1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
molecule keywords Peptide chain release factor 1
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
4JI6E 2DIXA 5LMNE 4GKKE 1YYWA 5LMUE 2ZM6E 2HHHE 1XMOE 4DR1E 2LRSA 4X66E 3P1XA 4X8WA 4LFBE 4JYAE 4JI1E 4DUZE 1J26A 1X49A 2L2KB 1STUA 3LLHA 4DV7E 1FKAE 4DR4E 5CFFE 4K0KE 1N32E 2F4VE 2NUGA 1IBKE 2LJHA 1IBME 3HTXA 1T4NA 1J5EE 4LF4E 1N33E 2DB2A 4B3RE 4KHPE 1X48A 4DV4E 1RQ0A 1XMQE 2DMYA 2E5LE 1O0WA 2NUFA 4DV1E 4WYQB 1HNXE 2RS7A 2RSMA 2NA2A 3T1HE 2L3CA 2N3HA 4JI4E 1HR0E 1QU6A 2UXCE 1ZBTA 1I94E 2LBSB 3ADLA 5IWAE 1HNZE 4DV5E 2L33A 4LFCE 2N3GA 4DR7E 4DV2E 4JI3E 3J7Yp 1XNRE 2LTSA 4DR6E 2LUQA 4JI5E 4JI8E 2EZ6A 2B7VA 1T4OA 4GKJE 1YZ9A 4JI0E 4DKKA 4JI2E 4DR5E 4OX9E 3C4TA 2VQEE 1FJGE 5BR8E 2JVAA 2JY9A 3T1YE 1T4LB 2LTRA 4NXME 1UILA 1GQEA 4WFTA 4YHHE 4YY3E 2UU9E 4LF5E 4LFAE 1WHQA 4M30A 1EKZA 2L2NA 2UUBE 3ADGA 2YT4A 4B3SE 1XNQE 2CPNA 2KHXA 1X47A 1PKPA 4AQYE 4M2ZA 2UUCE 1YYOA 4X64E 2L2MA 1N36E 2LUPB 2NUEA 4DV0E 1WHNA 3C4BA 1RC7A 4DR2E 2RTXA 4LF6E 4DUYE 4X65E 1HNWE 3VYXA 2MDRA 2UUAE 3ADJA 4LF7E 4JI7E 2B7TA 2UXDE 2RS6A 1N34E 2UXBE 2B3TB 4JV5E 4DV3E 4OOGC 2IHR1 4LF8E 3VYYA 4B3ME 4LF9E 4DV6E 4X62E 3ADIA 4B3TE 3OTOE 1UHZA 1DI2A 2VQFE 1IBLE 4NXNE 1YYKA 4DR3E 2L3JA
chains in the Genus database with same CATH superfamily
1VQLS 1RUSA 1H7XA 2FUG9 3NCRA 1PGZA 2GAGC 2DMIA 4PG8A 5KT6A 4I1TA 3H2LA 4DUZE 2EL5A 1VRTA 5KFQA 2DR5A 1DURA 4QU6A 2W2NP 3KG0A 3DKDA 2J6UA 4G1QA 3CCUS 2R3VA 4DF4A 4WYQB 3TVYA 2VG5A 5JUMA 2QMWA 5JMNA 4K4ZA 5E3PA 1QAIA 2KOUA 5LOQA 1VRTB 3CJ4A 2EN2A 4F7VA 2MEWA 5IV4A 5ADZA 3QRQA 3F6HA 3LMLA 1EZZB 2I6WA 4FN5A 2ALZA 1Q8LA 4GC6A 2HIQA 5C7PA 4R03A 2YTQA 3IA0A 4MAKA 1VCTA 3EICA 2JVAA 4B9MA 5DGAA 4WU3A 3LGHA 1HBOB 1YBUA 3IMQJ 2MKKA 3M1VB 1ZZNA 4ZVHA 4TLQA 3X1LB 1JNRB 3BH6B 4QWDA 1RHUB 2XMJA 4FS2A 5K9FA 5AE3A 3D6TB 3SCLE 3N9UC 2ROGA 1GFWB 2HQGA 3QPIA 1U09A 3VK6A 2HVEA 2XO6A 1WACA 2CPHA 5A0YA 2OEJA 4YQWA 1MWZA 1NSQA 1SL1A 4NLWA 3BDPA 2O5DA 2CQGA 1M5KC 3H90A 4F3OA 3IP0A 1FK9A 3IN5A 4DDFA 4ID5B 4USWA 3ILIA 3ZFVA 3B4DA 5HMWA 3TZZA 4ZYDA 1WOSA 3KLIA 1HW8A 3MR7A 1HNXE 2DHGA 1C1CB 1H73A 2MQQA 2EN3A 4W4MA 4OYMA 4URGA 4OX7A 1JLEA 1CC8A 4O0IA 1S1UB 2AX0A 2NPIA 2AGPA 4JI8J 2GO8A 2JYAA 3QRRA 3BGOP 4ZVTB 4RKUC 4R2CA 3KJVB 1VFJA 4IG0A 4KO0B 4DSEA 4RL1A 4WFTA 2W8KA 4B9UA 2EWLA 1B64A 3ULHA 2HURA 3KUEA 3PEJA 2MKHA 4L3NA 1MNEA 2C3YA 1CJKA 2M9AA 1YRUA 5KT3A 4CO4A 4OV6A 1PCAA 4LBIA 3I5CA 3KDOA 4ERDA 2EOJA 4JV2A 2W01A 1OSCA 4KHPJ 1RTIB 2OLWA 2E44A 2GIFA 2IMOA 5B0FA 1XEZA 3M9MB 3ADIA 2QMUB 4Q2LA 2VIHA 4WYWA 8AT1B 4BC7A 2VFUA 3OJSA 2C2OB 1V5VA 1ICEB 2PN6A 4QWCA 2AGQA 2FHMA 1Y3KA 5IXMB 1RWPB 1KLMB 2DY1A 4PG6A 4K4TA 3DF6A 2YH1A 4NZVA 3MEGB 4KHPE 2MZQA 4IYQA 4P7DA 3VVUA 4XPCA 1BMQB 1PJQA 1RT4B 1ZBTA 2VDIA 5IWAE 5F8LA 4X62J 4OZ2A 3UVJB 2B9DA 4M95A 4LIRA 4OX9E 2E5IA 2DEIA 2F7VA 3IO1A 3EPGA 3TYTA 3NRBA 4CRJA 3A4TA 2BE7D 5ETSA 1ZM9A 2OPPB 4WWSA 3Q8SB 2Y1IA 3IFEA 2F8BA 2H4WB 5GMKa 2XHWA 1FNOA 1Q8BA 3VYXA 5D8HB 2UV8A 4ZP8A 4N77A 1QUPA 5KFFA 1SIZA 4KFBA 3MTKA 2EXUA 4MMOA 2FZGB 2GMHA 3T41A 1UP1A 2YTGA 2IM2A 3MM7B 2DRBA 5LMNE 5KTQA 3LGNA 4ATNA 1HI0P 5THWA 2YX4A 4A8XA 3MPYA 4LFBF 2XHCA 3U1MA 1PYTA 1Q7LB 1NEEA 3N6LA 1NK8A 4J5OA 2BKPA 4O4RA 2QA1A 1IBLF 4AL6A 3QAEA 1SB6A 3CDUA 2EWHA 1WEXA 1LOUA 1IR0A 1J5OB 2YWQA 4DR7E 2BOPA 2I9SA 2AJ4A 4DR6E 3DLEA 3SQGA 1O6XA 4O0NA 4RW6B 4R2DA 2DR9A 4M5IA 5D6GA 5LJ5Y 3LQVA 3J7ZT 4ECZA 4ZHRA 1FJGF 3Q8YA 4LFAE 3MM5B 4CO5A 5LL6R 3IWNC 2CQDA 1TV6A 5GAEI 3OLAA 1U48A 1EQMA 1R8HA 4ZPAA 2XGPA 2XLIA 4FK5C 1WF1A 4DMIA 2W2OP 1X5SA 2IM0A 4XAKA 1GTKA 1S79A 5BYSA 4FPRA 1YJUA 5AC4A 3DDIA 1HBUA 2ZZMA 3D6MB 3DRPA 1RADB 3OXGA 2B9WA 2CYYA 1GXLA 3RG6A 3T9ZA 2HHHE 1SC4B 4C7QA 4PZVA 1JLFB 1U1QA 5CHCB 4G65A 5A6PA 1KJKA 2YPZA 2VL1A 1KOOA 4PQUA 1IN0A 4Y2AA 1DLOA 3VAHA 5A6WA 5IS2A 3HJFA 1S1XB 4U67Q 3ITHB 4ZPDA 3GZ7A 3SV3A 3F44A 2CJQA 2C2ZB 2DGUA 1Q5VA 4WIIA 1BBGA 1N6QA 3CJTA 2JRSA 3GR0A 4OJHA 4V19J 2EZ6A 2OMLA 5C25A 3E01A 4JP8A 1FK9B 3QMQA 4I2PA 3R9LA 2D3OR 2JPAA 4IG0B 4KO0A 3DLBA 2EM5A 3MEDA 3MAQA 4NZ0A 2I2YA 4ENOA 2UUCE 3L09A 2LQJA 2AD9A 2NUEA 2IIHA 4C8YA 1NCLA 2XZTB 1Y0HA 5IT4A 3NG8A 2QGFB 2N82B 5L1IA 2L6MA 4RUAA 2UUTA 2V85A 4JI5J 1B4SA 5T6JA 1WKJA 3M1VA 4ZMMA 2L92A 1GMWD 3DHWC 2WRMA 3WQPA 3AOBA 2Q1LA 4IO1A 3M9NB 2WCXA 1STUA 1X4GA 2IA0A 1BBOA 1Q1KA 2GVDB 1Z2LA 1MU2A 2XMMA 3EXYA 4DJBA 4PCQA 4LUBA 4DV4E 1R8PA 4WFNQ 3UDLA 5AXMA 3Q89A 2MQPA 3FEYB 5HBMB 2G0IA 2X3DA 2U2FA 3C6TA 4BHQA 4RWXA 3T5KA 3C4TA 2F8MA 4QBUA 1NU4A 1VBXA 2DYAA 2Y8WA 2E1RA 1WELA 4JOUA 3TUZC 3ICLA 1UVIA 2YT4A 4QIEA 1VJWA 2EI5A 3PIPQ 3ADAC 2OFGX 1S4FA 4UOFA 3OPKA 5GMEA 1AUDA 4Y65A 3MTJA 4X4QA 3ONQA 3L3CA 2FQQB 3HD2A 2C2DA 4A8QA 5I42B 5KFNA 1S7IA 9ATCB 4UY85 1VQYA 4WF9Q 4EO6A 1ZM2A 1B70B 2GMLA 2XCAA 3TUJC 2M7SA 1RHQB 4IO9Q 2YNHA 4L72B 1M90T 1TN9A 4RW9A 3ENWA 1VQ6S 4ZLLA 4DS5A 1ZTTA 1N33F 3TZXA 2N8XA 3T5HA 3BGRA 5H9EK 2DXDA 3PW4A 3B6BA 3W65A 3FCWA 2PE8A 2UV8G 1FDNA 3HTXA 4XK8C 3GYXB 1XMQE 2DMYA 1Z1ZA 2V0NA 3GTYX 4GVBB 