB 1EQ0A 1F60B 4F02A 3QGHA 4G6VB 3DNCA 1ZPVA 4WXOA 2ADBA 2E5LJ 3C6TA 4ECXA 3PZPA 5B0CA 1IQOA 1T94A 1S1VA 4DSFA 2FZGB 3M7VA 4X4NA 1GTHA 2DT9A 4CM0A 1ZA2B 4WK1A 3QT5A 2XMMA 2XMKA 3OTOJ 4JI6J 5H9EK 1FRHA 1LW2B 3V6DB 1VQ4S 4WPYA 2JP9A 1TL4A 1WKJA 4YB7A 3ZNUA 4P6QA 5GMDA 2MJUA 1NSQA 4ZN3A 2W4PA 2JX2A 3A4TA 2EMZA 1CJUA 1N36E 1BXNA 1NNDA 4E2FB 1X5TA 3WC0A 2GIFA 3KLGB 3TZXA 1SH0A 3CNQP 2N3OA 2VL1A 3FIGA 4RH8A 4OZNA 3UDEA 1FO1A 3R5CA 2E1MC 3W2VA 2Q79A 2LVWA 2B7CB 1GMWD 1O5JA 2UXCE 4ZPTR 1X6FA 2JR1A 2CJXB 3MCOA 1NRKA 2V8DA 1U1OA 2V9WA 3CJ2A 2HWIA 4F9AB 2VQEE 3BJYA 4FP9A 1PO6A 3TUIC 2LTSA 1U48A 4DSJA 4S0MA 2JEJA 3M9NB 2W01A 1HYSA 3NCQA 3QBCA 3EM1A 2W9CA 3CIMA 4KQZA 4MJKA 3EPGA 1T4LB 3FBEA 4RWWA 2QRRA 3CVKA 3C6TB 2V4JA 4EI2A 2QLXA 4CDIA 3DDIA 4LFAE 2BUNA 3F0NA 2ZJQQ 4OZ2A 1C2PA 1OPIA 4PG8A 3GSIA 2EM7A 1PKPA 1MG7A 2ZJPQ 3UDCA 4X64E 2G1DA 3DMJB 4WZMA 3LO3A 1RHRB 2HQDA 2WW8A 1SQEA 4R0JA 4ED7A 2EBEA 2KHXA 2ZZNA 3H7HB 3G82B 4DV2J 2CNLB 4DV6E 2MY7A 2M2BA 5I42A 4OJGA 4LF1A 2KN4A 4DQQA 4ZVHA 2NA2A 4QYRA 2DR6A 1G2EA 2DXFA 2KHCA 4LSZB 4LF8E 2DRAA 3V4MA 2HK3A 2VBZA 5KFZA 2N3GA 4OYZA 1WJ9A 2HNZA 2HQFA 4B3MJ 3DJWA 4J91A 4RL1A 5HLFB 1OYDA 3W2WA 4LF6J 3THOB 3DMJA 3G6VA 3W2VB 1KLNA 3BS9A 2EP3A 2HRYA 3BSNA 1FTCA 4JV5E 1BY9A 2X1BA 4ID5A 2B8PA 1T9WA 1X4GA 3DU6A 3D67A 3DOLA 2JC0A 4MYTA 4UQTA 4P75A 3E8OA 5L9NA 3KYLA 3HVTB 3OT9A 3UDVA 1P6TA 2EFQA 4HTJA 4UT4A 3FRZA 1JLAB 3NGKA 4ZVUB 1HD1A 2V67A 4PRFA 4CIOA 2ELYA 5B7WA 2L6MA 3D6MB 3DLKB 2HURA 2FB0A 2KXFA 4JI0J 2LQJA 5CCLA 1YVFA 3UCGA 2DNZA 4NLTA 1D9DA 1FFWB 3NS7B 1HR0E 4B3TE 3CF5Q 4K4ZA 3ADGA 2G1HA 3CD5A 1YITS 3TP2A 1LV5A 3NXZA 1M5VC 1P9YA 1CS4A 1H2VZ 1SR9A 5HSPA 2CJ9A 4F3QA 3MR5A 3OHBA 1TV6A 4CTAA 3B4MA 1PBUA 3DFEA 4U96A 4OYWA 5KL5A 4H4MA 5A6JA 4CI0B 1UN6B 5DLFA 1JB0C 1B3TA 4JYAJ 1X6EA 3DLKA 4DUYJ 1AZSB 5EDWA 4EEYA 2JL9A 2EPPA 1TK5A 2L9WA 3MEKA 2I5JB 1T9TA 4F26A 3D1OA 3BR9A 3AODA 1ZZNA 2Y1JA 3W61A 3ULHA 3UQSA 1RKJA 2NZ4A 1PCAA 2C2KB 2CVIA 3OL7A 2EJ4A 4OJ3A 2HG4A 2N82B 2CXEA 3M2VA 4ZYHA 1P27B 3GLJA 3SDEB 4XDCA 2EN3A 3MM8A 2DH8A 2UVVA 1TL1A 1XMQF 2FQQB 4H4KC 1S4EA 1UZDA 5LSLA 1DFDA 4LQ9A 2XC9A 2EMHA 3D68A 4FN5A 4P2MA 5CABA 4PG5A 2CWKA 5IT9Y 1SKRA 2D9HA 3R27A 5KFHA 2N3HA 5KFLA 1LKZA 2IJRA 2YWGA 2EPOA 5IC4B 3J80U 1A1HA 4F2JC 5K8MA 4C0OC 4IDKA 5M2PA 3AOBA 4XDDA 