1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
molecule keywords Peptide chain release factor 1
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
4AQYE 4NXME 4YY3E 1X48A 2N3GA 2LUQA 3J7Yp 1IBME 2NA2A 4DUZE 4DV7E 1XMQE 4LFBE 2UUCE 2IHR1 2KHXA 4JI3E 3C4BA 4X64E 2UUAE 2LRSA 2N3HA 4JYAE 2L33A 2NUFA 1IBLE 3C4TA 1J5EE 1IBKE 1RQ0A 4DV4E 1I94E 2DIXA 4DR7E 5IWAE 4DR2E 4LF4E 1PKPA 4LF9E 2RSMA 2LJHA 4JV5E 1XNRE 4X65E 1J26A 2CPNA 1YYKA 4DV1E 4DUYE 2L2NA 3T1YE 4JI2E 2LTSA 4GKJE 4X66E 2ZM6E 4DKKA 3T1HE 4GKKE 3OTOE 4B3ME 1T4NA 2VQEE 2UXBE 4B3RE 1N33E 4DR5E 1HR0E 2YT4A 1N32E 2RS6A 4B3TE 1STUA 4NXNE 2EZ6A 1YYOA 4M30A 4LFCE 2LUPB 4DV0E 5LMUE 2VQFE 4X8WA 1N34E 1HNXE 1WHNA 2JVAA 3ADJA 1GQEA 2HHHE 4JI5E 4LFAE 1ZBTA 1X47A 1FKAE 1XNQE 2UXDE 2L3CA 1UILA 1EKZA 4DV3E 4LF5E 2NUEA 2B3TB 2LBSB 2L3JA 1HNZE 4OX9E 1T4OA 1RC7A 4M2ZA 4DR3E 1WHQA 4DV5E 2NUGA 1X49A 4DR6E 1HNWE 2JY9A 2UUBE 2DB2A 4DV2E 3VYYA 5CFFE 4JI0E 2RS7A 4JI4E 4JI1E 4DV6E 1T4LB 3HTXA 4DR4E 4OOGC 4WFTA 1O0WA 4X62E 4JI6E 1YZ9A 4JI8E 2RTXA 1FJGE 1UHZA 1N36E 1DI2A 4JI7E 2E5LE 2B7VA 1XMOE 4YHHE 3ADGA 2UU9E 4K0KE 3VYXA 2B7TA 2UXCE 1QU6A 2LTRA 5BR8E 3ADIA 2L2KB 1YYWA 4DR1E 3P1XA 2L2MA 4LF8E 4B3SE 4LF6E 3LLHA 4LF7E 4WYQB 4KHPE 5LMNE 3ADLA 2MDRA 2F4VE 2DMYA
chains in the Genus database with same CATH superfamily
2XHWA 4WYLA 3K7RA 5HQLA 2RUGA 3T1AA 3UCZP 3C4BA 2VFVA 4DFKA 3Q24A 4YN3B 4P2XA 1B99A 1KLMA 2ERRA 1KQSR 1ICEB 1EIYB 3ET6B 4Z2XA 4L3KA 4JI8F 2Y1LB 4CT8A 2KXFA 1IN0A 4DUYF 3D1QA 4OLOA 1GMUA 4HTJA 4ER8A 2LXUA 2FJWA 3PW4A 2L6MA 1HYSA 2Z2LA 4ECZA 1TKZA 1TL7B 4M5HA 2K7IA 1ZS6A 5KL4A 1DTQA 4NASA 3OL9A 2EPAA 2DR6A 2BM0A 3BGFA 4D3HA 4KSEB 1IR2A 2GO9A 4WFBQ 3D54A 5ETOA 2YZTA 1S6UA 2HSEB 1QTNB 2A6OA 3CJ2A 2B56A 3V81A 5KFFA 2EMKA 2RT3A 2RS2A 4LSNA 4FKYA 5L1LA 5M2UA 1AXQA 4Z7YA 5F41A 3D28A 1WDTA 1JLCB 3FQKA 1DY3A 3CW2C 2H1YA 3C4TA 3UW1A 4DR7E 4X4VA 2ILYA 4M5DB 4GKKJ 5KFVA 5T7LA 3M32A 3DCAA 3M8ZA 3MM8A 2R2TA 2KVIA 3MHSC 4NLVA 3EXCX 2VPWB 2J0SD 1D9DA 4HR2A 1LXNA 4AL6A 2DYAA 3N28A 4M30A 3JSMA 4JV1A 3VF0B 4Y2IA 2HWTA 4Q43A 3BDEA 1GK8A 3IBFB 2V2VA 1PIEA 1ZAAC 2B3TB 5B0EA 1KLNA 4U96A 4ZVRB 5CAAA 2W4CA 1HBNA 4DL3A 3D6FB 4OZNA 1N34J 2EKYA 3FCVA 1VYAA 2GNKA 2AQ4A 1M1GA 1ZYQA 3MCSA 3W2VA 1OYEA 2FJBB 1FJGE 2H65B 2X3GA 4YHHE 2BANB 3LPYA 3FFIA 2ZZMA 4PKDB 4R2EA 5JVHQ 2KKHA 2ILZA 3CC2S 3NNCA 4WK3A 3P1XA 3VALA 1FD8A 4DPWA 4LF7E 3TUJC 2HBQB 2J6UA 2M4MA 3JYTA 5HMZA 2DLKA 2QT7A 1NHKL 2ZD1B 2KRBA 2YTCA 4PG7A 5KFPA 3J81j 1YUJA 3OUYB 3OFFA 3BEGB 2JDJA 8AT1B 3H40A 1UL3A 4OJ1A 2A25A 3DDKA 4IRCA 3OUYA 3U1MA 1FDAA 4C11A 5EN1A 4QBUA 1CULB 1FRKA 5E41A 3M6WA 4UOCA 2BYCA 4JI8J 2XB2D 1VLOA 1Q16B 2HHHJ 2EL4A 2KU7A 2MZQA 3GLJA 5LMUE 4WP8A 3CUNA 4TU7A 3BB5A 4JI5E 2WW4A 3MWBA 2ZH4A 4NZ6A 5ETPA 3BO2A 1O51A 4WXCA 4O5GA 4LQ9A 3IAM9 3UN2A 3F44A 3GG1A 1IBLJ 5GADI 2IM2A 1N88A 4MK8A 3C3LA 1SJ4P 4MYTA 5HBMB 4WFXA 4CTAB 1U6ZA 3C14A 1U1PA 2NPIA 1RWNB 3KG1A 1S77D 5AXNA 2RSIA 5B08A 5M2RA 2DNMA 5BR8E 3PR5B 2CYYA 1MROA 4FYXB 1NB7A 3MFIA 4LVOP 1BB8A 4B3SE 3HXLA 2XLJA 2MDRA 3KK3B 2VF3A 1J27A 1C4CA 2QL7B 2DHSA 1Q8KA 1RT7A 3EZOA 2IM0A 4C3MA 3BBCA 3NOCA 3OD2A 2BMBA 2H4WB 1T9YA 3K5PA 2IJFA 1B0TA 1HA1A 2G2YA 2V9KA 3CD5A 1A7GE 3KJNB 2AF6A 3O1LA 2GQQA 2E5LF 2GHWA 2HNDB 1B64A 2LJUA 4I2PA 3EPLA 1OIAA 2B6AB 3BR8A 2GMHA 1I1GA 4MJKA 2RS6A 2FY8A 3NGUA 3MMJA 5DM7Q 3K5LA 1YLXA 2N3OA 2NZCA 3OFHA 2ZH7A 2HHQA 3M9OB 1IR0A 4DPUA 3OW2R 2ZM6J 3QZ8A 3PDNA 1U47A 4JI6E 3MR3A 3PW2A 1KVJA 1TR0A 4IUFA 4QWBA 5HQ8A 1OO0B 4F26A 3IG1B 2EOMA 3KYLA 1NK7A 2UVUA 3D7SB 2PMWA 1UP1A 2B9YA 4CP5A 3CDEA 4QYRA 2HQ3A 2M70A 3K5NA 4RW6B 1D3WA 4ZJLA 4CM0A 4DCPB 4ZOSA 1IBCB 2CJKA 2ZBIA 3J7ZT 2EPRA 3IN5A 4LR7A 1AAYA 3DKDA 3PW7A 5LMUJ 4NZ7A 3IS9A 2FUG9 3MAAA 3W1YC 1X5OA 3TRGA 3KWMA 1NM2A 2R7WA 1NK0A 3HHLB 3KNAA 3Q89A 3OFEA 4J8ZA 3VGTA 4IR9A 5KG7A 4B3OA 1R3NA 3DOMB 1JLEB 2HQCA 3G8SA 1LW0A 1DGCA 4DR5E 5K9FA 5KT6A 1Q79A 4ZP7A 4Y2MA 1FRMA 3IO1A 4O3PA 1XN9A 1HMVB 3M8PA 1HQ2A 4Q8EA 4DFPA 1WKJA 3NGSA 4K4SA 3M30B 3EPKA 2XBPA 2M8HA 1XMQF 3BGRA 4KHPJ 2GAHC 3I56S 1M1KT 2HPUA 5T41A 4LIWA 3WX8A 4DLGA 2DLQA 1A1GA 1RTJB 4G1QA 2LA6A 2QMUB 2EC0A 3PW0A 1S49A 3Q8QB 3RYLA 2OP5A 1U8SA 3NOGA 2GQCA 5LXYA 4TVAB 4CLTA 2F65A 1U0HA 2M1SA 3FZBA 1APSA 1YJTA 2XYPB 3E01A 2PSZA 3QJPA 1W2BR 4NA1A 2DGQA 2NZ4A 1FRJA 1PJTA 1F2GA 3SSRA 4CZCA 4FNHA 2A10A 2D7SA 4O3QA 1TAUA 1WXRA 1RTDB 4V1Ak 4DV7F 4UY85 1H72C 1PBAA 3TR5A 1NZ8A 2BW2A 3Q2TC 2RF2A 1JLGB 1YBTA 3TAPA 2LXIA 2EOOA 3NEKA 4RZRA 2QRRA 3G6ES 3NNAA 1S4FA 2Y0BB 2B0GA 4YP3A 2BA9A 1QVFR 2H4YB 3CJRA 5LSLA 1Q7LB 3D6HB 1JK9B 3VQTA 1AYEA 4HEIA 1ZETA 3ADGA 3MM9B 4B3RF 1XEZA 2M2BA 2MGZA 3MF5A 3BBBA 1RT1A 4EBDA 4JV2A 2J9EA 4I1TA 3QYYA 4DQSA 2FJVA 1WHXA 4AQYE 5KFWA 1RUSA 3MR6A 1XMQE 5L39A 1S1UB 1WTFA 4E2FB 3EGNA 3NL0A 4O3NA 1URNA 1ZTWA 2CJBA 5L9XA 4WPYA 1NJWA 5A8RB 4RPFA 3N6MA 4HEA9 5EHHA 3OVSA 4OJHA 2DGWA 3LQVA 4FYWB 2RQCA 1FD2A 4H4OA 4F0HA 1HNVA 5B0BA 3RAQA 2HGMA 2MKCA 3PRBA 4F2JC 2RSQA 1F2HA 3U1LA 1NH7A 4ZPCA 3CIZA 3HPOA 3Q8VA 1FTCA 1V3SA 1NKBA 