5IFMA 2EK6A 3E01B 3BYPA 4X9JA 3GJRB 2NABA 3VGTA 1NZ8A 3OD2A 1RWMB 3RAQA 2F4FA 5KL3A 4DUZJ 2YTCA 4CIOA 2UUAJ 2RU3A 3DOMA 1HQEB 2MDAA 3CJSA 1NCSA 2NXEA 3HZEA 3H8YA 3A1YG 4RW7A 2YY3A 1AYEA 2KVIA 3T1YF 3FRYA 3J80U 1K47A 3UNYA 2KB2A 5IT9C 5KOWA 5E3AA 4DR7J 4C11A 4TU7A 3VYYA 3ZZTA 3C14B 3V6DA 4ECRA 1S1UA 2RJZA 4KHRA 3BO3A 2VPXB 3HXMA 4HDGA 1FX4A 4DF8A 1GH8A 4N47A 2PC6A 3TA1A 4OHWA 1D8ZA 3D9BA 3DLLQ 5KFOA 1K44A 1KVJA 4I6AA 3VGSA 4L73A 1UZDA 3W5ZA 1XNRE 2R7VA 3H5YA 4UT4A 4H54A 3OTEA 1K1QA 1WUUA 4IQMA 3MURP 1TAUA 2HHHJ 3K5LA 3TWZA 2HHSA 3CC7S 3KK3B 2WBRA 2QYGA 2CPXA 3TX0A 5B7WA 2IRUA 4M2ZA 2YWKA 3TA2A 2ADRA 4R8UB 1TKXB 5D4PA 1VQNS 2EC2A 5KL6A 1FX2A 1MMNA 3I9ZA 2V8QB 4C8ZA 4CNYA 2VODA 4DL6A 6FDRA 5IT0A 1VK8A 3D28A 3RR8A 4CZCA 3BM7A 1ZAXA 2CJBA 4J9VA 5GADU 2L3JA 1X5WA 3PY8A 1DBDA 4GMKA 5CH7B 3M8RA 2YNGA 3VCDA 2P6SA 3K0JA 1KRPA 2ZITA 2WSEC 3PDNA 2F4VE 1SQEA 2CJYB 4LF9F 4Q35B 2HYIB 2ELYA 3FCVA 1CG2A 2EORA 2IAJB 2NYIA 2J0SD 2KTQA 1N5TA 5AXNA 2JOXA 5A8WA 2M5YA 2JSXA 2PA3A 3HT0A 4OIXA 4K4VA 4WPYA 2RQLA 2ZD1A 2RHSB 5D78A 2P2CB 4WXOA 5H1SV 5DM7Q 1IR2A 3V6JA 2WOMB 2J7KA 2J0QD 1PYOB 2RF2A 3VAMA 4F02A 2EMXA 5EGYA 5HLFA 4C3LA 3IRWP 3DU6A 1N5QA 1OY9A 1RP5A 2AYEA 2EFPA 2MKYA 3ISZA 4C11B 1JJ4A 1T9WA 1X9SA 1VK3A 1IUJA 2R1FA 2CPYA 3AJDA 3VZHA 2WK4A 1EAYC 3G71S 1RE1B 2HQIA 1H74A 2LQ5A 4ZCKA 3BPSP 4S0MA 3MSWA 1HWLA 4NLOA 1EX8A 1YUIA 4IRKA 4F04B 1WC4A 1L3UA 2V2VA 2K7IA 3IC1A 2HWHA 2LEPA 4M1KA 5LL6d 1E6VB 1ZM4A 4NYPA 2E9ZA 2G1HA 5ETMA 1IBKE 4JV1A 2OAUA 4DR2J 2HNZB 3B8HA 1T11A 3J7YI 4BMJA 3QT5A 2RSMA 3HSGA 1APSA 2L3CA 4JI4E 2EC0A 2YWWA 3LWMA 2JX2A 1HBMA 4N41A 5E3RA 3W2WA 4LJMA 1WTFA 2IDLA 2GGPB 1SQFA 1FTCA 2OP5A 2J7WA 4F9AB 1J2VA 1N54B 2ZFHA 4K7QA 3D4JA 5E3CA 3ZXWA 1D0EA 1RT1B 4CTAB 3AHPA 2D1CA 1WJPA 5IV8B 2NUUG 1JLBA 2EBEA 3TUPA 1WHNA 3DRSA 4DL2A 1FFSB 2ZC3A 1HR0F 3HO1A 1SIWB 3AAWB 3QT8A 5I4MA 3M05A 2OSQA 2VBXA 3KJNB 3S01A 3HKWA 3GQCA 5A6AA 2PD1A 1JIHA 2P9EA 3OHAA 4JYAF 4HACA 3DXBA 5AXKA 2EN1A 2HFOA 4KE5A 1MROB 3VZIA 3BR8A 3T19A 1RHJB 2GS8A 4M0VA 1LWXA 5CZXA 2RSQA 2WZ1A 2OTJS 2W9BB 4AL5A 1A1GA 4LFCJ 3FQKA 2O66A 4YY3J 4NLVA 3CC4S 4Y28C 2E1MA 3BN4A 2Q66A 3HX9A 4B3TJ 2A18A 5IZHA 1JQGA 3QZ7A 2DHAA 2GGPA 4DFKA 2XI2A 3VV2B 2K4VA 4J9KA 2MQMA 4BHCA 2H3EB 4LF6E 2KO1A 1JK2A 3LALA 4LF8J 5D0HA 2F8HA 5A76A 1U2FA 2BANA 4N5SA 3MEGA 1R43A 4ICLA 2WBSA 1VQ5S 3BREA 4IG3B 4I2PB 4NLQA 1VOMA 1IKYB 2MJNA 4QJVA 8RUCA 2OKQA 2RUSA 3QNWB 2V86A 2EMGA 1NB7A 5LJ3Y 1IBKF 2FJXA 3K5OA 1H2VZ 5JJBA 4AUKA 4LRAA 1JXLA 3Q8UA 1SC6A 2XGQA 1RWUA 1G7CB 4Q28A 2K7KA 2BUNA 3CCWA 1UFLA 1U1MA 4EZ6A 3ADLA 3KKFA 5H9FK 2QLBB 1HNWF 1QLNA 1WXRA 3DCAA 4KH1B 2HC5A 2L9WA 5HLFB 1ZYQA 4WYLA 2EPNA 3EDRB 3D6HB 4O5GA 4MK8A 3DRPB 1EP4B 2EP3A 1SKUB 3QJJA 3DHXA 3W2VB 2HLTA 3BSAA 1WC1A 3HSJA 3ZZ0A 1UZHA 4DU7A 5L38A 2BE2B 1MWYA 1HNWE 3R5GA 3M8QB 3OL8A 1YJRA 1WEYA 3DN9A 1J5EJ 3NWRA 4AT1B 4DL5A 3OSNA 2QT7A 2HHQA 3KWMA 3ENQA 3QATA 1UJ5A 4DR4F 1C0TA 1AA1B 1XMQJ 1CJTA 4ED1A 2J9EA 3NS5A 2ZM6E 4DSJA 3UQSA 3DGPA 2ZJRQ 2HBQB 5ETTA 3TQ1A 4YUDA 1LXNA 1J5OA 1N32E 1F2GA 2QYCA 3JSBA 1IR1A 2GO9A 2R2SA 1O0WA 3CD7A 2VOPA 4BC9A 3G82A 4P10A 5KG4A 2UUBJ 3EPIA 2HK3A 1S49A 1XR6A 2HGHA 3DI6B 1TF6A 1TL3A 3GV7B 4KAIA 3J80Y 3PRDA 1KFDA 2EMCA 3A8IA 1ACMB 2YRMA 5IM0A 4RW8A 5AC5A 2YWHA 2MGZA 1RI7A 2B4PA 4N8OA 2GHVC 4X64E 1LWFA 2HHXA 1HNZF 3OTBA 2W25A 2DXFA 4NL5A 2AJQA 2DH8A 2WAQD 1UVKA 3WZ0A 2ROPA 1O0PA 4QPTA 1S9FA 3HJVA 2M88A 4DFMA 4F67A 1IQTA 4WKRA 1WC0A 1VQ8S 5C2GA 2ZJQQ 4JI6F 3JTZA 7FD1A 3BBCA 2RS8A 1PJSA 1LFWA 3M6VA 2ZBCA 3W66A 1RACB 1FWKA 2MY8A 1R8CA 2FPHX 3U7JA 4IKAA 4LBPA 4DL0C 1X9MA 4RZRA 4OHYA 1KLMA 1Z2ZA 5L1KA 4PRFA 2VQEJ 1NHKL 4C0HA 1YVFA 4WKYA 2OTLS 1R27B 1RMDA 1BE4A 4LF5F 4ED0A 3DRRA 3WC2A 3EGWB 1L4SA 2IM3A 2VZ9A 4LF5E 2H5JB 4B3SE 4OMFG 1IJEB 1WC6A 3VAGA 1TK5A 3OUYA 4ZS6A 1HI8A 1RLDA 4DV2F 3THVA 1RABB 2MHNA 4DS4A 1YJ9S 1DGCA 1IBCB 2JC1A 2VG6A 4GKJE 5KFKA 2YWGA 4EBEA 4C9DA 3NNAA 5LXRA 3O2IA 3LO3A 3R5BA 5ETKA 3P4UB 4K0KE 3R7SB 2P8IA 4WSPA 2EOHA 4B3RE 4ED6A 3CCRS 3ILOA 4R2RA 3AXKA 3RAXA 1PC4A 4WE1B 1IJFB 1R0AB 5CABA 1KR4A 3BIDA 4EBDA 4UUXA 4JI5E 3RB3A 2AJ1A 3IWXA 4CLKA 2WOMA 3THOB 2NQPA 3HVTA 2DPIA 2KDOA 1FD2A 4F54A 2X3GA 4C3KA 2PO4A 5F3TA 2RRBA 3CCQS 3HHLB 1HMVB 3MUTP 2G4BA 3QIPB 3FDSA 3BKUA 3G2XA 1BWEA 2Q8UA 4FS1A 4Y2KA 1QVGR 1LV5A 3RU0A 2AWZA 2EG1A 4A8WA 2OPSA 3W9HA 1S97A 2BANB 1J5EF 1YWXA 4HTGA 3NBPA 1PBUA 3K17A 3LF0A 3RRGA 1PJ7A 4YR2A 5D4OA 2CPFA 4U7CA 2DNOA 4NE9C 2EM6A 2CT1A 2RMLA 3P1XA 2G13A 3BZQA 3TVKA 4DR4E 1ZOTA 3R6GB 1W7WA 4YB7A 1S1TB 3W8PA 5DZ6A 1FKOB 1SBRA 2ZH3A 2FHJA 2ODRC 1RAHB 4WPAA 4TU9A 3T9NA 4LVOP 1F9FA 2R4FA 2BKOA 4DX7A 4OZNA 4MK9A 3G86A 4NLYA 1XNQF 4YDDB 4Q45A 1PO6A 3S1TA 4U96A 1HQUA 1SC1B 3DRSB 2DRDA 5BR8E 2L48A 3GSIA 2G7HA 4X64J 3CSKA 2E7VA 4NXMJ 3BJYA 2FHJD 5M2PA 1A1KA 2RUGA 2I9IA 2NS1B 2HZAA 1HI1A 2OJ3A 2VFSA 3HLUA 2LV2A 4M5DA 4P2FA 2R76A 1JLAB 1RLCL 4J9RA 4B3RF 3EDQB 1ZAAC 3HFZB 3M99B 2RB7A 4ILLA 5GADI 3NMRA 1N56A 1FE0A 2BJDA 4R5PA 2GX8A 4WE1A 1SCJB 4ZJQA 1H38A 4B3TF 1T9VA 