2L08A 4ZJQA 2V8QB 4WXWA 3CO0P 3U1MA 2H5IB 2DGCA 1NEEA 4LIRA 5KFIA 4TY8A 3BSCA 2FC8A 3MXHP 2EG2A 2QA2A 4H4OA 2HIQA 1X9WA 1Q8IA 3JB9k 3KZZA 1SI9A 2VG7A 4CTAB 2UZAA 1K1SA 1TF3A 2A1BA 1QM9A 4M1KA 2UV8A 2HIYA 2XMVA 3IGNA 4R2AA 4DV5E 1SJ3P 2EPNA 1NSKL 4ICLA 1BQMA 2IM3A 3CCRS 2IVMA 5C42B 1S0MA 2UU9J 3HX9A 4HVZA 1N32F 2YKOA 4ILMA 2B9DA 1S4FA 4FZVA 3JSRA 1RAFB 2E1PA 2PI5A 3TEGA 1JLGB 3EZ5A 2MTLA 4F0HA 3SFGA 4PXEA 1KOOA 1ULRA 3CD0A 2CPDA 2YTCA 1DARA 2G0CA 2V85A 4MKBA 1K73T 5AJ3F 5CYQA 1RHJB 3FUYA 1YJNS 5KFCA 1NPPA 1FJ7A 1UWAA 4KIAA 5DZ6A 3SSQA 1S99A 3ENVA 4QWEA 3RB4A 4FVMA 2GHVC 2VQFF 3KLEB 4BDPA 2EM9A 3OVBA 1SBRA 1IKXA 4DFJA 3M8PA 1C0TB 4JI2J 2HGMA 3H5UA 5KFVA 2OELA 2ENAA 2W7OA 2DR5A 3IAS9 3OTCA 1QTMA 3D1QA 2RDJA 4XPEA 1RTIA 4EWTA 5KL4A 2EC2A 3D0GE 2ZHOA 2AMCB 4G1QA 4ED6A 1PSDA 1MN9A 3J81Y 2E9RX 1W2IA 3I0SA 3IP0A 3DRPB 4IQMA 3C3LA 4CLKA 4KKOA 2CPJA 1UVKA 1NPRA 3BO4A 2ATLA 4OHWA 2EVZA 3PW5A 2OEMA 1JLQB 5D4LA 3I0RB 4RNHA 1W7WA 4NCAA 4CO2A 3SV4A 3Q83A 4L76A 2DNLA 4GO7X 1KONA 1N6QB 1SUQA 2VJUA 1SJ1A 2RJZA 4N77A 2IA0A 4GZNC 4JV1A 3THTA 4HACB 2BEFA 2HKEA 2OD4A 2ZM6E 5L8RC 1URNA 4NLUA 1HWLA 1RU1A 3A13A 4LBHA 1VGYA 1HI0P 3QJLA 1ZM2A 2VG6A 1WHQA 3RZAA 2DLKA 2LUPB 2LMIA 4BMJA 3DU5A 1HNXF 3MGJA 1WOSA 4X4RA 4OI6A 4Q2LA 5DJBA 4DV1E 3OMLA 1C0TA 3HT3A 3OSNA 1YLXA 4M5KA 2UP1A 3IBWA 2ALYB 4DR6E 2CNKB 3N9UC 5LMNE 1VMBA 2QC3A 1TTHB 2NPIA 3LF0A 4I69A 4X4SA 3UI3A 3LP0A 1WG1A 2ZC4A 3KK1B 3DLEB 1VC6A 2B3TB 3CIZA 1QAIA 4RR5A 1P9QC 4PXCA 1F0XA 1UVIA 2IIHA 2O5DA 8AT1B 1S1WA 3WHIA 1F5BA 4ETZA 1JX4A 1VQ8S 2YTQA 4LRCA 5LL6R 4DR1E 2LYVA 2FJVA 2WSFC 4DSEA 3GIJA 5A8WA 4FNHA 3IAM9 4IRDA 4ZVSB 2CDRB 4UOFA 3K8VA 2MGZA 2LJHA 1EIYB 1SIZA 4I2QA 1YJVA 1BUXA 1N0VC 5JMNA 2OGUA 2VF1A 1VRTA 4EUVA 2OPSA 2LQ9A 2W4DA 1TQLA 4A4JA 3IR7B 3OL9A 2XB2D 2ZUAA 1HLWA 2EK1A 4KHPF 1BWVA 4WFYA 1IVZA 1WHYA 3DOMA 4YUDA 2KXNB 3TUJC 3FZBA 1QJHA 2CQ3A 1Y00A 3BGOP 1Y7PA 4I67A 2ERRA 2KL8A 1VBXA 1WTFA 2YH1A 2F4VF 1XMOF 3AJ2A 3Q8UA 4PQUA 2XWYA 4C2MA 2HNYB 2YRMA 5A8RA 3ZZZA 5B08A 4RBVA 2Z4PA 2DJWA 3RBXA 2G2OA 4NOHA 4WKYA 1DURA 2VU5A 2VHGA 1NDCA 3R3TA 2NXJA 5KL2A 1FNXH 2IFXA 5KG6A 3LP2A 4DS4A 4E8UA 3G4SS 3BO2A 4J37A 3G8TA 1NCLA 1F3VA 3W62A 5THWA 2DB1A 3AJ1A 4O4RA 1QY7A 1H3DA 1L5UA 2HFZA 2KONA 2EOYA 2OHDA 1VC0A 1M5SA 2R8IA 4M5DA 3G86A 3HHLA 4O4GA 