1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Peptide chain release factor 1
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
4LF7E 2LUQA 4JI7E 2NUGA 4KHPE 1J26A 3T1YE 2DB2A 2YT4A 1WHQA 5LMUE 2EZ6A 3ADLA 2DMYA 5IWAE 2B7VA 4JI2E 2NA2A 1XNRE 1N34E 1WHNA 3C4TA 2UU9E 4JI0E 1GQEA 4DR5E 1HR0E 5BR8E 4LFAE 3ADIA 2UUBE 4OOGC 4B3RE 1YYKA 5LMNE 4DV0E 1RC7A 1N32E 4DUZE 4X64E 1IBME 2VQFE 2L3CA 4DR4E 1PKPA 3VYYA 4DV3E 4WFTA 1RQ0A 2NUFA 4JI3E 2IHR1 2ZM6E 4LF5E 2N3GA 1YYOA 1X48A 2L33A 2CPNA 1FJGE 1UHZA 2UXDE 4DKKA 4B3ME 1J5EE 4WYQB 4X8WA 2JVAA 4X65E 4DV1E 1ZBTA 4DR2E 3T1HE 4JI5E 3VYXA 1T4OA 4DV7E 2LBSB 4B3TE 3LLHA 2L3JA 4M2ZA 2RS7A 2VQEE 2UXBE 2RSMA 1XMOE 4B3SE 4NXME 3ADGA 1STUA 1XMQE 4JI1E 4JYAE 2HHHE 2L2MA 1T4LB 1N36E 1EKZA 4LF4E 1YYWA 2UUCE 4DR3E 2LUPB 2B7TA 4LFCE 4OX9E 4LF9E 4LFBE 4M30A 1X49A 4JI6E 4YHHE 3HTXA 1IBKE 4DV6E 2L2KB 4GKKE 2DIXA 3C4BA 4X62E 4DV4E 2RTXA 4NXNE 2JY9A 2RS6A 2E5LE 4DR1E 3P1XA 2NUEA 2N3HA 4GKJE 1IBLE 2F4VE 1X47A 3ADJA 2B3TB 1UILA 4LF6E 1T4NA 4JI4E 4LF8E 1YZ9A 5CFFE 2LRSA 1O0WA 4YY3E 4JV5E 2LJHA 2MDRA 4DUYE 2KHXA 4DV2E 2UUAE 4DR6E 4DR7E 3J7Yp 2UXCE 1QU6A 1XNQE 4JI8E 2LTSA 2L2NA 4DV5E 4X66E 1HNZE 1DI2A 2LTRA 4K0KE 1HNWE 1N33E 3OTOE 1I94E 1FKAE 4AQYE 1HNXE
chains in the Genus database with same CATH superfamily
4FF4A 4JI7E 4X4RA 4DWIA 3ITHA 2CJQA 4H4OB 1BQMA 3KUEA 1NPRA 2J0WA 2PIIA 1YLXA 1YJ7A 1V3SA 1IBLF 3D5MA 1A1IA 5KG7A 2CQ1A 2KHDA 2W25A 5KFXA 4UQTA 3RTVA 5HROA 3ZZPA 4LF8F 2VG6A 2PD1A 4XO0A 4QR1A 3T1YF 3GV5B 4S0MA 4AUKA 3H5YA 2UU9F 1IR1A 3RB0A 4P2SA 3OTDA 1MNEA 2MZTA 3BGFA 4DV0F 1RISA 1WKLA 4PQAA 4WK1A 1NEEA 4P2MA 1VRUA 1GMVA 1J5EJ 2QIFA 2M7QA 2HHHE 4NLWA 1N36J 2W9AA 3D4JA 1V5IB 3CE8A 5AXMA 2IVYA 3LAMA 1CJUB 1RAEB 4K8RA 1OSCA 1H3DA 3Q8UA 1N32F 1XMQJ 4ZJLA 1XQIA 1IBCB 2EOIA 5B0EA 3HSGA 4WZQA 2GMJA 2MYFA 4WFXA 1X4CA 1VK3A 2EQ3A 4O43A 5IT0A 3OXGA 2V83A 3CJ2A 1K1SA 3L9ZA 4HI2A 2FHKA 3QJLA 5IWAE 5D8HB 1N5YA 3R6LB 4C6AA 2L41A 1KLMA 3UE2A 2D9OA 2JYAA 4LQ3A 4FDFA 4P7DA 2CQ3A 3THOB 4LBIA 3UD3P 3TX8A 2JOXA 1IQZA 2IHR1 2HWIA 5LL6d 4A8MP 1TV6A 4HHHA 3QT5A 4MK9A 4JI5E 4C97A 4P71A 1NB2A 3DN9A 2RUGA 3NMRA 2L6MA 3MPYA 2CPYA 1UVMA 4USUA 1X4AA 4URGA 4C8YA 3PX0A 1P6TA 3EQ1A 3JQKA 3GILA 2OI2A 8ATCB 2B7TA 1X4BA 2K7JA 4B3TF 4DV4J 4NLDA 4A8XA 1FERA 4DHVA 2Y8WA 4LF6E 4KPCA 3WDOA 5EDWA 1O0WA 1JLFA 2CQDA 1RT3A 4GVBB 5KT4A 2YKNB 4ZS6A 4KAIA 2C2ZB 1OYEA 1SC6A 3MAHA 4ZN1A 4QW8A 1JK2A 2EPAA 5L46A 2EWLA 2VF3A 4LF7E 1O8BA 2DNMA 1FEEA 3MPUB 3NAIA 1JJHA 4M5HA 1YYKA 2CJKA 2R2RA 4TQRA 3L3CA 5C24A 1HNZF 2UXDJ 5IXUA 2EM8A 2FHOB 2DMIA 4Q0BA 1ZH5A 3FQLA 5B0GA 3OVSA 3CDUA 1NUEA 3CCWA 1EQ0A 5HANA 2PO4A 2VQEE 2W8KA 1KVIA 1HMVB 3TUPA 4IDKB 1JK9B 4F9CB 4M8LA 1VMBA 3L7UA 2A0FB 4DG1A 3T5JA 1SB6A 5CAAA 5DRKA 5HMXA 2J7UA 3W2WB 2MMYA 1BQNB 3N5FA 4TUGA 3KXDA 1RABB 1TAUA 2IAJA 3R5DA 2HHHF 1C0UB 2BE2B 4MK7A 3ISZA 1CULB 1F2IG 3FMBA 1PYOB 3JTOA 2QLXA 3DHXA 3KHGA 2A3JA 2E5LJ 4BWMA 4K0KE 1XK8A 2RIJA 6FD1A 2NXUA 3Q2SC 4AD6A 3D6TB 3BQ2A 2CZ4A 2HBZB 3SV3A 1L3KA 4W98A 2C2NA 2BJDA 2YNFA 4ATNA 5KG5A 2CJBA 1RWUA 3ZO7A 1IKVB 4UZBA 3RU0A 3E2EA 4K50A 4DR2E 5IWAF 1X3CA 1HPZA 2NS1B 4OYAA 2HNYB 1ZYQA 1FFWB 3EGVA 2EKYA 4J9SA 4A8WA 1JWWA 4EK2A 1LXJA 1S1XA 3JSMA 2RDDA 2Z0GA 2Q43A 4B17A 4HDHA 4M1KA 4DN9A 2MTLA 4LJMA 3I5AA 4X4NA 4HH1A 2L48A 2YWKA 2RTXA 4RNFA 4V19X 5KFTA 1HQEB 1HLWA 3J81j 3ISND 5HAOA 3T5KA 2ZVSA 3PM9A 4QWCA 3NMAA 3MCMA 1MMDA 5CYJA 2WVDA 1XR5A 4X66E 3HZEA 5AC5A 1RCXB 3M6WA 3S1TA 2AMCB 5RUBA 4WYWA 4KHPJ 1PYSB 1TF3A 1D9DA 3HF5A 2GX8A 3RBXA 2C2KB 3CDAA 3MEEB 4OI4A 3OLBA 3QNWB 1N6QA 1JK1A 1S4FA 2IYGA 4NI2A 4XTTA 2RMLA 2W2MP 2W9BB 2JEFA 4RW7B 4X65J 3THVA 3C3LA 3PACA 5B0DA 2XB2D 5KFQA 1VYAA 4P73A 1AUSL 5DM7Q 2J6UA 4ZYGA 3JQJA 3V81A 3NBPA 2XGPA 2YWWA 3RRGA 4F3QA 4NLPA 1X4EA 2YRHA 2RRBA 2ZE2B 3UQSA 4LFBE 1RAIB 2ZJPQ 3DRRA 4NXNE 2VQEF 1RAGB 1FX4A 2D74B 2IVFB 1RU2A 2EMXA 2ENHA 2I13A 3VQSA 3PX4A 4DR7J 4N47A 3EPHA 2JFKA 2QA4S 2FHMA 2FVPA 1XNQJ 2MY7A 4Y6IA 1VR6A 2HHXA 1U48A 2COLA 3IXQA 2CDQA 3RG6A 3VHTB 1FKPA 3V6DB 2MQ8A 1YK9A 4PG6A 1RA7A 1PBUA 2P2CB 4JI0J 2B7VA 4DZDA 4YOEA 2HNDB 1AFIA 1W26A 4OX9F 3HXLA 2D9HA 2XYPB 3K5LA 1RHKB 1OMSA 1M5KC 4LR9A 3RUBL 2CJYB 3IFEA 4CH7A 1WRJA 3G86A 1FE0A 2Z56B 4CCHA 3FFIB 4ELVA 1U02A 3BGRA 4EI2A 1NPPA 2R7SA 3UPFA 4HT5A 5JUMA 4I68A 3NG8A 5IC4B 2GMLA 1F2GA 1BXNA 2QO3A 1WHXA 2J9DA 1U0HB 4U9RA 1AFJA 4WSPA 3MECB 1RWNB 2AW0A 4MTPA 5IT4A 3MM5A 3ILLA 4F4KA 2EPMX 4QYZK 4NLVA 4NLUA 3DLHA 4RKUC 2HBQB 4OI6A 3FNNA 4KGMA 2MKNA 3C6UA 2H4YB 1S0VA 3PJXA 1CSJA 3KJVA 2RPCA 4J9UE 1UPPA 1TUGB 2WSEC 4YHHJ 4I0WA 1QU6A 5I42B 2KFZA 4ED5A 1R8HA 5CYMA 2I9IA 3PW7A 3GIRA 1RTDA 2EL6A 2WCC3 4NLQA 2NUGA 1NDPA 3TVZA 1UKUA 1XNRE 4OLPA 1BY9A 4OL8A 1FJEB 3CCLS 4LFCF 1S76D 2VG5B 5ETSA 3HMJG 3BBBA 4X66F 4MAKA 3BO4A 4NE9C 3FC9A 3OTCA 5AJ3F 2W2NP 2MGZB 1SIWB 4HEA9 3MHHC 4IG3A 5C42A 2EMFA 3N4WA 2A2DA 2QJ3A 2GIFA 2BKNA 1SQEA 4URQU 2XZDB 3CJ3A 3H90A 1VQNS 3KHRA 2CPXA 3AOCA 5HQLA 3D1HA 5E3RA 1S9EB 4WIQA 4IOCQ 2JOBA 5AE1A 4ED1A 3A8EA 3BGOP 4DN0A 