2D9OA 4NA2A 4TLRA 3CEDA 1NKEA 1VYAA 3THNA 1BLUA 1TKTB 4JI7F 1TUGB 4LSLA 4RPFA 2VA3A 1KQKA 2ZNZA 3IRXA 2ASDA 3W2VA 2VASA 3QIDA 5CA5A 3TAMA 4IS1C 1HQEA 2V94A 1NHUA 3DC2A 1LWCA 5KFTA 1WC5A 4JYAJ 3BH7B 1EH8A 1EH7A 4MFBA 2QEXS 1Y10A 2COLA 2DPJA 2ELZA 1PKPA 4LMZA 4RW6A 2FJWA 2RNEA 2EOFA 2E1AA 5KL5A 3KFWX 1RT5A 1K9MT 2FVSA 2ZD1B 1URNA 2M1SA 1JJHA 3O6QA 2IJFA 2QV6A 2RAQA 1RDRA 1Z1BA 3RZAA 1FO1A 2HJJA 3PFOA 5HO4A 4XDDA 1YFHA 4Q0BB 1G2DC 2GJFA 1H7WA 3V4IB 1ITPA 4L76A 3LAKA 4X84A 2HFVA 5K8PA 4ZVQB 5CFFE 5D0GA 4G6VB 1C0UB 4X4VA 4FYVB 4DQRA 3GWCA 4DV1E 2CKWA 2VC0A 3KG1A 1B0PA 2C3OA 5FLXC 3PEHA 3ETMA 4DUTA 1YJWS 1FDAA 3IAS9 4DV4J 3UE2A 1VDHA 2V2ZA 2NREA 4HACB 1RAAB 2WVDA 3C2PA 2EMYA 2JR1A 2IVMA 3JQMA 3RTVA 1YX2A 2KT3A 3ET6A 3F0NA 3G4SS 5IQQA 5BR8F 2MQOA 3RB6A 3UCUP 3MHSC 4QIFA 1A9NB 5KFDA 1FRXA 5F8IA 1S0MA 1Y5NB 1XNQE 1MMLA 2VD3A 1L3KA 1HNXJ 1MN9A 1W26A 1KQGB 2B7CB 2ZH2A 2MC6A 2XMTA 1A1IA 1CQMA 1WDDA 5EUHA 1F1BB 1Q8KA 1N32F 4RLEA 1Y9OA 2WBUA 5IWAF 1MW7A 2CVIA 4MTPA 2UUCJ 3CJ3A 3MCOA 4DCOB 1TL4A 2KN4A 3MM8B 2F40A 1CJVA 3PRVA 3G82B 4ELUA 4R0EA 1XMOJ 1TUVA 1TL1A 4OX6A 2XY7A 4R2AA 3UR0A 4MKAA 4QU7A 2ACMA 4DHVA 3S8SA 2ZKUA 3IAM9 3UN3A 1S76D 1Q86T 2IJNA 3I4PA 3OTOF 4HH0A 4RWWA 4BWMA 3P3DA 4I7FB 1I3OB 2BMBA 4USIA 2BM0A 1RTDA 2BBEA 5HAOA 2B7VA 4BWJA 1NDLA 3H7HB 1LW2A 2H4YB 1H2TZ 4J9SA 1RWOB 3AA9A 1RT7B 8ATCB 2QG9B 1FI4A 4I0WA 4KRWA 4R2SA 3CVKA 1KSPA 4B9NA 2Z2LA 1WG1A 3CNQP 2FJVA 1SKSA 3IWBA 5KFWA 3NOCA 1U49A 1F3VA 3QRPA 2XMWA 1XWLA 1V6HA 4NLDA 1X7VA 1VC6A 1F5BA 4BDPA 4YFUA 5C5JA 2JEIA 4B3ME 2XS2A 1CJKB 2DIUA 2E66A 4O3QA 3KLEA 3DMJB 2UVUA 1XMOF 3H20A 2KXFA 1YIJS 4ILRA 1YG0A 4X66E 2KHDA 4YHHJ 1HBUB 4AQYJ 3CMQA 4OYAA 4NPOA 1QJHA 1UBDC 2HHHF 2ASYA 1LEOA 3K5NA 2Q79A 1Q16B 3SDEB 1BD6A 3Q2TC 2EPIA 4FYYB 1RAOA 1GEHA 3L4BC 4DV2E 3P5BP 2H5EA 3K58A 2JWOA 4CH0S 1CEZA 3K5PA 3M8YA 2ZOGA 3T1YE 4C8LA 4ZPBA 2EPKX 3CCSS 2ZBRA 1FFWB 2ZUGA 4M30A 2PI4A 4U8VA 4RNFA 4KQZA 3TW0A 2EN7A 3FRZA 2EG2A 4WXCA 4ZLJA 3RRHA 2V8PA 4F0HA 3G96A 4ZYEA 4R25A 3D3CJ 3G6ES 1U6ZA 2O3DA 4NWBA 3T1YJ 4K0KJ 4DR7F 5CCLA 1RYSA 2JC0A 4RO0A 1UPMB 2J7UA 2BX6A 3TAQA 5G0RA 4DUZF 3A8KA 1YJ7A 2DNQA 1RAIB 5KFJA 2CQ1A 2UUAF 3M32B 2CIMA 1VGYA 1U6BA 5IC4B 5J2PA 4W98A 1NHVA 4R8OA 5F9LA 1UJ4A 1RBAA 3OXFA 2LFVA 3FNNA 1TK0A 5KG1A 4BCAA 1IM6A 1NK5A 1TQLA 2JWNA 5DDOC 4C2MA 1F9HA 5D0RA 3B78A 5C2CA 3TJ8A 1SC3B 1N33J 9RUBA 3JAMC 2B9XA 1N8RT 3GJSB 3MM6B 2CJKA 3CO0P 1UILA 4ECSA 2JL9A 4U95A 2D74B 2YTPA 1UA0A 3SCJE 3MCMA 3UO0A 2B51A 3DFEA 3BPDA 3H42A 2C42A 1O51A 1RT2B 2OD4A 3PJXA 3GCXP 3D6FB 1C0TB 2ZOMA 1TFYA 3Q24A 4ZITA 4ZOSA 2F65A 2BXJA 4LRBA 3DI6A 3H09A 1VBZA 4KKOB 1ZZFA 4LF8E 4TXSA 4DBQA 2FLOA 2V2KA 4RW7B 3R7NB 4NLPA 2OELA 4KPYA 4LQ9A 3H0PA 4ZP7A 2L9NA 4NCGB 2ZBQA 4IRDA 3I6PA 4KPCA 4X4UA 2W7PA 3NWGA 2X1GA 3D0HE 1T9XA 4E8UA 5KFCA 3U1NA 1SUQB 2HNZA 2D3O1 2HWIA 2FGOA 3HHDA 1FRKA 5SUHA 4ZLPA 2ZVSA 2EVZA 4C3MA 4DV1J 5KFIA 2V9WA 1S10A 1F5AA 2PFDA 2O1PA 3A8JA 1BQMA 2EQ3A 3M8QA 2K3IA 4JI4J 2EOZA 2OI2A 2VBYA 2CPEA 1HYSB 3IR7B 4DKKA 2NXUA 2B43A 3P49B 4EWTA 3ITHA 3BO2A 3DYAB 2YKPA 4P78A 4RW9B 1UWAA 4PQUB 5KFYA 4ECWA 2CNLB 2V8GA 4JI5F 5B0BA 4C97A 3EM1A 3R1LA 1WSVA 1ELOA 1U6FA 2C2KB 2A1BA 4P2XA 4R5PB 4E0DA 3SQGB 3MAAA 4CLZA 1MSWD 2YX7A 3M2RB 4DPXA 4LIWA 2CQ2A 2F4VF 1OQ6A 4X4OA 1M1GA 5DNYA 2A10A 4J9LA 3GFXA 5A2QU 5CCMA 1N5YB 4ZP9A 5LMUE 2E5JA 2ILYA 4EGLA 2H9ZA 4RUHA 1TR0A 1X49A 3C8YA 3NOGA 3OTCA 5KG3A 2FLPA 1DTTB 3C16B 1IKYA 3SZ2A 3CCZA 2HVHA 2YBVA 3FMWA 4NEYA 5I3UA 5I42A 1Q95G 4WK1A 3RBDA 1QE1A 2ATLA 2OEKA 3J7A1 4FYDA 1G2FC 2GVDA 3CJ2A 3U1LA 4KZSA 3W60A 3MD3A 4IRCA 2BQRA 5DG7A 3O8WA 5HQ8A 1WF0A 3JSMB 1D9DA 2VQEF 5F0WA 3R2CJ 2N4CA 4YY3E 1XR7A 4GRSA 1D9AA 2HQCA 2UXCJ 5D0EA 4QR1A 1U7LA 2MSSA 3EZ5A 2X1FA 2YKOA 3ET6B 2APOA 2OMOA 2OPRB 4DWIA 2IM1A 3ZZPA 3KK2B 5RUBA 1R31A 4DV3E 5F8NA 4DR6F 2IHR1 4USHA 2YZTA 2FLLA 4M5NA 1X5OA 5J2NA 4Y2MA 2XO7A 2XEXA 3EGNA 4F26A 4PEOA 1FEHA 1HNZJ 3CB4A 5L8RC 4PG4A 2QL7B 4R2EA 4O3SA 2GNKA 1W2IA 4K5RA 2QMXA 3NCQA 2EPRA 1RQ0A 3O3LA 3M7VA 1TL7A 4MYUA 4CDIA 1H72C 3PVXA 1HR0E 1IBLJ 4WP8A 4DR3J 1HNZE 3J7AN 1XTZA 1M5HA 2HHTA 3W5YA 4JI2J 2GLIA 1NSAA 2EOMA 2MKSA 5DJBA 3GLJA 2ENCA 4DV2J 4LFBJ 3V6KA 2HHVA 1NB2A 4J7CA 1JLBB 2HFSA 1R0AA 1RWVB 2CJAA 1UEVA 4MJKA 1G2EA 4F4YA 2Z0GA 2HGLA 4EYIB 3CWJA 4CCHA 1KONA 4EO8A 1T05B 1PJ6A 4OLOA 3LW5C 2I8EA 4QW8A 3F41A 2PMWA 3GFZA 1F3FA 3OFFA 5DQIA 4UY8T 2C1EB 3FEZA 4RUCA 3ZC4A 4RHBB 1MG7A 5DG9A 2CVEA 4OOGC 3UN5A 5DDQC 2EFOA 2L08A 1K1SA 3MR6A 1PILA 4LSZB 3KLFA 1VJQA 1BB8A 4BS2A 3BKTA 2I0XA 4RJVA 3OR1A 4URSA 2ZZTA 2EPCA 4J9QA 4DR1E 3MMCA 3ISNC 1XMBA 2R2TA 2GHWA 2RIJA 5JVHQ 4ZJOA 1S48A 1SPBP 2JVOA 2M70A 1NRKA 3LGMA 3CC2S 5ETNA 5E2QA 4EBCA 3LH2S 4WZMA 1Q8IA 3NGUA 1NBEB 2AYGA 2DNHA 4LFCE 1NKBA 3OFGA 1GAOA 4JI3E 3K8WA 4XDCA 5CXTA 4J90A 2Y0BB 3UN2A 2LMZA 1BQXA 2R7UA 1OPIA 3CDAA 3KXDA 2X1BA 1C1CA 2W7OA 1HNWJ 2EPUA 1S9EA 1NK7A 1NSPA 4ZHRB 1OPZA 3FBCA 2MZ1A 1VQ7S 2FHOB 3GIJA 4KFBB 4DSKA 4DFJA 2JOBA 2Y3YA 3C4BA 3IWDA 2W9CA 4PXEA 3BGHA 1R6VA 5EN1A 2M0GB 