4Q0BB 2JFDA 2JH3A 5F9LA 4IYQA 4EU0A 3CCRS 4JBCA 5E3AA 3KMQA 3SQOP 1YZ9A 1X31C 3DLKA 2HLTA 1V5VA 1UZDA 3D9BA 4OL8A 2AD9A 3J7Z5 2FIUA 4Q2MA 4GRSA 3WQPA 4FBTA 3M9NB 1JXLA 1RWVB 1RWUA 4MIWA 1VC5A 5AE1A 1DLOB 5IWAF 1DTQB 4CO5A 3DDNA 3HQ1A 3BGHA 1F5BA 1WOOA 1BLUA 2ASJA 1RU1A 3R7NB 3JXOA 1KTVA 3DYAA 2W9BB 1AH5A 3PY8A 5KT4A 4DR2E 4I56A 1SJFA 1RE1B 3R5CA 2AZ1A 5A2QY 1T8EA 4PQAA 2A0FB 4YHHF 2C2OB 4PZVA 4RKUC 3OR2A 3EVMA 3WIVA 2RDJA 4J9SA 1N33E 1C0TA 4UT4A 2HIQA 1YSJA 3BYPA 4HT5A 2ZUGA 3TA2A 5DQHA 3VR1A 1C2PA 1VHIA 3ZZUA 1RTDA 4PUOB 1H2VZ 2G7HA 4DV3E 1FKAF 4WE1A 2XYGB 2Y8YA 2WK4A 1UFWA 3MPWA 1XR7A 3BDPA 2HFOA 5A6BA 2RS7A 2ATCB 1G6BA 4DR4F 2OEMA 4BCAA 4ANCA 1M5VC 1LQ9A 1XMOE 1X0PA 2IVFB 4PWDB 2HJJA 4Q7AA 1XR5A 3EM1A 3PFEA 1LWEB 2VL1A 2LTRA 4OZ0A 1YSAC 5D0HA 1YYWA 3KUHA 3V6DB 3WDOA 3QNWB 4B3RJ 2G0CA 2P6TA 4F6NA 4J9LA 4IG0A 1AROP 1IBLE 4DSFA 5B09A 4JOUA 3MI7X 3K89A 3MM6B 2YTQA 3RB4A 1VISA 3MMCA 3V6HA 2V6AA 3D67A 1NK5A 3R8YA 2GCFA 1HQUA 3AJ1A 2ZJRQ 2ZH5A 1S1XA 5IM0B 1F1BB 1BY9A 5L9NA 2GMJA 1IBKF 2ALZA 2VA2A 3KK2A 3PKMA 3MM5A 5FLXY 4QU6A 1N0VC 2F4FA 1UPPA 5KFCA 3UPFA 1T4OA 3POTB 1DRZA 5KFLA 5GAHU 4FS2A 3AUZA 1WC5A 5KFXA 4PG4A 2UXBJ 3EDRB 2UU9E 1UW4A 4P2FA 1B0VA 4CO1A 1UAWA 2EPUA 4F3OA 4N7TA 1UPMB 1XJWB 1ZPVA 3TVKA 2KYXA 5J2NA 1N33J 3TQEA 3VAHA 1HHQA 3B8HA 1IM6A 3FJ2A 1K1SA 5H9EJ 4KYZA 4EO6A 4ZVGA 5HSPA 3UE2A 2CJXB 5KG1A 5M2PA 2EOJA 4JI2E 2DNGA 2I6WA 3SV3A 2ZM6E 5A6JA 3KUGA 3H2LA 3HZEA 2HVHA 1TZ0A 4I2PB 1VHFA 2EN6A 1C4AA 2XQCA 2HQDA 3FBBA 4JI3F 5I3UA 4F0KA 4FYVB 2V63A 3AJ2A 4M2ZA 1TUVA 1R6VA 1HNXJ 2CNNB 2RQMA 4USUA 2MKKA 3FC9A 2ZNYA 1RT7B 4CLLA 1O0WA 5AASA 2EPXA 2W9BA 4K0KJ 1WF0A 3VQSA 4O4KA 2FVCA 2EI5A 3A8IA 2H5IB 2WVCA 1H7WA 2HAIA 2DR9A 2K1RB 3BPSP 4IOCQ 1TUGB 3BQ2A 2M9KA 1QAXA 2CPYA 4DPTA 1LK7A 4N56A 1CC8A 1N5TA 2CNLB 1RAEB 5A6WA 3TYTA 1T05A 3W63A 2BJ9A 4KBIA 2JHEA 3LALA 3MR2A 3AA9A 1U1LA 1PGZA 1RT4A 1VS3A 3EICA 4JYAJ 2P9EA 2IMWP 2KT2A 2UVVA 5IZHA 3DOKB 5I42A 4EWTA 2HQIA 4R03A 4OMFG 3ZZOA 1VQOS 2FB0A 2JX2A 4IQMA 3GIIA 4DV0E 1N34E 3DRSB 4JI5J 2VPXB 1ZBTA 3E51A 2N4CA 3UWTA 2QLXA 4DL6A 5GAGU 1NJZA 2DXEA 2MQQA 3D2WA 5ETSA 2F3JA 3W9IA 4DSLA 3I82A 1S1UA 1BC6A 4LF2A 2XO6A 5BR8F 3LTOA 5DDRC 2AKWB 4OZ2A 3I31A 4OYWA 2NYHA 2EN3A 1JK2A 4ECWA 1BBGA 2EOSA 4FF2A 2H54B 2DMYA 4ZYHA 3PHEA 1GXLA 3SFGA 1TN9A 4OV6A 2XTJP 1ZM4A 2DIXA 4DUYJ 2H9ZA 1REGX 4U8YA 4ZPTR 1ZAVA 4LF9E 4LU9A 3KLIB 1OS5A 1YYKA 4X2BA 2AJ1A 2EM5A 1TAQA 2I38A 3KOAA 3EXYA 4OFZA 3V6JA 3OXGA 2VQEE 3K8VA 3KJQB 3BH6B 1HR0E 1C0TB 3UI3A 2UXBF 4U8VA 1CEZA 3FK4A 4TN2A 5DZ7A 5DQGA 3EPGA 2C3PA 3MSWA 2CZ9A 4NE9C 2OLWA 1F2IG 4ERDA 1ZOTA 1N52B 1KQKA 2EPLX 3IBCB 2DGTA 1FKOB 2DO4A 2MHEA 2B5JB 1LV5A 4EZ6A 1BQMA 3I4PA 3U1NA 3RZAA 3FKBA 1UZHA 3I0SB 3LF0A 4AT1B 2RU3A 2JRSA 2HGNA 1X48A 1NPRA 4J9OA 3T5KA 2OPPB 3RAXA 4WU3A 3SDEA 2FC9A 4PR6A 4QW8A 3PYGA 1NHUA 1OY9A 3M7VA 2KJVA 3FRYA 3R1LA 1K8AT 2F8MA 4KB7A 4N47A 2G0JA 3CCTA 2EG2A 4RU9A 3RW7A 4LTYA 3S7RA 1TL5A 4OI1A 1N32E 2HZAA 2MXYA 2AZ3A 2OPQB 4C48A 4DI6A 4M9VC 4LFAJ 2J0WA 1M5HA 4B3TJ 1T0TV 3JSRA 1X47A 2RDDA 2A2DA 3AFGA 5MAOA 5E33A 1R8AA 2HW3A 7FD1A 2GW8A 4ZP6A 4KTQA 4NRTA 1RJJA 3GJTB 4DR2F 4EI2A 2EN8A 4W92B 2EN2A 4ILLA 2W2MP 1RWOB 3IRXB 4M5LA 1G7CB 2RQKA 1CJTB 4OX8A 4NRUA 3EPIA 2L3MA 4YDDB 2WBMA 2YKAA 4LVNP 4DV5J 4WYQB 3AXKA 4QR0A 3HO1A 1PC5A 4N77A 3KK1B 2R2RA 4YY3F 4NEZA 5L1IA 2UUCJ 2OHDA 3H5YA 4RNMA 3IBWA 3NY0A 2N3LA 1JLBA 2B8PA 2JWNA 1GMWD 5DQIA 3ISND 1RBAA 6AT1B 3I55S 4J37A 5EWGA 3IWNC 3JTNA 4K59A 4LSLA 3NGRA 4AFFA 2PN6A 4C7QA 4C0HA 3GV8B 1Z1ZA 2UUBJ 2IJNA 4B3MF 1YYOA 4RHBB 4LF4F 3RRGA 3CSKA 1M5KC 2JVAA 2YVSA 4U95A 2FY1A 1FXRA 4JI2J 2JR1A 1VBXA 2KM8C 2B8QA 2YTDA 4O24A 1SH2A 2YTEA 2HAFA 3UD4P 4NMLA 1AB8A 5IT0A 1IUJA 2PC6A 2EM7A 1FRHA 2OPRB 4QWAA 3UFCX 4B9VA 1PYSB 1HNVB 3ELHA 1M0SA 2ZBQA 3QAEA 1HHTP 3ZO7A 2OO4A 2XC9A 4Q35B 1S7IA 4ALZA 1QU6A 1IJFB 2FLOA 3FQLA 2YPNA 4PAAA 2QA2A 2YU8A 4KHPE 5LMNE 2QSFA 1Q53A 1S59A 2ROPA 2C3MA 3NG8A 4IQXA 1NH8A 2E5IA 4K4VA 4ZYGA 3K2YA 1LLMC 3DJWA 4HYKA 5HJYA 2CWKA 4DV1J 1TMMA 1O6XA 4MKVA 2B43A 1Z2LA 1FFWB 1NK9A 4ZJOA 3THPA 4K4XA 3T19A 3W5ZA 3THNA 2OUGA 5DJBA 4ZVEA 3J80U 2EMLA 4ZLJA 1T03B 4OX9E 3HHKA 4GC6A 3J7AG 1G2DC 2C2EA 4PXEA 1ZAWA 2YTGA 1FRIA 2I8EA 3E8OA 2DH8A 1N32F 4OHWA 1BQNB 4CO2A 1JLGA 1SXLA 1WF1A 1VQ9S 3TZZA 3TA1A 2DH9A 2RHQB 2VFUA 2YWWA 1AZSA 4IJDA 3CF5Q 2BX6A 1Y9OA 2EFPA 1HNZF 2POKA 1EKSA 2QLFB 3O2IA 2V89A 1TKTA 3W8PA 2JOQA 1JNRB 3H25A 2QGFB 1VDHA 1X3CA 4TUGA 3IXQA 2DNNA 4ZVOB 2EPMX 3PW5A 5DDOC 4NLQA 4DL0C 3OL8A 4WFAQ 2HFNA 1KHWA 2AGOA 4U9RA 2KM8B 4DV2J 5LL6R 3T5JA 4NLXA 5LSRA 2GPIA 1MEYC 1F9FA 3DC2A 2WW8A 1KJKA 2N4DA 4U67Q 4WXOA 4F4ZA 3AHPA 1EJ7L 2KONA 3M30A 1WELA 2XY6A 1H7XA 3M2RB 2QLWA 1JMTA 2YKNB 2HGLA 2LLZA 2BEFA 4FZVA 3PR4A 4RU2A 4DV6J 3Q0AA 2ZKTA 3LWLA 1S5ZA 3AJDA 2M4IA 1IKWB 4DN0A 1UHZA 3KLHB 1N5YA 3GJRB 3ZTOA 3DM2B 3H8YA 2HURA 3KG0A 1ZM9A 3GZ7A 4AYBD 4F50A 1OPZA 4L5NC 2PDAA 3G9CA 3ZTRA 1UEKA 4FYDA 3DLBA 3V2UC 5AE2A 1HBMA 2MKHA 3QWPA 2PD1A 2HS0A 2E5JA 1YTYA 2HVIA 2XEXA 1FDDA 