1ZBTA

Crystal structure of peptide chain release factor 1 (rf-1) (smu.1085) from streptococcus mutans at 2.34 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
320
Chain Sequence
HHMNIYDQLQAVEDRYEELREEANSRETVAVYREYKQVVQNIADAQEMPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHAKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDATVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide chain release factor 1
publication title Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
rcsb
source organism Streptococcus mutans
molecule tags Translation
total genus 96
structure length 320
sequence length 360
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00472 RF-1 RF-1 domain
A PF03462 PCRF PCRF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zbtA02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbtA03
4YY3E 1DI2A 4KHPE 2LBSB 1WHNA 4DR1E 3OTOE 2MDRA 4JI0E 2KHXA 4DUZE 4B3RE 2L3JA 4X64E 4DR2E 4LFAE 3ADIA 2UUCE 4LF5E 4NXNE 1STUA 4YHHE 2N3HA 4B3SE 4LF6E 2L2MA 4M30A 2DMYA 1FKAE 4JYAE 2B7TA 1N34E 1HR0E 2LJHA 1YYWA 1N32E 2VQEE 5BR8E 4DUYE 3T1HE 4DKKA 4JI5E 3VYXA 1X48A 1GQEA 4JI7E 1J5EE 4B3TE 2LRSA 2DB2A 1XNQE 4M2ZA 2RS7A 1YYKA 5IWAE 2DIXA 4DV7E 2L33A 4JI8E 2RSMA 5CFFE 1UILA 3ADJA 4LF8E 2HHHE 3ADGA 2L2NA 1YZ9A 3C4BA 4DV1E 1YYOA 1N36E 4OX9E 2N3GA 1RC7A 4X66E 4LF7E 4DR5E 1IBLE 4K0KE 4DV2E 1O0WA 4JI3E 4OOGC 2RS6A 4LF9E 5LMNE 2L3CA 1T4LB 1I94E 4LFBE 1ZBTA 2NA2A 3LLHA 1EKZA 1WHQA 1J26A 2UXCE 4DR6E 1IBME 2CPNA 2L2KB 2LTRA 4GKKE 3VYYA 2NUFA 4JI2E 2E5LE 4NXME 2VQFE 2LUQA 4DV5E 4DR4E 4JI1E 1N33E 4DV3E 1UHZA 4X65E 2LUPB 1FJGE 3T1YE 4DR7E 4DV4E 1QU6A 4JV5E 1T4OA 3J7Yp 1PKPA 4WFTA 2ZM6E 1XMOE 1HNZE 4JI6E 4LFCE 4X8WA 3P1XA 2UUBE 2UUAE 3C4TA 4AQYE 4LF4E 4X62E 2JVAA 1HNXE 2LTSA 1IBKE 2YT4A 2IHR1 4B3ME 1X49A 2UXDE 5LMUE 2B3TB 3HTXA 2JY9A 2B7VA 2UU9E 1T4NA 4WYQB 2F4VE 4DV6E 2UXBE 2NUGA 4DV0E 1X47A 2RTXA 1RQ0A 1HNWE 2EZ6A 4GKJE 3ADLA 1XNRE 4DR3E 4JI4E 2NUEA 1XMQE