5HVHA 4ZVSB 2D3ZA 3AQPA 4JUZA 3D1HA 2LCWA 1IKXA 4Y2CA 1NDPA 2YKMA 2ENAA 2CADA 1S6OA 3KJQB 2CQPA 4LTYA 3OVAA 1S7HA 4G1QB 2GPIA 2KKHA 3KNGA 1PJTA 2AJ0A 3FIGA 2IRYA 1RAEB 3MAHA 1VBYA 1J26A 4NHRA 2GIRA 1X6FA 3SV4A 3ZOQB 1MU2B 2ZBIA 4C4WA 2MGZB 4PYDA 2FY1A 4WFAQ 2B6AB 5KG5A 2ZJPQ 3I56S 2QLJB 2DTJA 2OPSB 4KB7A 1S0VA 2J8SA 3CDEA 2OEMA 3M4XA 2MKDA 2DH9A 3PR4A 1Y7PA 3EPHA 1VMBA 3MEKA 3GG0A 1MN7A 6FD1A 4Z7CA 3JB9k 2BV3A 1PAEX 4P7VA 1XNRF 2N3LA 4YDXA 2BQ3A 3LWLA 3QYYA 3MXHP 2XC9A 2MDRA 1T8EA 3ADJA 4WTYA 2EN4A 4ZLNA 3VHTB 3PIOQ 1N34J 1VRUA 4KGXB 2E5GA 3N6NA 2IC3B 4K2JA 1CSJA 2LRSA 2RD5C 3W1YC 3LPYA 5IXUA 4DFPA 4HTIA 4PG7A 4YS2A 4LF4E 2HIYA 1HNIA 3G8SA 4U6PA 4PYAA 4RU9A 3OR2A 3J80C 2XULA 2UXDF 3G6YA 1S0NA 3M2UB 1CQNA 3GPAA 4J37A 1NNDA 3L00A 3ZTRA 3WHIA 3OL6A 4NZ6A 1M5OC 3DMJA 3OFEA 1RWKB 2RS2A 1UETA 3R3TA 5IT9U 5LSRA 2CPIA 2B5JB 2J0XA 3IXQA 1WI6A 2B0GA 4I56A 1OS5A 2SXLA 2HGMA 3KOAA 2EOSA 2EFQA 3SMZA 2C3MA 4OJGA 2RHQB 1T3OA 3MR3A 1YDLA 1C4AA 1HNIB 2CNNB 3HCXA 4YY3F 1TL1B 1AAYA 1WI8A 5ETOA 5IT9Y 1SV5B 1WNEA 3D1QA 1MMDA 2UVVA 3MM8A 2B7BB 2ZNYA 1HNVB 3CXCR 1QTMA 2NCKL 4KIAA 5F41A 5C24A 1OYDA 3TNVA 5CYQB 1FCAA 3I82A 2JEJA 1NM2A 5IQ6A 1GMWA 2KHCA 1BXNA 4JI0J 4DV7E 1FKAE 1PC5A 2L3MA 3I31A 4DV6F 5EX0A 5DDRC 2CJ9A 4L75A 4ZCMA 2EK1A 1KHVA 1R3NA 3RGIA 3AOAA 3MOJB 2VG5B 3AT1B 4GO5X 2NZCA 1VLOA 1URRA 2PMHA 1HR0J 1SH2A 4C48A 4G1IA 3BV8A 1AFIA 1JJCB 5DG8A 2P9GA 3DLHA 3NGSA 3QO9B 4ZVFA 4C0BA 2CPZA 2L41A 3IM9A 3CJ8A 3GMGA 3W3SA 1XERA 2QL9B 2MXYA 2FC8A 2XMVA 1SJRA 1VHIA 4C8MA 4L5NC 2UU9F 4OYWA 2OPPA 2YQ0A 2AMCB 4Q8FA 4P75A 2WHOA 4TNOA 1UW9A 3NEKA 3CMES 3BQ2A 4JV5E 4FBUA 1R8AA 2JDJA 2RKIA 4LF9E 2MC5A 2LVWA 2DNRA 2H48B 2EKYA 1TAQA 2YTDA 4G3IA 2E5LJ 2FB0A 1RISA 1GK8A 3TARA 3C66A 4DLGA 1YRXA 3DNCA 3CF5Q 2HBRB 4FF4A 1X0PA 2YWFA 4TVAB 2EMBA 3I0SB 2Z2YB 1U1NA 3AFGA 2HGNA 3J7Yp 2UUCF 4QR2A 1U1LA 4DCPB 1IKWA 5A8KA 2VU5A 4DQQA 1NJYA 3PNIA 4URQU 2XS7A 3H40A 1X4HA 3HMJG 3TVZA 1JX4A 3QGIA 1C2PA 2MTLA 5T7LA 5AJ3F 1T05A 1VQOS 2CQHA 4EEYA 2R9LA 2VKRA 2W2PP 1CBKA 3HPZA 2M2BA 5GAEU 1KN6A 2LDIA 3OR1B 3JS9A 1P9YA 3MHYA 2RU9A 1ZETA 4MYTA 2R8IA 2ZWOA 2YSOA 2WCC3 4OHXA 1LK7A 3TAMB 2IA6A 3IR6B 2DCLA 4OHVA 2LECA 1TVRA 3LAMA 4C8NA 2V8DA 1HLWA 5DZ7A 2ZH5A 2EJ4A 1NH7A 3CMAS 4Z7YA 3R8YA 3Q2SC 3FBFA 1NJIT 2VQFJ 1KLNA 1RT7A 3I96A 1Q82T 3KLIB 2FTRA 5DS7A 3JXOA 1XR5A 1FJEB 1B0TA 3THPA 2VFRA 1HPZA 4ZVGA 1WD6A 2J9DA 1NK0A 2BW7A 5L1LA 4PXDA 4DSIA 4X4SA 1T0TV 1PIEA 3DOKA 1FXRA 2EMWA 1U1RA 2CQ3A 3HPOA 2ZH1A 3ETOA 2CG4A 4H4KA 3NP5A 4DR5F 1DARA 2CFXA 3Q0AA 2CQ4A 1A1FA 1FDDA 1NMEB 4DR6J 2KHXA 4ZVEA 2V8HA 2BRLA 3GR1A 3GP9A 1DTQA 1XNQJ 2XCPA 3TEHB 2I13A 2DBBA 3R97A 2CNKB 1GXUA 1XNRJ 4XIUA 1P1TA 5DQGA 3EPKA 1YHQS 1RU2A 5J1EB 4L6V3 2NLWA 2QTWA 3DLKB 2MLXA 3UDEA 1RHRB 5EDWA 3HFKA 3UNGC 2G2YA 1NKCA 1A1HA 3V4IA 3LP0B 4R8UA 4OZ5A 2CG8A 1SH0A 1TL3B 2HS4A 5LMUF 3DM2B 5KFGA 3C6MA 4GVLA 4B9TA 4U7UD 3QFWA 2B9YA 2M8HA 3C19A 2QFJA 3HD1A 5SZTA 3H2UB 4B3MF 5F8HA 3JTOA 2HVDA 4O43A 2RQKA 4CYUA 5FDLA 3ZZOA 5T41A 3D0IE 1FRMA 1UN6B 1S4EA 2CDRB 2XYGB 2UU9E 4NLUA 5KFBA 3WX4A 3C16A 5KFEA 4KH0B 2HNDB 2MJUA 2VG7B 3R5JB 2XM3A 4WSGA 3K57A 2W9AA 3PJ9A 4USUA 2JVRA 3QT7A 1LQ9A 1RTIA 2V83A 4XPEA 1A6LA 3NS6A 3AUZA 3AODA 5DLGA 4CQ1A 7AT1B 4WIQA 1LWEA 2VF1A 4DV5F 4Y34A 1BQMB 1PDAA 4Y00A 4DN0A 3GONA 3MPWA 4M5HA 5ETVA 5L1JA 4GKKE 4TUGA 2V69A 1VRQC 3CCES 3SCIE 3R5CA 1RTJA 1JLCA 1S1WB 3JU0A 1YZ7A 4D3HA 4ZN3A 2C3UA 3OR2B 2EPZA 1MLAA 2D69A 5HJYA 2LU2A 1L3TA 1N52B 1QU6A 1UFWA 2V2QA 1RT3B 2IBKA 2GQQA 5HI7A 2UZAA 4ANDA 5DRKA 4NLGA 1RBOB 2DO0A 2VG6B 1HYSA 1K0TA 5A8KB 1F0XA 2LXUA 3POTA 1S6QA 2FVQA 3FCHA 5CYJA 2CQBA 2EOXA 1FERA 3HVRA 3P45B 1UJ6A 2QA4S 2XSJA 1AH5A 4JV0A 4LF5J 2XS5A 3H25A 5K5MA 1EHWA 2QLWA 4B08A 1I94F 1RZMA 3CCTA 1FXLA 3SXLA 2XYPB 3ZO7A 2XSFA 3KNAA 4CLYA 1NPPA 4EI2A 1JLEB 4OJ1A 3ZTOA 1K73T 1AT1B 5HMXA 1NPRA 4DX8H 1DI2A 4USJC 1SL0A 5KG7A 4FNIA 2GVZB 2IAJA 3CTRA 4OYZA 5DLFA 3MD1A 3G9CA 2W7AA 4HEIA 2B6AA 1VQMS 3FSIA 3AD8C 3PYDA 3T6BA 2YQ3A 1T4NA 3PACA 2ADCA 1X4CA 1RAGB 5GAGU 4USVA 1CULA 4DR3F 4ZN1A 3MM6A 4NXNJ 4CT8A 1DQ8A 4F2JC 2JP9A 2XWYA 2JFDA 3ELHA 4OJ3A 1L3SA 2K1RB 1FD8A 2GQCA 3HHEA 5J2PB 3MEEB 1KBRA 1GX6A 4UW2A 2LMIA 3P8BB 4EFAC 1SL2A 2AEMA 3EMTA 4CLPA 4WJBA 3PKYA 3OXLA 5EX3A 3IG1A 4Q5VA 4CO2A 1WOOA 3AY0A 1FHTA 2D9PA 2A0FB 2BZ2A 4KV8A 4KGVB 5K20B 4TQSA 4LF4F 4B3SJ 2UXCF 2HHUA 3EXCX 4WXWA 4M5GA 2H5IB 4DQSA 4O3NA 4HR2A 2DGSA 1U0HA 3QIPA 3O44A 3UK3C 1E6YB 4ILMA 1WG5A 3E3XA 1NK9A 1VISA 1NO8A 4K5SA 1EKRA 1NK6A 4M94A 2YTOA 1HBNB 2PEBA 1VQ9S 4ES2A 4ED3A 4KY3A 1EJ7L 1FJCA 1FVSA 3BN7A 2MKIA 4JI3J 4X65F 4LF6J 2BE9B 1D3WA 4LRFA 2IRXA 1RK8A 3HHKA 1A0OB 4KT0C 4CLTA 4AQYF 2CZVC 3KHGA 3KUGA 2V5HG 2WONB 4Q44A 3MHHC 3MUVP 3OUYB 2LEAA 3PX0A 3SDEA 1FNMA 1XQIA 2WBMA 4HEA9 4OX9F 1D09B 4TYBA 4LQ3A 3CIMA 1R89A 4MIAA 2K7JA 2L2MA 4ED4A 3FZBA 4FF1A 2VG7A 3T5JA 1WDTA 1G4CA 4OQJA 2EBGA 2EL6A 4MLQA 4MIWA 3BGUA 5A8RA 4ED7A 2XQCA 4CT9A 3MCNA 3OL7A 3MMAB 2WW4A 3HSDA 1SKWA 4GVBA 2FVPA 3BBFA 2AW0A 5EWGA 5D4NA 2FYXA 