4UOGA 2QEXS 1JMTA 2PGCA 3BQ0A 3J80C 1XBWA 4TYAA 5D77A 4LFBF 2MZSA 2JOQA 3DLBA 3CDBA 4NXNF 2CG4A 1IBLJ 1YWXA 4ZIWA 4LF8J 5FLXC 3D0HE 1TTHB 3T1YJ 3MM8A 3IRXA 3DLGB 2WSCC 3R5GA 2UU9J 2ZBRA 4CYUA 4EZ9A 1Q7LB 4M5LA 4DV0J 3ZTOA 4C3LA 5J2PB 2M8DB 4DBQA 4I56A 1IWAA 5L1LA 5DQGA 1R0AA 5T6JA 2QMUB 1EETB 4DR6F 5EWEA 4PWUA 2HBYB 2EMAA 4I4BA 1N32J 4TXSA 2JLGA 2CT1A 3TW0A 3UD5A 4RLEA 5K20B 1N4LA 5F3ZA 4B9TA 5KFJA 4IQMA 2LDYA 4LF4E 4O5GA 4USJC 3V4IA 2YTQA 1D09B 1EH8A 3LH2S 1VQ4S 4WZMA 3A1YG 2EM9A 2ZH1A 2OMLA 1HYSA 2BEFA 2CQIA 1NXIA 4RNHA 4A47A 3IAM9 5GAHI 3CCSS 3VQTA 4I6WA 2OPRB 2CJXB 5KAKA 2EFNA 2GO8A 3PO5A 1S5ZA 1IR2A 1VHIA 1ZAXA 4HYKA 4C3MA 4RUHA 1K0VA 4JI2E 3HHLC 1YRUA 4NCAA 1UP1A 2UUBE 2VODA 1TL5A 4DCJB 1PBAA 1BUXA 1RT6B 1VC5A 2J7JA 1TL3A 1LW2A 3VAIA 3G8QA 3GR1A 1UPMB 2KM8C 4CQ1A 1RWXB 2VFUA 4B3TJ 4J9QA 4B9NA 3EGZA 2MQNA 4C7QA 4DF4A 1J5OB 2RQ4A 2ZH4A 3U1LA 3KLGB 5T7LA 2C3UA 2ZC4A 2Y1IA 1E6YA 2M70A 2YH0A 2XS7A 1OSDA 4Q2LA 3MEGA 1NK9A 3HSZA 4WE1A 4IOAQ 3SSRA 1T3NA 1RT1B 3UW1A 1SIZA 4TN2A 3AJDA 2DGSA 1WORA 1JLCA 2EPPA 4KWYA 5KFHA 4TLRA 2W9CA 3CIZA 1LNQA 2HNZA 3O2IA 3J7Yp 1FJ7A 1NHKL 2PMZD 2DNNA 4F2JC 2LU1A 1HNZJ 1S72S 2L2NA 2CTDA 2CAJA 2B4VA 2UVRA 2EN2A 1B64A 4X4TA 3JXOA 1FVQA 3SSSA 1RKJA 1OS5A 4B3RE 2HFZA 3MDFA 3H4DA 1B0PA 4AYBD 2K1RB 1KD1T 4ERDA 4ECUA 1T9VA 2I1RA 5B09A 1FCAA 3H20A 4QZVB 2OP5A 2GHPA 3A4TA 4CO3A 3KDOA 2HFUA 3BKFA 4EO8A 1EP4A 1FD8A 2NXCA 3DRSB 4KHRA 1IXKA 2J5AA 2F1FA 1WXRA 2HHHJ 1HA1A 4R0EA 4ANDA 1KQGB 2UVWA 2ZNYA 3MR7A 3TZZA 1FTCA 2J7KA 1IKXA 3DHWC 2YX7A 2MQQA 4UT4A 3ETOA 1T05A 1AH5A 3G71S 2YZTA 1TKDA 2CPIA 2CUYA 3G6YA 1RAJA 3MM7B 2MDRA 4DFJA 4H54A 3EXCX 2CJAA 4O44B 4ZPVR 1PJ5A 1TL7B 4E98A 2YX1A 3WC2A 2ZJQQ 3GIIA 4F3MA 3J81C 3LGHA 2V4JA 1FI4A 4X4UA 1Q16B 3HPOA 5IWAJ 2XCAA 2RHSB 1WHVA 3W3SA 1Y9OA 4ES1A 2JLEA 3OD2A 3KG0A 3D0GE 2RE1A 2FGGA 3UDVA 2C2EA 3CMQA 4ILRA 2ZD1B 4CM2A 2HZAA 3T1HE 5A69A 4I8OA 3OXFA 4ZPWR 4TU8A 3LWMA 1SJ3P 1WG1A 4Q5VA 2EPIA 1T03B 1Z1BA 3SMZA 3CGIA 2JRSA 1UVIA 1HW8A 4DQRA 2EP3A 4CTAA 5J2QA 3PX6A 4WFBQ 5HQ8A 4JBCA 1KBRA 5DZ7A 5KG0A 4PYDA 1XR7A 3K58A 2ENCA 5CQGA 3SEOA 4RW4B 1QAYA 3OW2R 4LF5F 5DLGA 3IG1B 1NKBA 2KVIA 3QGHA 4LU9A 1QJHA 4IYQA 2WCXA 2J0SD 3DLEA 1RHQB 4WPAA 1SJFA 2EM2A 2JP9A 4G65A 3Q8YA 2WBUA 4A46A 4ZP8A 4PG4A 3CCRS 2EOOA 2RF2A 1GTHA 4ZP9A 4WSGA 2PN6A 4IG0A 1Z2ZA 1B0TA 3R9LA 2LT7A 1YYOA 2VBZA 5GMEA 2ROEA 3FRYA 3J7ZT 2R2UA 1UTAA 1WHWA 2VQEJ 1A7GE 2RS7A 3QWUA 2FVSA 1X9SA 2RVJA 1QAIA 4BS2A 3EVOA 3UR0A 2H4WB 2EXUA 4RU9A 1DLOB 1VK8A 4UW2A 3K89A 4ZLNA 3HDSA 2DIXA 1R8PA 1YKWA 2NPFA 3O1LA 4TQSA 2GO9A 2EM5A 2EOMA 4LVNP 1FFSB 1BQMB 2B7BB 2YRKA 3K2YA 4IR9A 3AOAA 3R1LA 4OX9J 5CZXA 3W61A 3G6ES 1JIHA 1LLMC 4RBVA 2EM0A 4BHQA 1UFKA 2KOUA 2XYHB 5JXSA 4MYTA 2YTPA 2AT1B 4CT8A 5BXIA 5ETKA 1R3NA 3FBFA 3QMQA 1WI6A 4F36A 3UDEA 3GIMA 3MR3A 2V8VA 1ZAVA 1VRUB 3CCVS 2QA2A 3EJMA 1PKPA 3BBFA 2V4RA 3UN5A 2LLZA 4HR2A 5EWFA 1UCNA 4OHYA 4LREA 3SCKE 4ZVSB 4P74A 2AYEA 5K9FA 2HFNA 1Q86T 4WXCA 4PUOB 5LMUF 1VQ8S 3HHLD 2V88A 3B82A 2P9GA 3PW4A 1FO1A 4F7VA 1FWPA 3D3BJ 4Y2CA 4O4KA 4M0VA 3HSDA 1UJ4A 4XDDA 2DXDA 3GCXP 3L7PA 2EM3A 2OMOA 1RWVB 2ZH9A 5BYRA 1QY7A 5MAOA 1X4GA 4LFCJ 3I32A 1F3VA 5HBMA 2UUWA 4X66J 4ZVOB 1SQFA 4Y2IA 4USVA 3HLUA 3J7YI 4M5KA 5AJ3J 4DSLA 4PXDA 1VQKS 1U25A 4RWXA 4I7FB 3M2UB 5DGBA 1TMMA 1TKXA 5KFZA 2GGPB 4J9RA 1UBDC 1WNEA 4R25A 5F9LA 4WP8A 5EHHA 5L39A 4DL3A 1ZM2A 2CQBA 1H2TZ 3HHKA 1B4SA 4Z7CA 2AJ2A 3ZTRA 2LVWA 2ILYA 4HACA 1U8WA 4Q43A 2JFDA 3R5JB 3I0SA 2V8PA 5ETPA 3LTOA 2DPIA 2MC6A 2QLWA 1RT3B 3M99B 1S9GB 2WZ1A 1VRQC 4I67A 3BSOA 4H4KC 4R8UA 2E5IA 2QZ8A 3FZBA 3U27A 3AJ1A 4LFBJ 4K7QA 2EMWA 4J9NA 8RUCA 4NXNJ 2R9LA 2HVEA 3TAPA 4Q2MA 2U1AA 4MIWA 4HH0A 5C24B 1LWCB 5DO2A 1E6VB 4ZCMA 3QG5C 3TVYA 2ZDOA 3MCOA 3CTRA 4WKYA 3UNGC 2V9KA 4RW6A 1AW0A 2IM3A 1C2PA 3KWMA 2OEMA 4DS4A 2CZ9A 4DR6J 4MMOA 2JSXA 4BWJA 2Q3PA 3MR2A 1CJKB 5KFCA 3MURP 4QOTA 4RPFA 3DOKB 1JX4A 4DG1B 3K5MA 2RNEA 4LR7A 1SL0A 3HZGA 4PYAA 4O3NA 2ERRA 2EI5A 1R0BG 2HRUA 4WBFA 1WF0A 2LBSB 3DLKA 3MFHA 1MMLA 1YTYA 1WUUA 3F73A 3HHDA 4DSFA 4OHXA 4JI1E 3OL9A 1YUIA 3ILOA 4R2RA 2V2KA 3PRBA 5CZVA 2MKJA 2C2MB 2YH1A 2E66A 2KZZA 1SCJB 2KT5A 4ED0A 5I4MA 2L9DA 2FY1A 3OXLA 1YG0A 4WCEQ 5KFAA 1LKZA 4DV2E 3KUGA 4UQGA 4KE5A 2QX0A 5DZ6A 5J1NA 4P2FA 1M5PC 4JI8E 5AE3A 3UCGA 1KSPA 4NPOA 1HPZB 2YTNA 4OJ3A 2FD2A 4PABA 2BKOA 4GC6A 4J5OA 1S1XB 3UFCX 5IQ6A 1HIYA 4OI0A 3CJ0A 2ZH3A 3M1VB 2RSIA 3BZQA 3WZ0A 2Z4PA 1YSJA 3VR1A 3ZTPA 3EYZA 2AX0A 1H2UX 4ICLB 2IRXA 4OYMA 1HI1A 1NK8A 4WXDA 4AFFA 4DSKA 2EN3A 1JLBB 4BMJA 1IUJA 3GONA 2EOXA 2DY1A 3ZFVA 3GPAA 3I55S 1NEIA 1UJ6A 1EKZA 4KV8B 2VH7A 2MDGA 2KG0A 4NLGA 1WJPA 4ECVA 3K0JA 4CLUA 1CJUA 1S7IA 2DH8A 5DG9A 4ILMA 3MSWA 3S01A 3SXLA 3W5XA 3SCIE 1N6QB 3GJSB 3NKYA 1WTFA 2QA4G 2LXFA 4NI2B 2XS5A 1SL1A 2YY3A 2DHGA 1H73A 4NOHA 1MG7A 5KFFA 2IC3B 2P6TA 1JKHB 3FCHA 4W4MA 5D15A 4ED6A 3DDNA 1S6PB 5C5JA 2FJAB 1CC8A 2DT9A 3NBPB 1F5CA 3FQKA 2DB1A 4DR4E 3TEHB 1GX5A 1UHZA 4RZRA 2GHFA 2FLPA 3DRRB 2PE8A 3JS9A 2WHOA 4MIAA 2ASJA 5J2MA 4XIUA 