4PZVA 2ASJA 1G3OA 4ZCKA 4YY3F 1BHNA 4IS1C 3MOJB 3IXQA 2GHPA 3BBGA 3EZUA 3FEYB 4Q35B 3EPIA 1VQNS 1IBCB 4YOEA 4N56A 2DXEA 1LQ9A 2H54B 1U24A 1TL7B 3Q8QB 3V4IB 3A3NB 1K9MT 2XSJB 2HHXA 3WZ0A 3CCJS 4DMZA 2GQ2A 2PFDA 1V5IB 2MXYA 4LRBA 1RACB 1PDAA 4DFKA 5HMYA 2LA4A 4JI1E 3MPDA 4F0KA 3BYRA 1RWKB 2J9EA 4PQUB 4Q8EA 4U8VA 1TL5A 2IM2A 3VK6A 2YPZA 3CCVS 2HHSA 2QMXA 2HLTA 3LQVA 4B3SJ 1C1CB 1RCOB 3KLHB 2V86A 5BXIA 2EK6A 2C2EA 3AOCA 4FNIA 1NDKA 4R03A 4USKA 3BF4A 4L73A 2FY8A 4P2XA 3F73A 2YWFA 3QGIA 3UFCX 2B0GA 1LW0B 4C98A 1SVDA 3IMQJ 2ENHA 2NUFA 4LFBF 2B6AB 2A2CA 3OR1A 1NHVA 1YRTA 2AEMA 4N47A 2WCC3 5C25B 5AXKA 3I82A 5IT4A 4AL7A 4TY9A 1MU2A 2LU2A 4E98A 2ZH9A 4ZMMA 4NCBA 1O51A 4H4OB 3K5LA 3L3CA 4K5RA 2ZH2A 4YDDB 4IRCA 3RB0A 2VONA 3SV3A 3QYYA 1TKZA 4KPCA 2R7QA 2YTJA 1QU6A 3ZTRA 4JI4E 4RW6A 2EN7A 1VQOS 2ZE2B 4ZN1A 5LMUE 5T7LB 1NB2A 1YRXA 3T3FA 2EPXA 4ECVA 4HH1A 1UILA 1RWWB 1JJ4A 3AA8A 2PSZA 1R0AB 4OX6A 3PHTA 5F8IA 1ZTWA 3TA0A 2C3OA 1T3NA 1HHSA 3LP1A 1ELOA 3EXYA 4WTOB 2Y9HA 4QJVA 2YNGB 3HSDA 2GMJA 3HLUA 2DD8S 2BM1A 2BKPA 4BLGA 3AOAA 1ZBTA 4NRUA 4I7FB 4OMFG 4BC7A 4DLEA 1OSDA 3KLHA 3PM9A 2POKA 1ZAAC 4AD6A 4NYZA 4IH5A 4DJBA 2HPUA 3PNIA 1HARA 4USVA 2B9YA 1J5OB 4JI7J 2EOOA 2R76A 2QL9B 4PG4A 1PJTA 3BKFA 1CG2A 1I94F 4LFAF 2EEYA 1TKXA 2KT3A 3HKZD 3QAEA 1X0PA 3OHAA 3GIKA 2ATCB 2NZCA 4WFBQ 1XJWB 4JI8J 3AAWB 2UXBJ 4I68A 2OTJS 3DYAB 2NS1B 2I9SA 1JLBB 4JYAE 1QVGR 3ILOA 4P9SA 2LDYA 2V83A 3CE8A 4PWDA 1PJ6A 3TWZA 1D3WA 2VV5A 2YBVA 2ACMA 3AD8C 5KFQA 1ZBQA 1SUQB 4OI0A 2VBXA 1BGXT 3QO9B 1UP1A 3P4UB 1NHUA 5T7LA 4DSLA 1QE1B 2HHUA 4ZLPA 3FC9A 1YYWA 2KM8B 1S59A 3HSJA 1U09A 2XULA 4A8YA 1A0OB 4YFUA 4OV1A 1XN9A 4AQYF 4GO5X 1WD6A 1RK8A 1RA6A 3H5XA 1TV6B 4ZJLA 4Y2IA 2YNGA 3H4BA 3J7Z5 3NLCA 3MMBA 5I4MA 3AXMA 4IOCQ 4RU9A 2WK4A 3WX8A 3NWGA 4C8LA 3IWCA 1XNQE 1YUIA 1T3OA 2EOSA 4HHHA 5FDLA 3GG0A 2HQCA 1BQMB 3QO9A 3BH6B 4WU2A 1QAXA 3T9ZA 4OV6A 1KQSR 1GZ6A 3M4XA 2MDGA 4DCPB 5ADZA 4EBDA 2R2TA 2R9LA 4B3RJ 2HGLA 3AJDA 4QR2A 4ER8A 2D1CA 1CPZA 4C8NA 2L2NA 2J6UA 3C14A 4B9MA 3VCDA 2RS6A 5IT9C 2RPCA 2RSQA 5C24A 2F40A 2C2NA 2YTFA 1IBLF 2M7QA 1OQ6A 5E41A 5EGYA 2XEXA 2P9CA 4OIXA 1GH8A 2E5GA 1EHWA 5FDLB 1VQYA 1I3OB 2LQBA 2BMBA 2OEKA 3DM2B 5DRKA 3C2PA 1A1LA 4WYLA 2IVYA 3VAIA 2JHEA 3K89A 2EQ1A 3T5JA 3M8PB 3BR8A 2QX0A 4J5OA 2IDEA 3W9IA 1IR2A 