chains in the Genus database with same CATH superfamily
3OBIA 4HVZA 2HBYB 3EPGA 3C2PA 1Q8IA 1HHQA 1S6PA 2HLUA 2WSCC 4IDKA 2UUCE 3MFHA 4LSNA 5A6WA 5HSPA 4N56A 1GX6A 1GNKA 2HQDA 1N32E 2OAUA 2BDPA 3C6TA 1V3SA 2ZM6F 2RHQB 4DDFA 2YBVA 1NK8A 2CKWA 3HO1A 1N56A 2V9KA 4KTQA 5D8HB 4WU3A 3FCHA 5A8WA 4PYAA 1RHJB 2AYEA 1S7HA 4NLGA 3GZ7A 1RCOB 3F73A 1TL3A 2RU9A 3AQPA 3GG0A 5GAHU 3KK2B 1HI8A 4DL0C 5HATA 1S9EA 4ED0A 4CYUB 3B8HA 3SCLE 2BBGA 3NGSA 1NJZA 2EPIA 3BKTA 3I4PA 1NU4A 2EJ4A 2HNZB 2VU5A 1U1KA 3TNVA 1YJUA 1D9DA 3M8QA 3DRSB 1UL3A 2CJXB 4ZYGA 5C25B 2UVUA 3QFHA 1A1IA 4P9SA 1YGYA 3CO0P 2F9DA 4OI6A 1XNRE 3POTA 1HI0P 2DRBA 2DHGA 2V2KA 3A8EA 2K7JA 3R27A 3BSNA 3IGVA 4BDPA 1SKUB 2OPRA 4LRAA 1IQTA 3PKYA 2QJ3A 3G8TA 3FRYA 1S1UA 3HVRA 1QSLA 3CCZA 1GQEA 1UVNA 4Y2AA 2WSFC 4TU7A 3RBDA 1OO0B 1XNQE 2RS7A 3TQ1A 2W8KA 4N77A 5F8IA 3QAEA 4UZCA 2ZH7A 1OSDA 3QYYA 2B4VA 4USMA 2JLFA 1FNMA 1YBTA 1WHQA 3UD3P 4HTGA 4QR2A 1RHQB 2J6SA 1HBMB 2H5JB 2LUQA 2HBZB 2R7TA 2XS2A 4IFYB 1RK8A 2NPFA 3BO3A 4KH1B 3TUZC 4YQWA 3IWBA 3K5LA 3KHGA 4DV6J 2ZZTA 4ELUA 4TUGA 3KZZA 3PRVA 2QO3A 3A4TA 3KLFB 3OTEA 4TY8A 3DC2A 1FKOA 1BWEA 1RBOB 3AJ2A 3ZTRA 4DR2J 2DHHA 2WVEA 1VBZA 1X60A 3SZ2A 3ISNC 2WBTA 3Q2TC 3QZ7A 1I5OB 1JLQB 4OYIA 1QTMA 2R7QA 1RTIB 1N0VC 1Q5YA 4DR4F 3V6HA 1NK4A 4RBTA 2FVQA 1ZETA 5A6PA 2XCPA 1NB2A 3NCPA 3LGMA 3ETMA 2L33A 3DXSX 3IG1A 4J90A 3MMJA 2WK4A 5KG2A 1T38A 4TKTA 5CYQA 1Q7LB 2O66A 2M52A 1BQMA 1Z2ZA 5HP1A 2DNPA 4B9UA 3TEGA 3N6NA 5CABA 1SL2A 2CQ1A 4RU2A 1SJFA 2BE7D 4DV5E 1TKTA 4QIWD 3OMLA 2WBMA 4FS2A 3GFXA 3RZAA 2VG6B 1S1XB 3LA0A 1D9FA 3H5XA 2HBQB 1FKAF 1NCLA 4K5SA 4L3KA 3ZTPA 3C19A 2NXJA 3H98A 5BJRA 1H72C 5IXUA 2RIJA 1AUSL 1S0MA 3EXYA 4ZDNA 2EBEA 4ECYA 1U02A 1HWUA 1WC0A 2W9CA 3D1QA 3PW2A 1Y00A 2LA4A 3GIRA 3IR6B 3J81C 3A13A 2A10A 4Y28C 2YKQA 2IJRA 4OJ3A 4YP3A 4ZP9A 