2BYCA 4RNNA 3HJVA 4B9LA 3IBCB 5DNYA 4B9SA 1DARA 3JB9k 3U1NA 3JSBA 4YB5A 4C0BA 1KKHA 1NNDA 1X9WA 4H4MA 2JNJA 2KYXA 1WOPA 4NLTA 2CPDA 5D0HA 4JI4E 1KHWA 3VAKA 3W1YC 3QT6A 1TFWA 1VOMA 2LV2A 4OI2A 2XULA 4Z2XA 2YTIA 2B0GA 3NL0A 2POKA 4N76A 3OTEA 1WSVA 2F8MA 2X51A 4TYBA 3PZPA 1I94E 2QTWA 5D4NA 2QG9B 2GQ2A 3R3TA 2DR6A 2DJWA 4ZVHA 4DV2F 3K17A 4USKA 3HULA 2LQJA 2AEJA 4CRJA 1RC7A 2VPZB 4LBHA 3BM7A 2VQFE 5KFIA 1CPZA 4IO1A 4DPTA 3H25A 1KFDA 3M05A 2UP1A 3BREA 3TQEA 1LFPA 3N79A 1VGYA 3CCES 3QWPA 1FRKA 1X4DA 3C6UB 2PFDA 5KG4A 3OUYB 5FDLB 3TJ8A 3KJVB 3W65A 4ES3A 1FKAF 4LF5J 5E0OA 2XLKA 1BWVA 4D3GA 1L3UA 2JXPA 1HMVA 2GZOA 1NK7A 4DR5F 4IDKA 1RTDB 4NYZA 2LQ8A 2VDHA 1QDUB 2B3TB 3JU0A 1M0SA 1X6HA 4LF1A 3W2WA 1BQNA 4JV5E 4PG5A 3KTQA 3G4SS 3FCVA 2AEMA 5IM0B 1Q8IA 1Q81T 1NU4A 2VE7C 2RKIB 1C0UA 1DY3A 2BE2A 4R2SA 3G9CA 1CULA 3A8KA 3P45B 3VV2B 1HWUA 4JP8A 4IG3B 1XC9A 1S6UA 3D1OA 3V4MA 1A0OB 4CLTA 3PR4A 4B08A 4A8OA 3OFHA 3GYGA 2VRDA 5CH7B 2XMKA 3J7AG 2V94A 1IKVA 3FBEA 4WX9A 1J5EE 2GPIA 3RRKA 2XY7A 3HO1A 1PIEA 3T5LA 2AKWB 3O8WA 1GMWA 4FXVA 2EKNA 2WW8A 2YVSA 1XMQE 4ZMMA 3C66A 3DI6A 4B3MF 1Z4UA 2IA6A 3CD6S 4E8UA 3GLJA 4ED7A 2YTDA 4U67Q 2IRYA 1RTJB 2K2PA 2K7KA 1ZAWA 1WC4A 4FF2A 2CZVC 1NSAA 1Y5IB 2BA9A 3IR5B 3N6NA 3TAMB 1C0TA 2V85A 2IA0A 4ZP7A 4RUAA 4KHMA 3BN4A 4QIFA 1HQEA 2WONA 2ALZA 2GFFA 1D0EA 2XZTB 3AXKA 3G6XA 4F3OA 3GJTB 2GAHC 1KTQA 1FRIA 2P9EA 1GAOA 2NUUG 5IZHA 1R0AB 5D3GA 4JI4F 1A6LA 2P6SA 2UUTA 4WKRA 1WF2A 4FKXA 1NRKA 2EC2A 5GAGU 3KOAA 2I38A 3HVAA 2AIRB 4LF2A 5IV4A 1KP6A 5K14B 4NRUA 5KFKA 1TUWA 1I94F 3V4IB 4NEZA 3MF5A 3NAHA 5LMUJ 1K0TA 3SQOP 5KL6A 3VYXA 2W9BA 4EFAC 4RW7A 4EBEA 3I0RA 4XAKA 4MYUA 1HYSB 4EUVA 2VQFF 3L09A 2JZ5A 3HI9A 3QRPA 2DHXA 2N4DA 5A2QY 2N3OA 1CQNA 2XHCA 1YZ7A 2E7WA 1LFWA 3LO3A 1IBKE 3AV0A 2XHWA 4F67A 1TFYA 2IRUA 2FJXA 2AP6A 1QNTA 2NSCA 3R27A 2V2ZA 1Y4ZB 3BGHA 2EMZA 2OFGX 2DXFA 1S0OA 1TL3B 2CNNB 2IMWP 2FGOA 5ETMA 3NGUA 2OJ3A 1CC7A 1X0FA 3QAUA 5L8RC 4I69A 4Z37A 4JV5F 1UVNA 2W4CA 3G6VA 2FJBB 3B6BA 2RDIA 3PYFA 3V6DA 4ZVTB 3QPIA 2P5VA 4RW8B 2HNDA 2R8IA 1PJTA 4P6QA 1YJWS 1ZTWA 4MFBA 2FLOA 4FYWB 3A3NB 2X7IA 2UV8G 5KFVA 1JLCB 3MGJA 2FVCA 2M7SA 3MMAB 2YU5A 3EGWB 2VA3A 2UXBE 2W9CB 2R1FA 4R0JA 5AT1B 1KQFB 1H7WA 5GAGI 3ULHA 5A8RB 2CPEA 2X3DA 1KYQA 1U0HA 3HM9A 1RE1B 2I5JB 2MLXA 4DV6E 3MECA 2E5LE 2Q79A 4DMIA 1XMQF 3CJKB 3IM8A 3FEXB 4QIGA 2G4BA 2CSHA 4I64A 1SL2A 1LK5A 4R03A 2C28A 5DG8A 1BBGA 1HHQA 5K8PA 2OPQB 3MFIA 4YDXA 1H2VZ 4IRKA 2ELYA 4OZ1A 3F44A 3D68A 5I42A 2AF6A 5KFWA 3I9V9 4ZCLA 5KFEA 2HFOA 1EP4B 2ABYA 3THTA 2I8EA 2KL8A 4KKOA 2X1GA 3CC4S 1FRJA 2RT3A 4M9VC 2MQMA 1P8GA 1RUSA 3ENWA 2OPSB 1YX2A 2JVRA 1HNVB 2YQ3A 4QWDA 4ZYHA 2PMWA 1T4OA 2MGZA 1CBKA 2XI2A 4OLOA 2WAQD 1FXLA 1HBNB 5E5NA 2QRRA 4LUBA 2NXNA 4NLSA 1NCSA 1NDCA 4BDPA 5G4DA 3KLIB 1ELOA 4AQYF 3QT7A 1YUJA 4RW9B 2M4MA 2O1PA 1YJVA 2UUCE 2KN4A 4M30A 3UN3A 2V4JB 2G1DA 1YBAA 3BYRA 4NASA 3BIDA 2K06A 4ZLPA 1YZ9A 2E1RA 1TZ0A 4LSLA 1FJCA 1RWPB 3AFGA 4OQJA 1S97A 1S9EA 2FTXB 4F0KA 2AJQA 4DV1F 2HPUA 1IBKF 3P5BP 2Z2ZA 1VFJA 3OTOE 2ZWPA 5HJXA 3UCUP 2UVVA 3A8JA 2VJVA 3ZTQA 4FPRA 1N54B 2MEWA 1EX8A 4MKVA 3I87A 3H5SA 2DKOB 3ADIA 3DLGA 1O5JA 1MN9A 2VPXB 4O4RA 3F6GA 2EL4A 1QSYA 2RQCA 1SBRA 3I4PA 2Y8YA 3AB4B 2HIQA 5J2PA 3NLCA 1NBEB 3HD1A 5DG7A 3ADAC 3EPIA 2HGLA 3C6TA 1EETA 2JH3A 4NA2A 2ADCA 2FZKB 1NKCA 4IS1C 5KFYA 3FZ2A 4P10A 1V9OA 2LDIA 4FBUA 1VBZA 3M4XA 1FF2A 4LF9E 4F2RA 3HTXA 3DU6A 2UXBF 1TK8A 3JSRA 1I51B 2IM0A 3ILJA 4DU8A 4LRDA 3DM2B 2H51B 4GVLA 4K4SA 4YFUA 1DQ3A 4DSJA 2VDIA 4N77A 4DV6F 4M63A 2QLBB 2VFSA 2LO3A 1TKTB 2IDLA 5H9FJ 1N33E 4ZLJA 2CFXA 1R8CA 2OPRA 1DTQB 1REVA 2C3MA 2V6AA 2K7IA 3KG1A 2EFGA 4CLZA 1N5SA 4QW9A 3VTIA 2YKQA 3DXSX 3QATA 3RB3A 1VBXA 2YX4A 3D6MB 1A1FA 5F8IA 1R8BA 2QA1A 2WSFC 1RAOA 3GV8B 3NNCA 1KRPA 5SUHA 1NDLA 3BPDA 1J5OA 2E29A 2FTRA 4KQZA 2LU2A 3CUNA 3KLGA 2DO4A 2V5HG 3SI8A 4C11B 5KL4A 3BS9A 4IH5A 3UWTA 4YHHE 1BLUA 1H6KX 3IC1A 1GTEA 4JOUA 4CIOA 2V34A 3BR8A 1RT1A 4UOHA 2YWEA 3PG9A 3CT9A 5HLFB 1ZBQA 5J1EB 1NK5A 2W2QP 2XGQA 4F26A 2X3GA 2V8DA 1LWFB 4DV2J 2V8QB 3PFEA 1M1HA 3FK4A 1HBOB 2UUCF 2C3YA 2VPYB 3GJQB 3BKTA 3DOLA 3G8TA 2F9JA 2MSSA 1R6VA 2ATLA 3P6YC 1HWLA 1OJ4A 4C0OC 3QSYB 3CVKA 3ADLA 2HFVA 5IT9Y 3E3XA 3QGIA 3D0IE 1WACA 4DUTA 4FF3A 4F2SA 4EYIB 2WVEA 5A0YA 1YBUA 2VU5A 3QLHB 3OTOF 3N0VA 4X4SA 3IR7B 3EGNA 4WYLA 4WTOB 4YR3A 4DR5J 1D9AA 2XLIA 4RU2A 3LA0A 2OD4A 2JVOA 3QQCD 2NZ4A 3DRSA 1B3TA 2QYGA 4Y00A 5DQHA 2LUPB 3D6FB 1VIOA 3CCJS 1IBLE 3DDKA 1FD2A 4OZ5A 2DGOA 3TR5A 1RDRA 3S6EA 4LF8E 1UILA 2YTJA 2JLFA 5GADU 2YWHA 4N8OA 3QSIA 4AL7A 2DCLA 4J9KA 4Q7AA 3MM7A 4LF9F 3NNAA 1HFEL 3G82B 2MZJA 1SXLA 3BF2A 1TL7A 3LP2B 3VGSA 1NLKL 4U7UK 1Q5YA 3I0SB 2G9OA 1SJ1A 2JEJA 3TARA 2AGQA 1ZS6A 1NAQA 5LMNE 1N32E 2MY8A 5IFMA 2G2YA 4GKJF 1N33F 4B3MJ 4R8UB 4QR0A 2L33A 2MKCA 2RU3A 4FNIA 1MGTA 3MPDA 4FS2A 3T9NA 3EMTA 1HI0P 4NLXA 3SYZA 2EN8A 2ZD1A 3TO8A 2VUGA 3MUTP 3CC7S 1EKRA 4RNMA 1JXLA 2DBBA 4C98A 1T03A 2RDJA 4RL1A 2BJ7A 5KFNA 3Q22A 1N5QA 1Y0HA 5KFUA 5LM7E 3KK3B 3QT8A 2YKAA 1Y10A 