3MAQA 4A8FA 2B43A 1F9FA 1NKBA 2I38A 2HFUA 1TAQA 4C3MA 2EM5A 4YY3J 1STUA 4O23A 5C2CA 3C4TA 5D77A 4IDKB 2F4FA 2FD2A 3N6NA 2EMBA 4MKYA 3JYTB 4WZQA 2J8AA 2EM8A 1NMEB 3CCQS 2CIMA 1MWQA 1LW2A 5DDQC 1O8BA 3QWUA 1SXLA 2D3ZA 3EMTA 2RRBA 3EGWB 3CJQA 4F3MA 3G2XA 1EP4A 2MZRA 1FFSB 2RS8A 1VQSA 3M2RB 4LFCF 4B3ME 4X4TA 4DV3J 2RHSB 1HW9A 2L3JA 3D4JA 1NH8A 5F8NA 1RABB 2OD6A 3M6UA 3AD7C 3IBCB 4J9MA 2B7VA 1Q78A 2HNYA 4I56A 1VRQC 4LTYA 5GADI 5AASA 1IBKE 3ILIA 3RBDA 2DMIA 1J27A 3JQMA 4IG0B 1MMDA 1X4AA 3GFHA 4MFBB 1NM2A 4OQJA 3T1HJ 1N34F 2CQHA 3M8SA 2F4VJ 2JY9A 1S76D 2FLLA 1IKWB 2VPYB 2YH0A 2JZ5A 4F7VA 3X1LB 2C28A 4UTGA 3TJ9A 5IV4A 2KKHA 5DDPC 2NR0A 1N88A 1XQIA 1WNEA 3Q22A 3MEGA 3V2UC 1Q8BA 4K2JA 3FQKA 2RQMA 1YYOA 3KUEA 2M88A 2OUGA 3BDPA 5LMUF 1DQ9A 2QJ3A 3T5KA 1X31C 3NY0A 1U6BA 2UUCF 4FYDA 4WXDA 1IMUA 3NAIA 3QAUA 2OJ3A 1NK7A 5E2QA 2B9EA 3ISZA 3PKMA 2EPLX 9ATCB 2QYCA 3UWTA 5K14A 2RKIA 3C15B 2MQMA 1Z2ZA 4BHQA 2KVIA 1K0TA 2QSFA 2XO6A 3W5XA 3BH7B 2K4VA 2KHDA 4L5NC 2Z56B 5K8NA 3HHKA 1X4CA 1HNWJ 5IQQA 1DZ5A 1A1FA 4CYUA 1Y5IB 3HHNB 3AQPA 2F9JA 3Q2TC 3FJ2A 2XCPA 2OO4A 3M8QB 2ACYA 4ZCMA 1RWMB 2AF6A 3KUHA 4YHHF 3NL0A 2EOZA 4DCOB 3CMQA 3K58A 3CMAS 3CMES 4DHVA 3ZTOA 2YX1A 2RKIB 4K4WA 2HZAA 3J7YU 5DQIA 1R8BA 2YKMA 4LF4J 5DGAA 1BMQB 2DBBA 2R1FA 1UJ5A 1FD8A 1T7PA 4AQYJ 4DQRA 4LIWA 1VLYA 1KBRA 3CSKA 1YJ7A 4QU7A 2ZH1A 2VODA 2VFSA 4CYUB 4X62E 2DNKA 2FYXA 3MM7B 4TN2A 4WFZA 3KJQB 1GTEA 4EYIB 3H2LA 2ZWPA 3QFHA 3GR1A 4NMLA 4ZVGA 3FCVA 5KAKA 3IR6B 2MHEA 4U7CA 2HZVA 4F0MA 1AB8A 5B0AA 3ZZ0A 5IS2A 2RD5C 2RS7A 2LFVA 3OVAA 3OV7A 2M9AA 2A18A 1LEOA 1SH3A 4RJVA 4DUZJ 1I1GA 2XI3A 3CDAA 4LFAJ 2W2QP 4ECUA 1LXNA 2DRDA 4F4WA 3FBBA 3PFOA 4NLVA 2UV8G 3KK3B 4NPOA 3BSOA 5GMEA 3EYZA 1PYSB 2QYGA 4UUWA 2X51A 2A10A 5ETOA 3HHLC 5CA5A 5LM7E 5F8MA 4JOUA 3O1LA 5BYSA 1X5WA 2CT1A 2CQ0A 2YT4A 5DNYA 1SC1B 1RT3B 2CQ1A 1NK0A 3C16B 4C0BA 4OX9J 4YR0A 1WOOA 5BYRA 2MGZB 4CO1A 3S01A 3AHPA 1RMDA 1RB0A 1UPPA 3K5PA 2RNEA 5KFTA 1RTJA 1VIXA 4PXBA 1BQXA 1SKUB 1S6PA 5HQLA 4F8RA 3V4IA 2MLXA 3OTOF 2D7SA 2DLQA 2EMXA 3D3BJ 4KGVB 4F4ZA 2R8HA 4LF4F 4BS9A 1VK3A 3HD2A 4ECYA 4OX8A 5IWAE 4C8OA 3PDNA 4O3QA 1LFPA 3PO4A 2XMAA 3BPSP 2VASA 4PR6A 2I9IA 3MM6A 1OWXA 1VISA 4M0VA 2DNQA 1DTTA 4OJHA 1XERA 3KLIB 1E6YB 1Q7YT 1WUUA 5D6GA 4KHMA 2DNHA 1UA1A 1S79A 3DKDA 1X7VA 3OW2R 5J2NA 