4GO5X 2B5JA 2LU1A 2ZDOA 5G4DA 3OHAA 1ROFA 1VI7A 3KTQA 4M5GA 2ZE2A 1XMOJ 1MWZA 5IC6B 4YUDA 2IRXA 5BYQA 2XZDB 4W90B 2E1AA 5H1SV 2VG5A 3JSYA 2DVIA 1JLQA 4DQPA 3RTVA 4KHPF 3MCMA 2M8DB 4KY3A 1RA7A 3FEZA 1EP4A 3TNVA 1EQ0A 1YGYA 3C2PA 2JC0A 1RCOB 3P45B 1NKCA 4GC7A 1UEVA 5KFJA 4I0WA 3KLGA 1MNEA 1T4LB 2Z56B 2EC2A 1WC3A 4KHMA 1T39A 3ISNC 2CUYA 2AHOB 3HHEA 1RK8A 4NLRA 1H0HB 2QC3A 2FHJA 2HHUA 4R8OA 3MM5B 3DGPB 1S1VA 3A3OB 1Z4UA 4M5KA 1V9OA 3N0VA 2K3IA 3QGPA 2FJXA 4F9CB 1IKYB 3RBXA 1DQAA 1SC4B 3C16B 1SKUB 3P8BB 3EZUA 3HPSA 3RU0A 3GCWP 4CO4A 4QWDA 1NDCA 3MPDA 4DR7F 2B9EA 5B0FA 2YU5A 5CYMA 2ZVIA 4KKOB 2VH7A 4ANDA 2XO7A 1Q5VA 2GC8A 2RD5C 4WXDA 4X62F 5J2MB 1YBAA 1RTHA 3IWDA 2MLZA 2PO4A 1WC6A 3R3TA 2D1CA 2LMZA 2K8GA 1SH3A 1Q95G 1M5SA 5LMNJ 1WHNA 1RWPB 1GTEA 2QX0A 4R0EA 2V86A 2L3JA 1RTIA 4CWBA 1LWCB 2YRMA 4OYZA 2E1PA 5E7OB 2XMJA 2IM3A 3H5UA 2HHHF 4R8UB 2GHPA 1QY7A 1HNXF 4N41A 2E5LJ 3C15A 3CIMA 4CNYA 2MZ1A 3EX7B 2LXFA 4OX6A 3BN4A 4ZYEA 1Y5NB 3C19A 3BO4A 3UR3C 2AYEA 4TY8B 1YDLA 3IGNA 4DN9A 2LUQA 1Q78A 3P5TL 4LSZB 3BSNA 2Q6BA 3JQKA 4ED0A 3SFUA 3BYRA 4LRAA 1HPZB 4DQQA 3W60A 3ZZPA 1S0MA 2PT0A 3PVXA 5LXRA 4A8SA 5J2QA 4JV5E 3NBPA 3UDLA 2J8SA 4B9LA 2CPNA 1PG5B 4O3SA 2L2NA 1DURA 1R0AB 2EM0A 1RWMB 3NS5A 1BE4A 4K4TA 2R7TA 3EJMA 4TQRA 1HNXE 2LU2A 1FDNA 1NU4A 4ELVA 3PV8A 3CJTA 1VR6A 1P47A 4A8WA 2OGUA 1SIWB 1R8HA 1WHQA 3HX9A 2L9WA 4ID5B 2EPNA 1CBKA 2G0IA 2Z4PA 3GB0A 2MZJA 2HZVA 5IQQA 3VHQA 2C2NA 2OEKA 2B7VA 3GIMA 3M1VB 5FJ4A 1U24A 4C8OA 1S4EA 3P3DA 3O3LA 3GJQB 3HFKA 3EPJA 1WI8A 2B4UA 4DL7A 2FD2A 4UOFA 4ILMA 1DTTB 3NS6A 4O0IA 3CMAS 3W2WA 2MZSA 2WVEA 4TQSA 2HHVA 2QA4G 2YNFA 1JLFB 1QUPA 4OHYA 3GFYA 2R2UA 1RU2A 3HSZA 3CJQA 3EZ5A 5KL2A 4LR8A 4DG1B 2R8IA 4NZ0A 3MR7A 2VODA 4AQYJ 3V81B 4J5OA 4LRFA 3HLUA 4K4UA 4F04B 1MMNA 2CVIA 4NXNE 4MK7A 2AJFE 3BM7A 3KWRA 5F9NA 5HN0A 5KFKA 4L72B 4EYHB 4ENOA 1L3KA 2V4JA 1S1XB 5IM0A 5BYRA 2W7OA 1RGVA 3R5GA 3HJVA 2ZOMA 3DRPB 4WPAA 2NS1B 4DCJB 1R8BA 3G2XA 4H4OB 5A69A 2DEJA 1RHQB 3ICLA 2D3O1 2EFQA 1WJPA 4WKRA 3P5BP 4HL9A 1AFIA 4WZQA 1NUEA 2XMUA 5HMYA 4HHHA 1YIJS 1FVSA 2CQDA 3LP1B 2CFXA 3JYTB 1SL0A 4DSKA 1FEHA 1X9MA 2WSEC 4PQUA 3CD0A 2EVZA 2VG5B 3QRQA 3R5AA 2EPZA 3M8YA 1JLAB 4LBHA 5JXSA 1C1CA 1U6FA 5KL6A 1FKPA 2CAJA 4HI1A 1N56A 1VC6A 4JP8A 2IYIA 3LA0A 3M99B 2YWEA 5CD4H 1RWWB 4KC5A 1BGXT 3R97A 5DM6Q 2VKZG 3FIGA 4MT1A 3OTOJ 4BWJA 4RWWA 1T11A 5HATA 2VUGA 2FVSA 5HL7Q 4BC9A 2B9XA 2W2NP 2YRKA 2ASDA 1WI6A 1YJ7A 1W2IA 5J1EA 3FEXB 1RACB 4TYBA 2VASA 4LMZA 1RHMB 3LP0A 2HQGA 3W2WB 1TK0A 1KOOA 2R8GA 3RMPA 3CMQA 3WC2A 2EPKX 1EX8A 2MYFA 3TVYA 5G0RA 1EH8A 5F8MA 4QZVB 3VZHA 4HKQA 3T1HF 3L3CA 1PDAA 3GSIA 2JVRA 3KHLA 3GE9A 4ZCKA 3PEJA 1YJNS 2CPZA 3ZTPA 2AU0A 1R43A 1UJ6A 1CQNA 1Y0HA 4FVCA 4UZCA 2MY8A 2R9LA 2LJHA 2F40A 4FF3A 4KWYA 1KONA 5A8WB 1RT2A 2EKNA 3NCRA 4BDPA 3I0RA 5SUHA 2OEJA 4TUIA 4CO0A 3NP5A 2V4RA 1VLYA 1D8YA 2AEJA 3ETMA 2MKYA 1RTJA 2EE8A 4AD6A 2LCEA 3MEEA 5AXKA 2EQ0A 1VQ6S 5K5MA 2R7VA 5E3RA 3R1HA 4UF4A 3D3CJ 1R0AA 2QA1A 2UUCF 3SCLE 4N5SA 2QLJB 1B70B 4ZA1A 2E7WA 3RRKA 3US5A 4FPIA 1Y3JA 3NLCA 4JI5F 1HBOB 1FT8A 4QJVA 3MGJA 5C5JA 3ILIA 2EOXA 2EK6A 1J5OB 2HZCA 4J9PA 4ECQA 4FYYB 2MSSA 3GFXA 4Y65A 3GG0A 3WHIA 5CCMA 2N82B 3M2VB 2ZJQQ 5DG7A 5AE3A 1TP7A 1WD6A 2DNPA 3V4MA 3C6UB 2YNHB 1CVJA 1S9GA 3MM9A 2X51A 4FVMA 3M8WA 1X4BA 1VQPS 2CADA 2DGXA 3IG1A 2WOMA 2VZ9A 1OQ3A 3EWGA 3I5BA 2O01C 1ZAXA 5BR8J 2AW0A 4NLTA 2CQHA 4C0BA 3HULA 4C8KA 3JS9A 4OYBA 2UUAJ 3LOUA 4Y2AA 4LF9F 5ETMA 4X65F 1HR0J 1RYRA 2CPEA 2HYIB 4TYAA 1GXUA 2E1MC 5LT5A 1AW0A 2BJ1A 4DV2E 2MMYA 1SI9A 4CLFA 3M9MB 2CPIA 4NCGB 3AV0A 3DRRA 1XERA 2MLYA 4FP9A 4L74A 4D3GA 4K50A 2DRDA 1DFDA 4L3NA 2NREA 3W9HA 1N8RT 5HVFA 3BF4A 3E01B 3KLFB 1EH6A 2G1HA 3DOKA 2L48A 4NXMF 2BACA 4YEAA 3RAMA 4QYZJ 3F6HA 3AY0A 2ABYA 1N4LA 4CQ1A 3TW0A 4QIEA 4WJBA 2LKZA 1WORA 1RB0A 3BIDA 4OZJA 3KLGB 4F9AB 2BVZA 3OTCA 1S7HA 1JJCB 3MAQA 2EOHA 2LQ5A 2F5GA 1PJSA 3MAHA 1YITS 2VKRA 5F8HA 3EGZA 1X9WA 1HQEB 3N01A 4WK1A 1YHQS 4IFYA 2WAQD 3OBIA 4A8QA 3D5MA 1BD6A 3KNGA 4B08A 4ECSA 3HMJG 5KFIA 4LIRA 1NNDA 2UUBE 3R2DJ 1PYTA 3DXBA 2OMOA 5GMEA 4I8OA 3OL6A 1F6TA 5KFOA 3QZ7A 2V2QA 4P78A 1OYDA 3J7AN 2KDOA 2V5HG 3KZYA 1YUIA 3G4SS 1HBMB 2P2CB 1Z2ZA 5IV8B 2GA7A 1A9NB 2DTJA 1VOMA 4DQIA 3QGGA 2IY5B 4AL7A 1KDNA 4DV0J 2IDEA 5ETLA 1S99A 2EMBA 3EPHA 2Y8WA 3HVTB 4M5DA 5B0AA 2CPJA 1F3VA 3EMTA 1V3ZA 1A1KA 4ZMMA 3TOQA 4MFBB 2Y9HA 4PWUA 2XYHB 4K2XA 5FD1A 2ADRA 4X66E 3OVAA 4LFBF 4F54A 3NCPA 2VPYB 4ZLPA 2R8KA 3NAHA 1O8BA 5IT4A 2BE2A 4P72A 3T9ZA 4QQBA 1FJEB 1VQ8S 1NLKL 4DR6J 4ED5A 3SV4A 3MR5A 1RAJA 1ACMB 4QIVA 1MMDA 2L92A 2MC5A 2XI2A 4C3KA 4KH1B 4HHJA 1BQMB 2E9ZA 1OJ4A 2G9OA 2VG6A 4DV6E 3A8KA 2GAGC 4RH8A 1U49A 4LF1A 2DNRA 4BHBA 2MZTA 1IVZA 3R6LB 1FI4A 2JWOA 2DR7A 2VPZB 4R2RA 4URQU 3KLFA 2AJQA 2YTOA 3PRVA 2RQLA 2ZFHA 4H54A 3RBZA 1HL6A 3HVTA 4J9MA 3L7UA 2WB1D 2KOUA 3ADLA 3I96A 1KVKA 3CO0P 4NA2A 2YKMB 4GEQB 2PMZD 2IBKA 5AC5A 2YKPA 5ETKA 1AZSB 3BSCA 5IWAE 5KFZA 4NLYA 1NSKL 2F63A 2DY9A 3C14B 3BR9A 3QT7A 3IA0A 2KXNB 4CLYA 1Y7PA 4PYDA 1FDBA 