5CZXA 4M5HA 4ZVRB 3Q8UA 2QTWA 1EQ0A 2CJAA 2IM2A 2Z2ZA 2YWHA 2L6MA 2QEXS 1IBKF 2CQGA 2E5JA 2GX8A 1RKJA 4DQSA 1XBWA 1H74A 1HQ2A 3MMAA 2E1MA 4AL6A 3V4IA 4DR3F 1EH7A 4R0EA 4RBUA 4OYWA 2J7JA 1TUWA 3BKUA 2DEIA 2FDNA 1IM4A 3H4DA 3M6XA 4DL7A 4N8NA 2ZM6E 4RW9A 2H4WB 1WEYA 2VJUA 3CJQA 2RQLA 3BYPA 2I38A 3EE3A 4F54A 3TVZA 3TR5A 4F6MA 1QSSA 1WDTA 2EMKA 1PJSA 4Q5VA 3LP1B 1FK9A 4DX6A 4CDIA 3M05A 1U1OA 3AOAA 3BH7B 3NG8A 4B3SJ 2APOA 2KHCA 3I31A 3FZBA 3BSCA 2P9GA 4M5DB 4X4RA 3NY0A 1NDKA 2EPAA 3IWLA 1OIAA 3T1YF 2MYFA 3BBBA 4K4YA 1PIEA 4ZJLA 4JYAJ 2AMCB 1RTHB 3AH6A 4FVCA 1YRUA 1V9OA 4U8YA 4NLRA 2HHUA 1NHKL 3VHQA 1JLGA 2F4VF 3VQTA 4FK5C 2KVQE 5HANA 2N4DA 2D9HA 1DLOB 3CJ8A 4F2RA 4NLOA 4IH5A 3VVUA 2XHCA 4BHBA 5LMUJ 2C3YA 5IT9Y 4I64A 4QYZK 2LQ8A 2R3VA 1VQ4S 5DM7Q 4WP8A 3I5BA 4IG0B 5B0AA 5DQHA 4GMKA 4P10A 2CVEA 3J81j 2NXCA 3PVXA 2DHSA 1YDLA 3K0JA 1Q5VA 2FLPA 2BJ8A 1ZM3A 2B9XA 2PT0A 2NSCA 4IR1A 2Y0BB 2NREA 4C8OA 3M32A 3QBCA 4BWMA 2FJBB 5IS2A 3DDKA 3CGIA 2QSWA 2ZH8A 1FD8A 3VZHA 2PFDA 1LQ9A 4P7DA 3VAKA 4Q45A 1AROP 1RHRB 1XK8A 3MEGB 2YU5A 4L74A 4R2SA 1TV6B 5LJ5Y 1X9WA 4WIIA 1B64A 3WDOA 4CIOA 1V6HA 3US5A 1S6PB 3W8PA 1UFWA 2XC9A 1O6XA 4ECWA 1SC3B 2DPIA 2Q1LA 1YPNA 4DR4E 1WORA 4LSNB 3W5XA 1VLYA 4C6AA 3NAHA 5L1LA 4K59A 1BGXT 2MC6A 5B0CA 4A8YA 2X1GA 3C6TB 5FLXU 2AJQA 1MNEA 2V89A 1RAIB 2FQQB 4ZP7A 2X1AA 2QA4S 2ZZNA 2UUAJ 4P2XA 5A8WB 3TWZA 3G6YA 1TL3B 4F2JC 4J8ZA 3SMZA 2LECA 1S9EB 1FWKA 4WK3A 1JLAA 2PMHA 4DR6F 2ENHA 1OYEA 3MEEA 1FKAE 2EMCA 3Q24A 1VQ7S 2HMIB 1FJGF 5SUHA 2YTIA 2CVIA 4ED1A 3GIMA 3KLIB 3M8QB 4WWSA 1JNRB 3HPSA 3FCVA 2X3DA 3PTWA 4IG3A 5EX0A 2JFDA 4DF4A 2DLQA 2N82B 2WAQD 3CDBA 2CT1A 3POTB 4OHWA 2L9DA 4WU2A 2CPNA 4N76A 2KJVA 4RWWA 1T9VA 2D9OA 4ZVGA 1UHZA 3HT3A 1QU6A 3RBZA 2IIHA 1FCAA 4DJBA 1IQSA 1S1UB 2CADA 5LOQA 1YUJA 1IBKE 4WSPA 4ECQA 3H09A 5KFNA 3W9IA 1RHUB 1IKYA 5KFEA 2PI4A 4DPTA 1JLEA 4FN5A 5BXIA 1BHNA 3J7AN 3CJ3A 