3U27A 5KT2A 2HNZB 2C22A 1M5HA 2F5GA 3CCMS 2DPIA 2RAQA 2VPWB 2VG6B 1X5SA 2I13A 2X3DA 3J7AG 2B6AA 2NXUA 2K8GA 1IN0A 3RAQA 1NJZA 1AH5A 3AD9C 4CH1A 1PILA 1VBYA 4NASA 1XR6A 1XMBA 1L4SA 1H74A 2E9TA 5FD1A 3MM6B 1VS3A 3R8YA 1L3SA 3OTDA 1SV5A 3EICA 1U0HB 1AYEA 3JAMC 3TRGA 4C7QA 5L46A 1R27B 1T8EA 5KFAA 2FHOB 4GRSA 2J7KA 5B0GA 3JQJA 2ZD1B 4I8OA 4KO0A 4KT0C 3H42A 2VFTA 2VD3A 1XMQJ 1Z2LA 1AROP 1AT1B 1XC9A 3OXFA 3TQ1A 5KFUA 1O0WA 4DEZA 4DKKA 1NKCA 1WELA 1JXVA 1Q8LA 1FF2A 2BJ3A 4X66F 2FY1A 5CHCB 1QNTA 2DNMA 2JFDA 4GKKJ 1WJPA 3KLEA 4FYYB 2E7XA 1LXJA 2OAUA 3LP1B 1N52B 2EOIA 1RXOB 1TUGB 4CLSA 1UZHA 3KKFA 4TLRA 4LBIA 3EQ1A 4XK8C 2EM2A 3R2CJ 1H73A 4G1QB 3UNYA 3JSYA 1HYSB 5L39A 3H8YA 4J9NA 5A6PA 3DM2A 2ZJRQ 1VQLS 3M32A 2HK2A 3ETMA 3HKWA 2VBWA 2YTDA 5GAHU 2E1CA 1TKDA 3KWMA 2ELZA 2QZ8A 1P8GA 3OJUA 4WP9A 2VQEF 2XY7A 4C4WA 5FLXU 1T05B 1M5OC 4M5JA 2L92A 2G0JA 3F41A 3R1HA 3R5JB 4NXMJ 5A76A 1S12A 3SDEA 2CZVC 3W7BA 5KG1A 1R89A 2B56A 1SV5B 4J9KA 4NRTA 2ILYA 3GFXA 3OTEA 1Y9OA 1PAEX 4GKKF 1HNIB 2NSCA 1SC6A 5KFEA 1R8PA 4GKJF 5A0YA 1MMNA 1R8AA 4ERDA 4DZDA 3ZZOA 4HHUA 7AT1B 3HPOA 1N36J 5B0EA 3IWNC 2RILA 4TVAB 2B51A 1OY8A 4FF3A 4UQGA 5KFNA 4TY8B 3VGUA 4X65J 3CUNA 2J7JA 5H1SV 2SXLA 5JVHQ 4ITSA 4RBUA 2CFXA 1S6UA 4LF6F 1HBUA 1OMSA 2K3KA 3ITHB 4P73A 4FF2A 3TAMB 2UXCF 2O01C 1DHMA 2Q66A 2EPRA 1WDTA 3MPUB 2R8JA 3MCNA 4KE5A 1NK9A 2EMFA 1M0SA 4ZIVA 4W90B 2GGPB 4O43A 3SQGA 2FJAB 4DL7A 5LLQA 3KUGA 1DQ3A 3W5ZA 1S1XA 1RADB 1IBLE 3IWLA 1X4FA 5GADU 1M1GA 2UUBE 1FCAA 3BPDA 3VQTA 1J5OA 4ECWA 3GJRB 2VJVA 2QTWA 4ZK7M 4AYBD 3IS9B 3OUYA 2LO3A 2F4VE 2D74B 3ZNJ1 4P7DA 5IT9U 4Y2AA 3ZTPA 2CZ4A 2HYIB 3R5BA 3QLHB 4HLBA 1H7XA 4LSLA 4F4AA 1ZAWA 3CJTA 5KOXA 2DKOB 3NEKA 1SL1A 2EOEA 1HNZE 2OEJA 4B08A 5KFBA 4HT5A 2UXBF 3NGUA 3PHEA 5BYQA 4JI8F 2MKYA 3CC2S 3LTOA 2BBGA 2KFYA 2JVOA 1U1LA 1FDAA 3CXCR 2BANB 3DC2A 1S5ZA 4ED5A 1RT7B 3C19A 4DV0J 3V6HA 2VG5B 1EETB 5KT3A 2DEJA 1EH8A 3S8SA 3LW5C 3VQSA 1Y11A 3SSSA 5SUHA 2QEXS 3CPWR 4WF9Q 4JI3F 2FJEB 4JI7F 4IUFA 2GVZA 2G7HA 1B99A 1NZAA 3RGIA 3RUBL 4A8WA 5EWFA 1DQAA 4L6V3 1DQ8A 3R2DJ 3ENQA 1PC5A 1YSAC 4DV6F 2EL5A 4RKUC 1OPZA 5J1NA 5T14A 2YVSA 2WZ1A 3EDQB 3JSMA 3EX7B 3M8YA 4K7QA 1PKUA 3GIMA 1HWIA 2ILZA 5E0OA 1YJWS 3TUZC 4Q44A 4TU8A 3HI9A 4ECRA 1S1XB 1SQGA 3JAMU 3ZFVA 1YZ9A 1RT1A 2VPXB 4C97A 2B7BB 1R0AA 