4GKJE 2VC0A 2BOPA 1NB2A 3LO3A 1MG7A 1AUDA 1RBLA 2JZ5A 3DGVA 3Q8UA 4P2MA 4Y0FA 4H4KC 3JTPA 4EMDA 4NLSA 3D68A 4CLSA 1X5SA 4YY3J 4Z7CA 1MW7A 1A1JA 3I4HX 5DG8A 2WBSA 1NDPA 5J2NB 2NQPA 1CJKA 2PEBA 3DGPA 3ZTSA 4DMZA 3GIJA 4ECUA 4BWMA 5L1JA 2DD8S 2ENCA 4RBUA 5K8PA 1N34F 2I9IA 4CCHA 3AB2B 1FJGF 4JI4J 1FNMA 5JMNA 2OTJS 1CSJA 3SCIE 3JSMB 4NZVA 5H9EK 4A46A 1U1QA 2MDAA 5A8KB 4DR5F 5E2QA 5A6AA 3LP1A 3NGDA 2DK2A 3VAGA 3A3PB 1K44A 1NCSA 4B9MA 3MM8B 3W5YA 5E3CA 5I3QA 4PYAA 2OSRA 3K5OA 2V8PA 4NCAA 2C42A 1QNTA 3DF6A 2BANA 4LF4E 5L38A 3RW6A 3QIDA 1X4DA 1J5EJ 1SKSA 1KQFB 5E3QA 3OTOF 2BJ7A 3D0IE 1SKWA 4J9UE 3G8TA 3I9ZA 5D8HB 2ZWOA 2V8VA 1RT2B 1E6YA 5DRKA 1FNOA 4I69A 1YFHA 3A12A 3QO9B 3M6VA 1JKHB 4DR3E 1IKXB 2HBRB 4OX7A 4FKXA 4TLRA 3LWMA 2J76E 4C8NA 3PX6A 5SZTA 4R5PA 4LF5F 4GZNC 2EQ1A 1GFWB 1RT6A 4RW9B 5D4PA 3UDEA 2V8QB 3NMAA 2HK3A 3MUVP 1YI2S 2VBXA 2CXEA 1WRJA 2ZVSA 1S9GB 3C8YA 2YH1A 2ZH3A 4UUXA 4USWA 4DF8A 3DLGA 2R7RA 4DV3J 2ZBCA 4DX8H 2XI3A 3LW5C 4E98A 4UOGA 2R4FA 4RBVA 4IRKA 3V4IB 1YRTA 4KHRA 4C8MA 1PAUB 3DLGB 4JI1J 3K59A 2D9PA 3DOLA 1W7WA 1WKLA 2JXPA 4DUZJ 1FKAE 1DAXA 1IWGA 5K8NA 1LW2B 1P27B 1YX2A 2ACYA 1T02A 2RH3A 4YR2A 1G4CA 1T9UA 2J9DE 2GVZA 4WU2A 4ZCMA 4USHA 2P8IA 2Q3PA 4EBEA 1EH7A 4JI6J 1QE1A 1R8PA 4USTA 1DI2A 4PQUB 3I0RB 4RNHA 1GX5A 2ROGA 3J7YI 1KLMB 4HI2A 5JVGQ 2HFZA 2L9NA 2JEJA 3VAKA 3NGKA 3CXCR 4WTOB 4W4MA 2XLKA 3LGNA 1VK3A 2ZUAA 4URSA 4YR3A 2RE1A 2OFGX 1YRXA 2CQGA 2CQ4A 2FTRA 2PMHA 7AT1B 2B6AA 2HIYA 4RR5A 1S6PA 2GJ2A 1ZU1A 1IQZA 2XZWA 2WB4A 1UCNA 4LJMA 2EMIA 1U09A 2GQ2A 2R2SA 4I6AA 2JEFA 3J7A1 2VG7A 2V8GA 1I94F 1GMWA 4X65J 2BE9B 2EOYA 1UWBA 3QWUA 3C6MA 4NOHA 3FNNA 5IC4B 2UUWA 3TEGA 1DBDA 2W4DA 2KYZA 3QGIA 4JV5J 3FMWA 4JYAF 2E1MA 1TV6B 4J9QA 2LVHA 3M8RA 3QG5C 4LF7F 5IT9Y 2HKEA 2E66A 3MD3A 2DT9A 4YB5A 3CDWA 4YB7A 2C2KB 3OJSA 1Y4ZB 1HNWE 1LXJA 1T7PA 2DB2A 4RW7B 3KLIA 5F8JA 1KSPA 4IOBA 2VQEJ 1RHUB 2ZH9A 2XMVA 3QLHA 2ZH1A 3EYZA 2WSCC 1Y5IB 1FKOA 2LQJA 2C2ZB 1IBMF 2QMXA 4KGVB 4C4WA 3WBZA 2D3OR 1VQ4S 3VWSA 4K0KF 3PO5A 3NNHA 3KMSA 3GWCA 2CJAA 1FNXH 2ZEJA 4DPXA 4DV0F 3QSYB 5A0YB 3GV7B 1X5TA 4BHQA 1I5OB 1KEKA 5EDWA 3DI6A 2J8AA 2X1AA 1G3OA 4EBCA 4RUAA 1SR9A 2A2CA 1VBYA 3HF5A 1OMSA 2CIMA 3ISZA 4K2JA 2V50A 3EGVA 2MKJA 4GVBA 2W8KA 2ZD1A 1FCAA 2MJNA 1JXEA 4GKJF 3CCVS 4HACB 1TFWA 4CNZA 2LCWA 3T5LA 4B3TF 2QYCA 5DO2A 2BUNA 1XNRF 4H4MA 1F5AA 1HNIA 2FZKB 2FYXA 2VC1A 4AUKA 2EQ3A 3CMES 1CJVA 3FCWA 2F4VF 1EKZA 1DLOA 4XPCA 3MD1A 1HR0F 1UFKA 1SV5A 5CFFE 5FIIA 2VG6B 1WG4A 5DZ6A 1JJ4A 3PJWA 2QEXS 2LT7A 2GJFA 2FHJD 1GH8A 1G2FC 4F36A 3A3NB 2CQBA 3H59A 3SEOA 3C66A 1WKKA 4MAKA 3ADIA 4Y2CA 1BUXA 4QU7A 4Q5VA 1K1QA 1PYOB 1R0BG 4A8XA 1XMQJ 1ZM3A 3T1YF 4YQWA 4B3MJ 5KL5A 2NUFA 4DV6F 1ZR9A 4ZYDA 4DR1J 2HHWA 4OI0A 2YX4A 3DOMA 4LF5J 4M1KA 1M5OC 5B0CA 3K6QA 2PGCA 3CCZA 4R2PA 2Q6CA 4K8RA 4MKAA 3C6TB 1PC4A 1DQ8A 2GIRA 4KH0B 3MOZA 4CLWA 3PYEA 2HWIA 4ICLB 5F8NA 2HRYA 4IG3B 2M9AA 2EOEA 4ZVUB 2Q8UA 2HLUA 4DFMA 4JI7E 1UA0A 1Q86T 2BRKA 1TVRA 3VGVA 2ZC3A 3FUYA 5CYJA 2J0QD 2ZWPA 5HP1A 1NDKA 2HHSA 2N3GA 4DUZE 4KGMA 1KYQA 2RUSA 2C28A 1SQEA 4C97A 4R2AA 1E6VA 3OFGA 3ZOQB 4M95A 2E5GA 2BQUA 2FC8A 2Z2YB 2CKWA 1KHVA 1HI0P 1LNQA 4DU8A 1QAIA 2XS2A 3ENAA 4TLQA 5A6PA 2GLIA 1DARA 1RKJA 2D3ZA 4F8RA 1REVB 2DCUB 4ED7A 3CPWR 1GX6A 3Q8RB 4LFCF 3N9UC 1CPZA 2DGSA 2L08A 2UXDF 1EHWA 2KRRA 1WHWA 2LQ8A 2M3DA 2JEIA 1OQ6A 2D41A 3DU5A 2KTQA 5EUHA 4O43A 3FCHA 3F0NA 3FBCA 4JV5F 4MIAA 3UN3A 2DBBA 3X1LB 2Z8QA 2IYGA 3ULHA 2OKQA 2F8HA 1NSAA 4M94A 4OZ5A 1A6LA 3HK2A 2ROEA 3NAIA 3OR1A 2DRAA 3G8QA 2FVRA 3VHTB 1RXOB 2EPIA 4U7UD 1FTRA 2WHOA 3M2RA 4OYMA 4DR3J 1HQUB 1GMVA 2DNLA 4N8NA 4DV4J 3O6QA 4Y3CA 2VD3A 2DXFA 2MQOA 4X9JA 1IJEB 2CQ2A 2J6TA 3HPZA 3QIPA 1FJCA 3SQGB 4LRDA 3FSYA 5A8WA 2LEAA 1GZ6A 1T3NA 4DX5A 2W2PP 1EP4B 3ZFVA 1NDLA 4USKA 2I5JB 3M6XA 5ETNA 2CSHA 2I13A 2CDQA 4DPYA 5F0UA 1I51B 1QAYA 1JWWA 2NLWA 3MM7B 2QL9B 5IT9U 2YWQA 1CJVB 1R6YA 2GGPB 2J9CA 3TA0A 4O4GA 5E5NA 3HT3A 4USJC 1U02A 2HMIA 2MLXA 3CDUA 4U7UK 4DUZF 2YKQA 2GIFA 4DV5F 4C9DA 4XO0A 1QSLA 4GMKA 5LM7E 4C8LA 2IC3A 4DSEA 2BXJA 1SC6A 5KG2A 1O5JA 5J1EB 3CC4S 2WZOA 2UXCF 1X9SA 1RT3A 2HQFA 4DR2J 3NGTA 1VIOA 2V67A 1L3SA 4YS2A 3QQCD 4RL1A 3DLEA 4JI7F 4ZDNA 2EL5A 5HROA 4DV3F 3KLHA 4GKKE 4Q8FA 1LWFA 4QYZK 5FDLA 4OLPA 2E1RA 3UCUP 2FTXB 3CD6S 2UXDE 3T6BA 4DR5J 1UILA 4EO8A 1KC8T 3LP0B 5LOQA 3HSGA 4MYUA 2G1DA 3AD7C 5L1KA 2HFSA 3MEEB 3B82A 2J7KA 1TUWA 4OHVA 2DHAA 4OOGC 4F3MA 4FXWA 5L46A 2EP3A 3X3UA 5KT5A 3KJVA 2R76A 4KV8A 4WFZA 4QCLA 3G71S 3GP9A 3EQ1A 1FESA 2FZGB 1WOSA 4X4TA 3JTOA 4WCEQ 1RT1B 2HBYB 2MGZB 3UVJA 3PEHA 1L3TA 3IM9A 1UJ4A 3BO3A 1NJYA 2WSFC 3CJKB 3J7Yp 3SZ2A 1KD1T 2C2MB 3C6KA 2Y1IA 1K47A 4P75A 1CLFA 5ETQA 3H5XA 2AV5A 3GFZA 1M1HA 2EN7A 2O5DA 2EOZA 3OTDA 1JLAA 3HXMA 1AUSL 4ZKAA 2ZBPA 3D1OA 3KHRA 1SL2A 2W8LA 5T14A 4X64F 2VOPA 2HVZA 3UVJB 1D8ZA 2UV8A 2OH2A 1NPKA 3DFEA 5HO4A 3VVTA 3RB6A 2X7IA 2OIHA 2DNZA 3F6GA 5IXUA 4Q2LA 2CTDA 4XAKA 3F73A 1WF2A 8RUCA 2ADBA 5KFEA 3J7YU 2WBRA 3MURP 1NMEB 2P5VA 3IR7B 3M8QB 4CI0B 2Z57B 1F9HA 