5HJYA 1NK6A 4IKAA 1CJVB 1TMJA 4JI4J 3FKBA 4ECYA 3JAMY 4RW4A 2BACA 4PRFA 5DDQC 3UDCA 2E5HA 2HHVA 2KZMA 4URSA 1S57A 2Y1LB 1I94J 2BABA 2GS8A 2W7AA 3HHNB 2I9SA 3DCAA 1LOUA 1HL6A 2YTCA 1G7CB 2HZVA 3RW6A 2Q1LA 1YGYA 5DGAA 4EO6A 4JI3E 3GU0A 4PCQA 2ADRA 4IR1A 5GADI 4WYQB 1VDHA 1KQKA 1XWLA 2XNQA 2EG2A 5K5MA 4I2QA 2HRTA 2JL9A 1G1XA 2PI4A 1HBUB 4BC9A 2FUG9 1DJ0A 3SFGA 2W24A 2CQ4A 1PJSA 3MCSA 4PWDB 1L3VA 2M3DA 2Y1RI 2G2OA 1DLOA 3VZIA 1SH2A 3C16B 1OQ3A 4HKQA 4M5JA 2EOYA 2LYVA 4WF9Q 2F4FA 1U47A 2OEJA 4LSNA 4JV5J 5HQMA 3CB4A 4BCAA 1CVJA 4DL0C 2M1SA 4FXWA 2IVMA 4OJ1A 5H1SV 4JYAF 1FA0A 4LBPA 4F0MA 2J8AA 2LCWA 4CNZA 5F9NA 4NZ7A 2MKDA 3AAWB 4KO0B 4ZN3A 2YXLA 2ASDA 4PXCA 3NCQA 3RB6A 4YY3F 1VLYA 1LW0A 4CLWA 2E1MA 4OI3A 3K7RA 3RZAA 2AWZA 5LMNF 4O4GA 5A6WA 3H5UA 1RMDA 2CDRB 1HNXF 2VF1A 1UEKA 3TAQA 2L9NA 1VJQA 1BHNA 4O24A 1EZZB 1WC5A 2HHWA 1CLFA 4NCGA 4UY8T 2N7CA 2I2YA 4PUOA 4KSEB 4FZVA 2RS6A 1WEXA 1GH8A 4USTA 4QYRA 3VALA 3S8SA 1SJ4P 1SFEA 3C15B 1C1CB 2A25A 2EG1A 4DDFA 3T3FA 3EPKA 1FE4A 4XK8C 2EFQA 4H4KA 2HHUA 4QU6A 5J2MB 4ALZA 1RBLA 1RTHB 4ANEA 4I7FA 4UF4A 4WXOA 3HFVA 3M2UA 3KWRA 4OOGC 2LQBA 2GGPA 2C2OB 4QIWD 3VK6A 5KT5A 4KGZB 3I4HX 3HD2A 2E5JA 1P47A 3HVTA 4AQYJ 2JWOA 4P7TA 2ZH2A 1VQ7S 5KFLA 1RYSA 4H4MB 2J9DE 4M95A 1TU0B 2DGVA 2I6WA 1G6BA 4K4UA 3TYTA 5KG3A 1FVSA 2HKEA 2LP4A 1YQHA 2FGCA 3BO3A 4NXME 1PJ6A 3HCXA 1I6JA 2ROPA 2A6OA 4JI3F 2OAUA 3IWNC 5A6BD 1KR4A 2F65A 4DV1J 2BKPA 2UZAA 4ZP6A 1N56A 1S9GA 3PEJA 1IBKJ 1HR0F 3LGNA 2YU8A 1GT8A 1JXVA 2GV1A 2E5GA 1KFSA 2XY6A 3KHLA 4RWWA 2LRSA 2EMHA 3W62A 2LQ5A 3G2XA 3PW5A 3E8OA 4PQUB 1FRXA 2PI5A 1RAAB 3KLFB 2HHSA 3MMBB 4ILLA 1LQ9A 1LWCA 4F02A 1E6VA 2LFVA 4ZPDA 2R3VA 5LL6R 1O6XA 2FJDB 4MKYA 2DR7A 1Y3KA 3Q24A 2H48B 2OGUA 3PIPQ 2V68A 2EOHA 3T9ZA 1M90T 4ECZA 2W8LA 1JLEB 4ZVGA 1S0MA 1LWXA 2OSQA 2RQMA 4RX6A 1CJKA 2K3IA 5C25A 2DGTA 2IJFA 5ETNA 3DOKA 3M8ZA 4F4WA 2JVAA 2VONA 3KG4A 4PPZA 1B0VA 4NYPA 3OTBA 4EEYA 2VB6A 3MM6B 5KT7A 2UXBJ 1XTZA 2YKOA 4O3OA 2PT0A 2ZFHA 4K4YA 2QL9B 4DQSA 1H74A 1HBMB 2DH9A 1AXQA 1U1LA 2U2FA 3TZYA 3HKZD 5CHCB 4OX9E 5H9EJ 4DV6J 2QMXA 3M9OB 4DSEA 2GW8A 1KDNA 3PTWA 4OZ0A 1ZR9A 1NKEA 2IPOB 2PA3A 5AE2A 1FJGF 3M8PB 3EWGA 3P96A 3G8SA 4IFYB 3SDEA 2AU0A 5E41A 4FP9A 1D9FA 1Q78A 4K2JA 3J80U 4EGLA 3VAJA 5C7PA 4NZ0A 1OYDA 5KT2A 4L74A 4X4VA 3DI6B 1ZA2B 3LWLA 3BH7B 1Y00A 2B43A 5AC4A 5FLXU 1X60A 4DL7A 1WKKA 1WC1A 5IQQA 3M1VA 4AXIA 2R7RA 1C0TB 3RAQA 5A2QC 3GIJA 1KQSR 3DGPB 4KFBA 3R1HA 4ICLA 6AT1B 4WXWA 1IM6A 2XLJA 2DRDA 4U7CA 1U1MA 2WONB 2QSWA 1FNOA 3IWBA 4CP5A 2N4CA 4J8ZA 4KH0B 1JLBA 4MIBA 1K73T 2VV5A 2UUCJ 1YDLA 2YSOA 4UOCA 3DRPB 3NP5A 4LFCE 3A12A 1HHTP 5D3GB 4IUFA 1PILA 4KV8A 5IOLA 2CJ9A 1N3GA 2HJJA 4NXMF 4ZVUB 5HATA 4Q44A 2VPWB 2AJ1A 5D0EA 3GJRB 3LMLA 3OR1A 1NJZA 1VBYA 1R27B 2FJEB 1PAEX 2QL7B 1WTBA 3ECRA 3C19A 4DV5E 2CNLB 3OTOJ 4NZ6A 4F4YA 3BDEA 3W63A 3IAS9 5T41A 2IC3A 3I0RB 1JKHA 2DMYA 4K5SA 1S6PA 3JYTB 2YNIB 2C22A 1HQUA 1IVZA 1Q8BA 1B70B 1DURA 2FYXA 4K4TA 1FXDA 4I6AA 3I5BA 3RBZA 1ZZNA 2L92A 4IH6A 2IDEA 3PW0A 2CYYA 3OBIA 1GXLA 3I5CA 1KC8T 2V69A 3D6HB 5LXYA 1IKWB 2HMIB 3ZOQB 1VQLS 3T41A 1F0XA 2R2TA 4ECSA 4L3KA 2F7VA 4LF9J 2KRRA 1HD0A 3SQGA 3M2RB 1DQ9A 3W8PA 3L95X 2X1BA 1A1HA 3RW7A 4K59A 4A4JA 2E72A 3LP0B 1UFWA 4Y3CA 3JSYA 4OZLA 3DJWA 2D3ZA 4OJGA 3EZOA 3FJ2A 3SSQA 2BOAA 5ETTA 2RU9A 4DR6E 5IC6B 3C14A 1RB0A 1EB0A 2JEGA 2IBOA 4MFBB 4GKJJ 1N33J 3EXYA 3W64A 1WDDA 2C42A 1U1NA 1K1QA 4DPXA 5HK4A 1PG5B 3TUZC 3PIOQ 2FZCB 5HMWA 1X9MA 4ECWA 2XNRA 3I6PA 3OJSA 2XO7A 4X64E 2JWNA 2XC9A 1D8ZA 4FYDA 2NUHA 1QAJA 2WVFA 2F4VF 1RT5A 2QSFA 2YTGA 1JQGA 3AH6A 1ZBTA 3H7HB 3C8YA 1NDKA 5ADZA 3KLEB 2EFPA 3PYDA 2XMVA 4TY9A 3MTJA 3GG0A 2AX1A 4ECRA 1G2DC 1RLCL 3OUYA 5FDLA 3Q8RB 4EZ6A 4XPCA 1AYEA 2N3LA 4HTJA 4ELUA 2FHJD 3DNCA 4OZJA 3C6MA 1IJEB 4YUDA 2EN6A 4DV3F 5LSOA 2VOPA 3TJAA 2V50A 2CQGA 5LLQA 4KKOB 4PZVA 3Q2TC 3BSCA 5K8NA 1HW9A 2OD6A 1TR0A 4F4AA 2WOMB 3AUZA 1DZ5A 5IM0A 4CO0A 1N5TA 2RKIA 2F40A 3UDLA 1M1GA 1WDTA 4ZPCA 1GQEA 5GAHU 3OL7A 2CQCA 1BMQB 2HLTA 4DV5F 3J81U 2GNKA 4CH0S 1IQSA 2BVZA 1T02A 2DEIA 2CPFA 1S1UB 2GJFA 4ETXA 2BBGA 4F0HA 2EE8A 1QM9A 1T39A 4LSLB 3ADGA 4KH1B 3BSAA 1DTTA 2NSBA 1FX2A 2MJUA 3CWJA 1EQMA 2WBSA 2BANB 3T19A 4RO0A 5KOXA 3FSYA 1RTJA 1T9XA 2NPIA 3WC0A 2AJ4A 3K59A 2XTJP 3PFOA 3TAMA 4YP3A 2ZM6F 4JYAJ 1DHMA 4IRDA 3MD1A 1JLGA 3VVUA 2CNKB 2KHXA 1SH0A 2W4DA 2RRAA 5H9FK 5KFDA 4MJKA 3T6JA 1KLNA 3CIMA 3ZZYA 1DI2A 1Q79A 1Q82T 2CQ0A 4R2AA 4YY3J 2B56A 4PXBA 3G87A 2G2ZA 1LV5A 2H54B 3G96A 3C6TB 4WU2A 4C0HA 2ZKTA 3GWCA 4QQBA 5LMNJ 5A76A 5KL7A 3GFXA 2N82B 4RHBB 3HHLB 3BQ1A 4GZNC 2CQHA 1ZOTA 1HNXJ 2HG4A 5K14A 2NYHA 2FDNA 5E3QA 1ZM3A 4JV2A 2KM8B 2YWFA 2DTJA 2ZOGA 4N56A 3FEYB 3UVJB 2K8GA 4X64F 2VA2A 3VGVA 2J9EA 2J0XA 9RUBA 2EC0A 3H2LA 2R7WA 2XEXA 3EPGA 2V2VA 2YQ1A 1REVB 2QC3A 2Z57B 4DR1E 3ELHA 3I96A 2HVHA 2HAIA 1IBMF 3IGNA 4IH7A 4LRBA 3OVAA 4M5DB 3ZZZA 2XCPA 2XSFA 4HT7A 2EMIA 2ACMA 1IWGA 5IT9C 1XMOF 1HNWE 3CSKA 3AXMA 1IKYB 1WC6A 4DEZA 4DZ6A 3GIKA 1TN9A 4CLLA 1ULRA 4CM0A 1WHQA 3M6VA 2R76A 3VAHA 