1LK5A 1ROFA 2LECA 1M1HA 4ECZA 2GJFA 5GVQA 3BDEA 1EH6A 5LOQA 3W8GA 2HWHA 1HQ2A 1FRKA 5CAAA 3C14B 4RNMA 4AQYE 2IM0A 2WBUA 3A8JA 5L1JA 3BGRA 2YQ0A 4IR1A 2O66A 5HMZA 1TL3B 1IJFB 1YPNA 1CSJA 1NK6A 4UY85 4OZ1A 1CQMA 1WG4A 3UE2A 2HFVA 2GVDB 3FVYA 4DFMA 1FX4A 2ZHAA 3GZ7A 3EPHA 5F0WA 3KHLA 4NA3A 3MUMP 3KJFB 4CLPA 5DQHA 4F6NA 3HFKA 4HDGA 3VAKA 2KB2A 4DUYE 4FBTA 3G96A 2VUGA 1HR0F 2V4RA 4X4QA 3GYXB 3CC4S 2DR7A 1PG5B 3BGRB 4Y6IA 2ZH5A 4IYQA 2DCUB 2FJBB 3DLJA 3HQ1A 3QATA 2PEBA 4DR5E 4ZJOA 4DI6A 1RAJA 1C1CA 4QIFA 2UVWA 3ZXWA 4NA1A 4NZVA 5EHHA 3M2RA 4IFYB 2X1FA 4Z7YA 5J2QA 2YTOA 3DYAA 2CADA 2GFFA 1H7WA 2EC0A 2NLWA 3QIPB 2PDAA 2AT1B 3KWRA 2VICA 2IBOA 2I5JA 1S1VB 4WFNQ 1RUSA 1MWZA 3TYTA 3L95X 4NLQA 2EOFA 3OR1B 2VFRA 3LGMA 2FZKB 3IM9A 2L8TA 4OX7A 4EFAC 1VBKA 3R7BB 1RT2B 2FPHX 5KFFA 1Q82T 3ZC4A 1UEVA 4J9VA 2VB6A 4BS2A 1IKVA 4DOZA 1JLEB 2MZQA 2M70A 2MZJA 2D9OA 1VHFA 4N41A 2OMLA 2YNFA 5AE1A 2YWQA 1I94E 1SB6A 3KLGA 3EVMA 3DI6A 3KHGA 2NUEA 1TKTA 4BBYA 2QA4S 3LWMA 2YRHA 1T4OA 3PJWA 2DGXA 3JS9A 5KG0A 2BRKA 3S7RA 3AUZA 2PIIA 4LR7A 2BACA 3G9CA 1S1UB 3N0VA 2GO9A 4CLFA 2UUCE 2N4CA 4C8MA 4JI7E 2QFJA 2QL5B 2VG7B 1EQMA 4I0WA 2QO3A 3UO0A 5HN0A 2O3DA 4M95A 5D4NA 3GYNA 1UWBA 3KG4A 5E3CA 2W9CB 1H2UX 1B7YB 4OI3A 3W8PA 4IRKA 1Q5VA 1GMUA 2NSBA 4F04B 2XHCA 4K50A 4LFCJ 2HHHF 2V4JB 5KL7A 3G8SA 1YFHA 4DQPA 2ZNZA 3H90A 5DDRC 3FMWA 5AE3A 3B6BA 1JQGA 4WP8A 2KG0A 4RUCA 2FUG9 4FDFA 2HAIA 2IVFB 1TL7A 2NABA 3IFEA 5JVGQ 4DX8H 4DBQA 1SJRA 1SPBP 1GXLA 2H3EB 5DZ7A 1YHQS 4YHHE 1IKYB 5HK4A 3T6BA 1JLEA 3PX0A 4HHJA 4R2CA 3D66A 2EOXA 3CJ3A 4F50A 2BV3A 4Z7CA 3UD3P 2APOA 3G8QA 4IQXA 1REVB 2EMAA 1EKSA 2BM0A 3NGRA 4B3OA 3E01B 3AY0A 1KN6A 2VH7A 2E7WA 3KDNA 2EKNA 4MKAA 4R25A 2BE7D 1GX6A 2XQCA 1FE0A 4P78A 4DZ6A 1WI8A 3PYEA 4DPWA 2M1SA 4KHRA 3F44A 5AT1B 1YWXA 2G13A 5A6BA 1HPZB 1U45A 2ZM6J 3TJAA 5BJRA 3W63A 2DY1A 3KMQA 2XNQA 4MAKA 3KFWX 5C25A 1TAUA 3OL6A 1REVA 4USHA 3UN3A 3THNA 1WHXA 1NSAA 5D3GA 4JV2A 3NRBA 1UL3A 1GAOA 2WBSA 1TUVA 2HNDA 1G1XA 2EM6A 2XNRA 5IFMA 2P9EA 1YKWA 1TKZB 1FHTA 3I55S 2CAJA 2YWKA 4DV2F 5KT6A 3M8WA 4LRDA 3CJ8A 2L41A 2YKNA 4ZIWA 3O44A 4KO0B 3PVXA 5F8JA 2LU1A 4O5GA 2ASLA 3H59A 2PT0A 3D2WA 4LF7E 3D54A 3C4BA 1WEYA 2IM1A 1Z4UA 2J9DA 3MM5B 1UJ6A 2DGVA 2NXCA 4HEA9 4JI4J 4F9CB 1FDNA 2H9ZA 2R7RA 5TSEA 2HW3A 1WC1A 4K2XA 4X2BA 