4ELVA 3W8GA 1KVKA 4ECUA 5HP1A 1T03A 4OI6A 1NUEA 3CIZA 1FT8A 2J9DE 4ECQA 3V5RA 3R5AA 1G3OA 5HN0A 1JK9B 4FYXB 3S6EA 1TKDA 2DNYA 2LYVA 4JV5F 3DM2A 2NA2A 5CYMA 3M30A 4DQIA 2VOOA 3OMLA 4YB1P 3EZUA 1UKUA 3IR5B 4DSFA 4RNHA 4YN3B 2L33A 1XJWB 3US5A 1RTHB 2V4JB 2KZZA 3RRKA 1N36F 4LF8F 4HT5A 2V50A 1NLKL 1H3DA 4Y6IA 4OYIA 1ZS6A 2KYZA 3GIMA 3QQCD 2AKWB 5KAKA 5HATA 2XZDB 3IG1B 1T02A 4IR9A 5IWAJ 4ZDNA 3UR3C 4JI0F 2JLGA 3CUNA 1V9OA 4AQYE 1YYOA 4K4UA 4LF2A 2OD6A 4LFCF 1WTBA 1SJ1A 3T1HJ 4PKDB 3E2EA 1EETA 3CGIA 4X65E 2AEFA 1TTHB 5HROA 2VICA 1VHFA 3MF5A 3M6XA 3M2VB 2VE7C 1S5ZA 3CJKA 5M2RA 4CO3A 1JMTA 4WP3A 4ZP6A 4QW9A 1FJ7A 2PDAA 4ZPWR 1OIAA 3N28A 4C6AA 3DOKB 2DR8A 1Q53A 2VV5A 2WZOA 2BOAA 5LSOA 1I51B 1Y5LB 4RW8B 2NUGA 1C0UA 2EOEA 3CJKB 1S99A 2DB2A 2BBGA 1CJUA 1NDKA 4GZNC 3DOLB 3OFHA 1RWXB 3U02A 1Y11A 2B56A 3TQMA 4QPXA 5LXYA 4OZJA 1HHTP 2I5JB 3ZNJ1 1UW4A 1SH3A 4DQPA 1N5YA 3VTIA 2M8DB 2EM9A 4H4OA 4DL4A 2G1DA 2PEHA 1Q5YA 4KSEB 1FRLA 3IM8A 2AV5A 2B8PA 1RB0A 2DXEA 1WF2A 2LA6A 1FVQA 2RQMA 2XSJB 4M5JA 2IVYA 3HPSA 3MDFA 5HK4A 1CJTB 3EUNA 2FY8A 4CLLA 2Y1LB 1YLXA 4Q8EA 3MMCB 4ZVRB 4JBCA 1FRJA 5T7LB 2KRBA 2OPQA 2ILZA 4AYBD 2R7WA 3MMBA 2LVHA 3SSSA 4RBTA 2H65B 3BF2A 1IBMF 2EPAA 4X8WA 2L2KB 3NMAA 5HMZA 2CQ0A 1QNTA 2NUHA 3TR5A 4ELTA 3RB0A 2IJRA 5DM6Q 1QUVA 2HAFA 2F5GA 1SFEA 4J8ZA 4F6MA 5E33A 2VFVA 2GJ2A 3FQLA 4QOTA 2E9RX 4JI8E 5F3ZA 2QRRA 1PBAA 5H9EJ 5HMYA 3U27A 1RKJA 2R7TA 4MT1A 5KG0A 4B17A 4YHHF 2VQEE 4N4RB 2WSCC 3RYLA 4M5KA 1U26A 4NOHA 1NK4A 2ZKTA 1N48A 3B54A 1N36J 4DG1A 2HVZA 3BQ0A 1NAQA 3P6YC 2CPNA 1OJ4A 4YMEA 5KFLA 2NPFA 4C8KA 3LANA 3DOLA 1Q0NA 3W5XA 3RUBL 1WSRA 3CJRA 4A8OA 5F8JA 2W4DA 3DDNA 5HJXA 2E5LF 3OLBA 2DNNA 3BQ1A 5E5NA 3SFUA 4I67A 3HZGA 1CVJA 1HBNA 3OTDA 3OTOE 5J2NB 2MY7A 1DHMA 1XC9A 4R0JA 2AT1B 2H54B 2K1RA 4KGZB 3SSQA 5DQHA 1KWMA 1KOHA 1HBOA 4ZA1A 2KG0A 3P5TL 4TN2A 2AQ4A 4O4GB 5ETPA 2PT0A 1V3RA 4FDFA 2MHEA 3KK3A 4QIGA 1H2UX 3QSYB 1ZPWX 5G4DA 3NCPA 3HHLC 2F9JA 1ROFA 4FXWA 4NLTA 3C6KA 1ZA1B 3KYLA 3HT3A 3TZWA 3KJFB 4F9CB 3AQOA 4NXME 2XY5A 4N76A 4RH8A 4IFVA 2MPUA 1RU1A 1EARA 4DV6J 2FIUA 4JI3F 3J7YU 5A6JA 1LFPA 3PHEA 2HBYB 1RCOB 1X9WA 5D77A 2J9CA 1F5CA 4OYBA 1T03B 1FFGB 4DV6E 1O5JA 2YQ1A 4N8NA 5LLQA 1OQ3A 2MQLA 2GMJA 3LP1A 4TQRA 2DRPA 2XI3A 5AASA 1N88A 2F3JA 5CD4H 4CTAA 5K8NA 3FSYA 4HKQA 1NJZA 1UMJA 1KS2A 4OYXA 2AZ3A 4K4YA 4NA1A 2DITA 5KL4A 1B3TA 5C25B 3T5LA 3MPVA 1DRZA 2R7XA 1TF3A 1KC8T 4A48A 2BE2A 3NS7B 1Y5IB 5DO2A 5K14B 4QZVB 2Z30B 1FDBA 1UVMA 5IC6B 3HSZA 4DL3A 3TUIC 4LR9A 3OVSA 4UQGA 3IBFB 4DR5E 1UTAA 3CCVS 2BR0A 3K5MA 4OX9J 4PPDA 3HXLA 4TY9A 3AD7C 3R7BB 1FE4A 3Q8RB 2JOQA 2LUPB 4O3OA 2B9EA 3OVBA 4N56A 2I38A 1JK1A 4FF3A 2UUAE 1AXQA 2VC1A 2PI5A 4X65J 2QZ8A 2ASJA 2ACYA 1GNKA 2EPPA 3S7RA 1S57A 3PXGa 4QIVA 2FVCA 2LEBA 2NSCA 1YYWA 3IWLA 2C3PA 1K8AT 3BYRA 4RU2A 2WVBA 3MM9A 4JYAE 3HK2A 4CM2A 3VGVA 3HDSA 1U1OA 2XWXA 5J2QA 1Q79A 3DLEB 4NASA 4E98A 1M5PC 2R7QA 1T9TA 1RWWB 4M8LA 1S6PA 2CDQA 3Q8QB 1YJNS 3NLCA 2LJUA 2XG8A 2FHKA 4FPIA 5DGBA 2FLNA 2EQ0A 4OI3A 4OL8A 3FFIA 2R8JA 2E1PA 3AH6A 4BLGA 2YVSA 1TKZB 1H0HB 2FGGA 4WFZA 2WW8A 2QX0A 5F0UA 2IPOB 5KL7A 2EPOA 2AYMA 2W2MP 1WHQA 1FNXH 2BYCA 5E0OA 4Y3CA 2RE1A 2MSTA 5FDLB 4Q43A 3ILLA 2AEJA 4I6YA 3TQEA 2ENHA 1RC7A 4P73A 4LR8A 3UD4P 3QT6A 1LK5A 3MMJA 1N34E 2Y8YA 2N4DA 1RWNB 1X8DA 3VWSA 3CD0A 1QVFR 4HVZA 5E41A 3WBZA 4GEQB 1RCXB 3C6TB 2B4OA 2Q6CA 1SR9A 2XTJP 1LWFB 3CJ5A 2OO4A 4FBTA 3NNHA 3PJWA 3UVJA 1QSYA 2DLKA 2UVRA 1XIQA 3RAMA 1NZAA 4ED8A 2HQDA 1P47A 3EE3A 2QIFA 3TRGA 1EIYB 3CCLS 5FIIA 4FVMA 2V68A 4YR0A 2CZ4A 1I94J 1R0BG 1KFSA 2A25A 3V81A 1YKWA 3M30B 1T3NA 6AT1B 4GKKJ 4CNZA 2DH7A 1KQSR 2UUWA 1KD1T 4Q2MA 2JJ4D 4KYZA 3ENAA 1X47A 1A1LA 4B02A 4DXLA 3DOMB 5KFAA 3EQ1A 2GW8A 4NLXA 2DJWA 1TP7A 2CAJA 3PG9A 3G6XA 3QGGA 3UPFA 4NX9A 4WZQA 3LTOA 4A8SA 2E1MC 3KG4A 1HARA 4KHMA 1S0OA 2ERRA 1X31C 3NKYA 4IDKB 2FZKB 3A3NB 4PG5A 2DLQA 3PRBA 2HWTA 3VQSA 1X48A 1DLOB 4DV5J 2DEJA 4A4JA 4DMZA 3GSDA 2YTEA 4QCLA 2A3JA 3VGUA 4PQAA 1S1WA 3D67A 4PABA 2VPYB 1ZAWA 4B9VA 1IXKA 4PWDB 1SQGA 1KKHA 2LQ9A 1YZ9A 2LP4A 3I9V9 3LP2A 4NYZA 3UW1A 5KT7A 2Z58B 3OBIA 3IS9A 3MOZA 1TMJA 2GQ2A 3LP1B 4I7FA 4QWEA 2ROEA 1MWQA 2QSFA 3QJPA 2VKZG 1PJ5A 3J7AG 1GMUA 3L7PA 3BEGB 2DHSA 3SYZA 2KFZA 1NSKL 3QJLA 1HIYA 4CLWA 2VHGA 2RRNA 3H5UA 2HRUA 3RBXA 2UXDE 1LW0B 2DGCA 7FDRA 2ZHBA 4N7TA 1KP6A 3MUMP 4YOEA 1HQUB 4NRTA 3PW7A 4P52A 3UI3A 4ED5A 2CRLA 2D41A 2XLJA 2CNOB 3VAJA 5J2MA 2DNPA 1IKVB 5EHHA 2V4QA 5J1NA 1T9YA 1Y4ZB 5LM7E 2C2NA 3GIRA 4IFYA 4U9RA 4IUFA 2YNIA 4F2RA 1LW0A 1TKXA 4HL9A 2YKNA 2BA9A 4I4BA 1IQZA 1FF2A 2V8VA 1UWBB 3AB4B 1VIOA 2W9BA 4IOAQ 4LF7F 1REVA 1JKHB 4F25A 1U8WA 3Q23A 1UVJA 4DR5J 4F36A 2LCEA 3MEDB 2QSWA 4FNHA 1OY6A 1X3CA 4NCBA 1LKZA 2NR0A 4AXIA 2YTFA 2K06A 1RAJA 3AV0A 1KNZA 1FRHA 1U24A 4YB6A 3BBBA 4USKA 4UOCA 3L7OA 2XBPA 3C3LA 1DAXA 2VQFE 1TVRB 1NJXA 4DZ6A 1NH8A 1RT4A 3ENVA 1M5SA 2RDJA 1CPZA 3SQOP 2EPMX 5I3QA 1PSDA 1BWVA 1RT1A 2RQCA 2ZM6F 3ZNUA 2NUFA 4AD6A 1U2RA 1JNZB 3FJ2A 1KHWA 2V88A 1QTNB 4DR2F 3KJVA 2FGCA 3TOQA 1SV5A 3SSRA 