4ZJQA 3EDRB 2DK2A 1N34E 3PV8A 5E3PA 4MLVA 3AA8A 1R7IA 4GEQB 2HFSA 5DQIA 4JI3J 2NUFA 2ZOMA 4ZKAA 3HJFA 4LF5E 1DBDA 4RW8A 3W9JA 1GZ6A 2KG1A 1D8YA 1HR0J 3TP2A 3MUVP 2QT7A 5J2NB 1DGCA 2M8HA 2YBVA 2XSJA 1T9TA 3QIDA 3KYLA 3CCMS 1STUA 5CABA 3RR8A 1JNZB 3MMAA 1UW4A 2AGOA 1S99A 1GTKA 3DOLB 3GCWP 2V8HA 2DD8S 4YR0A 5I3PA 5A8RA 3DF6A 4DUZF 2KFYA 2I5JA 3NGKA 3BV8A 3BBCA 1NSPA 3TA1A 5LSLA 1WD6A 3CJKA 5A0YB 4B3OB 4DL4A 5MLCV 4C3KA 1JJCB 2AYGA 2KI2A 3NCRA 1CS4A 3RRHA 2OPQA 2ZHOA 4YMEA 2JHEA 4J9VA 2YKPA 5EGYA 3MHYA 4OV1A 2NA2A 2Q8UA 2L08A 4OYOA 4YB1P 3MR5A 4Y34A 5HI7A 2JJ4D 3OHBA 2DEJA 1MWZA 3FBBA 2DPJA 3A3OB 2PEBA 1NK4A 1WJ9A 4X4PA 4F50A 1VCTA 3OSNA 1EH7A 2OPSA 2HEKA 2VBWA 1M5VC 1HNVA 1PJ7A 2DGUA 3ET6B 3TZWA 3Q8QB 2BX6A 2A10A 3BDPA 3L4BC 1TK0A 4TU7A 1VJWA 1HHSA 1FJGJ 4DX7A 5I3UB 2RD5C 2DIVA 1HBNA 3HX9A 4D3HA 3GP9A 1T9WA 3KLIA 1AROP 4RW9A 4Y2KA 2V67A 2PRTA 3V2UC 3JAMC 2DR5A 3K57A 4TY8B 3DXBA 5CD4A 2J8SA 2RHQB 1MROA 5GAEU 1FESA 4U8YA 2UVUA 4Y0FA 4DR1F 1HI8A 3AJ2A 5HP1A 4F6NA 4OZ3A 3IRWP 2ACYA 2YT4A 4K2XA 5LMUE 4ZCIA 3HP6A 4QR2A 2BJ1A 2IFXA 4HVZA 2QGFB 4JV1A 3T6BA 1Q5VA 1HNWF 3OV7A 4G1PA 1EARA 4OYPA 5ETVA 4BBYA 1Q8LA 2ZH5A 1N34F 4P9SA 2KJWA 2B51A 5KFGA 4M2ZA 2D3UA 2CXEA 4NXMJ 1QE1B 1WI8A 5C2CA 2EN7A 1SKRA 1W7WA 3EE3A 5AXLA 3KLHA 1L3TA 4Y65A 3PW2A 1J2VA 1SV5B 2ODRC 2PDAA 2Z8QA 3M2VB 1BD6A 1N8RT 2MQOA 2C2DA 5GMKa 1S48A 2R7TA 1FK9B 4NX9A 4R8OA 2H5JB 2R7OA 3UNYA 3NCPA 4DV7F 2CWXA 4WFYA 2JPAA 3DM2A 3TUJC 4NA3A 4OV6A 4B3SF 4E2FB 3T1AA 2CPJA 1PKUA 4I2QB 1AZSB 2WBTA 1TKTA 1S79A 3OVBA 4CLYA 1TP7A 2RAQA 2GIRA 1DTQA 2FY8A 3NEKA 1JNRB 2CQ2A 1SI9A 1OO0B 2D7SA 1L3SA 3J7YU 2CG8A 2YWGA 5KG2A 3HFZB 5GAEI 1ZTTA 1IQOA 3VGTA 2HZCA 3HPZA 2NZCA 1OQ6A 3BR9A 3GR0A 4LSNB 3N6LA 1O0PA 1RAHB 5A6BA 3MEKA 2ZUGA 3EICA 3VCDA 2L3MA 2WTFA 3Q23A 7AT1B 1NH7A 1KJKA 4DS5A 5LJ3Y 1VQMS 4KY3A 2VD3A 1RLDA 4YB6A 1RYRA 5BYSA 4X62E 1VLOA 4LRCA 4C11A 2QLFB 4AE5A 1NM2A 2XO6A 2FB0A 1K47A 2CWKA 2R8KA 3D67A 5L9XA 1BBOA 2CVEA 3IS9B 2NLWA 3ZXWA 5HLFA 5J1EA 1D1UA 1UVLA 1LWFA 1S4EA 1HBOA 4RBTA 2L9WA 4USMA 1LW0B 2F4VJ 1F1BB 2C3OA 3PO4A 1U6BA 5IXMB 2OLWA 4O4GB 1HWJA 2FC8A 3TWZA 2BXJA 2J76E 3THNA 2GVDA 4WFAQ 2R8JA 1YJUA 3Q8SB 3B78A 1S1TA 2BQRA 1A1JA 2Y1JA 4M5NA 1UVKA 3AY0A 5EUHA 2HLUA 2HAFA 4ZVQB 4MT1A 2R7QA 3BYPA 4HTGA 3QLHA 4G3IA 4NCGB 1GXTA 2R42A 5KFMA 2HURA 4TU9A 1R0CB 3PNIA 2DNZA 2UUAF 3MM9B 3GG1A 3MZIA 1Z1ZA 3OFEA 1N52B 4DV3J 2EPUA 2C2RA 2BW2A 2XI3A 4JI7F 1FWLA 3ILIA 3I82A 2BJ8A 1Y7PA 1RBAA 2EL5A 5E3CA 5JMNA 4WP9A 4DCOB 3DOMA 2YQ0A 2B5JB 5CXTA 4ZOSA 3MUMP 2JDJA 1UWAA 3FRZA 2Z2YB 4PR6A 1ZPVA 2YPNA 1MLAA 2DIUA 3HVTB 4DV5J 3C46A 2AYMA 4OX6A 3RAMA 2F3JA 3G82A 2VBXA 3TI0A 3JTPA 2ILZA 3FBCA 3IR6B 3NOCA 2YPYA 3PYGA 3GV7B 1F9EB 1AB8A 3ENAA 3LP2A 2HYIB 1U1QA 2J6TA 1S77D 1RT2A 2DNRA 5BR8E 1VIXA 2H36X 3DLJA 2NREA 1WKJA 4L76A 3NRBA 1TL1B 2EORA 2Y0SD 5A6PA 4LVOP 2H3EB 1RT4A 5LSRA 1BE4A 4GO5X 4EU0A 2W7PA 4YDDB 5G0RB 2W7OA 4B9VA 4GMKA 4CZCA 3QRQA 1DFDA 5AASA 2J7WA 1BC6A 3QIPB 3AB2B 3IBFB 4ID5A 4ZYEA 2ZM6J 3H4BA 1SJRA 5H9EK 4DCPB 4FN5A 1SQGA 1T4LB 2GHWA 2HGHA 4GO7X 2RILA 1JLQB 3EVWA 2N3HA 4CI0B 4ITSA 3SCLE 3J7AN 1LWEA 3KK3A 3FMWA 2OFHX 3T5HA 3TANA 1CJVA 2BW7A 1VRTA 4JI5F 1IR0A 1S9FA 2YNGB 1RHRB 5C25B 4X62F 1NHVA 3O6QA 3US5A 1A1KA 2CPHA 1UWBA 1ZETA 3WIUA 3LP1A 2LUQA 2ZDPA 2DR8A 3CPWR 1PO6A 2M9KA 1TAQA 5BYQA 2OKQA 1F9HA 2EMCA 1YSAC 4F4XA 1RT7A 2NXJA 4X64J 1W2BR 2D3OR 2H65B 3TOQA 2B6AB 3M8WA 4NYOA 4TVAB 4LF6F 4MLQA 2F9DA 1U24A 4ECQA 4ZPAA 3P4UB 4ZCKA 1KWMA 1KVJA 1GFWB 2MKHA 2VC0A 5A6JA 1IBMJ 2NR0A 2DGCA 5GVQA 4LF7F 3CJTA 1M1KT 1HBUA 3SDEB 4OX8A 1VI7A 2K3KA 3IM9A 1UL3A 5GMDA 4PWDA 1IM4A 1RU1A 1LK7A 1XMOJ 1SR9A 3AT1B 3KK2B 2EOJA 1UAWA 2EPCA 1JXEA 3QAEA 4DX6A 3C16A 3H98A 4OFZA 4ZVFA 1F60B 2YNHA 5ETOA 3D2WA 2KB2A 3THPA 4KRWA 1PYTA 1T11A 1JJ2R 3FSXA 3MOJB 3CMAS 1WSRA 2BBEA 1FKAE 2B8PA 1T3OA 4RJVA 4KFBB 4F9BB 1S1WB 4DR5E 3CD7A 2ODRD 5CD4H 1AA1B 4UY85 4FYXB 3OT9A 1PGZA 1DQAA 4OHVA 4DMZA 3QFWA 2L3CA 1K8AT 3KLVA 4ZYDA 4CO5A 2HK2A 2ZNZA 4KO0A 2ZKUA 4LMZA 2IIHA 1OWXA 5BR8F 5KL3A 4NL5A 4DUZJ 3WX8A 3QYYA 3OR1B 4K0KF 1BQXA 1EHWA 3CJ4A 2FHJA 1NK0A 4QBUA 3WQPA 4JI6E 3D9BA 1FT8A 3R5CA 3P1XA 1L5UA 1VS3A 2F8BA 3GTYX 2K4VA 3RYLA 2KHCA 5HVHA 3H2UB 5DDPC 5EX0A 1HQUB 4DR2F 4J90A 5F8NA 2M2BA 4O23A 3DDIA 3C15A 4R2PA 2Q66A 2HQDA 4CLSA 1C1CA 5DDOC 2IYIA 2DRAA 2MC5A 4B3ME 4KT0C 3OFGA 2G1HA 2HQGA 4DXLA 3POTB 2KXFA 2KU7A 4PXEA 2EQ0A 4CO1A 3R7SB 3J7A1 4R5PB 2GIQA 3R7BB 4YQWA 5DJBA 3Q0AA 2KYZA 1HNIA 2HRYA 1RTHA 5IS2A 4Q8EA 2EOFA 4F9AB 4KZSA 1FWKA 2NABA 1RHJB 3QRRA 3E01B 3SQGB 1S6OA 1ZM4A 2EPXA 2DVIA 2EK1A 1U8SA 3MHSC 2NCKL 5F0UA 4BLGA 3KMQA 3V5RA 4ANCA 3GZ7A 1I1GA 1TL4A 5L1KA 2XG8A 3MAQA 3NWGA 2RRNA 4RH8A 1R8AA 2A18A 1SKWA 4ZVPB 2FQQB 5HN0A 3GFYA 1KONA 4L3NA 1PC4A 3AOBA 2E1PA 4J9OA 3VAGA 4O3PA 2MDAA 2OPPB 3X1LB 3C14B 2B4PA 1U45A 2B8QA 1IMUA 3LAKA 3R2CJ 1F9FA 2HS0A 2LA4A 4DR1J 2ZZTA 3KDNA 3BO2A 3QJPA 3IWLA 4KYZA 2NXEA 2QE5A 2BE9B 4HL9A 1OY6A 3MAAA 4U96A 3GSIA 3LW5C 2EOZA 1AAYA 4JUZA 3PHTA 2WBMA 1RT5B 