1TTHB 1FE0A 1Y11A 3M8QA 3K0JA 2VU5A 1RAOA 2ACMA 1Q82T 4ELUA 1VQ7S 3MMAB 2HVDA 4WE1B 3DHXA 1Q8IA 3R2CJ 1QTMA 1TKDA 3IM8A 1UVNA 3AD8C 4K5SA 4L6V3 3L95X 4ZVHA 3RR7A 5AJ3J 5E0OA 4ZIVA 3BQ0A 1S72S 5CH7B 2GZOA 3AB4B 4DSJA 2RQ4A 4S0MA 4NXNJ 3T1YJ 2DISA 3Q86A 3OR2B 2DGVA 1JQGA 3HVAA 1V5IB 2W2QP 3FBFA 5CYQA 2DB1A 1XBWA 3MEDB 2JL9A 4F3QA 5F3ZA 1KFSA 2EZ6A 3BZQA 4KFBB 1JJHA 4NXNF 2YSPA 1RT6B 1UEUA 4BS2A 4X8WA 3HKZD 4IR1A 6FD1A 2CVEA 1KOHA 1CS4A 3HZGA 1U0HB 3CJKA 3L7OA 5K14A 1RAHB 2GVDA 2UUTA 3THOB 1S10A 2HGHA 5J2PA 5GMKa 4WFTA 2AX1A 5KFNA 3DLLQ 2YTJA 3TAMA 3HHLD 2IVYA 1BBOA 5IOLA 3SQGA 3I0SA 3JB9k 4DG1A 4Y00A 4QPTA 3V6KA 4QWEA 2B7TA 1H38A 5LJ3Y 1NAQA 5H9FJ 4JI0F 1JLBB 1FRXA 2J5AA 1GTKA 4QWCA 3BSAA 2EMGA 4I6WA 1TFYA 3NS7B 2ODRC 2LECA 1FA0A 4F4AA 4JI3E 5KFYA 5B0DA 3OR1B 1RISA 1FWLA 2DNQA 2VIHA 4J9NA 3FVYA 2EMYA 3TVZA 3BREA 5HLFB 1KBRA 1S1TB 4B3OB 4RNOA 3DLEB 4BLGA 2VBWA 4CM2A 2ZZNA 1KKHA 5DNYA 2EM4A 4BHCA 4NYPA 4F4YA 2VQFF 3THVA 1LEOA 3CCLS 4ECVA 4B9TA 4DS4A 4LFAE 4ES3A 1RCXB 1LWXA 4AXIA 1SH0A 4G6VB 4IFVB 4OZ3A 3KHGA 5GVQA 2DNHA 4A8KA 4BMJA 4TY9A 3JSBA 2KO1A 2RKIA 3GYNA 1Y10A 3RB3A 4I7FA 2JOBA 2RMLA 3N6LA 3QATA 4RW9A 4BBYA 2QE5A 1I3OB 3CCSS 1N33F 3ZZZA 1QAJA 2MQNA 5KL3A 1TF3A 3MECA 2HBZB 3AQPA 4R0JA 7FDRA 3BKTA 3Q8YA 4LFBE 3MHHC 4MTPA 5KFHA 2CQIA 2RF2B 3OSNA 3UQSA 2LRSA 4DL5A 4URGA 1IBKE 3NCQA 5CYMB 3S8SA 5I3PA 2MKSA 1YQHA 1DQ9A 2O3DA 2MB0B 4N76A 4LRCA 3CGIA 2U2FA 3LH2S 2COLA 5C24B 4KGZB 3HFVA 2Q66A 4OI2A 4B3TE 2V4JB 1XIQA 2ZH2A 4FF4A 1UA1A 3G6YA 3TJ9A 4OQJA 4A8OA 3K58A 1N32J 3W8GA 3M2UB 3R27A 2AJ2A 2WTFA 1URRA 4DPOA 4ICLA 4CRJA 2AT1B 1SL1A 2QTWA 1NKEA 4FS1A 3MPYA 4M0VA 4LF8F 5I4MA 1X5PA 3AT1B 2H5JB 2O1PA 1EKRA 4HTGA 3JQJA 1FF2A 3HSJA 4PWWA 1WG5A 1VQMS 2AJ4A 3TQ1A 1S97A 2IIHA 1VFJA 1CJKB 1FX2A 4NX9A 1S12A 3IR5B 4PWDA 2CWXA 2IHR1 3P96A 1TMJA 2XY5A 4M63A 4ED3A 3W2VB 2EM9A 3IGVA 4ETZA 2W7AA 4I7FB 2XCAA 5HJXA 1P9QC 1MN9A 4LRBA 4WX9A 3C46A 2ELYA 2C3UA 1VJQA 3L09A 2Q79A 4I64A 3FSXA 1AA1B 4EGLA 3Q22A 4J90A 3PYDA 1VRQC 1DQ3A 2D9HA 1WG1A 3OTEA 3ZC4A 5IV3A 2L41A 1HD1A 3QAUA 3UD5A 2V34A 4NI2B 2XLIA 1ZTTA 4NL5A 4TKTA 4YHHJ 2IFXA 1PJ5A 4LUBA 4EEYA 4F9BB 1FEEA 4X4PA 2PIIA 1U1RA 2V0NA 2QSWA 2Y3YA 4LF6F 3BN7A 3IR6B 3HD1A 5GAHI 1R0CB 1OSCA 2YTPA 4IOAQ 4DV1F 2ZE2B 4NA3A 2BW7A 2UXCE 1GT8A 3PG9A 4LFCJ 3GJSB 5A6KA 4LSNB 5IV4A 1RP5A 4CO3A 2R7UA 3VGUA 2UUCE 3TZYA 2CPHA 4USIA 4ECYA 4O3OA 1NO8A 1X7VA 4NLOA 4DV4E 1QLNA 3AH6A 2Q43A 4L75A 2BE2B 2VDIA 4IRDA 3C15B 5KT7A 3N4WA 1XNRE 1TKXB 1SJRA 2BJ3A 3OXFA 4ECXA 2DNYA 2JPAA 2AGPA 4KO0B 5F3WA 2MQMA 2W9CA 1IKWA 3M6UA 4EUVA 2JLFA 4CT9A 3UDVA 2M5YA 2OFHX 1B7YB 1YJRA 4JI4F 1ZBQA 2V83A 2YKNA 1TKTB 2OD6A 4WIIA 4J7CA 5IT9C 2V2KA 4F4XA 1RC7A 4B9SA 2IRUA 4DXLA 3ITHA 5F0WA 1N6QB 1VQYA 5KAKA 2HHTA 1DJ0A 3QSIA 3W61A 1T9VA 3A13A 1B3TA 5HVHA 3D3BJ 2OPSB 5IWAJ 4RNNA 3FGVA 2HHXA 1AT1B 2DGOA 3MUMP 2RS8A 1K0TA 1REVA 4PG5A 1HHSA 4NCBA 2X3DA 1A1LA 1UWBB 1UETA 3RR8A 2FVQA 3CD7A 4IDKB 2IA6A 2UU9F 2YBVA 3NRBA 4ED1A 2W7PA 2MY7A 2KZZA 1TF6A 1HQEA 4I67A 3DRRB 1CULA 3Q23A 1YKWA 3M2VA 3GR0A 3CEDA 2D69A 4DV1E 2LTSA 2KG1A 4B02A 2QZ8A 2OTLS 4M5NA 4A8MP 3GYXB 1BQNA 4RUHA 2DJWA 1PJ7A 2BRLA 4MIBA 2L3CA 5HP1B 2BR0A 2E29A 4LF5E 2FZCB 4WP3A 4A47A 3H4BA 1L3VA 5IQ6A 3QFHA 2IA0A 4AE5A 1Q7YT 3P49B 1LFWA 3DRPA 2OJ3A 2F1FA 1MWQA 3IWXA 3KLEA 1L3UA 3UNGC 4X62J 3OJUA 3P6YC 3G6XA 2E5LE 2EFOA 3DOLB 2K2PA 4XK8C 5IFMA 2C3OA 2AJ0A 2GS8A 2AMCB 5ADZA 1IQTA 4TXSA 1U1OA 2DPIA 1N3GA 3CE8A 3IRXA 2QFJA 2AX0A 4LF8J 5HAOA 3JU0A 2NYIA 1NBEB 3KJVB 2XMKA 1J5EE 2GVDB 3VZIA 1U1NA 3D0HE 1EB0A 4KAIA 2YWHA 1T9WA 4GVLA 3M32B 4DEZA 1JJ2R 2YNFB 1YVFA 4HVZA 2DR8A 1PBUA 2OAUA 1SBRA 2JLGA 2XM3A 3CCWA 2AP6A 2OPRA 4LFCE 2HEKA 3G96A 2BB8A 5CYQB 3UCGA 1LWFB 4L76A 4IO9Q 1FE4A 2YX1A 2Z2MA 4DV5E 2EMWA 2ZOFA 3H2VE 3Q8SB 2V94A 4JI4E 1U7LA 2PA3A 2N8XA 5LMUF 1XR6A 3A8EA 1Y00A 4LF9J 4RX6A 2PFFB 3CWJA 1SV5B 3MMAA 2BOAA 1FFGB 1EQMA 1CS4B 3MFHA 3HSDA 4P10A 4WYWA 1P1TA 1C1BB 2F4VJ 2MZRA 2EXUA 4XDCA 5EGYA 1SUQB 3T41A 5DGBA 2WCXA 1S9EA 1NSQA 1R7IA 2MQ8A 1X0FA 2NXUA 1S0VA 2KL8A 1YG0A 1HNZJ 4FDFA 5HMWA 3V4IA 3CJ4A 2VQFJ 2WBTA 3DLKB 3OTOE 1Q81T 2UXCJ 4Y6IA 2IVMA 1RHJB 5DS7A 5AXMA 5A0YA 1UKUA 4OYIA 3SIPB 4Q28A 1XNQE 2FHOB 4UTGA 5EX0A 1NK6A 2O66A 1KWMA 2W25A 3AD9C 4DSIA 2OPQA 3MMBA 4ES2A 3LP2B 2LEPA 5BXIA 1ITPA 5D4LA 1N5VA 4MMOA 5AJ3F 4PPDA 1RTIB 4WP9A 2NUUG 3QFWA 3MEGB 3IWLA 3L4BC 4ED4A 1YJVA 4M8LA 2B7BB 4IS1C 3SSQA 1Z1BA 3GTYX 4RW7A 2YPYA 1TL1A 2K7KA 1HBUB 3QJLA 1JIHA 2X1FA 2J0XA 3TZXA 3K8WA 5D0EA 1IKXA 4ZPVR 1TL3B 3IFEA 4C8ZA 1SKRA 5AXLA 1UVLA 2A1BA 4HH1A 3A1YG 5J2MA 3GR1A 1X8DA 1IM4A 1E6YB 3THTA 1WNEA 5DLFA 1Q8LA 1OY8A 2E1CA 4ZVFA 3BV8A 4DV4F 2RSMA 1EARA 2EPOA 3N5BA 2HNZB 3DRSA 3VVUA 1EZZB 2CPFA 2CQPA 2VDHA 4F4KA 1QSSA 4F7VA 4H4KA 5RUBA 3IP0A 4XDDA 4U7CA 5AT1B 4DL2A 4NLGA 2BJEA 2UZAA 2M7QA 1NPPA 2XMWA 2EFVA 1VIXA 3L9ZA 3E2EA 2NUGA 1HWLA 4ID5A 3J80C 3TARA 3IWBA 3RBEA 2UUBF 5ETVA 5LL6d 4DR4E 4DR1F 2DIUA 3DN9A 1QE1B 4E0DA 2C2DA 4YB1P 1FJ7A 3W62A 2IJRA 2YQ3A 2NXCA 4RW6A 2QIFA 