3WDOA 1X5PA 1YQHA 3KLFB 1U0SA 1X4AA 2KT5A 2VJVA 3GV5B 2E1CA 3FBBA 2E7XA 3GFYA 2M3DA 3M8PB 3O5TB 1WJ9A 1U4BA 2A2CA 1KTVA 4HYKA 1W2BR 2IMWP 1YJVA 2AJ2A 1YZ6A 3J7Z5 1UAWA 3MM5A 4DR4J 1TKTA 1WOPA 3B4MA 1GMVA 2Q6BA 3GB0A 4DV0E 1VC0A 4Z2XA 2GV1A 1ZBQA 3TANA 2DGTA 1HKAA 2YNFA 4ER8A 2KONA 3D3BJ 4OZ3A 2RDIA 4JB8B 2ZEJA 3JAMY 4M5MA 1EH6A 4R2QA 5GAHU 1I1GA 3X3UA 4IOBA 5HL7Q 2R2UA 3RB4A 2GC8A 1OSDA 4ZVPB 1IBMJ 2V6AA 2I5JA 2X51A 2EPXA 2BJ9A 3THTA 1T39A 2X7IA 2F9DA 3GE9A 4OZLA 3MPUB 1JXEA 4XO0A 2GA7A 4DX6A 4DUYF 1KTQA 4M9VC 4DPUA 2Y1JA 4MK7A 2K2PA 3ISND 4FYWB 2RVJA 5LMNJ 4ZVOB 3BDEA 1Y3JA 3KK2A 2WBTA 1DQ3A 3N4WA 2BJ7A 3R5DA 1U2CA 2KJWA 4ZYHA 4NMLA 5M2UA 2K8GA 3PW0A 5TSEA 2YKMB 4K8RA 2BJ8A 2UXDJ 1VI7A 3AXMA 4I64A 3TI0A 2DNMA 4PUOB 2R42A 2QC3A 2ZH6A 2ZDOA 4OHZA 3ZZZA 2L9DA 3H5XA 3I0RA 1FA0A 4NYOA 2OH2A 2KJVA 3LUYA 4LU9A 4JI8F 2VBZA 2O01C 1HWJA 2W2QP 3RMPA 1L5UA 3J81j 4K0KF 1UHZA 4J91A 5CYQA 1X4BA 4PUOA 2AYBA 1YYKA 3A3OB 4X4NA 1V3ZA 5B09A 2BM1A 4J9UE 4NEZA 1BUXA 1HNVA 1JJ2R 5BYQA 4LF1A 2BVZA 4Z37A 1CLFA 3VHQA 1B7YB 3FFIB 1PKUA 2GHFA 3EVOA 5FLXY 3UD5A 1A7GE 5LT5A 3ZTQA 1YK9A 3GYNA 5FJ4A 5K8OA 2NXJA 3MM9B 3AA8A 3PYEA 2ZH8A 3EVWA 5HANA 3LPEA 2HW3A 5A8RB 2J6SA 4O44B 1IQSA 3ZZUA 3TAPA 3HF5A 3N79A 4O4KA 1FKPA 2M52A 2YTJA 4B3RJ 1DFDA 4F4WA 3CT9A 4ED2A 3ZTSA 4ECVA 2VRDA 2DGQA 4JV5J 4DR1J 4X66F 1QAYA 2CQIA 1UPPA 3GIIA 3M9OB 3NNCA 4B9SA 1XMOE 3TO8A 3FC9A 2JFKA 2BJ3A 3RR7A 1WWHA 2HLUA 3LLHA 2HKEA 2ZHOA 1QSLA 2MZJA 4BHBA 1N33E 1SUQA 3G8TA 2Z56B 2RH3A 5LMNF 4AXJA 1F2HA 2MZSA 2IYGA 2H51B 3CW2C 3RBZA 2E5HA 2PFFB 5F3WA 5A6BA 5A69A 3MR2A 2LUQA 3KHRA 5JVGQ 4QIWD 3QAUA 3Q8PB 1RHMB 2D7SA 4JI2E 4OYOA 2QFIA 1F60B 1B7FA 3DRXA 4FP9A 1WORA 4A8MP 4ID5A 1EKZA 4NI2B 1HW9A 4KV8B 4CLSA 1FWLA 4LSNB 1DJ0A 5KT2A 1VQSA 3D2WA 3CDBA 3CCJS 5FLXU 2B3TB 4DPWA 4ECTA 2EMIA 3QG5C 2XB2D 1GT8A 1N4LA 2B4UA 2DD8S 2DIXA 4IFYB 4I2QB 4A46A 2DO4A 3M32A 1IKXB 1T94A 2D3UA 4PXBA 4KGMA 1NEIA 2R8GA 1YGYA 3JTPA 4CH7A 4H4KC 4OYPA 2FTXB 4B9LA 1JKHA 3FSXA 5BR8J 3KUHA 1S1VA 3KLHA 1DTQB 3SBMA 1VBKA 2OPRA 2LQ8A 2CXEA 5L9NA 2YRKA 3GYGA 1A1JA 1DTTA 2YPNA 3AB2B 3B82A 1OO0B 1UEKA 3DGVA 4ECXA 2BW2A 2ZM6J 2YU8A 4P74A 3K7RA 3JSMA 5B0GA 5B08A 4JI2F 1RT6B 1X5TA 4V19X 3EGZA 3SIPB 4USTA 3QFHA 2LDYA 2HZVA 4HHUA 3IS9B 2W9CB 4CLFA 2K3KA 4P2SA 1QE1B 4UUWA 2MMYA 1XK8A 4LF7E 1F6TA 2KXHA 1S9GB 4W90B 4RUBA 2MB0B 2EMFA 4U8YA 4CO0A 2KYXA 5C42B 2EOQA 1SJ4P 2V63A 1Q4RA 4RNOA 4DSLA 4IR1A 3M8WA 3RW7A 1QAXA 1M0SA 4JI1J 4WP9A 2JXPA 2XLKA 1VIXA 4WBFA 4MKBA 3CD6S 2DISA 2HMIA 3MMBB 1IBME 1TK8A 5HQMA 4I8OA 3PCOB 2B5JA 2RS7A 2YNFB 5T14A 1JLFA 5A2QY 4P2MA 2ALYB 2UXCE 2RSIA 3FKBA 4FXVA 2N3GA 3H5SA 4R2PA 1B99A 4PWDA 3OW2R 2LTSA 3KLEB 4ITSA 4B3SF 3W7BA 4IQXA 2KFYA 2WSFC 4MLVA 2G2OA 2GIQA 2Y9HA 1FKPB 4U7UK 2C2EA 4ZPCA 2CPDA 2HBZB 4LF4J 1JLGB 1PYSB 2KI2A 2WVCA 4ALZA 4L8NA 2RRAA 2OPQB 4NCAA 5KG2A 4QR0A 1FESA 4ZYGA 1VRUB 2HAIA 4F2SA 3FBEA 2B7TA 2KFNA 1S9GA 3PTWA 4HT7A 3CDWA 4K4SA 3GU0A 1RT2A 1ZU1A 5DETA 1Q81T 4B3TE 4ICLB 5AXLA 1IBLE 1V3SA 4DR3E 3E51A 4KTQA 2ZDPA 3OT9A 2F4VJ 4LRCA 4CWBA 4DLEA 3CE8A 1QM9A 3VF0B 3G8QA 3H98A 4YP3A 3OSPA 1JLAA 3PYFA 2FJEB 1BHNA 1SKRA 1QY7A 3MFIA 4TKTA 1TV6B 1RXOB 4I6WA 4UOGA 1CJVB 1YBTA 2YKNB 1OWXA 1NDCA 3WIUA 4B3OB 2KU7A 2MZTA 4OZ1A 5GVQA 3GILA 2DNZA 1X60A 2CJXB 4OX8A 1YJTA 2MQ8A 4PR6A 2EKNA 3NBPB 3EZOA 2ZOFA 2NSBA 1GQEA 3QLHA 3NXZA 2YPYA 2DSYA 2J0WA 2KH9A 2LT7A 5L46A 3HFVA 4WFXA 5HVFA 3W9IA 2RTXA 2FDNA 4CM0A 5KFRA 2BQUA 4X4RA 3MM7A 3N5BA 2Z57B 4MH8A 3HHLD 1T95A 1H6KX 4ETZA 2IDEA 1AROP 4HH1A 4P7TA 1WC3A 2EN8A 1VLYA 2OIHA 4CP5A 3D7SB 2QL5B 2AX1A 1UVNA 2FJBB 4LSNA 3M2RA 2A2DA 5C24B 3KMQA 2LJHA 4OV1A 1J5EE 1ZM3A 4F50A 3PW2A 3A13A 2W8LA 2CTDA 4GKKF 3J81C 3JYTB 2H1YA 4A8YA 2PMZD 2QA4G 3WC0A 2MZRA 3K59A 2M4MA 4Y2IA 4WXDA 1RTZA 3KK1B 2H36X 1LNQA 3M6UA 3CO9A 5D3GA 1HWUA 3M8ZA 3HVTB 3V6DB 5HP1B 3Q83A 2QE5A 2JY9A 1BQNA 4EMDA 4QYZJ 2YRHA 5D15A 2PRTA 2OSRA 1UVLA 1IQOA 4ZIWA 3MAAB 3OQ2A 2YTIA 3BGLA 3LP2B 3PO4A 4P72A 2WONA 1TMMA 5B0DA 3MMAA 2EPLX 1YRTA 2WTFA 2EOOA 2MKJA 5EWFA 1YUJA 4W92B 2EM2A 4DV1F 2V34A 4LREA 3ECRA 2ABYA 4F4KA 3DYAA 2RILA 4K2XA 1CS4A 5L39A 1OMSA 1JLQA 2YU5A 3TJ9A 4LSLB 4GKJF 4LR7A 2AGOA 4H4MA 2VQFF 3BBGA 2HFZA 4B3MJ 4ETXA 5KFZA 4UF4A 1RTDB 1UFKA 2ZE2B 3JSRA 3H2VE 2EMZA 1S77D 3I0SA 2NXCA 1QD1A 2LKZA 1WEZA 2HFNA 3CULA 1ZAVA 3WX8A 2WVFA 2KM8B 3NAHA 2R2RA 4FKYA 2DGWA 3DRRB 2U1AA 4H4OB 4ES3A 5CD4A 5A8WB 5AJ3J 3EYZA 1N5VA 1KEKA 3N0VA 4KKOA 4IFVB 2EFVA 1HWIA 1HWKA 3MZIA 4IOCQ 1EB0A 3SFGA 1U1KA 1CJUB 4RNNA 3L7UA 2NXNA 3MI7X 1FWPA 2GZOA 3C46A 2IFXA 4RR5A 4JI7E 4DZDA 2EM8A 5K8MA 2PSZA 1U02A 2BRKA 3AJ1A 2WVEA 3TEGA 1IVZA 1C1BB 3GG1A 3KZZA 1OYEA 4CO1A 2YX1A 2J8AA 3CCMS 3IBCB 3VAIA 4JI1E 4G1PA 3DDKA 1YPNA 3AOCA 3JQKA 3FMBA 2HEKA 4RBVA 5B0CA 2X1AA 2LU1A 1P6TA 1Q7YT 3GV8B 3W9JA 4HTJA 2Y0SD 4FXDA 2YH0A 2P6TA 5G0RB 2PA8D 1H98A 1R6YA 3I0RB 5J2QB 2JHEA 3J81Y 2ZZNA 1U45A 3K6QA 4A47A 5I3UB 1UA1A 4E2FB 4YR3A 2J5AA 3PO5A 1IWAA 1S6QB 1NPKA 1I5OB 1RTHA 5KFVA 2FZCB 4F6NA 5CAAA 2IY5B 3SEOA 3F56A 