3M30B 1HNWJ 3B54A 2Z30B 2KT2A 3TEGA 4PQUA 3KLFA 3MMBA 1H38A 5KT3A 3M8YA 2V89A 1RTIB 1EAYC 5KOWA 2Z2MA 3BJYA 2EOSA 4OYIA 1N34J 4YS2A 2O66A 5D6GA 3M9NB 4L6V3 4I1TA 1FNMA 1JLEA 2PFFB 4L72B 2HSEB 2KFNA 1U2RA 1NJWA 4NCBA 3IN5A 3MEDA 3SIPB 1RCOB 1ZM9A 1M5SA 1HWIA 3EDQB 3QGGA 3MM6A 4OYXA 3M9MB 5D78A 2ZZMA 1L4SA 1CG2A 4IQXA 1APSA 3N01A 3BH6B 2ZEJA 2KXNB 2DYAA 4LQ9A 2GVZA 3MTKA 2ENAA 5B0BA 1HBMA 2FVRA 4DV7J 2C3PA 2D9PA 1X49A 5AXKA 4B3SJ 1RA6A 3DFEA 4LR8A 1S6QB 2H5IB 2AQ4A 5IV8B 1SC1B 2WRMA 2OEKA 3P8BB 1TVRB 3F56A 3M8PA 4JI6F 4C8OA 2V4QA 4ED8A 2EPOA 4UTGA 4IFYA 1S1VB 1MU2B 3BGLA 3N9UC 1ZAAC 1HQ2A 2DB2A 3R8YA 3CCUS 4AT1B 3O5TB 3LPYA 2VZ9A 2EQ1A 3PXGa 3ZNUA 4HTIA 4C48A 1DTTB 4DPOA 3EM1A 3W9HA 1JLAB 3I9ZA 2EMBA 4XDCA 4J9LA 4W90B 3D1QA 1X48A 1FHTA 3OSPA 3CNQP 5L38A 2EPLX 1NSQA 2DR9A 1P9YA 1UZDA 4I2PB 4ZDNA 2L3JA 1FTRA 2GQQA 4DF8A 1WG4A 1Q95G 3KMSA 3DGPA 1JLGB 3DYAB 1HD1A 3OQ2A 1TKZB 4WP3A 1FEHA 5KFSA 1ZU1A 2DNHA 1XNRF 3KNAA 4R2EA 3CC2S 2ZOFA 5DDRC 3DRPA 4C4WA 4CLPA 4Q35B 1C1BB 2DITA 2NQPA 1RP5A 3KNGA 5SZTA 2WVBA 3H0PA 2EBGA 1F3FA 3DMJB 1GMWD 3PDNA 3FUYA 4USIA 1YRXA 1WF1A 1UW9A 4FKYA 3ZC4A 1F6TA 4L73A 2VFTA 2FV4B 4A8KA 1X5OA 2BJEA 4U95A 2IM1A 3B8HA 3JTNA 2HGMA 4AQYE 3NY0A 5JVGQ 2UUAJ 4ZJOA 1SC3B 1FKOB 2G0CA 4C8ZA 4DQPA 4K4WA 1G2EA 1PAUB 2DY9A 3VVTA 3I56S 2PSZA 3JYTA 2YNIA 5B08A 1Y11A 2F8HA 2ZC3A 4ZVRB 4U8VA 4JI7J 2VKRA 1Y3JA 3RGIA 2ZUAA 2ATCB 3LQVA 3MCNA 1MSWD 4DV1E 5F3TA 2MZRA 1OY9A 3DGVA 1H0HB 2EM6A 2LMIA 4AXJA 2M52A 3PRVA 3IP0A 2R7VA 5K8MA 3QO9B 1JJ4A 3FIGA 1O51A 1IKWA 2HMIA 1NCLA 1KOHA 3M6UA 2ZBIA 3EVMA 1T9UA 3W2VA 2BR0A 2DISA 3BF4A 5CYQA 3M2RA 2OTJS 2ZWOA 1X5PA 1XJWB 4WJBA 4LTYA 1X5WA 3LP0A 4UZCA 1CJTA 4ED2A 1KEKA 1YJTA 4IRCA 4KGXB 3KJQB 4ZHRA 5DS7A 3IBWA 1YFHA 2DRPA 2XYGB 3TQ1A 4TNOA 3NNHA 3W5YA 4ZLLA 4DFMA 2XSJB 2EZ6A 5L9NA 3A13A 4LF4F 1ROFA 2BRKA 2OSRA 2DNPA 4LFAE 2FIUA 2XMMA 1ICEB 1VQSA 4OYWA 2R7UA 1P1LA 1T8EA 4C9DA 1HARA 3BPSP 2BJ9A 5HO4A 3K6QA 2MQLA 2E9ZA 1PDAA 5IV3A 2WVCA 3QZ7A 4R2QA 1U7LA 3KLEA 4L8NA 3Q8PB 1SJQA 3QGPA 4U6PA 4NMXA 3L00A 4JI5J 1X4FA 4JI2F 2X1AA 2HQIA 3CJ8A 4KR0B 1CS4B 1EIYB 4X62J 2YKMA 2UUBF 2FPHX 2APOA 3ENVA 4DU7A 1IJFB 2AD9A 3M6XA 2MJNA 2A1BA 3ZTSA 2VKZG 5KFRA 3EX7B 2ASLA 4EBCA 2HQFA 2VFRA 2EWHA 2BUNA 3BSNA 1KS2A 4ZK7M 3RMPA 5F8HA 2WBRA 2LJUA 4HLBA 2WOMA 4LF6J 1Y5NB 1GEHA 3HXMA 4NZVA 4FPIA 3KK1B 4WFNQ 1CQMA 2EJ4A 1RADB 2BM0A 1HKAA 2XMAA 1I3OB 4LF7J 3HK2A 5ETRA 2HVDA 1B7FA 3PVXA 4G6VB 1R43A 2EMGA 3ZZTA 2XMWA 4C2MA 2QFJA 4L5NC 1R6YA 3OR2B 2QLJB 1Y5LB 1S1UA 2RQKA 4IFVB 2HBRB 1QUPA 2OH2A 1MROB 2DNOA 1T0TV 2PC6A 3NGDA 3MPWA 2AYBA 3OLAA 2V87A 1YJ9S 3CEDA 3KJNB 1FDDA 5A8KB 3UO0A 5HP1B 2LECA 4HHUA 1V3ZA 4M5IA 2LVHA 4B3RF 3CMES 2M9AA 2CRLA 2BANA 1WC3A 4NLRA 4EWTA 2VBYA 2YPZA 2CVIA 4MKAA 2VOOA 1J27A 2B9YA 1BWEA 4IOBA 2DLQA 4DUYE 4Y2AA 2CADA 4G1QB 3ETMA 2W2OP 4AL6A 4LIRA 4ECXA 1X5TA 1VC6A 2DH7A 3ITHB 1P27B 1U6ZA 4QCLA 1LXNA 2O01C 4W92B 1EH6A 2MB0B 5BR8J 3VHQA 4B9UA 2N7YA 4FNHA 1X4HA 1A1GA 4LT6A 5HROB 1URNA 2VG6B 1XIQA 3K5PA 3KLHB 4K0KJ 4Y2MA 3CCZA 3H42A 2DSYA 4PG8A 1P1TA 3HHLA 2CPNA 1QSLA 1FRLA 3IWXA 3CO9A 3EZUA 4Q45A 2BRLA 1GK8A 2DNKA 3DU5A 4LFAF 1YRTA 2R4FA 4G1IA 2CKWA 1NH8A 1TUVA 3GYNA 2MLYA 4X4OA 2EEYA 1SUQA 3C6KA 3UVJA 1RSCA 2HHQA 2GA7A 2XQCA 4DR2J 4N4RB 2Q6BA 4YEAA 2JY9A 2HVZA 4GKJE 1KOOA 1FFGB 5LT5A 2VJUA 5HSPA 2GC8A 1DRZA 2LJHA 3MMCA 4NLOA 2HIYA 3T1HF 2B4OA 3HVWA 4M5DA 3OPKA 1NB7A 1NO8A 1QTMA 4QJVA 6FDRA 1RWMB 3IGVA 4F6MA 1RHUB 1N5YB 3NOGA 5C2GA 3VAFA 1KLMB 4PG7A 1IKYA 2O5DA 4L75A 1RI7A 2EM7A 2BOPA 1G2FC 2E1MC 1X0PA 1TV6B 4P78A 1NZAA 2DGWA 5B0FA 5CA5A 1TF6A 2M0GB 4J37A 4KIAA 1R31A 1RWKB 2ZITA 3BEGB 4NLYA 3M8SA 2E1AA 2DGXA 1XERA 5J2NA 3HQ1A 5CCLA 3HSJA 4KGVB 2HW3A 3DC2A 3H40A 2BM1A 5FJ4A 5M2RA 3L7OA 1IN0A 4CO4A 2X1FA 5BJRA 3TUIC 5TSEA 3ZZUA 3HVRA 1UEVA 1JLFB 2VL1A 3M8QA 4RBUA 4TLQA 2GVDB 3W7BA 1PSDA 1S1TB 4FF1A 2XM3A 3WHIA 8AT1B 4KC5A 3MWBA 3UD4P 2DHAA 2LTSA 4B3OA 1XN9A 3KHHA 1B7YB 2IM2A 4DL6A 4OZ2A 2H5EA 4DUYF 2VG7A 3F0NA 3Q83A 1D3WA 3V6JA 2E44A 3TVKA 1UN6B 1N0VC 2E7VA 3EPLA 3DRYA 4F04B 4Q0BB 4Z7YA 2IMOA 4QIEA 3MD3A 3P3DA 4DKKA 2AZ1A 1B69A 4FVMA 3HPSA 3EZ5A 1QVGR 1VQ5S 2KKHA 2VHGA 4OI1A 3DOMB 1UA1A 3R6GB 3ET6A 3ZZOA 4JYAE 4N41A 2MKSA 2YTEA 2L2MA 2EN4A 5I3UA 2FZGB 5A8WA 4JI6J 4ES2A 2YSPA 4GKKE 3M7VA 3VF0B 3EUNA 2ZZNA 1IQTA 2IAJB 1W25A 3CXCR 3MXHP 2JEIA 2P9CA 2AV5A 2H1YA 4UUXA 1RT2B 4YY3E 2OIHA 2O67A 2J6SA 4TY8A 4A8SA 4K5RA 1S59A 1I5OB 1RT4B 2OELA 4OZNA 1HNXE 3M32A 4BHBA 2DNYA 2YNFB 2VICA 3MR6A 4B02A 3CCQS 4ID5B 3GE9A 1UA0A 4ENOA 2RB7A 3PKMA 2EPNA 3LALA 3D54A 2B7CB 1S10A 2OUGA 3FSIA 4ZA1A 1U09A 1XNRJ 3R7NB 1LWEB 3JSMB 3NS5A 4H4OA 3H2VE 4N7TA 1VRTB 3AD7C 4ETZA 3N5BA 1QE1A 3H8YA 2LMZA 3J7Z5 3RBDA 1U2CA 5I3QA 5ETLA 1U0SA 1UWBB 3C4BA 2CIMA 3LP1B 2KO1A 4ZPBA 1SV5A 2B9WA 3AQPA 1V6HA 4DJBA 2XWYA 3ADJA 1T4NA 3M2VA 4A8FA 1RT7B 4X9JA 4RR5A 3MI7X 4DPYA 2J0QD 2UXCE 5KFPA 2XMUA 1FK9A 1YITS 1BGXT 2B4UA 4J9MA 1U6FA 4WTYA 2IJNA 3LOUA 1S12A 1AZSA 1AUDA 3C4TA 1GXUA 1HR0E 3TA0A 3B4MA 1URRA 4DPUA 