1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
b'HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide chain release factor 1
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
3J7Yp 1XMOE 2NUGA 2RS7A 2UUAE 2RTXA 4DV7E 3OTOE 3T1YE 1T4LB 2B7VA 2LTRA 1XNQE 2E5LE 4DV5E 2F4VE 4LF5E 4M2ZA 4JI3E 4LF8E 1UHZA 4DUYE 4GKJE 4DR1E 2RSMA 2LUQA 2NA2A 4B3TE 4OOGC 4DR3E 2UUCE 4LFAE 4X8WA 1N33E 4X65E 2L2NA 4DV4E 4X64E 1YZ9A 4KHPE 2IHR1 5BR8E 1IBKE 4M30A 1FKAE 1HNZE 4X62E 2LUPB 4WFTA 2UXBE 2DIXA 1O0WA 4B3SE 4LFCE 2B3TB 2VQFE 2B7TA 3VYXA 4B3ME 1QU6A 1J26A 3VYYA 1XMQE 1HNWE 1T4OA 4DV2E 2L3CA 1UILA 2UXDE 3ADLA 3P1XA 4LFBE 4GKKE 4JI2E 1X48A 4NXNE 4DV1E 1RQ0A 3LLHA 1J5EE 1HNXE 5CFFE 2VQEE 2LTSA 1ZBTA 4NXME 1EKZA 1X49A 1DI2A 1YYOA 1IBME 4YHHE 2RS6A 2CPNA 4DUZE 1N32E 4K0KE 4B3RE 3ADIA 2NUEA 2ZM6E 4JI7E 4X66E 4YY3E 2MDRA 1STUA 2UU9E 2DB2A 1N36E 2L2KB 4JYAE 1I94E 2LRSA 2NUFA 5LMNE 4JV5E 2KHXA 1WHNA 3C4BA 4DR5E 1IBLE 1XNRE 5IWAE 2JY9A 4JI1E 3ADJA 4LF6E 4DR2E 2N3GA 2DMYA 2LBSB 1RC7A 4JI0E 4JI5E 3C4TA 2L3JA 1YYWA 4DR4E 1FJGE 2L33A 4DKKA 4LF4E 2JVAA 1N34E 4LF9E 1PKPA 4OX9E 3HTXA 2UXCE 3ADGA 4LF7E 2UUBE 4JI6E 2HHHE 4JI8E 2LJHA 4JI4E 2YT4A 1X47A 4DV3E 2L2MA 1T4NA 1GQEA 3T1HE 4DV6E 4AQYE 2N3HA 4DR6E 1WHQA 4WYQB 5LMUE 4DV0E 4DR7E 1HR0E 1YYKA 2EZ6A
chains in the Genus database with same CATH superfamily
3OJSA 3OT9A 1T9VA 3BJYA 3Q0AA 1WUUA 2CJYB 2LFVA 4CWBA 3T3FA 4ID5B 4HEIA 1JNZB 4DHVA 5JJBA 3NGDA 2DNMA 2HBYB 5AXLA 2WVDA 1CULA 2MQNA 1SKRA 2IA0A 4DZDA 3DCAA 3VCDA 5KL4A 1QAJA 3GR0A 2D7SA 1RLCL 3MPWA 2YTEA 3P1XA 1NJIT 2LQ5A 2HWTA 4OI1A 5AASA 4G6VB 4DS5A 2OP5A 4DR3J 3BGLA 2DHHA 2ILYA 3GCWP 4C8LA 4K0KE 2VA2A 2G1DA 1MN9A 3JXOA 5I4MA 1UWBA 2EMKA 2EK6A 2DY9A 2ZD1A 4DV1J 3CCTA 1KQSR 4OFZA 2PEHA 1JLQB 1PKUA 2M7SA 3WHIA 4DMZA 4ZN1A 2H36X 4UQGA 3SFUA 2FJBB 2YWGA 4CZCA 4UF4A 5G0RA 4DR6J 1NLKL 2G0CA 4M5GA 5HSPA 1HBNB 2VIHA 3KUHA 5FLXU 5D15A 4ID5A 2VH7A 2V94A 2HHWA 2XI3A 5HLFB 3MCSA 3H2UB 3QFWA 2IM3A 3WC0A 2V67A 2LDIA 2JC0A 2XYGB 4NRUA 1URNA 2RAQA 3KG4A 2VA3A 2VPXB 1V3ZA 1RAJA 1Q16B 4TLQA 2L41A 2HYIB 3HVTB 2W7AA 5AE3A 2NSBA 3CMAS 3GYNA 1T39A 1Q0NA 3K8WA 3P49B 5KFUA 1M5PC 3IMQJ 2JX2A 3KUGA 3FSXA 2NUFA 2DNZA 2CJAA 4O4KA 4LF7F 2X3GA 2F5GA 3GV7B 2EOOA 4LF2A 1H7XA 1X4EA 1UJ4A 4KPCA 1RZMA 3I87A 3C4TA 4AQYF 4WFYA 1NK0A 1JLQA 2XYHB 4KGVB 2WTFA 3RJMB 5M2RA 4F4ZA 4I7FB 3PVXA 4B9SA 2F8MA 2DNRA 5L1KA 4CO3A 1QDUB 4CLYA 3ET6B 5D4LA 4USUA 3U1NA 4RW9B 5RUBA 3VVUA 4BC9A 1HBNA 1WG1A 2BYCA 2AYEA 1FXLA 3BV8A 1FI4A 3ILIA 1RAGB 2ZC4A 1S6OA 5HLFA 3SMZA 3NBPB 2CPXA 3U27A 4DR7J 2CWXA 1HBMA 5F3TA 2DH8A 2ALZA 5KFKA 2DNKA 5ADZA 2WVEA 2R7QA 4F0KA 1CJVB 3PM9A 2GMHA 3HVTA 5D0RA 3OR1B 6FDRA 1KLMB 4WXCA 5ETNA 3KMSA 4ECYA 3NNAA 1P1LA 1SKSA 2WCXA 1GMVA 1VIOA 2QA4S 3FZBA 2JVOA 4F8RA 2KJWA 4WYWA 4I7FA 4DU8A 2Z2YB 2E7WA 2FVQA 5KFYA 1QUPA 4J9NA 4DX8H 4G3IA 4PABA 4P73A 2LE2A 1S79A 1UEVA 4CIOA 3ET6A 4OHXA 4N8OA 4X4PA 2HLUA 1REVB 2DNHA 4HTGA 4Q43A 3RUBL 1Q81T 2UUAE 2W2MP 1MROA 4YMEA 2EPRA 3QT6A 2F4VE 2MJUA 4M5IA 4NZVA 2XS7A 4CYUB 4RNNA 1MMLA 5HJYA 1X6FA 3EM1A 3JSBA 3O6QA 1FFWB 1R43A 1ZAVA 4WXOA 2E1MA 2DNPA 4IRKA 1VI7A 4B3MJ 3MAAB 4PG6A 1Q82T 3JTNA 3LAKA 1CJVA 1N36F 3C6TB 3OR1A 5KFZA 1MG7A 1KLMA 4Y65A 2XS5A 3NCQA 2YWEA 2DMIA 5DZ7A 4U95A 5E5NA 2KN4A 1JQGA 1U6ZA 2I8EA 1S1UB 4TN2A 5HANA 3ZTSA 4DI6A 4O23A 4OL8A 2CNNB 2EFPA 3DLBA 2H3EB 4IH6A 4BCAA 4DV5F 4NZ0A 1REVA 1XC9A 2AEMA 2HGNA 4U67Q 3CCUS 2W2NP 1TUVA 2Q1LA 3BIDA 3H5YA 2GNKA 1HW9A 1CVJA 4CYUA 3W61A 1REGX 3HHKA 2MZQA 4DXLA 4WFBQ 3F0NA 3AH6A 3S1TA 2RRAA 1ZOTA 2HURA 3KLHB 3QIPB 2BRKA 3GJTB 3SFGA 2A6MA 2B7TA 3D2WA 4DUZF 2C3UA 3B8HA 3GPAA 3MAAA 4RW8B 1NKEA 1T4OA 3VYYA 2OHDA 2YSOA 3N01A 1XN9A 1H7WA 2UU9F 3NL0A 5F8GA 4YUDA 4USHA 3C6TA 3OL7A 2Z30B 4KR0B 1AA1B 3W2WB 2MLXA 4IG0B 4X66J 3FBCA 1LWXA 2W7PA 3LTOA 4LSLB 3R5AA 4N5SA 3NRBA 4C2MA 3IS9B 1U0HB 1HHTP 1S1UA 2PRTA 1XNRJ 3JAMY 4DU7A 1FXDA 4LF4E 2JVAA 1S0VA 4OX9E 3SEOA 4KGMA 1RU2A 4P9SA 4KTQA 2D41A 5IT9C 1F9EB 4ZMMA 3AD7C 2UUCF 4F02A 5C42B 3ZZTA 5THWA 1S0OA 1VRQC 1VOMA 4KGZB 2YKNB 4NEZA 3THPA 4ZVUB 4RNFA 3EWGA 3GJQB 4F04B 4X64E 2OSRA 2AJ2A 2PO4A 2D74B 4KHPJ 1YRTA 2OAUA 3KLHA 5AC5A 3QIPA 2NPIA 2RDDA 3DMJB 2J7WA 3OTOJ 2XZTB 4RW8A 1TQLA 2ROGA 2WOMB 2KXHA 5LJ3Y 3UPFA 3DOKB 3O44A 2OH2A 1QSYA 5F41A 1HHQA 1KFDA 3W2WA 3WIVA 4IG0A 4R25A 1CG2A 1RKJA 2LXFA 2VFTA 4LSLA 1DTTB 3IS9A 2YZTA 3T41A 4F4AA 1S6UA 1ZU1A 3BF2A 2G0IA 1CQMA 3LMLA 2BB8A 5F9NA 3SSSA 1FD2A 3GIIA 2OGUA 4ENOA 1BUXA 4P2MA 2DO4A 4Y2CA 4DL4A 4RNMA 2EZ6A 4DL0C 2WVBA 2EE8A 2Y0BB 4L5NC 3EPLA 5C42A 4Q8FA 2ROEA 1OQ6A 3V6DB 3IC1A 3OR2B 3G96A 2UXBF 1EETA 1AFJA 3KJFB 4IDKB 1HD0A 4LSZB 1NPRA 3MAQA 3H7HB 4DZ6A 4DV2F 2YTIA 1F1BB 1KOOA 3ENQA 3AJDA 4X65J 3IR5B 2CRLA 4NXMF 2ASYA 2V6AA 1T8EA 5L1JA 3DMJA 4B3SJ 4QWDA 2B4PA 2XMJA 2WOMA 1Y5IB 2M9KA 3DOKA 4YR2A 5FD1A 1UETA 4MYTA 4O4RA 3I5BA 3GIRA 1YYOA 2LEBA 2AMCB 3BSNA 3OHBA 4ED2A 4JI7E 3MZIA 1JXLA 5SZTA 2O5DA 1E6YB 4X9JA 1WHWA 1DTTA 3OXGA 2LYVA 3ZTOA 3LQVA 4WK3A 3TZYA 3ISZA 4HHHA 3UR3C 2B6AB 