5L1LA 2QLFB 4NWBA 1J5EE 4X84A 1CEZA 4NLRA 4WE1A 2FTRA 2EM0A 4CO5A 2ALZA 2LKZA 1E6VB 5AXLA 4O0IA 4USJC 1DJ0A 4YS2A 3UR0A 1B70B 4O3OA 1TK8A 2FC9A 5AXNA 3QFWA 2OTLS 3HZEA 5EWGA 4ZLNA 1R0BG 1UKUA 1HA1A 4R5PA 4P52A 2WBRA 2L3MA 4PYAA 2K3IA 4PXDA 3G6ES 4ANCA 3ZTSA 4ES1A 2EPZA 2M3DA 3UVJB 2JWOA 2DGSA 3T41A 1WWHA 1U6FA 1TKXB 4K59A 2G9OA 3B82A 4DR1F 2MDAA 2YWWA 4C11A 2C3UA 3G6XA 4EO8A 4JI3J 2EMYA 4IG0A 1N5TA 4HKQA 1E6VA 2KYZA 2BJ7A 4NXNF 4RUBA 2XMUA 3JSMB 4DV7E 2I0XA 2HVDA 1IKWA 2FLPA 4P2FA 3MFHA 2KU7A 3LALA 3IA0A 3SI8A 2B9WA 3OXGA 3CDBA 3K57A 4NLOA 3PO5A 2Q3PA 2WSCC 5KG4A 1B4SA 5KTQA 4B02A 2CJQA
chains in the Genus database with same CATH topology
1TFWA 3HVWA 2FJXA 4V19J 3NBPB 3LAKA 2C3OA 2PFFB 1T3NA 5EX0A 2OSQA 1HHSA 4TYAA 4Y3CA 1UVNA 3LP1A 1M90T 2HS0A 2PMHA 2H5EA 4K4YA 1ELOA 3EXYA 3N6MA 2AGQA 1WXRA 2ZFHA 3DF6A 3M2UB 5KFYA 4QJVA 5E3QA 2PC6A 2YNGB 3KHHA 3T1HE 3EGZA 1KFDA 3CJ5A 2GMJA 1XMQE 2MYFA 2GQCA 3HLUA 3I5AA 5AE2A 1GXTA 1YTYA 2DD8S 2EFGA 1HNVA 2LE2A 2BM1A 1J5EF 1S48A 1XNRE 3LAMA 1TP7A 2Y1RI 1FNMA 2BZ2A 2J9CA 4DL0C 5F8GA 2CJKA 1ZBTA 5KFSA 2B4UA 4R8OA 1A9NB 4NRUA 4I7FB 4OMFG 1G6BA 4BC7A 3GWCA 3VALA 4DLEA 2GGPA 3BM7A 4CT8A 1OSDA 2B7TA 1HPZA 2BE2A 4X4OA 3GIIA 3KLHA 3PM9A 1N5SA 2POKA 3FQLA 4DR5F 3SCIE 4NYZA 4IH5A 5HO4A 5HI7A 1KOHA 1V3SA 1ZM3A 4DJBA 1FVQA 2HPUA 3PNIA 4I6YA 3OFFA 3BEGB 1HARA 3M1VB 1S77D 4RU2A 3MTKA 2B9YA 2IMWP 1J5OB 1IBKF 1YJUA 3PX4A 3CD6S 4TUGA 1TKTB 2IJNA 4NYOA 2CQDA 5IT0A 5DO2A 4ETXA 3MECA 4M5DB 2DNGA 2WRMA 4PG4A 2MQOA 2AJQA 5D3GB 1CG2A 1N0UA 4Q0BB 1JMTA 1I94F 1BLUA 3ZZUA 5IM0A 5A6WA 1DTTB 2ZDPA 1UFLA 4LFAF 2F8HA 2V4QA 3QPIA 5E3AA 1VRTB 2E66A 1TKXA 5J2MA 1N56A 3T6JA 2UVUA 2ZH7A 2VA2A 2KT3A 1X4BA 2V89A 2FHJA 3HKZD 2A3JA 2YQ3A 3QAEA 1X0PA 3OHAA 3TVZA 3GIKA 3V6DA 2Z2MA 4ZPBA 2ODRD 3VWSA 1T03B 3SCJE 4WFBQ 4DV0E 2U1AA 2CQ2A 2L33A 2BRLA 4A8XA 4LQ3A 3AAWB 1RA7A 4RLEA 1YJ9S 4OOGC 4I68A 2UUAF 4Y34A 4YR3A 1BC6A 3L7PA 3DRPA 4PQAA 4CH7A 2KFZA 2FVPA 2B5JA 3MPVA 4DV0F 2OTJS 4NYPA 3TR5A 5H9EJ 1L3UA 4KTQA 3DYAB 2NS1B 2I9SA 1JLBB 2VFVA 2XLJA 3SEOA 4JYAE 1L3KA 2BYCA 3C6UA 1QVGR 3PJXA 4URGA 1OO0B 1HQEB 2MY8A 2E29A 2ZH8A 4ILLA 2XBPA 2LDYA 2MQLA 2V83A 3PR5B 3CE8A 4PWDA 2IRUA 3J81C 1D3WA 2OPQA 1HWUA 2VV5A 5F8LA 5KFQA 1ZBQA 1SUQB 3IR5B 4OI0A 2R7XA 2VBXA 2X1GA 1BGXT 3FGVA 2QA4G 2H36X 3OFHA 