2FJDB 1LLMC 1RT3A 2P5VA 3D68A 2Z2ZA 1XMQF 2XZWA 2EE8A 2LE2A 3CJQA 1FRIA 1VR6A 1PAUB 4X2BA 4IH7A 5KFXA 2BDPA 4D3GA 3VAFA 2OFHX 4NMXA 3PW5A 4PWUA 2D9HA 1N32J 4DL7A 1XBWA 2POKA 4WU2A 2J7JA 1RKIA 1N6QB 3NL0A 3C15A 2CZ9A 4DG1B 1HQ2A 2VFTA 2FC9A 3QGHA 3EJMA 2A6OA 1S1XA 2N3HA 4IDKA 4DV5E 3MCSA 1SJFA 4DV0F 3HP6A 2E72A 2BABA 1WRJA 3D54A 4Q7AA 4BBYA 4MKYA 4USMA 2VPWB 3A3PB 2BEFA 1RAFB 1JB0C 2LQBA 4IG3A 4FZVA 3OJUA 2J76E 2B4VA 2ATCB 3GJQB 2LXFA 1TELA 5EWEA 2WB1D 5KFPA 1SJ3P 2UU9J 2BJEA 4LFAJ 5KT5A 3EPLA 3M8PA 5AT1B 4NCGA 4EK2A 1GXTA 1RYRA 4F8RA 1RBLA 1DY3A 4M5LA 4C98A 4X66J 3BB5A 2YXLA 3DLKA 2DNKA 4YB5A 5E7OB 1EQ0A 1X6HA 4DV7F 1X4EA 4DPYA 4X4TA 4UQTA 1KYQA 3G87A 3UCZP 2E5LE 3D66A 3VALA 1N34F 1REVB 3FUYA 4KC5A 2EFNA 2E9TA 2DK2A 3DRYA 1AUSL 2MKCA 1UWBA 2XNRA 1I6JA 3KLGA 1KQFB 3DLGB 1FKOA 4ANCA 2G0JA 3UFCX 1SXLA 2YNIB 4ZIVA 1YITS 3BR9A 4V1Ak 4K50A 1JXVA 1J27A 3K89A 4F9BB 2EOIA 2YWEA 3I5BA 4IJDA 2I1RA 1GX5A 4TU8A 2LXIA 5KOXA 2XNQA 4ZPVR 2GHPA 2R7RA 4JI7J 3W62A 2Y1RI 2ZC4A 3I32A 1X4FA 5CZVA 4P6QA 2N7CA 4I2QA 2HS3A 1QAJA 3QGPA 1L3VA 2GFFA 2JEGA 2ODRD 4OZ0A 4HI2A 3DLGA 1EETB 1K0VA 1FEEA 2HSEB 4JI6E 2R8HA 2CQCA 3IWCA 4I68A 2EM3A 3HHLA 2IYIA 2HHPA 2DNLA 4F0KA 4DV7J 4TUIA 3T3FA 2DIVA 4DV3J 4LFBE 5J2MB 3W2WB 1PG5B 1ULRA 3H4DA 4CI0B 2YKAA 2JZ5A 4OI4A 3UD3P 5B0AA 4ECYA 2IBOA 2MDGA 2RT3A 4F4XA 1BC6A 4X64F 1RA6A 3GCWP 2W1BA 1RSCA 2HRYA 2ADBA 2C2RA 5CQGA 4LFAF 3NAIA 1S72S 4AL7A 4LT6A 4DUYJ 2EMHA 1AZSB 2FD2A 2BKNA 4LBHA 1T38A 1MGTA 1WHXA 1JLGA 3ADGA 3JSYA 5GAGI 3PX4A 3C15B 5BJRA 3MGJA 1RT5B 3UDCA 3KZYA 4DUYE 1DQAA 1RJJA 1WKKA 3TJAA 5BYRA 3AD9C 2KM8C 4DV0J 5D4LA 2DRAA 1S12A 4MFBB 2HNYA 4F4AA 5LSLA 3L9ZA 2QJ3A 3BSCA 1YSAC 1WHYA 3RW6A 4QYZK 3T1HF 4KGKA 2KRRA 1ZTWA 1NXIA 2GAHC 3JAMU 2V9KA 3NGTA 4DPTA 4CH1A 2EL4A 2HMIB 4RW4B 1E6YA 3N01A 3V6HA 1AZSA 3ZTPA 4NA3A 4O24A 1TL7B 4AE5A 4ZKAA 1VQKS 1TL5A 2BB8A 1XN9A 4F3QA 1HA1A 2V87A 3IGVA 2CUYA 2FJAB 1WHWA 4OFZA 4UZCA 3SI8A 3ZZYA 4F3MA 2GJIA 3UDVA 4NXMF 5BXIA 5AE2A 3ZZRA 1R7IA 4FVCA 2HK2A 1YI2S 2L2NA 1RT6A 4M5DB 4QWAA 3VR1A 1GTEA 4L74A 5ETLA 4DR2E 4OLPA 2UP1A 4EYHB 1B0VA 3E8OA 3QZ8A 2CSHA 2RS6A 1WG4A 1VS3A 2V89A 4X62E 1GZ6A 1C1BA 4FF2A 1T7PA 2XMAA 1CULB 3PX6A 3BGFA 2UVWA 3Q8VA 2EMLA 1NJWA 3T1AA 3RJMB 3M2VA 2KXNB 2CPJA 3VQTA 3KDNA 2DGVA 5HROB 4LF6F 1Y00A 2ZVIA 4ID8A 2HZCA 4LF7J 2OGUA 2AP6A 2VUGA 3HHNB 1S6PB 4A8KA 4RBUA 3D0GE 1P1LA 4J9NA 3D5MA 3FVYA 3KMSA 5IM0B 2DNGA 2RPCA 1EKSA 2UUBE 4DX5A 4NI2A 3TZYA 2ZE2A 3GJTB 2AZ1A 1TKZA 2BACA 3POTB 4Q0BA 1S6UA 4NLRA 2GVZA 2EOYA 2O67A 1VQ4S 3PFEA 4YEAA 3C6UA 5L9XA 5CYMB 1FXDA 1HMVA 3R6LB 3EX7B 3IBWA 4RW4A 4JI6J 1W25A 1HD1A 3A12A 1HHQA 1YTYA 5B0EA 4X4PA 3OL9A 1F9EB 5ETRA 4I69A 2IC3A 2DHXA 4K4XA 1SI9A 2MQNA 4ZJLA 1JLCB 1U25A 1RTJB 4GC7A 3PYGA 3JTNA 4ZPTR 1DZ5A 3M8SA 1RA7A 2EM7A 4F4ZA 1X4DA 5HQLA 4NXNF 4EZ9A 1BQNB 1KVIA 2EMAA 2EFGA 3I87A 4IH6A 2JLEA 4DU8A 3F73A 1ZH5A 3MECA 3UCGA 2Z4PA 3MECB 4OI2A 5GAHI 1N3GA 4J9PA 5F9NA 4TYAA 5K14A 3PZPA 3V4MA 3R1HA 2Z8QA 2B8QA 4MIBA 3A8EA 2YNHB 1ZR9A 3TP2A 2FV4B 2RDDA 5AE1A 2JNJA 2R8KA 5HSPA 1G1XA 2QO3A 2EMKA 2UUBF 3KLVA 2Z2MA 3KHHA 3ILJA 2EN6A 2VONA 4K4WA 2YTNA 3P96A 4UZBA 4PWWA 4XTTA 3R2DJ 4JI4F 1TU0B 4C8OA 3PKMA 1X6EA 1N5SA 3BGRB 4KBIA 1OY8A 1D1UA 2F1FA 3KK1A 2AU0A 3BSNA 4WFYA 1X0FA 2VPZB 3C6UB 3M6WA 3HULA 3QWUA 3RBEA 5KFHA 1RHKB 2QLFB 3LP0A 4PAAA 3L95X 3Q86A 5MAOA 3BO4A 2BJ1A 2ZH4A 4ZK7M 3DLJA 3FEXB 1M5VC 2NZ4A 2AIRB 5J1EA 2CA9A 3OV7A 4GKJJ 2YNGB 3F6GA 2F63A 2WB4A 3BF4A 4X62F 2UXBJ 2HPUA 3I5AA 2QLXA 1HHSA 4P71A 5KG6A 4JI0E 1R8BA 3PHTA 4O4GA 2M9KA 2M7QA 2LA4A 2KZMA 2DT9A 1DQ9A 3O1LA 3KLGB 4WK3A 3GIKA 4A8FA 1U1PA 1U8SA 4K59A 1N36E 3HI9A 3EGVA 3PM9A 3PV8A 5FD1A 3QLHB 4WFBQ 3EPJA 2G2ZA 1IBKJ 1IM4A 2VF3A 3W64A 2ZH7A 4KHPF 1HPZB 1M1KT 3SCKE 4UOHA 3J81U 3VVTA 1HD0A 4J9MA 4DOZA 2W4PA 1S9EB 4NLSA 4O23A 1UL3A 4WCEQ 4O3PA 1QDUB 2LLZA 1N0UA 2HHWA 2F8EX 4TY8A 2UXBF 3LA0A 4ZVUB 5A2QC 4QYRA 1WKLA 5KFUA 2Q43A 2KT2A 1M1HA 2EEYA 5LMUJ 2N3OA 2ZBPA 5KFSA 2E29A 3NGRA 3V2UC 1D8YA 2CWKA 2HNYB 3QSIA 1IWGA 4GO7X 4DCJB 1P9QC 1LWCB 4UTGA 2LTRA 2GCFA 1VC5A 2DGOA 4HLBA 3KHLA 4YHHE 2C2MB 1AW0A 3QBCA 3DXSX 1YBAA 2VA2A 3WIVA 1MEYC 2W4CA 2CWXA 2DY9A 5F8GA 1SVDA 2RQ4A 2VDHA 1AFJA 2V67A 1B69A 1SJQA 1D9FA 3W61A 1BY9A 3FK4A 1EP4A 2FVRA 2MLZA 2ZH9A 4O44A 2EW9A 5C42A 3FZ2A 3R27A 5KL2A 2C22A 2MKNA 1JWWA 1LW2B 2HQ3A 1TFWA 2RF2B 5JXSA 1P27B 2EQ1A 3CJ0A 2VH7A 2AF6A 5J1PA 2KG1A 4JI1F 3MFHA 4CYUB 1LWEB 2V4RA 4C0OC 1N0VC 2KL8A 3VAKA 4WX9A 1G6BA 1V5IB 4KJIA 4P9SA 4TY8B 2OHDA 1HFEL 2G9OA 3HVWA 1FJGJ 1U0HB 2MYFA 1R0CB 4ZCLA 2QN6B 2YSPA 4DN9A 3K8VA 2DGXA 1ZA2B 4DV3F 3NGDA 3Q22A 3V81B 4AFFA 2EM4A 2ZUAA 3EVMA 3HM9A 2QA2A 1FJGE 2AHOB 4ZCIA 3NGKA 1P8GA 3JQJA 3MWBA 1U47A 5A6KA 2XYHB 2DHHA 4F0MA 4WTOB 2DKOB 3K2YA 3MEEA 2ZHAA 2DVIA 4PPZA 1AB8A 4QWBA 4O3RA 2A6MA 4B3OA 2EM0A 4EUVA 1S1TA 4NZ7A 2HRTA 1IMUA 2HG4A 1T9UA 2C28A 2VBWA 4FKXA 3NY0A 5A6BD 3KLHB 1HL6A 5HBMA 3BSOA 3T6JA 5F8MA 1S1VB 3CD5A 1IKVA 2JLFA 4DI6A 2HFUA 2LO3A 2E7WA 3MR5A 2ZWPA 4DPOA 1MROA 1CC7A 4EU0A 