2G2OA 3D54A 2CAJA 2E1PA 4DR3E 3FSXA 1TFYA 2DH7A 2A3JA 3IO1A 3LGHA 1TR0A 3BBCA 3BJYA 1B0TA 5HK4A 1UJ5A 1WG5A 2DR9A 3IR7B 4ZVTB 2D3ZA 4IO9Q 2AEMA 4PPZA 2OHDA 2RT3A 3QLHA 4Z2XA 5GADU 5LSOA 2UUCJ 2IYGA 1HQUA 2NZ4A 4MFBA 3UCGA 2CG8A 2LEAA 4U95A 1N32J 4P2FA 2E72A 1TF6A 2OIHA 4TY8B 1FKOB 4LBPA 5HN0A 1H73A 2VQFF 2E5IA 5B0GA 1YIJS 4DHVA 2HHVA 3SCIE 2JXPA 3IBFB 4YR3A 1REGX 1X31C 1NH8A 1FX2A 3T1YE 3O2IA 3RU0A 2BJDA 2I1RA 3PX6A 4C0BA 1BC6A 1SH2A 2D3O1 4TUIA 3P5TL 4EMDA 2R1FA 1Q0NA 5BR8F 2KRBA 3KXDA 5KFOA 2GAHC 2F4VE 2XTJP 3G71S 3IG1B 2QX0A 2FB0A 2VPWB 1D3WA 1IQZA 2RKIA 1FRLA 4A8OA 4DMIA 1ZAWA 1HPZA 5CYQB 4ER8A 4BCAA 2JNJA 1BQMB 3IBCB 3CJ0A 1SKWA 2OKQA 3THPA 3HULA 1TKTB 4DL5A 2C3UA 1LFWA 4X4SA 4K2XA 3SV4A 3SQOP 2RU3A 2BJ9A 2HVZA 1Q79A 1A1KA 3EGWB 4NWBA 2LKZA 4PABA 1YLXA 2W2PP 2E5GA 2Y1JA 2J9EA 2HRTA 1WG1A 2Z2MA 1DQ3A 1Y4ZB 3R5AA 2RS6A 2DCUB 2W9BA 2DGTA 1N5YA 1T8EA 1XNQJ 2P8IA 3BSAA 4M5LA 2VA2A 1B4SA 2XYGB 3CIMA 3CW2C 5F3TA 2CYYA 2R8GA 4B02A 2DY9A 2ZH6A 2VIHA 4YHHF 1JJCB 5LM7E 4ZJQA 1QDUB 2PRTA 2QG9B 1IJFB 5IT9C 5EWGA 4JI7F 4O4GA 3UO0A 2OJ3A 1RB0A 2F9JA 1Y5LB 1RT2A 2K3IA 2K1RA 3OLBA 2FHKA 4B9VA 1LWXA 2R7UA 1AUDA 2NUEA 4NX9A 1BQNA 1AB8A 4O3RA 2VASA 2YPYA 3MMAB 1RAFB 3W2WA 3PJXA 3QSIA 3V4IB 1O5JA 3OSPA 2F65A 2RILA 4K50A 2CXEA 4WKRA 3ZNUA 4R8OA 2G0CA 1YZ7A 2E5LF 2PA3A 4RW9B 2HNDA 4A8MP 2B6AA 2HZCA 3AY0A 3PYDA 3KNAA 4JI6F 4LFCF 1GAOA 4Q7AA 2HWIA 1XEZA 3CF5Q 1TKZA 1QAXA 1T9TA 3ET6B 3AODA 4I69A 2UU9F 1TK5A 4U96A 3TYTA 5KG0A 4DR6E 2DNMA 2LTRA 1TZ0A 1RKIA 1WSRA 5CAAA 3W63A 1S6UA 1FJGE 2BZ2A 3TVKA 4AQYJ 2FJVA 1KOHA 4HACA 2XBPA 4Q8EA 1WC6A 4TY9A 2VFRA 4DV5J 4IKAA 2VQEF 4DF8A 3NWGA 2K7KA 2E5HA 5B0BA 1S4EA 2C2NA 3RB3A 2A1BA 2DNRA 3O5TB 2AYMA 1YBAA 1C4AA 2ZUGA 2A6OA 2YNHA 3M30A 1RT1B 1JLGB 2ASLA 3N9UC 4DV1F 1PKUA 3BQ0A 3PR5B 5E7OB 2NYHA 2AX1A 1U8WA 3RAMA 4OYOA 5B7WA 1NBEB 4RNFA 4ALZA 4F0MA 4ECUA 1VISA 3BGLA 4OI2A 