1S1WA 4HT7A 4X4UA 2R7SA 2V68A 3TQMA 4GO7X 5KT3A 4MLQA 1VRTB 5C42B 2F8BA 3SCKE 3QGHA 4FPRA 4KPCA 2ASYA 4N8OA 3R5JB 3MCOA 4DV2F 2E9RX 2MC6A 2ZHOA 2HRUA 2IDLA 5GAEU 2BJDA 1T9TA 5J1NA 2BKOA 4WIQA 2APOA 1GAOA 1SFEA 2YSOA 2BQ3A 4J9KA 3T1HE 2AYBA 2PI5A 4B3RE 1OWXA 2I9SA 2J9DA 4DR4J 1L4SA 2LFVA 2MQLA 3D6MB 3I6PA 2RNEA 4K5RA 3KDNA 3HD2A 1BHNA 1HNZE 2KFNA 1HMVA 3M8PB 3QJJA 1PKUA 4JI0E 2GX8A 2Y0SD 2HNYB 2F9JA 2JNJA 2RILA 1RBOB 3TX0A 5I42B 4ZLNA 4KO0A 3NBPB 3KK3A 3R9LA 1VGYA 2Z30B 4OYXA 2CQ0A 1TKXA 2NUHA 1CG2A 3B54A 3CCUS 4IFYB 5IXMB 3JQMA 2MQPA 2B9DA 3VYXA 2I5JA 2EN4A 1B4SA 5KG3A 4G1PA 4LF6E 2C3YA 5J1PA 4G65A 1NZAA 4YY3E 3BQ1A 1NEEA 1RT5B 4I2QA 4KKOA 2CPXA 3GFHA 4ZVTB 2N3HA 4IH6A 2R1FA 3I87A 1P6TA 3IMQJ 1OPIA 5D4NA 1HLWA 1H98A 2NCKL 2DH7A 1J26A 1A1FA 3TEHB 2YNGB 1FFSB 4DKKA 5D6GA 2Z2ZA 2R8JA 3W9JA 5D15A 1STUA 1QM9A 4DV7J 3W66A 2XZTB 3R7SB 2LYVA 3T1HJ 3RB0A 1VQKS 3I9V9 3KG4A 2YY3A 2G13A 1Q5YA 4YR0A 3H2UB 3ETOA 1RAIB 5KFDA 4TU8A 3UDCA 4KPYA 1FX4A 2CJQA 5KFRA 3KK2B 3BKFA 4CDIA 4DR1E 3D0GE 1JNZB 4RW8B 4ZVSB 4AQYF 3PRDA 5ETRA 2KFYA 5DGAA 1S6QA 3L7PA 5D3GA 1RA6A 5C42A 2RIJA 3ZZTA 4K4YA 1YJWS 2EMAA 4JYAE 3C6UA 2P9GA 2MTLA 4J9VA 2VOOA 1W25A 1UBDC 3T6JA 1T9XA 1U4BA 3CO9A 3CC7S 4CIOA 3HKWA 1U25A 5KFMA 1FWPA 5CZXA 2XSJA 2DRPA 2KHCA 2EN1A 5HBMA 2AEFA 4ECRA 2NXNA 3ITHB 2V69A 2X1GA 2WBUA 1S0OA 2YRHA 2YKMA 2WVFA 4OZLA 2LA4A 3POTA 2BBEA 4DR3F 1KN6A 3C16A 4CYUA 2E44A 4R2DA 4KGKA 2YWKA 2DGCA 1SVDA 3RRHA 4LBIA 4M5IA 2CA9A 1XWLA 1S1VB 2YNGA 3EUNA 4OYAA 1U26A 1ZPWX 3QPIA 4PEOA 1QVGR 2EW9A 1NEIA 4WFNQ 1U1KA 4P7DA 1C0UA 2XY7A 1KR4A 2HWHA 3FDSA 4KIAA 3UNYA 4IG0B 4B3SJ 2HFUA 3G82A 1NXIA 4DUTA 2F4VE 1X4HA 2VE7C 2QA4S 4NXME 2EFGA 4K7QA 3OT9A 3C6TA 3F56A 3CNQP 4X84A 1NHVA 1WSVA 2M88A 3MECB 4F6MA 4YFUA 3CJSA 4DDFA 2CJYB 3UN5A 1S48A 1TL1B 2ZITA 3F41A 3FFIB 2VJVA 2V88A 1I94J 2WOMB 4DBQA 2RHSB 4X4SA 3KLVA 4ZVQB 2W9AA 1IQSA 4USVA 4QIGA 5FLXU 2V8DA 5LLQA 3LP2A 4A8YA 3UO0A 1VQ5S 2JC1A 2QO3A 5F3TA 4GVBB 5GADU 1VQNS 2EM3A 2XWYA 2HHHE 1NK4A 4ELTA 2E9TA 3GSDA 2VJUA 2WONA 4ED2A 1MLAA 4ANEA 2H48B 4RW4A 2DRBA 1H74A 4FBUA 2W24A 2ZH8A 3HM9A 4KRWA 1FK9B 3DM2A 2K7JA 4ZN3A 2MEWA 1HNWF 3KHHA 5BJRA 4QR2A 3SMZA 3H0PA 4ZP8A 2XS7A 1KFDA 3G87A 2LP4A 2UVRA 2JVOA 2XMAA 4PCQA 2C2RA 2UVWA 1D1UA 2RJZA 2UUAF 3N79A 4P71A 3U27A 1I94E 1X4FA 3GQCA 4Y34A 2BE7D 2O67A 2OD4A 5T6JA 2R3VA 3ZZRA 3SXLA 4LBPA 3ILLA 1KQGB 1Y3KA 2ZBRA 2IRYA 5C25A 2E5HA 2WCC3 1HNWJ 4A48A 2W4PA 2G2ZA 3PYFA 3W3SA 3T5HA 1P1LA 3QIPB 3TUZC 4UQTA 1T03A 2FGCA 1WACA 2PI4A 2PRTA 1VBKA 5KFAA 3S1TA 3OMLA 4KJIA 3A4TA 2JFKA 1LOUA 5C24A 2L8TA 2VB6A 3LANA 2KB2A 2QG9B 2EBGA 3MEDA 3O8WA 4CYUB 2MHNA 3ADAC 1JK1A 4LR9A 4K0KE 4XIUA 2E7XA 2VFRA 1WJ9A 4B17A 2CPDA 1NJXA 4R2QA 2EORA 3OQ2A 4YDXA 4YB6A 3W7BA 4L8NA 2KT3A 3BGOP 1F3FA 1QD1A 3AOCA 2EWLA 3DMJB 3H20A 3W64A 3PFOA 3HVWA 1ZZNA 3OL7A 2EM8A 2EBEA 2GO8A 3KKFA 2XNRA 1J5EF 2EMHA 4F2SA 1KNZA 3MDFA 2QLBB 4ZP9A 3GPAA 3SI8A 2UP1A 4B9UA 3MTKA 4DJBA 4FF1A 4DFJA 3CDAA 4B3ME 4RBTA 2YQ0A 3BBFA 4DR6F 5THWA 1CJTA 2CT1A 1S6PB 2ZHAA 3DMJA 1DZ5A 5KOXA 2V2ZA 4ATNA 2FVPA 5A76A 2IPOB 2YKOA 2QV6A 1W26A 3BGUA 1VQLS 3PJXA 3AODA 2XULA 1WHVA 3MAAB 2KJWA 3IAS9 4OI3A 2Q1LA 1R31A 1S1TA 5HLFA 1X4GA 4JI8E 3NXZA 2DXDA 3GMGA 4CH7A 1VBZA 4X64J 1U48A 5C2GA 4JI3J 4Y28C 2EWHA 1JXVA 3MCNA 1IQOA 1MMLA 1O0PA 1UFLA 3QRRA 4NYOA 1C1BA 3FRZA 5DETA 4R5PB 3Q8PB 2R8HA 4DHVA 1SQGA 3K57A 1X6HA 2R7QA 4UUWA 1ZM2A 4QR1A 2NABA 1PO6A 4XPEA 3HHLA 4IKAA 1RT4B 2OSQA 3ZZYA 1JKHA 3SDEB 1CC7A 2OPPA 1QJHA 3TUIC 5KTQA 3IS9B 5MLCV 2XS5A 4NEYA 2LMIA 2DR5A 1T05B 4TY8A 3TI0A 5EWEA 3B4DA 1HW9A 1KS2A 2V4QA 2EOIA 1T3OA 1WHYA 3D1HA 2JOXA 3H42A 3CULA 5KFBA 1Q4RA 1F5CA 3BGRB 2QJ3A 1XNQF 1UJ5A 1MGTA 2JJ4D 2BZ2A 1YPNA 3TANA 3JTZA 1Y5LB 3VYYA 4QIWD 2AYGA 2EOQA 5A2QU 5EWFA 3NMRA 1YJUA 2W9CB 2ZOGA 3QT8A 4J91A 1FK9A 4LF4J 3O44A 3LGHA 3I32A 3LMLA 3B6BA 4NXMJ 1IBKJ 2GMLA 1MSWD 1RT3B 1K0VA 4TU9A 4ED6A 4V19J 4NYZA 2GFFA 2HK2A 1EAYC 1XC9A 4O23A 4LQ3A 3VK6A 3HVRA 3QT5A 4QW9A 4PXBA 4ZK7M 1RQ0A 2FLNA 2R7OA 4ID8A 3AA8A 1BWEA 5D3GB 3M8SA 1D9FA 4HDGA 2ATLA 2GGPA 4YOEA 4MK9A 5HANA 1HNIB 3R7BB 3J81Y 1TELA 2OPSA 4ZPAA 5KG5A 4NLDA 1SQFA 4DX6A 3CT9A 2BJ8A 4JB8B 4BS9A 3H09A 2DMIA 1CJUB 1HW8A 4CTAA 4XTTA 1WWHA 1X49A 3G82B 3A8JA 2XNQA 4B3SF 2FPHX 3CCJS 1S0NA 4ZCIA 4F4WA 3R6GB 4ECTA 3GONA 3OTBA 1RKIA 4JI7J 1QDUB 2XG8A 2CG8A 4LFAF 2HFVA 4JV0A 1JLQB 4G1IA 4G3IA 3EGWB 4GKKF 2ADCA 1WC0A 2RU9A 4DCOB 1VC0A 4W98A 1ZZFA 4OHZA 1N5SA 1NRKA 2K06A 3CB4A 4MKYA 1D9AA 2W2OP 3IWCA 2R42A 2G4BA 2KXHA 3WZ0A 2F8EX 2EM2A 4DX7A 1XNQJ 1IMUA 4X64E 2KVQE 3V5RA 4I4BA 4WSPA 3HDSA 2EM6A 1Q8BA 4RO0A 5GAGI 1HBNB 2KZMA 3Q83A 2LE2A 3ENQA 2ZNZA 4KV8B 2H36X 2CQ3A 1OY6A 2OMLA 4O0NA 1RYSA 1RTHB 4G1QB 5HK4A 2DIVA 3BGLA 3W65A 2UXDJ 3TUPA 3NWGA 4UZBA 3PIOQ 5B0GA 1R27B 4KZSA 3H98A 1N5YB 2M7SA 3QT6A 3MHYA 1X4CA 4C3LA 5F8GA 2ZC4A 1SJ3P 4Z37A 1LW0B 3AXMA 1N48A 4JI1E 5HROB 2RKIB 3MZIA 2LO3A 2YNHA 3LAMA 2V87A 4ILRA 4NI2A 5EX3A 1VJWA 4WXWA 3TZWA 1UVIA 2QMWA 4IH5A 4PRFA 2DHHA 4OX9J 1E6VB 1RHKB 2Z0GA 