1U1OA 5IWAJ 3ISND 3RBEA 2MKCA 2LBSB 4MH8A 4USMA 5KFMA 1R89A 3PEHA 3KK1B 5A2QU 1FJGJ 1HNZF 1RWWB 2R7UA 2P9GA 3PHEA 4R0JA 4N7TA 2BQ3A 3CJRA 3VHTB 3UVJB 2VG6B 3MD1A 3CJ4A 4NX9A 1YGYA 2X1AA 2J8AA 3QT5A 1R7IA 3V6DA 3OR2A 2W2QP 3P96A 3LWMA 4J8ZA 3MXHP 4IDKA 2RILA 4ELTA 2ASLA 1OSDA 2IIHA 1KTVA 3T5KA 3UD3P 3K5OA 3Q8PB 2V8GA 3H2VE 2KZZA 5JVGQ 2V0NA 1LWEB 4XPCA 2FTXB 4K0KF 3FEYB 2NQPA 5C24B 4CLFA 4NA1A 4JI2E 2HHXA 3UDEA 2WAQD 4ZPWR 2H5JB 3FEZA 3LA0A 2CAJA 1H3DA 3C46A 2I5JB 2B43A 1IBKJ 1K9MT 1E6YA 1KOHA 2BXJA 2QLXA 3BO3A 1I94J 3DDKA 2B6AA 3AD8C 4L76A 3TZWA 5I42B 2EN1A 2D9PA 2MQQA 4Y3CA 2QL9B 2NR0A 2I1RA 4ZIVA 3HXMA 3KK1A 2YWHA 3HTXA 1S77D 3ADGA 1FEEA 4DDFA 4MKYA 4LF9J 2AJFE 4F2RA 1RWPB 3K58A 4X4UA 4DLEA 4BDPA 1WDDA 5CAAA 3TX8A 2VG6A 1VQLS 2EQ1A 5L38A 5M2PA 3R9LA 2WSEC 3BN4A 2MQOA 3OL9A 3IWDA 2RIJA 1HBUB 5EX3A 4X8WA 4EZ9A 1JLEB 4H4MB 1UVJA 1VBXA 1HLWA 1SXLA 2XLIA 2DITA 3FRZA 4NLXA 4G65A 1CEZA 1LWEA 1B0TA 3MECB 2QC3A 1G4CA 5C24A 1PC4A 1R0CB 3IBWA 2HVZA 1FEHA 1L4SA 3LGMA 3VWSA 1FDNA 2I5JA 1N32E 2MY7A 2QRRA 3PEJA 3V81B 5B08A 3PV8A 2LEPA 1X0PA 1QTNB 5I42A 1JNRB 2HC5A 1P6TA 1PJTA 2L33A 4PG5A 2G9OA 3IA0A 1O0PA 1TUGB 4OHZA 1JK2A 1NJYA 1WHQA 5A69A 3CB4A 1LW0B 1RWMB 3N0VA 3TEHB 2HK3A 2ZH4A 4QBUA 3TANA 2A2DA 3WIUA 3NLCA 2F40A 4CI0B 2RMLA 3SZ2A 1BBOA 2ABYA 3HP6A 4DJBA 1HBUA 2JOQA 4ED3A 1KS2A 3DLEB 4M94A 1JLEA 4H4MA 3P4UB 4USWA 3PIOQ 5BR8E 4ZPBA 2E7VA 2DPIA 5DQIA 2HPUA 2UV8A 4LUBA 3DGVA 3MECA 2OEJA 2K3KA 1RWUA 3F6HA 4BS2A 1R8HA 4KBIA 2E44A 3HKWA 4F2JC 5KL6A 3B4MA 2C3MA 3GFXA 1JXVA 3V81A 1NM2A 2R7XA 4FPRA 4LRBA 3RRGA 5KFNA 2BX6A 1HWIA 5E3AA 2YRKA 5ITHA 3TW0A 5LSLA 2EMXA 4ZP6A 2ZFHA 2ZH6A 1I51B 3KMQA 5GADI 2UUAF 1IWGA 1A1IA 4CQ1A 3JU0A 1F9HA 3D67A 1LW0A 5HJXA 1T02A 2XMKA 2YWFA 2VPZB 1H74A 4BWMA 3V5RA 2VZ9A 3CCLS 2V87A 2Y9HA 3C6UB 4LF7J 1FJ7A 4IYQA 2EKNA 3DLEA 2CQ4A 3I5CA 3LGNA 4AQYJ 1T0TV 4RH8A 1VBKA 3MTJA 1U45A 4E2FB 4KB7A 3KLFB 4AFFA 3DRRB 1IUJA 1FNXH 1QTMA 4L8NA 4OZJA 5DNYA 1UKUA 3PFEA 2JEJA 3J81Y 3J7AN 2Z58B 1N5SA 1WDTA 3CCZA 2PN6A 2FPHX 3AXMA 1B4SA 3U7JA 4OYZA 2IYIA 1NJXA 2HIQA 2HZVA 2ZM6E 2AWZA 1PG5B 1QLNA 2MDRA 3FMWA 3QGGA 2LRSA 2MQLA 4QIGA 2LQBA 3TQ1A 1IQOA 2IJRA 2OJ3A 3MMJA 3LH2S 2E5HA 1YJWS 1UAWA 1V3RA 4OYXA 2YH0A 3U1LA 3RB6A 2RSIA 1KLNA 3V6KA 1VQNS 3CDEA 2YY3A 2B9XA 4A46A 2ZOGA 3OUYA 2QLJB 4K4SA 3HVAA 1T05A 1TAUA 2HFSA 3J80Y 4C3KA 4UQTA 5GAEI 2R3VA 3NGKA 1NU4A 3C6UA 2HEKA 5ETLA 3TARA 1JJ2R 4K2XA 2QMUB 4B9MA 1TUWA 5L39A 5IS2A 3E2EA 3TP2A 3QZ7A 2HVIA 3GU0A 3KLFA 4ECSA 3DRRA 4ZCIA 4URGA 2ZOFA 4ZVPB 1VGYA 1RJJA 4OI4A 2R4FA 2W4PA 3CGIA 1HD1A 4QQBA 2Q8UA 3QJPA 1IBME 3J81j 3RB3A 3P6YC 2Q79A 4HL9A 4IKAA 4WK1A 1TFWA 1CQNA 4LBHA 4LF4F 1D1UA 4JV5E 3UN2A 2RQ4A 1WHNA 4CM2A 2J0XA 4IOBA 2L9WA 4WTYA 3WZ0A 1RUSA 3HSJA 2LMZA 3HX9A 4ECVA 4XIUA 4K4ZA 1Y5LB 1SB6A 3PJWA 2AYBA 2MKHA 2GMLA 5KG3A 2DHXA 2ZH2A 1LFWA 2M9AA 2IAJA 3EGVA 4NASA 5AE2A 3BSOA 4JV1A 4J9LA 1SJ3P 1RYSA 1GXTA 4EFAC 1D9DA 4MLQA 4DQQA 1KC8T 4UOCA 4DMIA 3CDUA 5JMNA 4C8YA 4NLSA 5F8LA 3W7BA 3QPIA 4WJBA 5DO2A 1RP5A 4A48A 1EZZB 3JS9A 2XY5A 3R6GB 4Y2KA 1PAEX 2B0GA 2AV5A 2MZTA 1IR0A 2CPNA 1SVDA 4N77A 2GVDB 4FYDA 2DJWA 1ZZFA 4V19J 3Q2TC 5FLXY 3O3LA 4KGKA 2BM0A 3GTYX 5EX0A 3PRDA 5SUHA 1G3OA 5J1PA 2KG0A 2R7TA 3BZQA 3H0PA 3T1HE 3ZFVA 5EWGA 2YTFA 5E3RA 2V2ZA 2EOEA 1GMWA 4R0EA 4IQMA 2ZHBA 5IFMA 4DUYE 9ATCB 4MIAA 3CCQS 2LUQA 5GAGI 3H98A 4ZA1A 5LSOA 5KFXA 2ZJRQ 1AYEA 1C0TB 3KTQA 1S9EA 3D66A 3DJWA 3RR8A 4RU9A 1VQMS 2EM5A 1F6TA 3KLIB 2JEFA 2VB6A 1J26A 1U4BA 1NB2A 3CMQA 4JI7F 2AD9A 3F41A 3UI3A 1L5UA 2FZCB 4CP5A 2UUCJ 1DZ5A 1GZ6A 1GX6A 1ELOA 2JSXA 2KZMA 1X4DA 4KHRA 3LWLA 2GVDA 5IT4A 3OMLA 1T9XA 4OV1A 2G1HA 4CT8A 2FJXA 1DFDA 4PYDA 3QQCD 4PPZA 2XWXA 3UR0A 3L95X 1Z1ZA 5KT3A 2J9DE 4DQPA 3KZZA 3A3OB 2DVIA 1N34J 4P7DA 1TVRB 1YJ7A 3ETMA 2VPWB 3MMBB 4DV6E 5B0CA 1HNIB 2IC3B 5DRKA 4FF3A 3PIPQ 3LP0B 2A2CA 3CCVS 2V83A 1HWLA 2WSFC 4HR2A 4TUGA 1A1LA 5B09A 2HQ3A 4WWSA 2Y8YA 2DISA 3HULA 2R7RA 5A6JA 2C28A 2EJ4A 2MZSA 1C0TA 4WFAQ 4JI2F 3AOBA 1D8YA 5KFFA 2BW7A 2AHOB 2KYXA 1NHKL 3GB0A 4J9UE 2CZ9A 2HZAA 1X6HA 3DOMB 1J5EJ 2Z2LA 1ZA1B 3M2UB 3W8GA 4DPYA 3LF0A 2HVEA 3ULHA 4Q8EA 3UDVA 2NLWA 3EVMA 4FP9A 2ZHAA 4YFUA 4P78A 3MR7A 2NZCA 2JRSA 3O2IA 1XK8A 4LIWA 1UVLA 3Q8QB 2EFVA 2CQIA 1TVRA 3SI8A 3MMBA 3T5HA 3PX4A 2BZ2A 5BYRA 4DX7A 1HNIA 1X5OA 2IC3A 1M90T 1IR2A 5K8NA 3G4SS 3FJ2A 3LP0A 4DL6A 3D6TB 2I13A 4EO8A 1HR0J 1N5VA 3RU0A 3OPKA 1AT1B 1XNQE 2L8TA 2EN8A 4ANCA 4ED0A 1URRA 2HBQB 3FUYA 3AA9A 4H4OB 1U1QA 4A8MP 2FGOA 3NOGA 2XMMA 1U7LA 4Q44A 4Q5VA 1HNZJ 1NSQA 3NG8A 5CYMB 1N32F 3DOMA 3KK3B 4LQ9A 2ODRC 1S6PB 2XO7A 1FD8A 3MFHA 3MUVP 2DXDA 1QSSA 1I1GA 1RA6A 3M2UA 3T9NA 3K59A 2NS1B 3FNNA 3AV0A 1FE0A 4TU7A 4ZDNA 4M5DB 1M5KC 4O3OA 5LMNJ 3J7AG 5EWFA 2G0JA 4JI5E 5IQ6A 1WSRA 4F9AB 4K4UA 5K20B 2E5GA 1IQSA 1DTQB 3GILA 2J7JA 1Y3JA 2EW9A 5C25B 9RUBA 5HVHA 4LSNB 4O3QA 2DY1A 3QATA 1WJ9A 2N3HA 4FK5C 3KLGB 3JQJA 2DHGA 1Q5YA 1RAEB 3S01A 2JEGA 2BA9A 3HT0A 3R1HA 1IM6A 1TKDA 5A8WB 5BR8F 1DBDA 4H4OA 3DRPB 4DR1E 5CABA 2ENCA 2GZOA 2CNKB 2DCLA 