5I4MA 2YSPA 2R2RA 4F0HA 4L3NA 2HBRB 4USTA 1ZR9A 1HFEL 3KLEB 1WHXA 1MROA 3NP5A 1SL0A 3M2UB 3ADJA 2NUHA 2XMMA 4O3PA 5LMNJ 3H42A 4QIVA 2U2FA 2N4CA 2G9OA 4MK9A 4BS2A 1GTHA 4LR8A 2DKOB 3T5HA 2AJ4A 3V6DA 3OHBA 5SZTA 2NUFA 1ACMB 3GR1A 2EM2A 3F41A 4ZLPA 2OGUA 4Q28A 2LXIA 2O5DA 1YITS 5HJYA 1S5ZA 3D67A 4Q8FA 3ISZA 2EM6A 1L3KA 3SDEA 4MH8A 2KT3A 3RGIA 3EPIA 2ZE2B 3MR3A 2ZM6J 3FSYA 5EDWA 3JXOA 3I82A 1B69A 2QFJA 1WHVA 1JJ4A 2LBSB 3DOMA 1FRMA 2PEBA 4WCEQ 2DISA 2I9SA 4J5OA 2GNKA 2JRSA 4X4QA 5BR8E 2QLXA 3M2VB 2MJUA 2PMZD 1H0HB 4ANEA 1JLCA 1N3GA 1RXOB 3EDRB 4MLVA 2JC0A 5EN1A 5A6JA 3HHLA 1NSQA 2J0XA 2D41A 5DZ6A 3HX9A 1S49A 1HHTP 4WPAA 2MKIA 4J9NA 4LFBJ 3AOCA 3GJTB 5KFSA 3IMQJ 3R1LA 4FKYA 1F3FA 4KHMA 4DV0F 4P74A 4LVNP 3EXCX 2Q3PA 4L73A 1NPPA 2ZUAA 3M8PA 1NK6A 3KDNA 3OTBA 5AXNA 3OTOF 3ENAA 2DTJA 4NASA 1UWAA 3MEEB 2MZ1A 2ELYA 2ZBIA 4AD6A 2ATLA 1GZ6A 2CSHA 1FDDA 4UUWA 3EYZA 3EM1A 3MR6A 1NMEB 3U27A 2YQ0A 1MMNA 2H36X 1X5SA 4IG3B 2DCLA 2IM3A 1QY7A 2LXUA 1X4FA 4FNIA 5KAKA 4CLPA 3RG6A 2Z30B 1T03B 1OWXA 4YHHE 2N3HA 3A8JA 4GO7X 2EC0A 1MLAA 1IBMF 2R42A 3BN4A 4ZPVR 4JI7E 4OFZA 3KWMA 3TO8A 3ZNJ1 2I6WA 4QYZJ 1R89A 2AF6A 1IKYB 5E41A 2VC0A 4LQ3A 3C4BA 1JLEB 3PV8A 2FY1A 1KS2A 2FVCA 1WACA 1YQHA 2R7RA 1RE1B 1HWKA 5H1SV 1HNWF 1ULRA 1YRTA 2E5LE 3I9ZA 1TMJA 4R0JA 2LU1A 1VMBA 1FFWB 5L1IA 1RWKB 3PCOB 4A8SA 3MEDA 4JI6E 4LFCE 5F3ZA 1D0EA 1OYDA 1YBUA 2M0GB 4JV0A 1WD6A 2YTOA 4DR4J 2F4FA 2KL8A 2UU9E 5GVQA 3DRPB 2M88A 4B3TF 1X5PA 1LEOA 2LQ5A 5CXTA 4PG4A 2MSSA 1C2PA 1H3DA 3KUEA 1S76D 4HEIA 3ZZTA 3UVJA 4LF6J 1BLUA 1ZAVA 2PN6A 1HR0J 5IFMA 3BKFA 4C97A 2JFKA 1N6QA 1U7LA 3H5YA 1AZSB 3NS5A 1HBOA 2VQEE 2ZJQQ 2QA4G 1J5OB 1Z1BA 3TA1A 1EQMA 2HVIA 1F9HA 2W24A 2UP1A 2DIXA 2QSFA 1WDDA 2GHPA 3VGSA 4X62F 4ED2A 4DV1E 2XO6A 2EFNA 4M5KA 1TK8A 3RBEA 1M5VC 1CS4A 3VWSA 1HPZB 4LR7A 4CZCA 3OJSA 1TKXA 2E66A 4RW4B 4C0OC 2LU2A 1HNXJ 3UFCX 5DDQC 5HLFA 1Y3JA 3M7VA 3P1XA 