2IC3B 3Q2SC 1K9MT 3S6EA 1NK8A 1HBOA 3CCQS 3ENVA 2P6SA 1PCAA 6FDRA 1SC3B 3PTWA 1YWXA 3H7HB 1T94A 2HMIB 3VAFA 1PKPA 1VK8A 2ZH6A 3ZXWA 4PXCA 4MFBA 1JX4A 4FNIA 4X4RA 4O3RA 1JLCA 1QSYA 2ODRD 1OSDA 2RDIA 3HFZB 1H73A 2ZM6F 1AFJA 1T4NA 5HI7A 1HPZA 1BMQB 4X4QA 1N54B 5IS2A 1TK5A 1GQEA 3DDIA 3CCMS 2FLPA 3HHLC 4LF6J 2NR0A 2JP9A 3QMQA 3FSIA 3R5DA 4Q0BA 3DNCA 1F0XA 3IC1A 2W1BA 1LK5A 3NWRA 3ZNJ1 4X4NA 1HIYA 3HHDA 2HNYA 2C22A 2L2KB 5K8OA 2QL5B 1GTHA 1RMDA 2YNIA 1X4EA 2ZJPQ 2D3UA 3QBCA 1BWVA 2NA2A 2RRBA 2DNOA 3MM6A 5DLGA 2RVJA 2EJ4A 2DPJA 5FLXC 5H9FK 2FGOA 1R8CA 1S9FA 4C98A 2KN4A 2EFNA 2ZKUA 4OIXA 1PSDA 1TL3A 2BM1A 1YBUA 4O44B 3RUBL 5F8LA 2SXLA 1T95A 4UOHA 4ZCLA 1IBLF 2YTNA 1L5UA 2AEMA 1V3RA 2J6SA 5D4OA 4EYIB 3VGSA 2YWGA 2LQBA 1IKYA 1YK9A 3FBEA 1RAGB 4HTIA 1VRTA 4NHRA 5KT2A 1RWKB 2HS3A 3AOBA 4H4MB 4P9SA 5GAEI 1HYSB 4QIFA 3KLEB 2CQ1A 2IMOA 2LDIA 3MMCB 4X62E 1RADB 5JJBA 5DG9A 4NCGA 4HACA 2I1RA 3UK3C 2DSYA 4GKJJ 4PG8A 3ET6A 5HVGA 1U45A 4PABA 2J7UA 3BF2A 3J81C 4RLEA 1PJ6A 3I5CA 5KG0A 3GYGA 2K4VA 5A2QC 4M5JA 5C2CA 1IBME 1Q0NA 1U0SA 3WC0A 3KZZA 3B78A 2DO0A 2YWFA 2KI2A 4C0OC 4OYOA 4P7TA 1RI7A 2YXLA 1RLCL 1UVMA 2AYMA 3TWZA 1TVRB 5KFGA 4N4RB 2ZDPA 1U6BA 2HG4A 1G1XA 3ENWA 1S76D 4R2SA 1PJQA 2UXBE 5TSEA 3TO8A 2DNKA 3MPVA 2VQEF 4JI0J 3PX0A 1N36F 3TP2A 1I6JA 4OJGA 4PUOA 2A6MA 2ASLA 1TL4A 4RUBA 4ZPDA 5E3PA 4DR6E 1WEYA 1VRUA 3CDBA 3SYZA 3KJFB 2DY1A 5DDPC 3PX4A 1HBUA 1S6OA 1HWJA 2V9WA 1HWKA 3BJYA 3CJ3A 1N6QA 3DRXA 2NSBA 5T7LB 5G0RB 2BV3A 2LEBA 1HWIA 2MKNA 3DYAB 3MOJB 5KFQA 1MWYA 3RJMB 4ES1A 4HHUA 5FDLB 1XQIA 1QUVA 2B7CB 3BH7B 2EK1A 4ZIWA 4CLZA 1FRLA 5BYSA 5CQGA 4HH0A 4WZMA 2L33A 3EE3A 1IR1A 3ZZ0A 2QYGA 2IBOA 2UU9J 4RW4B 9ATCB 4LREA 4DUYE 1FWKA 3PM9A 2WRMA 3B4MA 5L8RC 4ETXA 1MU2A 5K14B 2MKIA 4FK5C 2LUPB 2VQFE 1TL7A 2VFSA 3ZNUA 1U2CA 2FV4B 1H2TZ 4JUZA 1LW2A 2XCPA 1ZH5A 3OVBA 1C1CB 2GHFA 2JSXA 4LF7J 1RZMA 5ETTA 2XGPA 4K4WA 1A1HA 3UR0A 4HLBA 5J2QB 1D0EA 4ZITA 2RRNA 3WIUA 3AOAA 1XMBA 4JI1F 3PACA 4CLPA 3HHNB 1V6HA 1MU2B 2G2OA 3HJFA 2RTXA 3BKUA 1S57A 4K4ZA 4DS5A 3M05A 1Q1KA 4DZDA 4PG6A 1HI1A 3ILOA 2YQ1A 4EZ9A 3DXSX 2L2MA 5F8IA 2BABA 1F9EB 2ZZTA 4C8YA 3LGMA 3ZTQA 1UW9A 2LVWA 2EL6A 4QPXA 3T9NA 2DHGA 2CNKB 4R8UA 2RPCA 3W5XA 4P6QA 2FHKA 2DHXA 1SPBP 2U1AA 2M52A 1U2FA 3RG6A 3S01A 4F25A 4ZVPB 2BQRA 2KG0A 1UWAA 2NXJA 2I2YA 3QRPA 3HCXA 5A8RA 1EETB 4DZ6A 1VQSA 2PEHA 2EPCA 2NUEA 1WC1A 4C6AA 2EOFA 4PXDA 1XMOF 2X1BA 3OHBA 1CQMA 3DLHA 4EFAC 3RBDA 4OYPA 1JLFA 4DF4A 1SB6A 1M90T 4F2RA 2DKOB 3D66A 5KG6A 3VAIA 4DWIA 4UW2A 1KVIA 3O5TB 4WFYA 1RLDA 2OELA 3MTJA 4P2SA 5K20B 3MMBB 4DU7A 1G2EA 4U6PA 2EMCA 2AWZA 1UVKA 3E3XA 2VA3A 1WSRA 1NSPA 5LMNF 4JI2F 1BXNA 3DLJA 1HKAA 1PAEX 2KFZA 5A6BD 1RDRA 3MXHP 2YTIA 1RHRB 5C25B 4NLPA 2DITA 2WZ1A 4DQRA 5A8KA 2MJUA 3DRYA 4ZHRA 2XSJB 5LSOA 4I68A 3D4JA 4NWBA 4OI4A 1S9EB 2BDPA 3ECRA 4LFBJ 5KG4A 3KFWX 1M5PC 1SUQA 3KUEA 3VCDA 3OV7A 4P73A 1X5WA 3D6TB 4Q44A 2QN6B 4IDKA 5CA5A 2LV2A 4P7VA 1HARA 2Y1RI 4WSGA 1LFPA 2B4PA 3UD3P 2JY9A 1PILA 4OHXA 3M1VA 4IG3A 2D74B 1H3DA 3SSSA 5I3UB 3PO4A 3PCOB 3KXDA 1N36E 2V8HA 2IAJA 4IFVA 4O4RA 2D9OA 2GV1A 4LT6A 1RTZA 5U47A 1N0UA 3N6NA 2GJIA 3ILJA 1RABB 1ELOA 1YZ7A 2WONB 2Y1JA 4F02A 2NXEA 3VTIA 4NPOA 1N5QA 1U2RA 3TX8A 2XMTA 2MKDA 2VRDA 1B0PA 3GV5B 2WVBA 2YNIB 4X66J 5JUMA 4RUCA 1NJIT 1FERA 3FEYB 1IKVB 3G86A 4RJVA 1RAAB 3DHWC 4Q45A 5CABA 1ZA2B 3PHTA 4ITSA 4KE5A 4UQGA 2HRTA 4P52A 3JAMC 2XWXA 2ZHBA 3BS9A 3H4DA 4WBFA 3SBMA 2P9CA 4I6YA 1IXKA 4OV1A 4FN5A 2HVEA 3G6VA 2H3EB 2N7YA 2F9DA 3K5MA 2M0GB 2KH9A 3ADJA 4OJ3A 1VMBA 1XNRJ 5D0RA 1U1MA 4CH1A 1WOPA 2E7VA 2VICA 2FJAB 5D77A 2CRLA 3K17A 2VFTA 1NCLA 1ULRA 5J2PB 1F60B 3HP6A 2HNDA 3BBGA 4CH0S 3M2UA 4UY8T 5CHCB 5AC4A 2K1RA 1FXDA 4RWXA 1LWCA 1LKZA 5GMDA 1TKZB 1GNKA 3U02A 3CCES 3MUTP 4J9RA 3U7JA 1IKVA 2WVDA 4LF8E 2EMZA 2R7XA 3AAWB 2FJDB 1ZA1B 5K8MA 2PA8D 2JEGA 3EVOA 4R25A 2OI2A 4C11B 2FHMA 1DHMA 3MEKA 5ITHA 2MSTA 1MROB 2UUAE 5LJ5Y 2BKNA 4FXVA 5KL7A 4R2CA 3ONQA 3DU6A 1YJ9S 4OI6A 1K73T 1U8WA 2QFIA 2B9WA 4Y2KA 1FXLA 3PXGa 3T1YE 1TU0B 3V6DA 1WC4A 2IAJB 3R5BA 4DMIA 4ZLLA 2VV5A 2YT4A 5B7WA 2B4VA 5D78A 3CJ8A 1S6QB 1SJ1A 2C1EB 3EVWA 4FXDA 3N5FA 4ZS6A 2EMXA 2DEIA 3QLHB 1X4AA 2EG1A 2I0XA 2B4OA 4MKBA 3H5SA 1S1WB 2CQCA 3T3FA 2EPPA 2HS4A 2DGUA 4WF9Q 1D09B 2VBYA 5DDQC 1JB0C 4MLVA 2EMFA 4ZHRB 2N7CA 4NLWA 4DL4A 1P8GA 1VCTA 2J7JA 1WUUA 2JYAA 3HT0A 1SC1B 5KFUA 4YMEA 2PE8A 1YZ6A 3H90A 4HDHA 2H5EA 3OLAA 2CG4A 3VAJA 2IM1A 1WEXA 2E72A 2PFDA 4A8FA 2ELZA 4KT0C 4B9NA 1SCJB 1X6EA 4DOZA 2VG7B 1TK8A 1HD0A 4C2MA 3PIPQ 3TAQA 3TJ8A 2YTFA 3GU0A 3PKYA 2F7VA 2GIQA 2Z58B 1YRUA 4WKYA 4CLKA 4IO1A 4E8UA 1RT5A 4I2QB 4EK2A 3PZPA 3GIRA 4ED8A 1CJUA 1H2UX 5KOWA 3TAMB 4F67A 4P74A 2H51B 2KT5A 5CXTA 1N36J 2B51A 4LSLB 4AL5A 1RWXB 2V85A 4DR7J 1EETA 2XMMA 4A4JA 4AXJA 3L00A 3CVKA 3OSPA 2UV8G 2MPUA 4KGXB 2RAQA 5HQMA 1UN6B 3MEGA 1WDDA 4OX9F 1R89A 5KFTA 3KK1A 3GCXP 4KFBA 1A0OB 4ZPBA 4WTYA 2FQQB 4TNOA 4WWSA 1MN7A 3GIKA 3NKYA 5CD4A 2YH0A 3IRWP 1TQLA 1UMJA 1IWAA 2CZVC 2ENAA 1RSCA 4DV7E 3J80Y 3MPUB 2ALYB 2YPZA 1KTQA 