4LFAE 1RTZA 2VONA 4Y2MA 4NCAA 4M5JA 3M9OB 3OBIA 1UVIA 1VQ5S 3QWUA 5CYMA 2BJ7A 3FBEA 2EMCA 1EAYC 3KK3A 1TF6A 1S6PA 4OJGA 4NXNJ 3H42A 2KTQA 2JPAA 3A12A 1N88A 4M5DA 3AAWB 1S7HA 1VFJA 4F50A 1X5PA 5KL7A 1VISA 4EZ6A 4YB7A 3HZEA 2VG7B 2VODA 4NLDA 3R5CA 2DMYA 3GFZA 5J2QB 4OX6A 1R8BA 4DL2A 3NS6A 3KHLA 2V8HA 2GHVC 1MNEA 2J0QD 5AXKA 1M1KT 5C25A 2N7YA 3IG1B 4LRDA 1PC5A 4LSNA 3IM9A 3KLGA 2BJ8A 1D8ZA 4TYBA 1BWVA 1KRPA 3W3SA 2W8LA 4NL5A 5F8IA 5A8WA 3R8YA 4LF5J 3DRPA 5H9FJ 2VF1A 2RRNA 1T9WA 1K47A 1N33J 2N8XA 1RHQB 2DGXA 5KFIA 2KT5A 2RD5C 2J9CA 3G6YA 2EQ3A 1HNVB 2Y1JA 2CQ3A 2E1MC 3N6NA 2ZM6F 3EPJA 2J9EA 3GONA 2KOUA 4IOCQ 3FC9A 7FD1A 2QG9B 3MEDB 2XCAA 3VQSA 4DG1B 1DQ9A 4U6PA 1EJ7L 2MMYA 3RRKA 4X2BA 4CLTA 2C2EA 2EPIA 4BMJA 2VG7A 2WZ1A 4ID8A 2XY6A 4ED7A 4JI0E 5J2QA 1MGTA 2HBRB 1HI8A 4B3OB 3CCJS 2HNZB 4L3NA 3QFHA 2KHDA 4PAAA 2JXPA 3NMRA 2E1CA 5EWEA 3I56S 5MAOA 3IG1A 1YUJA 2ODRD 2EPMX 1WTBA 2H4WB 4OYPA 2JZ5A 4EBEA 1G2EA 1SC4B 3VALA 3EPKA 5LXYA 3BGFA 2FGGA 1Z2ZA 2HZCA 2K7IA 2NYIA 3WX8A 4WXWA 3PY8A 4ILLA 2M4IA 1CJUA 4JI3E 3Q89A 1U1RA 3M4XA 1RAHB 4C98A 3CNQP 1PBUA 2ADCA 1FERA 4G1IA 4W90B 2RQKA 1HMVB 4DPTA 1U1KA 4ZVRB 1WXRA 1IBMF 3R5DA 3CC4S 3W9JA 2AF6A 4MK9A 4QWEA 2Z56B 4UY8T 1XMQJ 1RTIB 5D4OA 3KOAA 3KNAA 1ZBTA 1A0OB 1EX8A 3MEDA 4JV5F 5KFOA 1KP6A 2PGCA 4DG1A 3N4WA 1MW7A 5F9LA 3SDEB 2YTPA 3OVBA 5ETQA 5HK4A 4NPOA 1ZETA 2YX7A 4ES1A 4DV7F 1GMUA 2W7OA 2XMAA 3N6MA 2YRMA 3C8YA 4R03A 3CE8A 3H25A 2AX0A 3NCPA 1KTQA 2LP4A 2V4RA 3W1YC 3MURP 4K4VA 3J7A1 4C48A 2HNZA 1KQKA 4M63A 1FFSB 1JKHB 4JI6E 1NXIA 5H9EJ 3N5FA 5KT7A 4JI8J 4R8UB 3MM6B 3R7SB 1S1XB 5KG5A 2O67A 2EXUA 2B51A 4F54A 1X6EA 2M70A 1HI1A 1A1HA 3H4BA 1VDHA 2J5AA 2C3OA 3D6MB 3RB0A 4QR0A 4DCJB 1AW0A 3R7NB 2CUYA 1M1HA 5KFHA 4J9MA 1PYTA 2K06A 5EN1A 2M5YA 3DHWC 1M5SA 5CH7B 1HMVA 3OD2A 3TVYA 1AFIA 1NSKL 2KFZA 4WFTA 4Z37A 2GQ2A 2MKYA 2FVSA 1RTIA 2UXCF 1WG4A 4XK8C 1FCAA 1FFGB 3L7PA 2ZZMA 4FZVA 4WXDA 3IWLA 4NCBA 3HHLB 2MGZB 4YHHE 2MC6A 2IBKA 4PYAA 4B3RE 3EPHA 2YWQA 2UUWA 4O0NA 1B0PA 2F8EX 4P2SA 4ECQA 2HFOA 3UW1A 2KXFA 3DRYA 4X4RA 2N4CA 3R5JB 2DNGA 4JI1J 4LIRA 1SCJB 3IRWP 1RGVA 1JKHA 2BW2A 2KT2A 4EBCA 4AL5A 4R8UA 2EBGA 4ZITA 4ECXA 1WNEA 1DQAA 1S1XA 4DUYF 4LFBF 1BHNA 2YTNA 3EVOA 1XMOJ 1CC8A 1TFYA 1PJ6A 2GVZB 4LF4J 2UP1A 5DQHA 3V6HA 2BR0A 2FVCA 4USKA 2YTDA 2VFUA 3EGNA 1JLCB 2QIFA 1FKAE 4J90A 2RHQB 2FZKB 1GAOA 3QJLA 2BKOA 4DN0A 3A1YG 3M32B 1S1WB 4D3HA 1ZR9A 2E66A 1HI0P 4PXCA 4WP9A 4QIVA 1OO0B 1FDAA 3HHLA 2MGZA 2CXEA 3CD7A 3FKBA 5CYJA 1LOUA 5M2UA 4DLGA 3QMQA 4NA2A 1YJUA 3KLEB 1RACB 4DR5J 3M2RB 2AGOA 4DV6F 2COLA 1Z1BA 3FZ2A 4L74A 2JOBA 3V2UC 4I6AA 3T1AA 2AEJA 4PXDA 2ASJA 2LU1A 4ZN3A 2C22A 4R2CA 4B17A 5C7PA 3QT8A 1FWLA 3GFHA 1B70B 4N47A 1LEOA 2DBBA 2GVZA 3M99B 4RZRA 4GKJE 3Q8SB 1JLBB 2J6SA 2X7IA 2DYAA 3FQKA 4ZYGA 1D0EA 1JLCA 1FTRA 2QMWA 2H65B 1YHQS 2VKRA 1HQUB 2FHOB 2V4JA 3VYXA 1VC5A 3M32A 1S1WA 2KDOA 2ROPA 3KHHA 2ENAA 3HXLA 2I9SA 1NH7A 2RE1A 1PYOB 5DGBA 1V5IB 2HFUA 4OI0A 4QIFA 3BR9A 1S6QB 5L1IA 3MMCB 1SC3B 1EQMA 1CLFA 4R2QA 2YTGA 3DOLA 3KLEA 4PXBA 2ZH8A 4L72B 1C0UB 5EDWA 3Q8YA 1YJNS 4HACB 1WF2A 2AJ0A 5HI7A 1U1LA 3W2VB 2I0XA 3MD3A 5GAHU 2R9LA 4JI7J 1U2RA 4ZPDA 1XNQF 2ZBPA 4HLBA 2F4FA 3RGIA 4MKBA 4OJ1A 2Y0SD 1IVZA 2WCC3 4UY85 2BE7D 2HQDA 2YSPA 3IWXA 5L46A 1U24A 3OVSA 1MWQA 2CDQA 4E0DA 5A6BA 2GX8A 2XY7A 4RU2A 1JLBA 2YBVA 2J0SD 3AY0A 1U6BA 3MGJA 4YB6A 2CFXA 1VHFA 2IRUA 4ZVGA 2EOSA 1HQUA 5I3QA 4LFCE 1K8AT 1QU6A 1UPMB 4EI2A 4F6NA 4Q45A 3DNCA 1OPIA 2CQBA 3IBCB 3POTB 3PW2A 1NPKA 2CPEA 4WX9A 2YKQA 5AJ3F 1RMDA 3SXLA 3MFIA 4JI5F 1S6QA 3MMCA 1STUA 4RR5A 2CQ2A 1C0UA 3NGSA 4HACA 3TX0A 4DR2E 3FCHA 2ZZNA 1T38A 1Y10A 1N8RT 1T3OA 4UUWA 1NDPA 4RO0A 2L9DA 2UUBJ 4WFXA 1S12A 4DR6E 2GAHC 2ZWPA 2LKZA 4DR1F 2DLKA 3P45B 4EMDA 5EHHA 4YR0A 1N6QB 4LFAF 3PW0A 2BJDA 2GFFA 4NYOA 2GW8A 2DRAA 2XNQA 4QYZJ 3P5BP 3SQOP 4B3TE 3LALA 2QFIA 2DNLA 3OL6A 4RPFA 4X4VA 2EQ0A 1UZDA 2BJ1A 2PIIA 3NOCA 1WOOA 1MSWD 4N8NA 1TL4A 2JC1A 1SH0A 3QO9B 3GYXB 3POTA 3ICLA 5ETPA 4A8QA 3PYFA 1WC6A 4NLPA 4NZ7A 2DGQA 3L09A 3MF5A 1Q8BA 5LT5A 2HKEA 5T7LB 5CCMA 3OHAA 4ELUA 2KU7A 4X4TA 3ZZPA 3JYTB 2JJ4D 2EEYA 4OHWA 1FRJA 2SXLA 1YWXA 2ALYB 2MZ1A 4DKKA 2E1AA 3PXGa 3MAHA 3K8VA 1NHVA 2KKHA 2WW4A 3KXDA 4QW8A 3RAQA 4ZJLA 1RU1A 3O5TB 2R7OA 2BJ9A 1N6QA 4K5SA 4Z7YA 4IRCA 4RNHA 1KVIA 3EDQB 4JP8A 4DL7A 3W5YA 1A9NB 2RSMA 4HI1A 5J1NA 2JLEA 2V9WA 2ZH1A 2EFOA 4D3GA 1VBYA 3GE9A 2AEFA 4DV4J 2ERRA 2FJEB 1F60B 4WFZA 4KKOB 5DDQC 3B82A 2YNIB 5KFAA 4CLUA 4ZLNA 3ENWA 4MAKA 4ZCKA 3J81C 2W2PP 2XLKA 3EGZA 2FHMA 1NZAA 3MMAB 5A76A 3AJ1A 5BR8J 4JI0F 4TYAA 3NXZA 2ELZA 2WRMA 4RL1A 5T7LA 2EPOA 3EJMA 1QNTA 3JYTA 3F73A 2AT1B 3BGRB 2CJKA 2DLQA 3W64A 4Y2IA 2CJQA 1X4CA 5IQQA 3H2LA 3T6JA 1IR1A 3A8EA 2F8HA 4C3MA 4Y28C 5J1EB 4QIWD 1HQ2A 3J7YI 3B78A 4TNOA 4JI3F 5D0HA 4PUOB 1VK8A 2EMZA 5HMWA 2A18A 1HBOB 1P9YA 1DQ8A 1F5BA 1WI6A 1Y7PA 2QSWA 3J80C 4RBVA 1RT7B 2I2YA 1ZAAC 5LSRA 2C2DA 2H4YB 4ELVA 4LF8J 2FC8A 4ED4A 4YS2A 4EWTA 3K5PA 3FIGA 4QWCA 3AOCA 1N5QA 4KKOA 4B3ME 2IVYA 4C8ZA 2YNIA 3TJAA 2OELA 