2R7OA 3QO9A 1REGX 2XMKA 1I94E 2AJFE 2DR6A 4OI0A 2V4JA 2NYHA 2DB1A 1KDNA 2W24A 2IVFB 1RGVA 1LXJA 4IH5A 5GMDA 3HQ1A 1VQPS 3N6MA 3OHBA 1GTHA 1Z4UA 4HHJA 3BS9A 3CPWR 4OI1A 2VJUA 3GFHA 3QWPA 4KWYA 3TX8A 1S59A 2Q3PA 2YKQA 4LVNP 3PR5B 2JH3A 3DGPB 5ETQA 4DEZA 3N5FA 4MKVA 4LF9J 2N7YA 2MLYA 4LRDA 2UXBE 2DR7A 5MLCV 1E6VA 4DV4F 4L3KA 3DU5A 4H4MB 3HVAA 2G0CA 2KVQE 2HQFA 2ASLA 3DJWA 1JLQB 1CS4B 3TA0A 1C4CA 1FTRA 2DCUB 4RNMA 3AJ2A 1Q78A 1QSSA 2VB6A 4J9OA 3IRXB 1HBMB 3FGVA 3H59A 4HHHA 4QQBA 1IKWB 3G6VA 5H9FJ 3HKZD 3C14A 5IV3A 5ITHA 3OTOJ 4PXCA 4RX6A 4DR1F 3IGNA 2R7SA 3I4HX 5HVGA 5U47A 4CLUA 1YSJA 3T1HE 4HDHA 3KTQA 2LBSB 2XMUA 5KFMA 2JEFA 3LOUA 1UEUA 2J6TA 2XY6A 1ZPVA 2P9CA 1T4OA 3KWRA 4M63A 3I55S 1F2IG 3M2UA 5D3GB 2M4IA 5I3PA 2OUGA 3BKFA 1T4LB 2HVIA 1TUWA 1BGXT 2PGCA 4KR0B 1WHVA 3UWTA 1UCNA 5DDPC 5A0YB 3H4BA 2PIIA 2HNDA 2RKIB 5IOLA 5E3QA 3MPDA 3EWGA 3JYTA 4ANEA 4NRUA 5KT4A 3W63A 1HNXF 1TZ0A 4ES1A 4BS9A 1O8BA 2HS0A 4Y0FA 1FKAF 2L8TA 4HI1A 3D1OA 4NXNE
chains in the Genus database with same CATH topology
4FNIA 1FE0A 2IAJA 3CTRA 5DLFA 1VQLS 3RW7A 3MD1A 4IR1A 2BJDA 4R5PA 1QAXA 1M0SA 1H7XA 2FUG9 2GX8A 2XLKA 1VIXA 3G9CA 4WE1A 3NCRA 1PGZA 4MKBA 3CD6S 4PG8A 5KT6A 4I1TA 2DISA 2W7AA 1H38A 3H2LA 4DUZE 1VRTA 2B6AA 1VQMS 3FSIA 4B3TF 2HMIA 5KFQA 2D9OA 3MMBB 4NA2A 4TLRA 3T6BA 2YQ3A 2DR5A 1IBME 1DURA 3CEDA 1TK8A 1NKEA 3KG0A 4QU6A 1T4NA 3PACA 2ADCA 1X4CA 2J6UA 1BLUA 1TKTB 4G1QA 5GAGU 4I8OA 3CCUS 4DF4A 4WYQB 2B5JA 3TVYA 2RS7A 4JI7F 2YNFB 5T14A 1JLFA 4LSLA 4DR3F 5A2QY 2VG5A 5JUMA 3MM6A 2VA3A 2UXCE 2QMWA 4FXVA 4K4ZA 5E3PA 1QAIA 3H5SA 4CT8A 2KOUA 2N3GA 4PWDA 1VRTB 3CJ4A 1KQKA 1DQ8A 2ZNZA 3IRXA 3OW2R 2LTSA 3KLEB 5ADZA 2XWYA 4ITSA 3F6HA 2ASDA 3LMLA 3W2VA 2VASA 3QIDA 2JFDA 4FN5A 4B3SF 3W7BA 4OJ3A 4IQXA 2ALZA 5CA5A 2KFYA 1Q8LA 3TAMA 1HQEA 1L3SA 4GC6A 2HIQA 2WSFC 2V94A 1NHUA 4R03A 3DC2A 3IA0A 2K1RB 2GIQA 4MAKA 1FD8A 2GQCA 3HHEA 5J2PB 2JVAA 1LWCA 1FKPB 3MEEB 5KFTA 4B9MA 4U7UK 2C2EA 4ZPCA 5DGAA 2CPDA 4MFBA 1GX6A 4UW2A 2LMIA 2QEXS 4WU3A 1HBOB 1JLGB 2COLA 2DPJA 4EFAC 1SL2A 2KI2A 1PKPA 4LMZA 2MKKA 4RW6A 3M1VB 1ZZNA 2FJWA 4ALZA 2RNEA 4TLQA 4ZVHA 1JNRB 3X1LB 2E1AA 2RRAA 4L8NA 4QWDA 2OPQB 4FS2A 2XMJA 3KFWX 5K9FA 5AE3A 1RT5A 4NCAA 5KG2A 4QR0A 1FESA 3SCLE 3N9UC 4WJBA 1K9MT 3PKYA 1VRUB 2ROGA 3OXLA 2HAIA 5EX3A 4F2SA 3IG1A 1U09A 3QPIA 4Q5VA 2FVSA 4CO2A 3AY0A 2B7TA 2KFNA 3VK6A 1FHTA 2ZD1B 2D9PA 1WACA 1URNA 1S9GA 2CPHA 5A0YA 2M1SA 4HT7A 2BZ2A 4YQWA 3CDWA 1JJHA 4KV8A 4TQSA 1MWZA 3O6QA 4LF4F 4K4SA 1SL1A 1RT2A 2IJFA 5DETA 2QV6A 1Q81T 4B3TE 1RDRA 4ICLB 4NLWA 3RZAA 3BDPA 2UXCF 2O5DA 1FO1A 2CQGA 5AXLA 3PFOA 1IBLE 5HO4A 1V3SA 4XDDA 1M5KC 3EXCX 2HHUA 4DR3E 4Q0BB 4WXWA 3E51A 4KTQA 2ZDPA 4DQSA 4F3OA 4O3NA 4DLEA 3CE8A 2DGSA 1H7WA 1QM9A 3O44A 3QIPA 1FK9A 3V4IB 3VF0B 3G8QA 1E6YB 3IN5A 4ILMA 3H98A 1WG5A 3E3XA 4YP3A 1JLAA 4DDFA 3OSPA 1NK9A 4X84A 3LAKA 1NO8A 5CFFE 5K8PA 4ID5B 4K5SA 1NK6A 4G6VB 2FJEB 3ZFVA 1SKRA 1QY7A 4M94A 1C0UB 3B4DA 5HMWA 1HBNB 4X4VA 3KLIA 3MFIA 1VQ9S 4TKTA 4DQRA 1TV6B 4ES2A 3GWCA 4ED3A 4DV1E 1FJCA 2CKWA 1HW8A 1FVSA 2DHGA 1C1CB 2VC0A 3BN7A 3KG1A 4I6WA 1HNXE 1B0PA 2MKIA 2C3OA 5FLXC 3PEHA 4X65F 1YJWS 2MQQA 2YKNB 1OWXA 1FDAA 3IAS9 4B3OB 3JAMC 1D3WA 3UE2A 2KU7A 4URGA 2IRXA 2MZTA 1RK8A 4OX7A 2NREA 3HHKA 1JLEA 4KT0C 4OZ1A 2CZVC 4AQYF 3KHGA 5GVQA 3GILA 1CC8A 2DNZA 2V5HG 4O0IA 2WONB 3C2PA 2JR1A 2IVMA 4OX8A 1S1UB 3RTVA 2AX0A 1YJTA 2NPIA 4Q44A 2KT3A 3MUVP 2AGPA 3OUYB 2GO8A 2LEAA 3G4SS 4PR6A 4RKUC 3SDEA 3NBPB 3PX0A 5IQQA 3KJVB 2ZOFA 5BR8F 1VFJA 1FNMA 4IG0A 4KO0B 2MQOA 4DSEA 4QIFA 3UCUP 3RB6A 2WBMA 4HEA9 5KFDA 1A9NB 1FRXA 1GQEA 2NSBA 3QLHA 2W8KA 4WFTA 4OX9F 4B9UA 2DSYA 2EWLA 2J0WA 1B64A 5F8IA 3ULHA 2KH9A 1S0MA 1Y5NB 4TYBA 1XNQE 3PEJA 4LQ3A 1MMLA 2MKHA 3CIMA 1R89A 2VD3A 4L3NA 1L3KA 4MIAA 1MNEA 2C3YA 2K7JA 4WFXA 2L2MA 3FZBA 1YRUA 1KQGB 5KT3A 2B7CB 4FF1A 4CO4A 2RTXA 2VG7A 3T5JA 2ZH2A 2FDNA 2MC6A 4OQJA 2EBGA 2XMTA 5KFRA 1CQMA 3I5CA 2BQUA 4X4RA 3MM7A 4ERDA 4MIWA 4JV2A 3N5BA 3BGUA 5A8RA 1OSCA 4ED7A 5EUHA 1RTIB 4CT9A 4MH8A 2OLWA 3HHLD 2E44A 1T95A 2IMOA 3OL7A 1H6KX 4ETZA 5B0FA 1AROP 4HH1A 3MMAB 1XEZA 3M9MB 4P7TA 1N32F 4RLEA 1Y9OA 1SKWA 5IWAF 3ADIA 1MW7A 2CVIA 4Q2LA 4MTPA 4WYWA 4BC7A 2VFUA 3OJSA 1VLYA 3CJ3A 1TL4A 2KN4A 2OIHA 2FVPA 2PN6A 3MM8B 2AW0A 4QWCA 2F40A 5D4NA 5EWGA 2AX1A 4ELVA 2AGQA 1UVNA 2FJBB 4LSNA 3M2RA 4ECUA 4ELUA 4R0EA 5HP1A 2FHMA 1T03A 1Y3KA 4OI6A 2A2DA 1KLMB 1FT8A 3CIZA 1TUVA 2J9DE 4ECQA 5C24B 3V5RA 1TL1A 3R5AA 4PG6A 4K4TA 2YH1A 3DF6A 1G3OA 3MEGB 4OX6A 5HN0A 2XY7A 3KMQA 2LJHA 4OV1A 1J5EE 3UR0A 1ZM3A 4F50A 4MKAA 1JK9B 4QU7A 3PW2A 4KHPE 2MZQA 4DHVA 4IYQA 3S6EA 2W8LA 1TKDA 2DNYA 2ZKUA 2LYVA 3S8SA 4GKKF 4JV5F 3IAM9 4P7DA 3J81C 3DM2A 4XPCA 2NA2A 5CYMA 3M30A 4DQIA 2VOOA 3OMLA 3JYTB 4YB1P 3EZUA 1RT4B 1Q86T 1UKUA 2IJNA 1S76D 3IR5B 4RNHA 1ZBTA 4A8YA 3I4PA 2PMZD 3OTOF 4DSFA 5IWAE 4HH0A 4RWWA 2L33A 4BWMA 3P3DA 4I7FB 3US5A 2QA4G 3WC0A 2MZRA 1RTHB 2V4JB 3K59A 2KZZA 3RRKA 5F8LA 2M4MA 1N36F 4LF8F 4USIA 4Y2IA 4HT5A 3KK1B 2H36X 2BM0A 1RTDA 2BBEA 3M6UA 2B7VA 4BWJA