1VRUB 4X4OA 3CJ0A 1FVQA 2JLEA 3PJ9A 1J5OA 4JI6F 4PPZA 3VAMA 2AGQA 2DCLA 1GEHA 5CZVA 5D0GA 9RUBA 2EEYA 2XHCA 2FDNA 3AQOA 1A1IA 3FZ2A 3RGIA 4ZN1A 1S79A 1T38A 2FJEB 1BQXA 3I5AA 3OPKA 4NMXA 4O4GB 3TJAA 1FHTA 1HFEL 2W01A 2MDGA 3MM7A 1P9YA 2HC5A 1B7FA 2GHVC 3HTXA 3PNIA 2XGQA 3GILA 2BKPA 2CDRB 1H6KX 1J2VA 2HHPA 2LQ9A 1HWUA 3QO9A 3EDQB 1WEZA 4X66F 1XK8A 3HI9A 2NPFA 1GXTA 4ZJQA 2VONA 3DI6B 2LDYA 4BC7A 2YX7A 2CJ9A 2ENHA 3M4XA 3LPEA 1C0UB 2FGGA 3LAKA 3VV2B 5KFSA 2KHXA 3OLBA 2A3JA 3OXLA 4KR0B 5HMXA 2FLLA 2J7WA 2RRAA 3FMBA 3SCJE 3J81U 3WX4A 2NSCA 2VF1A 3JAMY 4X65E 1FJGJ 2L9DA 2HNZA 4M5MA 1SJQA 2BBGA 4DLEA 2VBZA 1SIZA 4USMA 1WTBA 3BSOA 1XTZA 3LUYA 1HI8A 2RB7A 1UVJA 2A18A 4CLUA 4O44A 2K3KA 3P4UB 2CZ4A 1IBMJ 2LBSB 4MH8A 1UTAA 4OZ1A 4IH7A 4F0MA 1X60A 4NLUA 3CJ5A 1KP6A 3JAMU 1LWEA 2GVZB 1TV6A 1RAFB 4V19X 2CNOB 1KRPA 2AIRB 3CTRA 4ZPWR 1FO1A 4QOTA 3KDOA 2VHGA 4L73A 1DTTA 2XSFA 5CCLA 1X6FA 1FKPB 1B69A 4RW8A 2KHDA 4KQZA 1JLEA 3BPDA 3LLHA 8ATCB 5C7PA 4RNFA
chains in the Genus database with same CATH topology
4MIAA 2XHWA 4WYLA 2DBBA 3K7RA 2PD1A 3QWPA 2RUGA 3T1AA 3X1LB 2HS0A 2IYGA 2Z8QA 3ULHA 2UVRA 2OKQA 3UCZP 2E5JA 2F8HA 2JVOA 1YTYA 4M94A 4OZ5A 1A6LA 3C4BA 2HVIA 3HK2A 2UVWA 2VFVA 4PCQA 2XEXA 1FDDA 4DFKA 2C2RA 2ROEA 4GO5X 2B5JA 2RJZA 3NAIA 3OR1A 3Q24A 3G8QA 2LU1A 3N79A 2ZDOA 2FVRA 2UUAF 2DRAA 3U27A 1I94E 1X4FA 5G4DA 3GQCA 2EPIA 1ROFA 3OHAA 1FTRA 2WHOA 4Y34A 1KLMA 2ERRA 3M2RA 1VI7A 1KQSR 2O67A 2OD4A 5T6JA 1HQUB 3KTQA 2DNLA 4Z2XA 3ZZRA 4N8NA 4JI8F 2ZE2A 4CT8A 3SXLA 2KXFA 1IN0A 4DUYF 3O6QA 1MWZA 3D1QA 1KQGB 1Y3KA 4YUDA 4OLOA 2IRYA 2IRXA 5C25A 4HTJA 4Y3CA 2E5HA 2LXUA 5BYQA 2VD3A 4W90B 2FJWA 4A48A 2E1AA 2MQOA 1IJEB 2CQ2A 2W4PA 5H1SV 3PW4A 3W3SA 2J6TA 3HPZA 3QIPA 1FJCA 2VG5A 3T5HA 1P1LA 3QIPB 3JSYA 3TUZC 1HYSA 2DVIA 1JLQA 3SQGB 2L6MA 2Z2LA 4UQTA 4ECZA 3FSYA 2FGCA 1T03A 4DQPA 3RTVA 5A8WA 2LEAA 4KHPF 1GZ6A 1TKZA 1WACA 1T3NA 2PI4A 2M8DB 1RA7A 1DTQA 3FEZA 1EP4B 3OL9A 1EP4A 5KFAA 3S1TA 3OMLA 3ZFVA 4KJIA 3TNVA 1YGYA 2JFKA 3C2PA 2BM0A 2JC0A 1LOUA 2I5JB 3BGFA 3M6XA 5C24A 1NKCA 4GC7A 4D3HA 1UEVA 4KSEB 2GO9A 2VB6A 4I0WA 5KFJA 3KLGA 2L8TA 2CDQA 3LANA 1MNEA 1T4LB 4WFBQ 3D54A 2KB2A 4KHMA 1QAYA 5F0UA 2NLWA 1JWWA 3MM7B 2EBGA 3ISNC 2YZTA 3MEDA 1R6YA 2J9CA 2GGPB 3TA0A 3HHEA 1S6UA 3O8WA 4O4GA 5E5NA 1RK8A 3HT3A 4USJC 2HMIA 4NLRA 3CJ2A 1H0HB 2MHNA 3CDUA 2B56A 4U7UK 4DUZF 3V81A 4K0KE 5KFFA 2YKQA 4XIUA 2FHJA 2E7XA 2VFRA 4B17A 2HHUA 4R8OA 2CPDA 4DV5F 3MM5B 1NJXA 2RT3A 1S1VA 2RS2A 1Z4UA 4C9DA 1V9OA 4LSNA 3OQ2A 4YDXA 3N0VA 4YB6A 4XO0A 5L1LA 2K3IA 5M2UA 1AXQA 3QGPA 3W7BA 2FJXA 1QSLA 4L8NA 4GMKA 4F9CB 1IKYB 4C8LA 1DQAA 2IC3A 4DSEA 2KT3A 5F41A 3D28A 2BXJA 1SC6A 3EZUA 1JLCB 3FQKA 1O5JA 5KG2A 3HPSA 5J1EB 3CC4S 3RU0A 2EWLA 2WZOA 4CO4A 2UXCF 1X9SA 4QWDA 3DMJB 3H20A 3PFOA 1RT3A 4DR7F 3HVWA 1ZZNA 5B0FA 3C4TA 3OL7A 3UW1A 4DR7E 4X4VA 2EBEA 2GO8A 3KKFA 5CYMA 2ILYA 4M5DB 2XNRA 1J5EF 4KKOB 2VH7A 2XO7A 5KFVA 1VIOA 5T7LA 4F2SA 2GC8A 2RD5C 1KNZA 3M32A 3MDFA 3DCAA 4X62F 1L3SA 4ZP9A 3MM8A 2R2TA 5J2MB 2KVIA 1YBAA 1RTHA 3DLEA 3SI8A 2UP1A 3MTKA 4ZDNA 4DJBA 4B9UA 4NLVA 4DV3F 2PO4A 5HROA 4FF1A 3IWDA 3KLHA 4DFJA 3EXCX 3CDAA 4GKKE 2VPWB 3R3TA 4Q8FA 2J0SD 4B3ME 2D1CA 2LMZA 1LWFA 4RBTA 1D9DA 2K8GA 4DR6F 5THWA 1LXNA 4AL6A 3N28A 5FDLA 1SH3A 4M30A 4OLPA 3JSMA 4JV1A 2E1RA 4Y2IA 3VF0B 3UCUP 2FTXB 1S6PB 2ZHAA 1M5SA 2HWTA 3DMJA 4Q43A 1DZ5A 3BDEA 3CD6S 1WHNA 1GTEA 5KOXA 2UXDE 4ATNA 2FVPA 4R0EA 3T6BA 1UILA 4EO8A 2V86A 2B3TB 1KC8T 2L3JA 3LP0B 5B0EA 1KLNA 2YKOA 3BGUA 1RTIA 2G1DA 2QV6A 1HBNA 2W4CA 4MYUA 5L1KA 3MEEB 4DL3A 4OZNA 1VQLS 3B82A 3PJXA 2EKYA 2XULA 1WHVA 1LWCB 4JV5E 2J7KA 2KJWA 5E7OB 4OHVA 2GNKA 3IAS9 2DHAA 2XMJA 4OOGC 4OI3A 2AQ4A 2Q1LA 1R31A 1S1TA 2IM3A 3H5UA 4FXWA 4F3MA 5HLFA 1X4GA 2HHHF 1ZYQA 3MCSA 3W2VA 3X3UA 4JI8E 4R8UB 2FJBB 2GHPA 5KT5A 1QY7A 3KJVA 1HNXF 1FJGE 3GMGA 4N41A 4CH7A 4KV8A 1VBZA 2X3GA 4WFZA 3CIMA 2BANB 4YHHE 4CNYA 3LPYA 4QCLA 2MZ1A 3EX7B 3G71S 3FFIA 1U48A 4Y28C 2EWHA 2LXFA 2ZZMA 4OX6A 3BN4A 4PKDB 1FESA 1Y5NB 3JTOA 4X4TA 4WCEQ 5JVHQ 1MMLA 2KKHA 1O0PA 2ILZA 1RT1B 3CC2S 3NNCA 3BO4A 4WK3A 2MGZB 3VALA 1FD8A 3P1XA 3UR3C 1UFLA 2AYEA 3PEHA 4TY8B 1L3TA 4LF7E 1UJ4A 3TUJC 4NYOA 1C1BA 2J6UA 3IGNA 3FRZA 3BO3A 1NJYA 2WSFC 5DETA 2M4MA 3CJKB 4DN9A 4R5PB 3J7Yp 3SZ2A 1Q78A 3P5TL 3Q8PB 3JYTA 1KD1T 5HMZA 3BSNA 2Q6BA 2QT7A 2Y1IA 2R8HA 2ZD1B 2KRBA 2YTCA 4PG7A 4DHVA 5KFPA 3K57A 1CLFA 3OUYB 2R7QA 3OFFA 4UUWA 1ZM2A 4QR1A 4ED0A 3SFUA 3BEGB 3H5XA 2JDJA 1HPZB 2AV5A 3GFZA 1PO6A 3H40A 4DQQA 1UL3A 3ZZPA 4OJ1A 2O5DA 4XPEA 1S0MA 3HHLA 2PT0A 3PVXA 4IKAA 1RT4B 3DDKA 5LXRA 2OSQA 4IRCA 3OUYA 3ZZYA 1JKHA 3U1MA 4A8SA 3OTDA 1JLAA 5J2QA 1FDAA 3SDEB 3NBPA 1CC7A 3UDLA 4C11A 3HXMA 4ZKAA 2OPPA 4B9LA 1QJHA 5EN1A 3D1OA 3TUIC 2CPNA 5KTQA 3KHRA 3IS9B 4QBUA 5MLCV 2W8LA 1SL2A 4O3SA 2XS5A 2L2NA 1FRKA 5E41A 2LMIA 1DURA 3M6WA 4UOCA 5T14A 4X64F 1R0AB 1T05B 2DR5A 2HVZA 4TY8A 2VOPA 1D8ZA 2UV8A 2BYCA 2OH2A 3TI0A 2XB2D 3DFEA 5EWEA 1Q16B 3B4DA 3NS5A 5HO4A 1HW9A 1KS2A 3RB6A 2V4QA 5AE2A 2KU7A 1T3OA 2OIHA 1WHYA 2DNZA