3PR5B 3BB5A 1TQLA 4ECTA 4QWBA 2HVIA 4JV0A 4UOFA 1WOSA 1X6EA 1XEZA 2EOQA 1WOOA 1UEUA 3V81B 2KH9A 1NZ8A 2R8HA 2YNHB 1U1KA 2AJ0A 3H09A 4MKBA 4OIXA 5A2QU 2EFOA 3VAMA 4LRFA 1VQ9S 1B99A 5D0RA 3MMJA 3VZHA 5L1IA 1X47A 2V9WA 1UFLA 2DRBA 4E0DA 3CDEA 1A9NB 2BDPA 5E33A 4A48A 4LF4J 5LJ5Y 2VFVA 1U1OA 2KONA 5KL5A 5HVFA 3IS9A 4GKKF 1PC5A 1KTVA 1FKPB 3KJFB 4KJIA 3OL6A 3PJ9A 4KB7A 2V63A 2OHDA 3PEHA 4JI1F 1VQYA 4DI6A 4XPEA 1T95A 2ALYB 1ZPWX 3QZ8A 1RTZA 2EVZA 4GVBA 2KRBA 2YKNA 3UI3A 2ZJRQ 3BGRB 5F8MA 1CEZA 2EMLA 1FJGE 1WG5A 1T94A 4JI2J 4RUBA 4J7CA 5M2PA 5B0AA 2UUBJ 3IA0A 2SXLA 1SH3A 2EM4A 1NPKA 2HQCA 4JI8F 3MM9A 4DOZA 4ED4A 1SKUB 4TUIA 3E51A 2YTOA 3MM5B 3ENQA 1YYWA 5JJBA 4C8NA 3P49B 2JC1A 3OHAA 4DR3E 1QVFR 3AHPA 3R5BA 2KJVA 2WB1D 4LRAA 3ONQA 3H5XA 2CPZA 3VWSA 4P75A 5F8LA 3H59A 2GJIA 1QD1A 1HNIB 2B5JA 3N6MA 5T14A 5AXNA 5CYMB 1RXOB 2LXIA 2RQLA 2VIHA 3HHEA 4YR2A 4ZVEA 2ZH7A 2HQ3A 1C4CA 4BS9A 2OTLS 5KG1A 2O3DA 3S7RA 3SV4A 1WHNA 2DO0A 2UXCF 1LEOA 1Q4RA 1MEYC 4CH1A 1NJXA 3W8GA 2HGNA 5E3AA 1R89A 5C42B 4K4ZA 5F8GA 3F41A 3NWRA 1TL1A 4PKDB 2W2PP 4F8RA 1SVDA 2GMHA 2AZ3A 3PHEA 4B3RJ 4P72A 1RZMA 5G0RA 4O0IA 3MAAB 1GX6A 3B4DA 1RAFB 3AODA 1X7VA 3QIPA 3UN2A 1N36E 4Q8FA 1N88A 4HHJA 3PYEA 2XZWA 2GJ2A 4Q28A 2NYIA 4ZPTR 4F25A 3LGMA 3NGRA 2EMKA 1YZ6A 2D3O1 2HC5A 3GB0A 3SCJE 5KFBA 1NSKL 1RBOB 2HNYA 3PRDA 4DR4F 1JLQA 2MSTA 1VQOS 1WEYA 2E7XA 2Y0BB 3CF5Q 4CDIA 3NS6A 5EWGA 4OJHA 3CDWA 1FDBA 1NMEB 3IO1A 3DRXA 2YNGA 3MM8B 3IRXB 3MEDB 4CYUB 3CJSA 3Q8VA 1J26A 2A2CA 1FNXH 2YRMA 2QV6A 3RR7A 2ADBA 2ZH6A 4LFAJ 1YPNA 3JQMA 3GYXB 2GVZB 3VYYA 5DLFA 3MOZA 4ZITA 2LEBA 4PAAA 3TQMA 2B6AA 2ZBCA 4C8MA 5K8OA 3V6KA 3BKUA 4LSZB 3JTZA 1FDNA 1KVKA 2MPUA 1U1PA 1H98A 2LA6A 4OHZA 3MEEA 1RGVA 5D4PA 4J9PA 2EK6A 2OO4A 4PEOA 3GSDA 2PEHA 3T1HJ 4NEYA 1VQPS 1REGX 1N0UA 5M2UA 1T7PA 4DV4E 2RH3A 2G0JA 3TA2A 1U2FA 1X5SA 2F4VE 3R97A 2KTQA 3ZZ0A 2EPKX 2BJ3A 3KK2A 3KKFA 4DR3F 1TK5A 3A8IA 2E1CA 4OMFG 2PA8D 4GC7A 5FIIA 1GNKA 2LTRA 2ZE2A 4RNOA 4OX7A 3NGSA 1G4CA 3DKDA 5DETA 2DNGA 4DLGA 4DL5A 2GAGC 1U26A 3I31A 1FXRA 3D7SB 4DQQA 3K8WA 3QFHA 3GFHA 2HK3A 1Q1KA 1C4AA 1LW2B 1S1WA 4FXDA 2BZ2A 4M5GA 1XMBA 4MH8A 2M5YA 3OL8A 4DV3E 4WFTA 1RQ0A 3UCZP 2BB8A 2IY5B 2UXDE 4JB8B 4F4ZA 3O44A 2R7XA 4DQIA 3NXZA 2QMWA 2RJZA 2UV8A 5T7LB 3BBGA 1KN6A 1E6YB 1TELA 1U49A 4WK3A 4QU7A 2H9ZA 3PKYA 1YJNS 3MEGB 4WIIA 5B0CA 1OPIA 2V0NA 4WE1B 1EJ7L 1KHVA 4OHWA 1OY8A 1VISA 3FFIA 1PCAA 1VC0A 5F0WA 5U47A 5HVGA 3RJMB 1PJQA 1VQ6S 1MN7A 3LPEA 2GLIA 1VHFA 1ZZFA 4OYZA 2MKYA 1WWHA 3F6HA 2HNZB 1J5EF 3MPVA 4DUYJ 3HT3A 1N36F 2D41A 5D4OA 2FLLA 1DQ8A 2QFIA 2DXEA 2RSQA 2FC9A 2MKIA 2DHSA 4BC7A 1V3RA 2EBEA 1UETA 1UMJA 1RK8A 2Y9HA 5EX3A 1X6FA 2GQCA 3BGUA 4O3SA 3N28A 3FCWA 2IBKA 4DX5A 3POTA 5E2QA 4O3RA 5IT9U 4R5PA 3W60A 1QAXA 1HWKA 4IO9Q 1H72C 2Z58B 2ZM6E 3U7JA 4C8KA 2Y3YA 4X8WA 5D0GA 1M5HA 3GQCA 3W2VB 3E01A 5CYQB 5THWA 1MMNA 4ELTA 2RSMA 4FVCA 4N5SA 2MKKA 1K9MT 1CJTB 3Q86A 2JR1A 4OYBA 2VG5A 1IKXB 3IWCA 4ZHRB 1T05B 3RBEA 2YWQA 5KFOA 2OPPA 4ID8A 2EMYA 1RACB 2HS3A 4HDGA 4QWAA 4P52A 4X4QA 3D28A 3R5AA 1ACMB 4QYZJ 2RS8A 5CFFE 2MZQA 5KT6A 2BQ3A 2HS4A 3W66A 4MK8A 4FBTA 4V1Ak 1G3OA 2LCEA 4DV4F 4CLFA 2EOEA 2MHNA 4QWEA 4X2BA 2V86A 3M30A 4NRTA 4KHPE 2BMBA 1A1LA 2EW9A 5B7WA 1DAXA 1RTIA 3FEZA 4NMLA 2V8GA 4J91A 2DNLA 4Y28C 1IBME 1YJRA 2V2QA 1U4BA 2W4PA 3C2PA 1T9YA 2YKMB 2QN6B 3WX4A 4X65E 3R2DJ 2J9CA 4V19J 2AGPA 4ED3A 2PMHA 1N5VA 3ICLA 2L8TA 2ELZA 4HI1A 4NWBA 5F3WA 1XMOE 1U1RA 1F5BA 4CTAB 5J2QB 3CULA 2HHPA 1OPZA 2UXDF 4FYVB 1RWWB 1WC0A 2MHEA 4EBDA 2R2SA 4PWWA 2D1CA 1XR6A 3A3PB 4WFZA 3FVYA 2CNOB 3UK3C 2Z2LA 1S6QA 2XBPA 3DLEB 3CD0A 3JAMU 4DR7E 3WIVA 1XNQE 1TVRA 2ROGA 3J80Y 1ZA1B 2RUSA 2RF2B 2R8GA 3SFUA 4DFPA 1S1VA 4IG0B 4JI0E 1MU2A 2EFVA 4CO2A 3QJJA 1SPBP 1UZHA 5FLXY 2D69A 1S0NA 2ASYA 4DUZE 4HEIA 5ITHA 2E5LF 2ZBPA 2EPZA 4O3QA 4A8YA 4CLKA 3EPJA 1JLAA 4FK5C 2XWXA 4B9MA 1RJJA 1YI2S 5HMZA 3NS7B 3LLHA 2EN1A 1V5VA 2F5GA 2JC0A 4R2DA 7FDRA 3ZNJ1 5L1JA 4WWSA 4I2PA 3CD5A 5F8JA 1RT6A 2WK4A 3DYAA 3O3LA 1TKZA 2HWTA 4GKKJ 3OFFA 2L2KB 1NJYA 1VBKA 1KNZA 3AD9C 2I0XA 2BE7D 4JI1J 2G13A 3WBZA 4BHCA 2ZBQA 3OJUA 1C1BA 1Z2LA 1WELA 2XMTA 3DMJA 2DNQA 4KTQA 4WPYA 1F2HA 1X31C 2W1BA 1Q0NA 3HT0A 3OMLA 1S7HA 4PPDA 4F54A 2AHOB 2P8IA 5LXRA 5J1PA 1YBTA 5KL2A 1N48A 3CJ5A 4JI8J 1SUQB 1SC4B 2WW4A 1Q7YT 1FKOA 3TRGA 3U1MA 1Q53A 5D4LA 4KHPF 1AT1B 3M8RA 3KZZA 4NHRA 4EYHB 4K4VA 3TZXA 1UJ5A 3KFWX 5LOQA 1YHQS 5HMYA 2AEFA 3D3CJ 2E9RX 3MMCB 4A8QA 2QL5B 4USWA 9ATCB 2EPRA 3K8VA 3CCTA 1RHMB 2HHTA 2K1RA 1WEZA 5CCMA 4CT9A 4X65F 3TNVA 5A6KA 2M4IA 1RKIA 3QO9A 3AA9A 2VC1A 2NUEA 1QLNA 3DLLQ 5A6AA 2FJVA 2ZHBA 3W9IA 3Q89A 5JVHQ 2A6MA 5EN1A 1QUVA 4C8LA 1MWYA 5HBMB 3HKWA 1QTNB 3CJQA 2UXCJ 3PCOB 1M5OC 3K5NA 2E9TA 1NHUA 1TKXB 7FD1A 1GMUA 2DLKA 3CO0P 2G0IA 3T1YE 4RUCA 3FDSA 1YIJS 2WZOA 2UU9E 4CNYA 4AL5A 2ZHAA 2LEPA 4DR7F 3PJWA 2KT3A 3AD8C 1MW7A 1XNQF 4DLEA 4DV0E 4O44A 4QPXA 1NJIT 1ITPA 4USHA 4HACB 4FYYB 2LXUA 4YB7A 3V6HA 1F5AA 4O0NA 4DX8H 2ZVIA 1FRMA 4M5MA 5ETQA 4NA1A 3LF0A 2MZ1A 4DFKA 5KG6A 4KPYA 