2UZAA 2ABYA 2BQUA 3F6HA 5E0OA 2E7XA 2MEWA 2MKHA 5LLQA 3J7AG 3NS6A 3CDUA 1BBOA 4F9AB 4IR9A 2Z8QA 2W9BB 1ZZFA 4KV8A 3HD2A 1N5YB 1LLMC 2G1DA 4C4WA 2L9NA 2V2QA 1VQNS 5ETVA 5ETNA 4ECTA 4I7FA 4WP9A 4RO0A 3G8QA 4DR3J 1HNVB 3B4MA 1F2HA 2YKNA 1P9YA 2DBBA 2RH3A 2GA7A 2RJZA 4DV4F 4FBUA 2B51A 5K5MA 3VAMA 2EOJA 1YK9A 3DU5A 2W4CA 3DN9A 3TA0A 3MOJB 5D4PA 2BQRA 1N8RT 2EL4A 4O4GB 3FRZA 2JR1A 3QPIA 5KFGA 1Q82T 5KFTA 2K1RB 4QU6A 1MMLA 2PE8A 2EOFA 4J7CA 3AFGA 1BQNB 3HFKA 4ZS6A 2E9ZA 4C0HA 2MQNA 4U67Q 3KJNB 1JWWA 1IKVB 2VFVA 3KG4A 5L9XA 4RU9A 2M8DB 2UUTA 4I2QA 1OY8A 2HNDB 2Q6CA 4LT6A 4UTGA 3T6JA 3N0VA 2VHGA 4LF1A 3QO9A 4ZCKA 3TI0A 3EZ5A 2V4RA 4DV0E 2B8PA 1TKZB 3EMTA 2JLGA 2IDEA 4CTAA 2EK1A 4GVBA 5HVHA 3OTOE 2CQDA 1URRA 1RTJA 2F4VJ 3L00A 4UY8T 1RLCL 2DMYA 3R9LA 2PO4A 1UN6B 2LJHA 1SKRA 2VDHA 2FVSA 4HACB 1N33F 4OL8A 2EMWA 1JKHB 4OIXA 3PKMA 4K5RA 3L3CA 1VJWA 7AT1B 1DAXA 3OT9A 3PFEA 4TQRA 1JNZB 3KJFB 2XMJA 3QSYB 3CD6S 2DLKA 3FVYA 3M30B 4R2EA 1IBME 1VQOS 3S7RA 1RWPB 2VB6A 1T9WA 4KGZB 5FLXY 1S1WA 4KHPF 2XMVA 2V8VA 3E01A 3PFOA 1N54B 2P9CA 2GVZB 1KWMA 3B82A 2OLWA 2EOZA 1Q81T 3MCSA 4HH1A 1MROB 4TVAB 2EPUA 1K0VA 1FFSB 4CH1A 1HNWE 2K3KA 1KFDA 4LJMA 2HFZA 2HHHF 2XMUA 2V2VA 4DV2F 3V6DB 2OFHX 4KRWA 1H7WA 3ITHA 2GO9A 2L2MA 5D77A 4X4TA 1VRUA 3D6HB 5JJBA 1VRQC 1YG0A 3DHXA 4PXDA 1T05A 3PEHA 4TQSA 3H8YA 5F0UA 3SDEB 4B3TE 5BYRA 2DNOA 3ETOA 1EH8A 4PAAA 3CJ4A 1C1CA 2LO3A 2Z58B 1QVGR 1A6LA 4JI2J 2V4QA 3DOMB 3CJTA 4KY3A 3AD9C 1IM6A 1BXNA 2QMXA 4NA1A 4KE5A 1WF2A 3NGTA 4XPEA 2V68A 3BB5A 4NYPA 4X62E 3OL6A 3QJPA 3MR5A 4YR2A 3SBMA 3MD3A 3J7A1 1S6OA 1M5KC 3HHLB 3QNWB 2ROPA 1WTFA 1XR7A 3GYGA 1XN9A 4CO5A 1XMQJ 1NHUA 2HFOA 1U0HA 4PR6A 3JSRA 2ZOFA 1N36F 3SYZA 4DQQA 5U47A 3UI3A 4DR1E 4LRFA 3KZYA 2YPNA 4LU9A 1FRJA 3M8PB 2D3UA 1STUA 4PWDB 3R5BA 1B99A 4KPCA 1S0OA 2E1CA 4I2PA 1IKWA 1UFLA 5CHCB 4X65F 3D6MB 2WBSA 2NR0A 1BD6A 5K8NA 2FZGB 4CLFA 2DB2A 