3NGUA 2OPSB 2N3OA 3K5MA 2E29A 2BOAA 3MMAA 2E1RA 2P6SA 2VJUA 1P8GA 5E2QA 3CD5A 4EK2A 4FVMA 2PD1A 3AOAA 4JI6F 5DJBA 4KIAA 1TF3A 3BGRA 1RTJB 2QTWA 3LW5C 6AT1B 3CF5Q 1PJ7A 3CDBA 1PCAA 5J1EA 1KDNA 2ZM6J 1K44A 3F56A 3CCMS 1A6LA 2HHHJ 2L08A 1ULRA 5HL7Q 2XM3A 2DRBA 4PUOA 2HAFA 5CXTA 1WC5A 3IAS9 1HBOA 4UOFA 1S1TB 1CULB 2N3LA 1JK1A 5BYQA 3M1VB 1TK5A 3HKZD 3BN7A 3MPUB 4J7CA 1RT7A 3MPVA 3NWGA 2YKMB 3ILJA 3HM9A 5DETA 4GC6A 2WBMA 5K14B 1A1GA 4ECZA 4N41A 4G1PA 4K59A 3PRBA 4ZVSB 1S48A 3DRSA 2Y1RI 4YHHF 2ZKTA 4DFPA 1CJTB 4B3RF 1A7GE 4R2AA 2V69A 2OPSA 1LK5A 1UWBB 5K5MA 2BANB 1IKYB 4PQUB 2DGSA 3NAHA 2ZD1B 5G4DA 2VQEE 4NLYA 3M8WA 1Y00A 2QLWA 1BQNB 5E33A 4MFBB 3VAJA 4DL5A 4X66E 2MSSA 3L00A 1OPZA 4DFMA 3T1YF 2LLZA 3L9ZA 4OQJA 5IC6B 3LP1A 1B7FA 2JNJA 3MOJB 1RTJA 1XNRE 5FLXC 2GIFA 3CJ3A 4N56A 2L48A 1HQEA 2MHNA 4EO6A 4RWXA 2ZEJA 3I0SA 1ZH5A 1O8BA 2VBYA 5LMUJ 1S1TA 1UJ5A 3M1VA 1MWYA 4F26A 2FJAB 4DV7J 3U1MA 4OYMA 1FKAF 2YKMA 2FUG9 4DSIA 4OZ1A 1H72C 3MOZA 4U7UD 1RT2A 3HFVA 5K14A 4LR9A 4RWWA 5HBMB 2NA2A 5A6WA 2AW0A 3FEXB 4KHPE 1KHWA 1FT8A 2YKPA 4BHCA 1VK3A 1H38A 3RAXA 4O3PA 1YG0A 1CJTA 2EC2A 2R42A 2VFRA 3VZIA 2BANA 1RQ0A 1IKYA 3I9V9 4PQUA 5F8HA 2A1BA 1ZM4A 1VLOA 1BQNA 4AYBD 4MFBA 4CH7A 2EL4A 2DB2A 3AB4B 2V9KA 4NE9C 3BQ0A 1RWNB 4OI3A 3P3DA 5LXRA 2MEWA 2CQ1A 2G4BA 3GJSB 5KL2A 2UXCJ 4RBTA 4OYAA 3CIZA 3OFFA 4W98A 3HDSA 1MN7A 3ZZRA 4C8MA 2UUTA 3MCMA 4GRSA 3WC2A 4GKJF 1S5ZA 1U8WA 2EOMA 1HBMB 2VU5A 3M8YA 1G1XA 1T4LB 4DWIA 2EPXA 3TNVA 3MM8B 4HKQA 2DEJA 2QYGA 1ICEB 4P71A 3FK4A 5HBMA 2FTRA 1D9FA 4OOGC 4P2XA 3W5XA 4AD6A 4O44A 4X65E 4OX8A 1VQ4S 4I64A 3G8SA 4B3SE 2R8IA 3UN3A 2MQPA 1IKWB 1FRIA 2UVVA 1IWAA 2U1AA 4F3QA 4DUYJ 4V1Ak 1YJ9S 4LFBJ 4P72A 3I96A 4DSFA 2IYGA 5L9NA 4LU9A 4RUAA 4QU6A 1R8AA 3BBCA 5LJ5Y 3K6QA 1RT1B 1WKLA 1NNDA 5IOLA 4NLGA 1OSCA 2JFDA 1YBAA 4WBFA 1JX4A 3CJTA 5IWAE 1S1VB 2POKA 4KE5A 1YYWA 3RBXA 4ES2A 1MROB 1FJGE 4DL3A 4F3MA 1MWZA 1AB8A 4AUKA 3SV3A 4C7QA 3SIPB 3OQ2A 3UCZP 2K3IA 4YR3A 4WYQB 3HI9A 3ZC4A 2X1BA 3TA1A 4Y00A 2BQRA 4LMZA 1Y5NB 2XQCA 3Q8UA 3CT9A 2MKSA 2DR5A 1D3WA 5E3QA 3C2PA 2BKNA 2M52A 3MM8A 1T03B 4HHJA 2K8GA 4LFCF 2O01C 4ERDA 2D9OA 3AD9C 2QE5A 3RG6A 5KFTA 1SQEA 4DV6J 2DHSA 5KL5A 4ECWA 4LR7A 1OS5A 1HARA 3HPSA 2CIMA 1NB7A 3IN5A 5HATA 4OYOA 5KT4A 1IKWA 4IUFA 3GIMA 2E9RX 4K5RA 3BGUA 4RW6B 2KG1A 4A47A 2DT9A 2PMZD 2EOFA 5B0EA 3HO1A 2HHUA 4V19X 5DG8A 1Q79A 3HSZA 1CSJA 1SR9A 1H2TZ 1LW2B 3MSWA 2H9ZA 5CQGA 1RT1A 2RDIA 4DR2F 1GMWD 2GHFA 4KAIA 2MB0B 2V4QA 1I94E 2LO3A 4QYRA 3FQLA 1G2DC 4OLOA 1YI2S 1S1VA 2A3JA 1F2GA 3VGSA 4DR6F 2EPKX 3QJJA 2B4VA 2RB7A 1M5OC 4NLWA 4LF9E 5C2CA 2K4VA 3D7SB 2YX4A 4MKAA 1FX4A 3TUIC 4EBDA 2YT4A 1BXNA 2L2MA 4QCLA 1WACA 2ZBCA 2XB2D 1KQFB 5CYQB 1UEKA 1YKWA 1ZS6A 1BQXA 3OSPA 3CIMA 4B3TF 2F9JA 1ZYQA 1MEYC 5BYSA 2E5LE 1T03A 2B8PA 2AGPA 3HD1A 4A8WA 1BLUA 4LR8A 2QJ3A 2L3MA 2LU2A 4OYIA 1FDDA 4XDCA 2E7XA 1PAUB 3CCWA 2Y8WA 3ZNJ1 5HN0A 1WHXA 4DQSA 3CJ5A 4M30A 1M1GA 2B3TB 4NEYA 5DZ6A 2PA8D 1BB8A 2VD3A 4RW6A 1JLGB 4F7VA 4Q2LA 4RBUA 2M2BA 3JAMU 3BYPA 2VF3A 5F8MA 2VJVA 1XBWA 1TP7A 3GP9A 2XMUA 1Q1KA 2LMIA 1LW2A 1C2PA 3VGVA 2XNRA 5F8NA 1DLOB 2QA4G 3UDCA 4DPUA 1TAQA 1VJWA 3IWNC 2VOPA 3I4HX 1UA0A 2XTJP 5BXIA 3TZXA 2RU3A 5KFDA 3PW5A 3RW7A 4CDIA 1GXUA 1RLDA 3EPIA 1SV5B 4IQXA 5CYQA 4TY8B 4USVA 3IWCA 1J5OB 2BMBA 2UXDF 5K8PA 5AJ3J 4X4NA 2BKPA 4MIBA 1SJFA 2BUNA 2NXEA 2LECA 6FD1A 1NDKA 4I8OA 3MM5A 1XMBA 3LP2B 4FXVA 2QSFA 3AUZA 2XHCA 1W26A 2C2RA 3BPSP 2RRBA 2HJJA 2YU5A 4KY3A 4DBQA 1NK7A 2GV1A 5D8HB 4DX5A 1JLGA 2DEIA 4L75A 1VQ6S 1VCTA 1WC3A 4DR1J 2YPZA 3IR6B 2Z4PA 2CPYA 1FJEB 3AT1B 3JTOA 4NLTA 2RQCA 1DLOA 3OLBA 5K8MA 2IVFB 1KONA 3QRPA 1TN9A 3HSDA 3L3CA 2CYYA 2L3JA 4NYZA 2JEIA 1TTHB 1GXLA 3THTA 1EETB 1X5TA 1SV5A 4DV3E 1K1SA 4TY8A 1J5OA 2FY1A 4FF4A 4FXDA 2O66A 3UWTA 4R8OA 3MEGB 4MK8A 3GR1A 4WKYA 4QWBA 2GJ2A 2L9NA 4O3SA 4P52A 1FJCA 1WOPA 3Q8RB 4B3MF 2EMIA 3LP2A 2DPJA 2DIXA 2B8QA 4J9RA 1QSLA 1UVMA 3RBZA 2XG8A 3LPYA 3ADAC 1P27B 3IGNA 3JTPA 4GKKJ 2QMXA 3RTVA 5A2QC 5ETRA 4CNZA 4LT6A 4TU8A 4UT4A 3AHPA 4FPIA 4J9OA 2WZOA 4KV8A 5L8RC 2V34A 1RADB 2MPUA 3A4TA 1RCXB 1Y3KA 2V8QB 2W2OP 3AQOA 2FJVA 1XR7A 1DGCA 2N3GA 3CCSS 2F3JA 1VJQA 4P7VA 4KPYA 2V8PA 3G6VA 1NEIA 4LVNP 2RSQA 2VE7C 2IMOA 3VV2B 4DPOA 2VQFF 4TKTA 3VAMA 4NYPA 3CPWR 2YWWA 4I2PB 4I0WA 2C2NA 2VPYB 4AT1B 3VAFA 4B9NA 1OY8A 3MEGA 4QJVA 4MT1A 4JI0J 5FDLB 1U02A 2IM2A 3E51A 2MKKA 3UNYA 1TU0B 2KRBA 4ILRA 3F6GA 4F4YA 3TO8A 2KXNB 3ZNUA 4CNYA 5KG0A 1W2BR 1FE4A 3CJSA 1M5HA 2L2NA 3FCWA 1FKOB 2KFNA 2VQEF 4LF6F 3VAIA 4DF4A 4K2JA 1KR4A 2YQ0A 1YBTA 2LXUA 3T6BA 4X66F 1HNWJ 4IH5A 1H0HB 3PFOA 2KFYA 2AJQA 2ZBRA 5L9XA 3WDOA 1LWCB 1H2UX 1PDAA 1QAIA 1XNRF 3IP0A 2RQMA 2LXIA 2BACA 2WVFA 4YY3J 2FB0A 2FVRA 2BABA 3G8QA 4P10A 3DU5A 2EVZA 4LRCA 3EZ5A 3DHXA 2ACYA 1E6VB 2XGPA 1CC7A 1X5WA 4YOEA 2E5JA 2BBEA 3CWJA 3ZO7A 5T6JA 4PKDB 5ETMA 4I2PA 4GEQB 3TYTA 4Q28A 4A8KA 1QE1B 3RRHA 3ZTQA 5FDLA 1YIJS 4X4SA 2KVQE 2LTRA 1FVSA 2YWKA 4KHPF 3FMBA 1O5JA 2QYCA 2PMWA 3CJQA 5IV4A 2M4MA 5I3PA 5I3UB 3HVWA 3N79A 3H8YA 2M1SA 1UEUA 