3QO9B 4TQRA 1UP1A 1NHUA 4LF8F 2LTRA 1YYKA 2RH3A 2AX0A 4URSA 5T7LA 4NLDA 4DSLA 3H09A 3MM7A 3VTIA 1K8AT 5D4PA 5KT7A 3NNHA 1QE1B 2HHUA 4ZLPA 1EKZA 5KG2A 1YYWA 3N4WA 1TFYA 1N54B 2P9GA 5IM0B 2KM8B 3NNAA 1FXRA 3RAMA 4HTIA 1U09A 2UUWA 4J9SA 2XULA 4A8YA 4Y2KA 2IRYA 3I96A 2AWZA 1M5KC 2J6TA 4QOTA 5T6JA 4YFUA 4OV1A 1XN9A 5I3UB 1QAYA 3TANA 3FEZA 3H2UB 4AQYF 3V81A 3P6YC 4Q8FA 3NS6A 3V5RA 4GO5X 3M30A 5E5NA 2GIRA 3TX8A 4C8ZA 3VAHA 1WD6A 4PWUA 1RK8A 4YB5A 1RA6A 1YJTA 1HBUB 2YKQA 2M9KA 1S0OA 4F54A 5KG7A 3H5XA 1TV6B 4RW7B 3DRSB 2LUQA 2EZ6A 3FNNA 1RTJB 2YNGA 4KAIA 4Y2IA 5KFMA 3NLCA 3MMBA 2B5JB 3HHDA 5I4MA 3J7Z5 1U1MA 2FJWA 5LJ3Y 4IOCQ 4YY3E 3UW1A 2WOMA 1C1BA 1Y3KA 4RU9A 1XNRF 2WK4A 4C8LA 3NWGA 3NMRA 3IWCA 1UHZA 4EU0A 1C4CA 1HQEA 3OJSA 4A8MP 4QIVA 2C3PA 1XNQE 4I6AA 1T3OA 1YG0A 2HLUA 3ADJA 3I5BA 5FDLA 3TI0A 3GG0A 4I4BA 3HK2A 3SQGB 1BQMB 5DG7A 2HFOA 4QYZJ 3QO9A 1WACA 4WU2A 1QAXA 3T9ZA 2KRBA 2HMIA 1KQSR 3PY8A 3CULA 2FHJD 1GZ6A 4ZA1A 3M4XA 4KSEB 3LGNA 3ZZPA 3M8QA 3IG1B 3EUNA 3JTPA 4M63A 4DMIA 3PXGa 5ADZA 4EBDA 4JYAF 2C2RA 5KFDA 2QA1A 5DM6Q 2R2TA 3OBIA 5M2UA 2R9LA 4F4XA 2HGLA 3K5MA 4QR2A 4B9UA 2MKCA 4WIIA 4NZ7A 2D1CA 2C3YA 1CPZA 4ELVA 3MPYA 2XSFA 4C8NA 2GV1A 4ED1A 1JXLA 4B3OB 2L2NA 2J6UA 4DV7F 5HBMB 1HNXE 1HHTP 5C5JA 2J0QD 4GEQB 3AH6A 4B9MA 3MMCA 2WSEC 3VCDA 1X9MA 2JOQA 1WHVA 1IQTA 2RS6A 2D41A 3MMAA 5KOWA 5IT9C 1APSA 3BO3A 2N7YA 2RSQA 1HNWE 5C24A 5G4DA 1XWLA 2F40A 2YKMB 2FVRA 4DF8A 4ECTA 3KG0A 2ZH6A 3CO9A 4B9LA 2DH7A 1OQ3A 3D0HE 1UAWA 1IBLF 2M7QA 1OQ6A 1S1UA 4LVOP 3CWJA 5E41A 3KK2A 5EGYA 4RUAA 1HMVA 2DHSA 2L9DA 2XEXA 2P9CA 4OIXA 5U47A 4ZKAA 1WHWA 4AUKA 3J7A1 1GH8A 2LRSA 2E5GA 1SL2A 2FHMA 2ROEA 2M8DB 5FDLB 1VQYA 2B4PA 2LQBA 2Z0GA 2ZE2A 4ELTA 2MQQA 3LP0B 1Q4RA 3DM2B 3C8YA 5DRKA 3C2PA 4JI4F 3VYYA 4WYLA 4GMKA 1FRXA 2IVYA 4J9LA 4JI0F 3VAIA 2JHEA 2BJEA 1T05A 4TYBA 3T5JA 3M8PB 3C6UB 2XGQA 1YQHA 1VFJA 3BR8A 2ZVSA 5LSRA 1S9FA 3H5YA 4DR3F 4J5OA 3KHRA 4NCGA 3MR2A 2E5HA 1JIHA 4HL9A 3MAQA 4A8FA 2B43A 4K5SA 1F9FA 2R8GA 4PWDB 1FKOB 3NNCA 3QGGA 1NKBA 2I38A 3H40A 3T1HF 1C4AA 4MMOA 4DF4A 1DRZA 1TAQA 1QVFR 1RTIB 2B9XA 2DNPA 2MSSA 4C3MA 3MMJA 4ID5B 1STUA 4O23A 3KLVA 4JI0E 3C4TA 2Z2LA 3FDSA 2IYGA 1Y3JA 4IDKB 2CQ4A 2AW0A 4I6WA 5D77A 1L3TA 3I4PA 2GW8A 2FD2A 3GSDA 3N6NA 4QWCA 4MKYA 2M5YA 2CQIA 2JLFA 4V19X 3JYTB 4WZQA