4JI0F 4DV7E 1QSSA 3M8QB 3SZ2A 3FGVA 3LUYA 3ZZRA 4B3SE 2KVQE 4DR4J 3TJ9A 3K5OA 1JB0C 4WU3A 5KTQA 2DHHA 4N8NA 3AQOA 4K4XA 1X8DA 2WB4A 4X84A 1Q8KA 2B9DA 2B9XA 2MXYA 4QPTA 3HFKA 3RAXA 2IJRA 4IJDA 1RWOB 2KDOA 3NGTA 1T38A 4QIVA 3RB4A 2VG7B 3U02A 3GMGA 3D66A 4CWBA 3BN7A 1W2IA 4TKTA 3LANA 4ZIVA 5HL7Q 1H7XA 1YVFA 3P5TL 3GFZA 4RW6B 3KUHA 3KZYA 2F63A 2FJWA 1K44A 2XMJA 2C1EB 2DGQA 2LE2A 2VASA 4YN3B 3J81Y 3IG1A 4R2CA 4YHHF 4U7UD 4LIWA 4ER8A 3KK1A 3CJRA 2DCUB 2GHVC 4DSIA 5FD1A 5A8WB 2N3GA 4FS1A 2BV3A 5DM6Q 3PY8A 3ISNC 4UUWA 3DLKB 3UR3C 4I6YA 3CW2C 2CQPA 2F8EX 1OIAA 3W5ZA 4B3TE 3VGUA 2W01A 2CA9A 2N8XA 1FDAA 2QYCA 4KGKA 2VQFJ 4KBIA 4DPWA 4P7VA 2LQ9A 3OR2A 2HWHA 2BQUA 1UVJA 1WHYA 4IFVA 2XS2A 3QBCA 5E7OB 2RS2A 2Q6CA 4DR3J 2FVQA 1P9QC 3M32B 5F41A 2XY5A 4M94A 5A8KA 1S49A 2GCFA 2AJFE 1EKSA 2ZH8A 2MQPA 2YTFA 4P2XA 2G7HA 3IMQJ 1BB8A 3IWDA 2B9EA 4GRSA 2LKZA 1SKSA 2UUAE 4EMDA 1FRHA 4DL2A 3X3UA 3TX0A 2MLZA 4G1QA 2M88A 1HNZE 2KXHA 2LEAA 2FLNA 1MWQA 3SBMA 2JX2A
chains in the Genus database with same CATH topology
4FF4A 3HXMA 4JI7E 4ED6A 3DDNA 1S6PB 4X4RA 2C42A 5C5JA 2FJAB 1U1NA 1K1QA 4DWIA 1CC8A 3ITHA 3KK1B 2CJQA 3TUZC 3PIOQ 4WFNQ 4H4OB 1BQMA 2DT9A 5HMWA 1CQMA 3NBPB 1X9MA 4ECWA 2XNRA 3I6PA 1F5CA 3FQKA 3OJSA 2DB1A 2XO7A 2J0WA 2PIIA 2JWNA 2XC9A 4X64E 4DR4E 1V3SA 2BM0A 1D8ZA 4FYDA 1IBLF 2NUHA 3D5MA 5KG7A 2CQ1A 2KHDA 2W25A 5KFXA 1QAJA 4UQTA 2F4VF 3RTVA 5HROA 1GX5A 3ZZPA 4LF8F 1UHZA 2VG6A 1RT5A 4RZRA 2QSFA 3HK2A 2PD1A 4XO0A 2FLPA 4QR1A 3T1YF 1B7FA 3PVXA 3DRRB 4G6VB 3GV5B 1R43A 3AH6A 1ZBTA 2PE8A 4AUKA 3H5YA 2UU9F 3C8YA 3ZZTA 2XMWA 3RB0A 4P2SA 4C2MA 2QFJA 4L5NC 1R6YA 3OTDA 5ADZA 1MNEA 2MZTA 2WHOA 4MIAA 3OR2B 2ASJA 3KLEB 1Y5LB 3BGFA 4DV0F 5J2MA 1RISA 4XIUA 1S1UA 2RQKA 4PQAA 2BYCA 2EFPA 4WK1A 2XMVA 4RNNA 4IFVB 1NEEA 4B9LA 1QUPA 2OH2A 4TY9A 1MROB 5DNYA 3MTJA 1VRUA 4B9SA 1DARA 2DNOA 3GG0A 2AX1A 2QIFA 4ECRA 2M7QA 3OUYA 2PC6A 3NGDA 2HHHE 5FDLA 3MPWA 4NLWA 2AYBA 2W9AA 3Q8RB 4EZ6A 3OLAA 3CE8A 5AXMA 3JB9k 2V87A 1YJ9S 3CEDA 4XPCA 3U1NA 1FDDA 2IVYA 3LAMA 5A8KB 2N3LA 5HP1B 3JSBA 4HTJA 2LECA 4ELUA 4YB5A 1V3ZA 1OSCA 4C0BA 1NNDA 1H3DA 1X9WA 4B3RF 4H4MA 3CMES 2FHJD 2KYXA 3DNCA 4OZJA 1N32F 4NLTA 2CPDA 1IJEB 2CRLA 4YUDA 2BANA 4DV3F 5LSOA 4NLRA 4EWTA 4JI4E 2VBYA 2VOPA 5B0EA 1KHWA 2CVIA 3VAKA 4MKAA 4WZQA 2CQGA 2VOOA 2B9YA 4KKOB 3Q2TC 2GMJA 4IOBA 1TFWA 2MYFA 1BWEA 4DUYE 4Y2AA 4WFXA 1X4CA 3BSCA 4G1QB 1HW9A 1VOMA 5K8NA 2OD6A 4OI2A 2XULA 4Z2XA 1VK3A 1TR0A 2B0GA 3NL0A 2POKA 2WOMB 4N76A 3OTEA 5IT0A 3AUZA 1DZ5A 4AL6A 5IM0A 4LIRA 2F8MA 2X51A 3OXGA 4TYBA 4ECXA 1X5TA 4CO0A 2V83A 3CJ2A 1VC6A 1K1SA 3PZPA 1I94E 5D4NA 1N5TA 2RKIA 4HI2A 2GQ2A 3R3TA 2DH7A 2F40A 3ITHB 2FHKA 1P27B 2DJWA 1U6ZA 3UDLA 4QCLA 1LXNA 3QJLA 4ZVHA 2O01C 5IWAE 4DV2F 4ZPCA 5D8HB 4W92B 1N5YA 1GQEA 5GAHU 2MB0B 4B9UA 3OL7A 2CQCA 2L41A 1KLMA 2N7YA 4FNHA 1X4HA 3UE2A 2D9OA 2LQJA 4LQ3A 4LT6A 2HLTA 4P7DA 5HROB 1RC7A 2CQ3A 2VG6B 2VPZB 3K5PA 3KLHB 4DV5F 3BM7A 1URNA 2VQFE 4Y2MA 2GNKA 4CH0S 3UD3P 3CCZA 3TX8A 4PG8A 1P1TA 2DSYA 3HHLA 5KFIA 2JOXA 1IQZA 2IHR1 4IO1A 1CPZA 2HWIA 2CPNA 1QSLA 5LL6d 1FRLA 4A8MP 1TV6A 3IWXA 3CO9A 3EZUA 3H25A 1KFDA 2BVZA 1T02A 3M05A 2UP1A 3BREA 4MK9A 4Q45A 4JI5E 1LFPA 2BRLA 2CPFA 3N79A 4C97A 1VGYA 1S1UB 4ETXA 2DNKA 3DN9A 3QWPA 2RUGA 3CCES 1FRKA 3DU5A 3NMRA 4LFAF 1X4DA 2L6MA 1QM9A 1YRTA 2R4FA 3C6UB 4G1IA 4LSLB 3MPYA 2CKWA 1NH8A 2CPYA 1UVMA 5KG4A 3OUYB 3ADGA 1TUVA 5FDLB 3GYNA 3KJVB 1X4AA 4URGA 4C8YA 4ES3A 1FKAF 3BSAA 1DTTA 5E0OA 4X4OA 2XLKA 1SUQA 2NSBA 4D3GA 1L3UA 2HHQA 2GA7A 2MJUA 3PX0A 3CWJA 1P6TA 1HMVA 2Q6BA 3GILA 1NK7A 2B7TA 1X4BA 2K7JA 4B3TF 4DR5F 2BANB 4IDKA 3T19A 4NLDA 1RTDB 4A8XA 5KOXA 3FSYA 4NYZA 1RTJA 4YEAA 1FERA 2JY9A 4DHVA 2HVZA 4GKJE 1KOOA 2NPIA 3WC0A 2AJ4A 3K59A 5LT5A 3PFOA 2B3TB 4LF6E 3WDOA 3TAMA 5EDWA 4YP3A 3JU0A 1M0SA 2ZM6F 1O0WA 3W2WA 1DHMA 1BQNA 1JLFA 4IRDA 2GC8A 1DRZA 2LJHA 4PG5A 4JV5E 3KTQA 3MMCA 3MD1A 1JLGA 1RT3A 2CQDA 4NLOA 5KT4A 3G4SS 2KHXA 2YKNB 1SH0A 4ZS6A 5IM0B 3T1HF 2W4DA 4KAIA 1SC6A 1Q8IA 2B4OA 3MAHA 2RRAA 1Q81T 5KFDA 1NU4A 3HVWA 4MJKA 2VE7C 2RKIB 1C0UA 2BE2A 3T6JA 4QW8A 3G9CA 1KLNA 3CIMA 4M5DA 3ZZYA 1Q79A 3OPKA 1DI2A 1NB7A 1NO8A 1QTMA 4QJVA 6FDRA 1Q82T 1HWUA 4IG3B 2CQ0A 1XC9A 1S6UA 3D1OA 3IGVA 3V4MA 2EWLA 4LF7E 1O8BA 1N5YB 2DNMA 2B56A 1FEEA 3PR4A 4B08A 4PXBA 3NAIA 3VAFA 1KLMB 1JJHA 4A8OA 1LV5A 4PG7A 3G96A 3C6TB 4WU2A 1IKYA 2O5DA 4C0HA 2ZKTA 3GWCA 3OFHA 4QQBA 1RI7A 3GFXA 2N82B 1YYKA 3HHLB 2CJKA 3BQ1A 2R2RA 2BOPA 5CH7B 2XMKA 4TQRA 3L3CA 2E1MC 1X0PA 1TV6B 2CQHA 5C24A 4P78A 1HNZF 1ZOTA 3J7AG 1NZAA 2DGWA 2V94A 2HG4A 5B0FA 5CA5A 5K14A 5IXUA 2M0GB 2FDNA 4J37A 4KIAA 1IKVA 1R31A 2FHOB 1ZM3A 5E3QA 1J5EE 2ZITA 3BEGB 1ZH5A 4Q0BA 3FQLA 5B0GA 4NLYA 4JV2A 3RRKA 3OVSA 3CDUA 2KM8B 3M8SA 2YWFA 3CCWA 2XY7A 3HO1A 3T5LA 2E1AA 2DTJA 2PO4A 2ZOGA 2VQEE 2DGXA 4N56A 3FEYB 3FCHA 3O8WA 2K8GA 1XERA 4FXVA 2W8KA 4X64F 5J2NA 2VA2A 1KVIA 2WW8A 3HQ1A 2YVSA 5CCLA 4ZMMA 1XMQE 3C66A 3DI6A 2HW3A 3DC2A 3H40A 1HMVB 4B3MF 1Z4UA 2J9EA 2IA6A 2J0XA 3CD6S 2EC0A 3H2LA 4E8UA 2R7WA 4IDKB 4ED7A