4CO0A 2OIHA 1FKOA 1IXKA 1G2FC 4KO0B 4QR2A 4TQRA 1YQHA 4ZS6A 1YPNA 5KFSA 3LANA 1HFEL 2Z57B 3GSDA 2ZUAA 2APOA 4O43A 1GFWB 1LWCA 4WFNQ 1JLAB 3HHLC 2KVIA 4B9UA 4XAKA 1Q8KA 2B5JB 1NO8A 4USIA 3HPZA 3L4BC 5KFEA 2GO9A 2LQ9A 2V2KA 2EL6A 2V50A 3GQCA 4ZOSA 1EB0A 2A6OA 3JQMA 5DM6Q 1VQPS 4DSKA 1E6VA 4ETZA 3M6XA 5ETKA 2CPDA 4M9VC 1T94A 4LREA 3TQEA 4B3RJ 1NK9A 1YRUA 2M88A 4A8XA 4P75A 1T95A 2NZ4A 1YUIA 3I31A 2YU8A 1B3TA 3TUZC 2FLLA 2XCPA 1U2FA 3NP5A 1QE1A 2EBEA 5HVFA 4ETXA 3QNWB 4Q2MA 5HQ8A 4YDDB 2DNYA 2BBGA 4X65F 3T1YJ 3Q8VA 3D3CJ 3M9MB 4B3SF 1R8CA 1HA1A 1BMQB 5I3UA 1N48A 1OJ4A 4KO0A 1WI8A 5DDPC 4MIWA 1HL6A 3FDSA 1RYRA 2X51A 1JB0C 2P9CA 3ADLA 1FRKA 1UJ6A 4OJHA 2R2TA 5HP1B 3FBFA 1JLAA 3LPEA 3G8TA 3EQ1A 2ZNYA 4N4RB 5IWAF 3JSMB 2B4UA 4ZJQA 1B0VA 2B5JA 1FJGF 2W24A 5GMEA 2BE9B 2Y3YA 3CCES 1TKZB 1H6KX 4DPXA 2OO4A 1UA1A 1YJTA 2HMIB 3BR8A 1V9OA 2YVSA 2HS0A 3MPDA 1ZAWA 4J9QA 1N34E 2PC6A 5DG7A 1LXNA 1X0FA 2HHTA 1OMSA 3G9CA 4QR1A 1NH8A 4WCEQ 2HWIA 4F9CB 3EZOA 2AYGA 1T4NA 1VRUB 5KFVA 2GHPA 4QWAA 1FRHA 4CLZA 3GCXP 1TK8A 1X9WA 4YEAA 2JH3A 2GAGC 1EIYB 2NUGA 3H20A 4IO9Q 2ADBA 2JL9A 2HG4A 3GZ7A 5DS7A 1NMEB 3MHHC 2MDAA 1T9UA 1VR6A 2V89A 3DC2A 2I6WA 3VAKA 2MKJA 1HW8A 2JYAA 1ITPA 4B9TA 3UD5A 2H54B 3C3LA 2F65A 2ZE2B 4UUXA 2VASA 4EEYA 5DGAA 3U02A 4M0VA 2OSQA 4H54A 2R2UA 1OY6A 3IGVA 1R27B 4I1TA 1XIQA 1SJRA 1J5EE 1S9GB 5HP1A 4XTTA 1I94F 2EMGA 2D3UA 2H1YA 3QBCA 3JSMA 3MM7B 2E9ZA 3ELHA 1YJVA 1SH2A 4U8VA 3SSQA 3G87A 1HWJA 5HO4A 2CNLB 4LF9F 2QT7A 2F4VF 4CT9A 3LGHA 1TKZA 1T7PA 2HMIA 3OUYB 2EM9A 2MLYA 3DI6B 2QA1A 1SQFA 3KJVA 1T05B 4DR4E 1WKJA 1ZPVA 2GQCA 2OLWA 5E3CA 2LJHA 2NXCA 4RX6A 3TJ9A 1VRUA 8AT1B 2E5LF 4F67A 4OI2A 1HR0E 2RKIB 2JDJA 2M0GB 1NEEA 4OHVA 5D4NA 4KFBB 1A1JA 2XLJA 1X60A 2K1RA 1R3NA 3MI7X 1HPZA 4KJIA 1W25A 2HFNA 1EP4B 1BGXT 1YBUA 4HDHA 3ZZOA 5CHCB 4F9BB 2ZE2A 1HNZE 4X62E 2VKZG 3CJ2A 1GK8A 2CPIA 4FF1A 4R2DA 2FZGB 4PXEA 2LDYA 4RNOA 4OX7A 2EMAA 1S9GA 1V5VA 3LLHA 1OY9A 1PIEA 2VDIA 1L3UA 2LA4A 2EPNA 2B9DA 3MM7A 2GC8A 2HQIA 1J2VA 4PQAA 1Q8IA 4RHBB 2HS4A 4KYZA 4LFCJ 2EFQA 3PHTA 1H98A 5LMNE 1RBAA 3HD2A 2MSTA 3DI6A 4YN3B 2D69A 2B9YA 3KHGA 3KKFA 3D9BA 3TZZA 5B0FA 2IAJB 1UVNA 1U2CA 3F44A 2V2QA 3BDEA 4URSA 4NLUA 4F4KA 5T14A 3T5LA 1KJKA 1PJQA 2VG5B 2WBTA 3FBBA 2RKIA 1VQOS 1Q95G 3O1LA 4KFBA 1TV6B 4DR2J 4Q35B 3OTDA 3BB5A 3JQKA 2P6TA 3TAPA 3W9HA 3EICA 5K8OA 3GG0A 1BWEA 2FV4B 1EP4A 4J9SA 1AUDA 1WC0A 3L7UA 3ZZYA 4Z2XA 1Y4ZB 1XEZA 2HVHA 2O1PA 4OZ3A 2R7SA 1NZ8A 1KN6A 4OX9F 3MHYA 3ECRA 2DNNA 4NXNE 2HQCA 4MLVA 4B3TJ 1L3TA 1Y9OA 1PBAA 2HGHA 3M8PB 4A8YA 4C11B 3RAMA 1N36J 2OFGX 4GO7X 5A6BD 1BY9A 3HCXA 3B54A 4MMOA 4DV3F 1WHVA 4ZLLA 8ATCB 2XMWA 1VQ9S 3TUJC 1RTHB 4X64F 2DD8S 2OPQB 4OMFG 1YFHA 2VG5A 1X4HA 1F0XA 2DIVA 2YKOA 3I4PA 3EGWB 1S9EB 2LEAA 2VFSA 2CQHA 4UZBA 4ILMA 1TV6A 3CD6S 3K17A 1RKIA 2VC0A 3OVAA 4LF5E 4DV5J 1B7YB 3PJ9A 3C6MA 2YH1A 3S6EA 1RHMB 4ED5A 3A13A 3DKDA 1N33E 1IKVB 4RJVA 3ONQA 1I3OB 2IHR1 4P74A 2R8JA 2MXYA 3DDNA 1R0AB 2JWOA 1TKXB 2Q3PA 2X1GA 4RUCA 3BSCA 2C3PA 2UXDJ 1GX5A 3BS9A 1NKCA 5HAOA 3ETOA 5KFLA 2GIRA 4DUZJ 3M8PA 4KGXB 1JJHA 4K4YA 4C11A 2G2YA 3H90A 3A3PB 4UZCA 2UU9J 2IMWP 4WTOB 4FBTA 3I55S 1QUVA 3FCVA 3NMAA 2DO0A 2HHSA 1MU2B 1X7VA 1RTHA 2OPQA 1DJ0A 1U1MA 2R76A 4WSPA 2EKYA 4C0HA 1R0BG 1VIXA 2DH7A 3GG1A 3DLLQ 3EDRB 1K73T 3H40A 4ZJOA 4QU7A 1PGZA 3NGRA 2WBSA 5A8RB 3HT3A 4EYHB 2DR9A 1LNQA 1IKVA 4RW9A 2R7WA 2CJ9A 1DQ3A 2EOQA 4FF2A 1WEZA 4IFVB 3WBZA 2CQPA 2CDRB 3GSIA 1R0AA 4NMLA 1TKXA 2EI5A 2JFKA 2JOXA 1XMQE 3G71S 2NXNA 2CSHA 2EFGA 4K7QA 2EK1A 3ZTPA 1Y11A 1FA0A 1F5AA 3PO4A 3Q22A 2A25A 3NBPA 4Q0BB 1HNXE 1IMUA 4HTIA 2D3O1 2C2OB 2VBWA 2ZVSA 1N3GA 1FVQA 1RT3B 3CC7S 1VC6A 1IBLE 5JXSA 2YKAA 5HQMA 1MU2A 1GNKA 4ZP8A 3W66A 3IO1A 2ZITA 3D0HE 2V5HG 4JI8E 3PNIA 1OQ3A 2VL1A 2F8BA 2RH3A 3VHQA 3OL8A 2R8GA 3C66A 4RUHA 2GPIA 3RMPA 4CO2A 1YJRA 2OKQA 2WHOA 5A8KB 5DLFA 4CM0A 1XJWB 5A8RA 2RVJA 3SCIE 4ZP7A 2FDNA 4AXJA 4I2QB 5J2PB 3DDIA 3TA2A 2AJ1A 5KG4A 5A6PA 4IFVA 4PCQA 1V3SA 1RSCA 2WB1D 2UXBJ 1LFPA 2V63A 2VQFJ 2XHWA 4DV2J 4OHYA 3RBDA 4E8UA 2QX0A 1YLXA 3MR6A 4Q0BA 4DOZA 1VS3A 3ISNC 4NXMJ 3BDPA 1AH5A 2RS6A 4MYUA 3TI0A 5GADU 4ITSA 5AE1A 1RHRB 2OPPB 3ZZUA 1YVFA 2BDPA 4FBUA 1RT3A 4P7TA 2YTCA 3DM2B 4JI1E 3EVWA 2NYHA 2W4CA 1JWWA 2VQEJ 4LF6J 2PFDA 1H73A 3W8PA 5HMZA 2CZ4A 3MWBA 2IDEA 2DGWA 4DF8A 1RCOB 3OXFA 1XMOE 2EPLX 4P2FA 3UO0A 5A8KA 2FVPA 3PKMA 1IKXB 2VBXA 3DN9A 2QEXS 4J9KA 4HT7A 2HS3A 3LOUA 5CCLA 3HZGA 3E01B 4I69A 4RW7B 4I2QA 5J2PA 2FD2A 2OI2A 2B4OA 1NUEA 2BV3A 2A0FB 4I6WA 3D0IE 2ZDOA 3PW7A 3PCOB 2KO1A 4C0BA 3M30B 4R2RA 4WIQA 1C1BB 1CBKA 3N9UC 1S97A 2UV8G 4B08A 3TWZA 4ER8A 3UCGA 4X4OA 2LV2A 1VQSA 5KFGA 4F25A 4K0KJ 2J0WA 2M8HA 4F3OA 2OPPA 1LQ9A 3OTBA 1N34F 1PSDA 2UZAA 3CO0P 1NCSA 3EE3A 2K2PA 2ZZTA 4DR5E 3DM2A 2FQQB 3JSYA 4ZK7M 3NNCA 4EYIB 5GAEU 2DTJA 4B02A 4KWYA 4N76A 2LJUA 4OZLA 1JJCB 3BBGA 2KT3A 4ECRA 3MEEB 1JLFB 2YQ1A 3GYGA 5A6KA 1T11A 4CO1A 1U0HA 4ZCMA 4YQWA 2P9EA 2OMOA 1WHYA 4NCGB 1IKXA 2CJXB 3BO2A 1RE1B 4TY9A 3E01A 4RW7A 2KB2A 3BM7A 4H4KA 4M5HA 1AZSB 4IO1A 1J5EF 4ALZA 2HFVA 1N54B 1U0SA 3LO3A 5IT9U 3W60A 1X8DA 4U9RA 1KNZA 2R2RA 5ETSA 3M30A 2WVCA 1HHSA 1C1BA 2YKNA 4A8FA 3TR5A 2OTLS 4O0IA 4OIXA 2NXUA 5C5JA 3Q24A 1X4FA 4DR4F 3I32A 2HLTA 3HF5A 1J27A 3BH6B 4NLOA 2BJEA 2W4DA 3GLJA 2FJDB 1SPBP 3C4BA 3TVZA 1BE4A 2JY9A 2EPCA 1L3KA 3DF6A 1FXRA 4ZIWA 1HR0F 1APSA 2W9BB 3MEEA 1CJUB 1JLFA 4B9VA 1DHMA 2E5IA 3I0RB 4DQRA 2LVHA 1YYKA 1SL0A 1FESA 1KWMA 2RS2A 4QIEA 1LWFB 2LVWA 4NCGA 3UN5A 3D28A 2OTJS 2IM1A 3JTZA 2XC9A 2YNHB 4X62F 4IH7A 2V85A 3BSAA 3OSNA 3BF4A 3QYYA 3QRQA 1X4AA 1AZSA 2WW8A 1U1PA 4BC7A 2WBUA 2RQLA 2GJIA 4MJKA 1ZA2B 4Y34A 4BHQA 3PJXA 3X3UA 2RF2B 1X4GA 4C3LA 4K50A 3ILLA 4RLEA 5LMNF 1VHIA 3R5GA 4BHBA 4WPYA 4ZKAA 1RWVB 1QAYA 2NUEA 1L3VA 3GV5B 2YXLA 4DX6A 2CT1A 3D3BJ 3FRYA 4OZNA 4ZPAA 2YPNA 3FFIB 1B99A 5B0BA 5IV8B 3DGPB 5CD4A 1MLAA 5D78A 3Q23A 2CPFA 2W9BA 4FYVB 5KTQA 1NDCA 5GAGU 2UUBE 5D77A 2DXEA 3UD4P 3CJ0A 2EG1A 2XS2A 3I0RA 4KSEB 2Y1LB 4DV0E 3QSIA 3IAM9 2EM7A 3G82B 5C2GA 1LWFA 3VVTA 2NUUG 5D4PA 2DNOA 2UUAJ 5F3ZA 2YNHA 2DRPA 2F4VJ 3UVJA 5A2QY 3G86A 2OPRB 2HAIA 4M5KA 4NXNF 3RB4A 2FHJA 2HRYA 8RUCA 3OFGA 4IR9A 2XEXA 4OYBA 4KZSA 1YK9A 5F3WA 1FWKA 3TAMB 2E5LJ 3VK6A 5L1LA 1L3SA 3R1LA 4J9PA 2RF2A 2GJFA 1WELA 4BS9A 4RW4B 2JP9A 3MPYA 4OZ2A 3N6LA 3M6WA 4ZYHA 4WZQA 2NSCA 1WTFA 4JYAE 1SL2A 4W4MA 4QOTA 4I6YA 5E3PA 4O3NA 1B69A 1R6YA 3H5XA 3FFIA 3QAEA 3ADJA 3DGPA 1KVKA 3NKYA 5KFBA 2GO8A 2CA9A 2IVMA 3S8SA 1JMTA 3D5MA 4JI4E 1D9AA 1X5SA 4NLQA 2K7JA 2JLFA 4X4QA 4LF5F 3VGUA 4FNIA 4FS1A 3G82A 1RTDB 1N33F 2HQGA 5KAKA 4U7UK 1Z4UA 5B0AA 1U09A 1EKSA 2DXFA 2PA3A 2LA6A 1UFLA 1FK9B 1IQTA 4ATNA 2OPRA 1FO1A 3OXLA 3H09A 4DV4E 3LUYA 3HMJG 2FLOA 3D4JA 3HJVA 2IBOA 1AUSL 2I38A 3O8WA 3TAMA 1NK6A 2YX1A 3K89A 1UWAA 2OD4A 3Q83A 3T1HF 1EKZA 4RW4A 1GTHA 4DN9A 1WRJA 2W1BA 5KT5A 1A1FA 3HJFA 2F7VA 4M5LA 4HDGA 3PO5A 2XMTA 3SQGB 1ZBQA 4LQ3A 3US5A 2JVRA 2ZBQA 1S0MA 3BQ2A 3I5AA 3M8SA 4L73A 3IM8A 5B7WA 4GO5X 1S4EA 3DFEA 1VQKS 4OX9J 2PMHA 3HHNB 3QLHB 7AT1B 1SBRA 2KM8C 4LTYA 1KHVA 2PI4A 4JV2A 4I56A 1QVFR 2VC1A 2YRHA 5KT2A 1N52B 1RTDA 2CWKA 1WC4A 1QAXA 1Q86T 2R2SA 1NCLA 1YRXA 2AP6A 2V4JB 2AX1A 1P47A 2HHQA 1FK9A 4LF8E 1BBGA 5KFWA 5IZHA 1AAYA 3OTEA 4DV3J 1XMQF 4C6AA 5KFJA 2CNOB 3HHDA 4NLVA 1HNXF 4X64J 1XERA 1RABB 1MMNA 1N5TA 2P8IA 2EMBA 2L3CA 4ZPVR 3DOLB 4HEA9 4FDFA 5GMDA 5FJ4A 1U1NA 1B64A 2QGFB 3MR2A 1GTEA 1IBLF 1OIAA 1C4CA 2EC0A 2EM6A 2W25A 3SQGA 1LKZA 1PJ5A 2DHAA 3IRXB 2GIQA 4JI8F 4OZ5A 2CKWA 5KFQA 4CRJA 3NNHA 1UN6B 1W2IA 2EMWA 2NXJA 2DGUA 2G7HA 2HHHE 3QLHA 3BH7B 1LXJA 2CQDA 1SL1A 2IY5B 1UTAA 1WSVA 2Z2MA 2ZDPA 4J9VA 3HSGA 3D68A 3J7Yp 3W9IA 2ZJQQ 3K57A 1RWXB 4TLRA 4M5MA 3R97A 1FRXA 5AT1B 1JK9B 3CXCR 4NHRA 3SBMA 4HTJA 1S7IA 2MZJA 2AZ1A 2IM0A 1F2HA 4NZ6A 2ELYA 3C19A 1RAOA 4QW9A 2EP3A 1UILA 1M0SA 4O24A 2IJFA 2FYXA 2Z2ZA 1TL1B 1AXQA 2LTSA 2QZ8A 3IR7B 2HNYB 5KG2A 1SJQA 3M6UA 3CW2C 4JI1F 2BJ3A 1HYSB 3IRXA 3R6LB 1YSAC 3PYEA 1YDLA 1UP1A 2E72A 5KFPA 2HHVA 3GV8B 3R2DJ 1XWLA 1NK4A 4PPDA 3NCRA 1SJ1A 2XZWA 4QZVB 3QGPA 5BJRA 3A8JA 1XMOF 4NWBA 3VAGA 1NDLA 1GQEA 3HFKA 3B4DA 2EM2A 2HRUA 1SKWA 4FXWA 5LMUE 3TA0A 1W7WA 2RU9A 5AC4A 3DU6A 2V8VA 2X3DA 3CSKA 4DV7E 4DQIA 3MCOA 2EWLA 3TOQA 2JWNA 1NK8A 1TR0A 2LT7A 3A8IA 3D1HA 3UCUP 4ZVOB 4DR3E 4YDXA 2QLFB 3CMES 3C15B 2AKWB 2QO3A 4F0HA 2GA7A 1WOSA 1YSJA 2OFHX 2C42A 4DV1E 4JI2J 1TL1A 3RR7A 2GMJA 2C2KB 3PG9A 2HNYA 1UCNA 4DR5F 3ADIA 4FYWB 4PWDB 4F6MA 2EOHA 1HYSA 4PRFA 2L2KB 2MQ8A 3KYLA 2EM8A 4HI2A 3DLKB 1PO6A 4WU3A 2ZOMA 1O6XA 4ZVFA 1UW9A 3EZUA 2VBZA 2HSEB 1RWKB 3D6FB 1PKPA 2UXCE 1HWUA 2YQ3A 1EQ0A 1F2IG 1NK5A 4WKRA 2DR7A 1GT8A 3N28A 1XR6A 1S10A 1NPPA 3IBFB 3QWPA 3PDNA 4FVCA 4CH1A 3EYZA 2IPOB 1EHWA 1F3VA 1WJPA 4UOGA 2H48B 3C15A 4ZYDA 4EU0A 4Y0FA 1WKKA 1O0WA 2V68A 4CLLA 3C14B 4LFBE 3M05A 3EXYA 2NABA 2LCWA 1N32J 4PWDA 5KOWA 1S99A 4FYYB 1SKUB 5DQGA 1SIZA 1NJWA 4YB1P 3KWMA 2UVRA 3C16B 4G1QB 3DLKA 7FDRA 3D6HB 4LRAA 2FGCA 2CVEA 2IJNA 3H5UA 2OD6A 2DGVA 3D54A 2DGTA 1U8SA 1F5CA 2VICA 5H9FK 4DR7E 1S0NA 4KRWA 5HMXA 2R8KA 4I68A 3KWRA 2EG2A 4WP8A 3SCLE 2AQ4A 1NSPA 3GJRB 3PTWA 1NKBA 4CCHA 4RUBA 1FTCA 1K0VA 1MMDA 1PILA 4ZVQB 4NI2B 2G2ZA 5JUMA 4ZVEA 4ED6A 3HPOA 3QIDA 4X84A 3TEGA 1IJFB 4ECUA 3V4IB 3BBFA 5LL6d 3C14A 1VYAA 1S76D 3KG1A 2DIUA 1BD6A 2ZH3A 3WQPA 1RHJB 3CC2S 3KLIA 4ZCLA 5E0OA 2PDAA 2XMVA 2PE8A 5H1SV 3B6BA 3PYGA 1Q7LB 3NY0A 2QFJA 2VRDA 2UUBF 2HFZA 3UNGC 2CG4A 3C16A 4G1QA 4OYWA 3RW6A 2EORA 3QZ8A 4DV0F 4K8RA 3PX6A 2ILZA 1N4LA 4CLWA 1Q5VA 3BO4A 2U2FA 3KJNB 3UFCX 4CLPA 1S9FA 4EGLA 3IXQA 1R8PA 2BRLA 3Q86A 4XDDA 1WD6A 2V88A 3THNA 3KJQB 2GCFA 4TU9A 3DRSB 4DR4J 3BKFA 4A8OA 1LK7A 1SI9A 1TL7B 4DSJA 5B0GA 2YNGB 4M2ZA 2ZJPQ 2P5VA 5AXMA 1G6BA 2EN6A 2MKNA 4NI2A 4LVOP 2EMHA 2W9CB 5D6GA 2HNDB 2AIRB 4O4GB 3THOB 3R7BB 2MY8A 2EL5A 1FKPB 1ZZNA 2GLIA 4KQZA 3OFHA 3V4IA 2OEKA 3LP1B 2DB1A 3IWBA 2EFNA 1VC0A 1NSAA 2J8SA 5ETTA 5CFFE 4U7CA 4JYAF 4ED8A 5FIIA 4NRTA 3UDLA 4IR1A 1HQEB 4ZPCA 4C8NA 2DNQA 4FYXB 4X62J 3I0SB 5EUHA 2YTJA 5H9EK 2FHKA 4FKXA 4JI4F 3AJ2A 2NREA 1S4FA 2B7BB 1GEHA 4C8OA 1T3NA 1SIWB 2H5IB 3DYAB 5J2MB 4O5GA 1VRTB 1RT2B 3KG0A 1EH8A 1PYSB 1SFEA 5KOXA 2QN6B 3DXBA 2WONB 1WG5A 2HVDA 2NUHA 3QGIA 4HH1A 5MLCV 2OUGA 2RTXA 1BQMB 1TL7A 4DV4F 2P2CB 4A4JA 2YNGA 1ZM2A 1NRKA 1U25A 2Q66A 3NAIA 4L3KA 3SSRA 1TL5A 2EMFA 1U6FA 1YZ6A 4ZP9A 2W9CA 2HNDA 4O4GA 2B9EA 1DAXA 2RNEA 4E98A 4ED1A 3R3TA 3VR1A 1FKPA 3KFWX 3Q2SC 2DR8A 5IM0B 4USJC 3NWRA 1LLMC 4UOHA 2HRTA 2NCKL 3PZPA 3T9ZA 2N4DA 2EM0A 1RHUB 3BREA 1IBMJ 3MEKA 3EXCX 2L6MA 3MR3A 1KBRA 1RISA 4QPXA 4TXSA 3T19A 2KHXA 2Z0GA 5TSEA 4LRFA 3QGHA 4C8KA 4JV5J 2UVWA 3RZAA 1M5VC 3M8QB 2YTQA 4CLSA 2EN7A 4K4XA 2HK2A 3QG5C 4B9LA 3DYAA 5J2MA 1I6JA 1ZPWX 3VAHA 4WZMA 2EOIA 4ANDA 1VRTA 2EPAA 1SH3A 4CLKA 2WONA 4PG7A 2H51B 3CDAA 4LF8F 4O44B 3A8KA 2IFXA 2CPZA 3ZZ0A 1BQMA 4TVAB 4ES3A 3OTOE 1RT4B 1X31C 3NS7B 5IV3A 1DTQA 2J9DA 2CADA 1KKHA 2AGQA 2A10A 5GAHI 1UFKA 1JJ4A 1TL3B 2VUGA 5A0YB 1N0VC 3K7RA 2FLPA 2K7KA 2DK2A 3KNGA 4RKUC 3T5JA 1DY3A 2GS8A 3BGOP 5IM0A 1P9QC 4JB8B 3SCJE 2R1FA 4GKKE 2LQJA 2PT0A 4OI6A 3VTIA 4R2EA 1T9YA 1X49A 5IXUA 5GVQA 3AFGA 1BC6A 3ZTRA 4DCOB 5CD4H 4KHMA 2JR1A 2MC5A 1S49A 2V8DA 4CTAB 4J37A 4ZVTB 2HQFA 2HHHF 4HT5A 2CTDA 3M8QA 4HH0A 5GMKa 1KEKA 3MUMP 2EWHA 1RAFB 2RUGA 2WBRA 5KG7A 4L6V3 4IS1C 5KL3A 4U8YA 2RJZA 2RPCA 5IT9Y 1IN0A 3NGTA 1EKRA 2XSFA 3G6ES 2ZWOA 3T1HJ 2ZH7A 2BVZA 1S59A 1VBZA 3D1OA 4FS2A 4Y6IA 2RUSA 1YZ7A 3CEDA 3GMGA 2CG8A 1RT4A 3L7OA 4KH1B 3BKTA 2KYZA 1JIHA 1N56A 2PI5A 2KRRA 4C9DA 1N0UA 5DG9A 5IT0A 4WYLA 1TL3A 1X9MA 2EMYA 1WF0A 5A0YA 1DURA 5IC4B 2KONA 5DM7Q 1SC6A 2CZVC 4URQU 5LM7E 1KSPA 1S72S 2EOYA 3MR5A 1HNWE 2CQ0A 2G2OA 4M95A 4DFJA 2OMLA 4JV0A 4PG8A 2ZUGA 2RDJA 3M8RA 2QLBB 4WIIA 4WP3A 3PYDA 3DRXA 2HWHA 4YY3E 1K0TA 4GZNC 3MDFA 1HNVA 3P8BB 4KH0B 2DGOA 1UZHA 2H5EA 3JB9k 4CTAA 3NS5A 1NHUA 4DS4A 1ZM3A 2RS8A 2Q43A 2WK4A 4FN5A 5LLQA 4M5NA 1HNXJ 3A3NB 3HHEA 2DSYA 5LMUF 2ZH5A 3LAMA 4J91A 2XZDB 2KHCA 2M7QA 5EGYA 2QL7B 1WEXA 2AZ3A 2HIYA 3K2YA 3DLGB 3BBBA 3AA8A 2VV5A 1IBLJ 3M2VB 4B3OA 4DR3F 3H4DA 3JAMC 2DCUB 2B7VA 2HGLA 2J7KA 1Q7YT 1HKAA 3CDWA 1ROFA 4BWJA 2BQUA 4M1KA 1V6HA 3KUEA 3W63A 4W92B 3BKUA 2M3DA 4DV1F 1KVJA 1IBKE 4IG3B 1OWXA 3HQ1A 2ATCB 2AYMA 3PRVA 4BLGA 3PACA 2EPUA 4TUIA 2Y1IA 2XSJB 2BEFA 1Q4RA 3C6KA 2I9IA 4ANEA 4XPEA 3IFEA 2XBPA 4OJ3A 4AXIA 1K1QA 1GTKA 2FIUA 1XTZA 4MK7A 3AODA 3J7YU 3OW2R 2HW3A 2V2VA 2CQGA 4F0MA 2VHGA 1TK0A 3R2CJ 4ZYEA 2XYPB 3MM9B 3ENAA 1UBDC 1NAQA 1YITS 3TRGA 2LQ8A 4C4WA 3S7RA 4ZHRB 3TJ8A 4S0MA 3SDEA 4WF9Q 1TMJA 2R7VA 3MM5B 2LCEA 3DLGA 4PZVA 4JOUA 4QYZK 4ZLJA 4CH0S 5E41A 2X1FA 3M2VA 3HLUA 3TUPA 3T1YE 3VGTA 2EOZA 1TKTB 2F63A 1XNQJ 3QSYB 3J7ZT 2EN4A 3NEKA 1OYEA 4Z7CA 3MM6A 2FJWA 4I4BA 2EOXA 3UK3C 4H4KC 2VDHA 4IG3A 4WPAA 1LV5A 4LBPA 3CO9A 2ENHA 3FSIA 1AROP 4HHUA 1WEYA 2XSJA 2PSZA 5CA5A 2DH9A 2Q6CA 1RK8A 3CJKB 3OLAA 3G2XA 3BEGB 2D1CA 3TAQA 2W8KA 1CPZA 4GVBB 4ZPTR 3M7VA 1PJSA 3GIKA 2MQMA 2EPZA 3VQTA 2PFFB 3MM9A 1VQ8S 4JI5J 3ZOQB 4MTPA 1ZM9A 4DR7F 4ZHRA 1EARA 4F2SA 5U47A 3EX7B 1JXEA 2D3ZA 4WSGA 5F0UA 3QRRA 1FRMA 3DXSX 1T9TA 1WC1A 2KH9A 3EMTA 2F9DA 4IFYB 3DLJA 3HFZB 1ACMB 5LL6R 3MTKA 1FF2A 1TKTA 4R2SA 1TMMA 1IQZA 5AXNA 5ETVA 5DDRC 4USTA 5HQLA 4LFAJ 1HIYA 3V4MA 2ASDA 4KV8B 4JBCA 2CPJA 5D0GA 4Q7AA 3MHSC 4PEOA 3DLHA 2EM3A 2XULA 1DRZA 4JUZA 3GFYA 2RHSB 3I6PA 3CJKA 2PEBA 1DI2A 2V86A 4GVBA 3E8OA 3CJ8A 2UVUA 2GGPB 2KM8B 1RT6B 1Z2LA 1X9SA 2ZNZA 1FX2A 5KG1A 4DFKA 2AJ4A 3R5BA 2VFVA 4MKVA 2BOPA 4LF7E 3GWCA 2QL5B 1TELA 2HGMA 4IFYA 4AQYE 3BPDA 3GIJA 4DCPB 2N7CA 2Z8QA 1QM9A 3M2RA 4KC5A 3UQSA 3ENVA 3H59A 1UL3A 4NLRA 4C97A 4Y2AA 4UW2A 4U96A 2WSCC 1WF1A 4LF1A 1EH6A 1UVKA 2HHPA 3KZYA 5KT6A 4IOAQ 2MZRA 3BGHA 2MHEA 1YZ9A 3QAUA 5A6AA 1XR5A 2IA6A 2LUPB 2J76E 4BBYA 4J5OA 4PWWA 4OZ0A 2R8HA 3OV7A 4ZLPA 2MKDA 3EPGA 1QY7A 3MCNA 1EH7A 1X48A 2Q6BA 2J7UA 2FLNA 3SYZA 3M6VA 1RAAB 2FC9A 3BYRA 4YP3A 2KJVA 2J6UA 3OJUA 2XO6A 2GGPA 1RT6A 4OV6A 1F3FA 1FWPA 1RI7A 3CUNA 2D3OR 4OLPA 1FDBA 3KLVA 1YTYA 4LBIA 3D0GE 3UE2A 1RT5B 4NMXA 4AL7A 2B56A 3HVRA 3ITHB 1VQ7S 3M9NB 2BM1A 2C2ZB 2MDGA 3CD0A 1C1CB 3AQPA 3W5ZA 3TVKA 1QJHA 1RBLA 3KK2B 1RXOB 2W01A 3FSYA 5E7OB 3W2VA 2CVIA 1H2VZ 1NJZA 4DPWA 4JI3J 3N5BA 2WB4A 2ZKUA 3SCKE 4DV0J 1QVGR 2CJBA 1QD1A 3PR5B 5HROB 4EUVA 1XQIA 2HBZB 2AU0A 5LOQA 2BE2B 2EM4A 5K9FA 2YNFB 2E9TA 5D0EA 5F0WA 2EN2A 4K4TA 3KHRA 2OEMA 1IM4A 2DKOB 3G6XA 4DSLA 1I5OB 1U26A 1N36E 2IRXA 2MYFA 5HMYA 2XGQA 1FRLA 4FNHA 3D1QA 2C3YA 3W62A 1RC7A 3J7Z5 1RT5A 2ADRA 4AL6A 3ILOA 3VF0B 3HK2A 3W65A 1RBOB 3ITHA 2L92A 3OFEA 1WORA 4M8LA 3OTOF 4JI6J 2YTOA 5KFCA 4F4WA 2EOJA 1C1CA 5T41A 4JYAJ 1UPPA 1VMBA 3KK2A 2JLGA 2XI2A 2MJNA 1Q78A 4YB5A 4DV5E 1CS4B 1Q53A 1UHZA 2DRDA 1DARA 2IDLA 3PW4A 3M8ZA 1KQGB 4JI4J 3JSRA 5B0DA 4IJDA 2RT3A 1FHTA 1KD1T 4GKKF 4DUTA 3CCRS 1FNMA 1HWKA 4LJMA 5HROA 4QPTA 2YPYA 3ZXWA 1U49A 2UXDE 1G7CB 2BE2A 4CO4A 4PWUA 2YNFA 2ZHOA 4DUZE 4YHHJ 2GHWA 5CZVA 5KG6A 2EMLA 2EPPA 3E3XA 3P5TL 4WE1B 4NOHA 2UU9E 3QO9A 3AB2B 2ATLA 5D3GB 5CZXA 5DDOC 1RB0A 4ICLB 2ZVIA 3WX4A 4GC7A 4AE5A 4FKYA 2FHJD 2XWYA 3K5LA 3MUTP 2MKIA 2EN3A 2JHEA 2RS7A 5IXMB 1UFWA 2B7CB 1CS4A 3I82A 5ETOA 1Q8LA 2B9WA 1VLYA 3THVA 4IRDA 1U48A 1HNWF 4KT0C 2UUCE 2G13A 3PKYA 2IRYA 4ZVHA 4TQSA 1SQGA 1KYQA 1WWHA 5JVHQ 1A1KA 5J2NB 1C4AA 2N82B 3X1LB 1RHKB 4C0OC 1SUQB 4YY3F 3OTCA 1CJKB 2DGCA 1N5YB 3BQ1A 4PR6A 3KJVB 1RAIB 1SC1B 4K4WA 1OYDA 1U47A 2ZH9A 4WE1A 3FVYA 5HVGA 5D3GA 3FGVA 4WU2A 3K5NA 4ICLA 2CPHA 3K0JA 3TQMA 2M8DB 1RWOB 1F9FA 3ZZZA 4I67A 1R31A 2F1FA 2MLZA 3RYLA 2ACMA 1X4BA 2K1RB 3J81U 2NPFA 1HPZB 4NA3A 1ZTWA 1P1TA 1VQYA 1Y0HA 1S57A 1X3CA 4GMKA 4R5PB 2ZBIA 1YX2A 2CQCA 2O3DA 2C1EB 2MTLA 1TZ0A 4P6QA 2KI2A 1NBEB 4HVZA 4ECTA 3SV4A 1FNOA 1UW4A 2KL8A 1IBCB 1IBKF 1ZTTA 3KDOA 5KFRA 3CULA 4GKJJ 2D9HA 3H5SA 1SJ4P 3R27A 2UXBE 1RDRA 2VQFE 5J2NA 1R6VA 1IJEB 3PX0A 4DV2E 1ZAXA 2QV6A 1SUQA 1O51A 2ZC3A 4HYKA 1CJKA 1N5YA 4XO0A 3J80U 5F8JA 4NXME 4DSEA 2J6TA 4F36A 3EUNA 1RA7A 1GH8A 4GVLA 3AXKA 2C2MB 2QA2A 3CVKA 4CO5A 4A8SA 3KDNA 3CTRA 1D09B 4LF6E 2GQQA 3QT7A 1UMJA 2W9AA 1KFSA 4R2PA 3VZHA 3HHLD 2E1PA 4O3RA 3I9ZA 4F4XA 3V6JA 2DR6A 2VOOA 1X47A 3PR4A 5DLGA 4R5PA 4UTGA 2FY8A 4PG4A 5G0RB 4DEZA
chains in the Genus database with same CATH topology
3S01A 3OJSA 2BA9A 2JEGA 4R8OA 3BJYA 3Q0AA 3J7Yp 3MEGB 4MK8A 3GR1A 4WKYA 2ZJQQ 3K57A 3R1HA 1TKDA 4QWBA 2GJ2A 5A8WB 5BR8F 4TLRA 2L9NA 1DBDA 3T3FA 4H4OA 1FRXA 3DRPB 4ID5B 4O3SA 4DR1E 1FJCA 1JK9B 3CXCR 3Q8RB 4B3MF 1JNZB 4DHVA 4HTJA 2DCLA 5JJBA 3LP2A 3NGDA 4LFAE 2DNMA 2MZJA 2IM0A 5AXLA 2VONA 2MQNA 1SKRA 4Y2MA 4NCAA 2DPJA 2IA0A 3DCAA 3VCDA 3OBIA 3M9OB 1UVIA 2DIXA 4J9RA 1VQ5S 4NZ6A 1QSLA 1UVMA 3QWUA 1QAJA 5CYMA 4QW9A 2XG8A 3GR0A 2D7SA 3LPYA 3KK3A 3MPWA 1UILA 1P27B 1S6PA 3P1XA 3IGNA 4OJGA 1NJIT 3JTPA 1M0SA 2QMXA 3RTVA 5A2QC 2IJFA 2LQ5A 2HWTA 4OI1A 1TL1B 1AXQA 4G6VB 4DS5A 2QZ8A 3IR7B 2OP5A 2KTQA 2LTSA 4CNZA 4LT6A 2HNYB 3BGLA 5KG2A 4TU8A 1SJQA 2ILYA 3AHPA 3M6UA 4J9OA 4C8LA 2WZOA 4KV8A 4K0KE 5L8RC 4JI1F 2VA2A 2G1DA 1HYSB 3IRXA 1N88A 4M5DA 3AAWB 1S7HA 2MPUA 1Y3KA 5I4MA 1VFJA 4F50A 1UWBA 2V8QB 1UP1A 1X5PA 2EK6A 3AQOA 4EZ6A 4YB7A 3HZEA 2VG7B 2ZD1A 2FJVA 2VODA 4NLDA 1XR7A 3CCTA 3R5CA 5KFPA 2HHVA 1KQSR 2DMYA 2N3GA 3GFZA 4OFZA 5J2QB 3CCSS 3GV8B 1XWLA 1NK4A 2PEHA 4OX6A 1JLQB 1R8BA 4PPDA 3NCRA 4DL2A 2F3JA 3NS6A 1SJ1A 2XZWA 3KHLA 2V8HA 3QGPA 4QZVB 2M7SA 4P7VA 2GHVC 1MNEA 5BJRA 1XMOF 4KPYA 4DMZA 3G6VA 1AFJA 2J0QD 4NWBA 4LVNP 5AXKA 3VAGA 2R7TA 2RSQA 2H36X 1M1KT 2VE7C 5C25A 2N7YA 2IMOA 3IG1B 4DPOA 3SFUA 4UQGA 2VQFF 1PC5A 4LSNA 4TKTA 1GQEA 2FJBB 3VAMA 3HFKA 2YWGA 3B4DA 4NYPA 3CPWR 2HRUA 1SKWA 4FXWA 5LMUE 3TA0A 4CZCA 3KLGA 4I2PB 4I0WA 1D8ZA 5G0RA 4TYBA 2VPYB 1KRPA 2G0CA 2RU9A 3DU6A 3VAFA 4B9NA 2V8VA 3MEGA 4QJVA 3W3SA 2W8LA 5FDLB 3CSKA 4DV7E 2IM2A 3E51A 4NL5A 1HBNB 2MKKA 4DQIA 5F8IA 5A8WA 2EWLA 3TOQA 2KRBA 2JWNA 3DRPA 4ILRA 4ID5A 5H9FJ 4F4YA 3F6GA 2VH7A 1NK8A 2V94A 1TR0A 3D1HA 3TO8A 2HHWA 2XI3A 2VF1A 3UCUP 2RRNA 2KXNB 5HLFB 4CNYA 3MCSA 3H2UB 5KG0A 4DR3E 2IM3A 4YDXA 1W2BR 1FE4A 3WC0A 1M5HA 2L2NA 2LDIA 3CMES 1FKOB 2KFNA 2JC0A 2VQEF 3VAIA 4LF6F 4NRUA 2DGXA 2QO3A 4DF4A 1URNA 5KFIA 2KT5A 2RD5C 2J9CA 3KG4A 2GA7A 3G6YA 1KR4A 2VA3A 1HNVB 1YSJA 2Y1JA 2LXUA 2VPXB 2OFHX 2CQ3A 1V3ZA 2E1MC 2C42A 1RAJA 3N6NA 3T6BA 2ZM6F 2J9EA 4X66F 1Q16B 4IH5A 4TLQA 4DV1E 2KOUA 1H0HB 3PFOA 2KFYA 2L41A 4IOCQ 2HYIB 1TL1A 7FD1A 2GMJA 3RR7A 2AJQA 5L9XA 3HVTB 3WDOA 2W7AA 2HNYA 1LWCB 1H2UX 5AE3A 3MEDB 1QAIA 2NSBA 2XCAA 3CMAS 3GYNA 3VQSA 4DUZE 4DR5F 1XNRF 3K8WA 4DG1B 3ADIA 1DQ9A 2RQMA 4U6PA 4PWDB 3P49B 2MMYA 5KFUA 2LXIA 2BACA 1M5PC 1HYSA 3RRKA 4X2BA 2JX2A 2FB0A 4PRFA 2L2KB 2C2EA 2FVRA 3FSXA 2NUFA 2BABA 2DNZA 2CJAA 3G8QA 4LF7F 3KYLA 2X3GA 3DU5A 3GV7B 2EPIA 4BMJA 2VG7A 1H7XA 4ID8A 2XY6A 1X4EA 4HI2A 4ED7A 3DLKB 1UJ4A 5J2QA 2EVZA 3I87A 1PO6A 3C4TA 2ZOMA 3DHXA 4WU3A 2ACYA 4WFYA 1HI8A 4ZVFA 1JLQA 3EZ5A 3CCJS 1NK0A 3EZUA 2HNZB 4B3OB 1E6VB 2XGPA 2WTFA 1CC7A 2VBZA 4L3NA 2KHDA 5M2RA 4F4ZA 4I7FB 4YOEA 2E5JA 1PKPA 2BBEA 3CWJA 2UXCE 3NMRA 1HWUA 5EWEA 2E1CA 3I56S 3PVXA 2YQ3A 4B9SA 5MAOA 3IG1A 2F8MA 5T6JA 2DNRA 5L1KA 4CO3A 4PKDB 2ODRD 1WTBA 2JZ5A 4EBEA 1NK5A 4I2PA 1G2EA 4GEQB 5D4LA 3U1NA 3TYTA 4WKRA 3VALA 4Q28A 4RW9B 4A8KA 1QE1B 2DR7A 1GT8A 3RRHA 5LXYA 3BGFA 2FGGA 3N28A 1XR6A 1Z2ZA 5FDLA 1S10A 1YIJS 4X4SA 2HZCA 4BC9A 1HBNA 2LTRA 1FVSA 2NYIA 2YWKA 1WG1A 4WXWA 3FMBA 4KHPF 3PY8A 4ILLA 3QWPA 2BYCA 2M4IA 1O5JA 2AYEA 1FXLA 4JI3E 2QYCA 1U1RA 2ZC4A 2M4MA 1S6OA 5HLFA 5I3PA 5I3UB 3PDNA 3M4XA 3HVWA 3N79A 3NBPB 3SMZA 4C98A 3H8YA 2LUQA 4FVCA 2M1SA 1UEUA 2ADCA 4CO0A 1FERA 4CH1A 3EYZA 2CPXA 4G1IA 3U27A 2OIHA 4W90B 2RQKA 1HMVB 1FKOA 1IXKA 1HBMA 4KO0B 4QR2A 1U1KA 4EU0A 5F3TA 4Y0FA 2DH8A 1WXRA 1O0WA 2ALZA 4TQRA 1YQHA 3R5DA 1IBMF 3CC4S 5KFKA 4ZS6A 2AF6A 4MK9A 2DNKA 5KFSA 4QWEA 3LANA 1HFEL 4UY8T 1RTIB 5ADZA 4LFBE 3GSDA 2R7QA 5D4OA 3KOAA 2APOA 2GMHA 3M05A 3HVTA 3PM9A 4J9PA 1ZBTA 3KNAA 1LWCA 4WFNQ 3MEDA 1JLAB 3EXYA 5KFOA 4JV5F 2LCWA 3OR1B 2PGCA 4DG1A 3N4WA 1MW7A 3HHLC 5F9LA 2KVIA 3SDEB 6FDRA 1KLMB 4B9UA 4PWDA 3OVBA 5KOWA 4ECYA 4NPOA 3KMSA 2YX7A 1ZETA 1S99A 4ES1A 4XAKA 5DQGA 4DV7F 2W7OA 3NNAA 2B5JB 1NO8A 4USIA 3N6MA 3HPZA 3C8YA 5KFEA 2GO9A 4R03A 1P1LA 2LQ9A 3CE8A 2V2KA 1SIZA 3H25A 1SKSA 2AX0A 3NCPA 3GQCA