1FHTA 1IBLF 1U1QA 1FVSA 1Y3KA 1YYKA 3PEJA 4X66J 2EOXA 1RWNB 4LF4F 2YKOA 2AEJA 1YYOA 4YB1P 4URGA 4FBTA 1UCNA 1YSJA 1PCAA 2EOOA 3GB0A 2X3GA 3T3FA 1EKZA 5D0RA 4DU8A 4PXEA 4QR0A 1DARA 2V94A 4DV4E 4EO8A 5IOLA 5IV3A 3T6BA 2W8LA 1EB0A 2FHOB 2D9PA 1SJ3P 4PG6A 2YSOA 2Q66A 2IHR1 1RWWB 5AC5A 2GQ2A 2X1FA 3BSOA 3KLVA 3EPHA 3VHTB 2DY1A 2KI2A 5DQIA 2J8AA 1K0TA 5E3AA 2JEGA 1X4AA 1LXNA 2HIYA 4NZ0A 4QIFA 3HFZB 2LQBA 2V5HG 2XGQA 4MKVA 2OPSA 3UR3C 2HAIA 3MOZA 5CYMA 1MN7A 3W65A 1Q86T 4NA2A 3MEDB 3G6ES 1TK0A 2P9EA 2M9AA 2FGCA 4AE5A 5HJXA 1X5WA 1UJ6A 2C3OA 4ZPCA 4PXCA 2K4VA 2XMTA 5KFAA 5F41A 2JOXA 1NHVA 3M8ZA 1JMTA 1HNIA 5GAGU 4R2QA 2W7OA 5LT5A 3QT8A 5FIIA 2GC8A 1N33E 1WOSA 2BB8A 1HBOB 4RL1A 1LNQA 3BGRA 5I42A 1RA6A 2A6MA 2ZZMA 1UEUA 3CEDA 4M5JA 3MM8A 4RUBA 1LWFA 4OX6A 3HZGA 1M90T 1U2RA 2DGWA 1WTBA 1WKLA 3NGDA 1H2UX 1U26A 5CCMA 3D3BJ 1F2IG 5E2QA 3RW7A 2H65B 4IJDA 2B56A 5KFVA 4K4XA 2VH7A 4FPRA 4KHPE 2FJEB 4DX8H 5LL6d 2LVHA 3CDEA 2N3LA 3QRQA 3GJSB 2V67A 3HSZA 4WJBA 3BQ1A 3FEYB 4NYZA 3KJVA 4QWDA 4L8NA 3PRDA 4YHHJ 1Q53A 3ILJA 2HHHE 4OZJA 2F40A 2EVZA 3PHEA 4WP3A 4DV2E 1M5OC 2A0FB 1M5HA 3D1HA 4H4KC 5DETA 4KV8B 1WOPA 3DM2A 1UA0A 1RYSA 2XLKA 2VKZG 5FLXC 4HH0A 3N79A 3I4HX 3L95X 1S77D 3MM9A 3DGPB 2IDLA 2ASJA 2YKNB 2IVYA 2BW7A 1UEKA 1ZAXA 2HPUA 2GIFA 3MPUB 2EQ0A 5LJ3Y 1ROFA 1NK7A 4OV6A 4W4MA 3HHLD 2VZ9A 3LUYA 5AJ3F 4LFCJ 5AE2A 2BMBA 4R25A 4YY3J 4JI0F 3EPLA 2KFYA 1YVFA 1M0SA 5H9FJ 2Z4PA 2Z2LA 4MJKA 2UU9J 3QG5C 2AD9A 1JB0C 1JXEA 4NZ6A 1SCJB 5HVGA 1KONA 1Y7PA 4I0WA 1JK9B 4I2QB 3WBZA 4NCGA 2E9TA 3FBCA 4KGVB 3BPSP 1HNZF 2ZD1A 3H5UA 5F8LA 1JIHA 2EQ3A 1UWBA 2VQEJ 4JUZA 1N36E 3PW5A 2W2NP 4EEYA 1HWJA 2EMAA 3UCUP 3MAQA 1K44A 5KT4A 2VRDA 4CTAB 2V0NA 4GVBB 3OUYB 5I3UA 3C6UA 5F9NA 5K8MA 4DV1J 4CO1A 4JI4F 4MK7A 4O43A 2O1PA 4X65E 4MAKA 3KKFA 5KFIA 4USWA 3P6YC 2WVBA 1TMMA 8RUCA 1RT4A 2MY7A 4LF4E 3JTOA 1X49A 1MWQA 4FF3A 5D4LA 2OFGX 4NLYA 1NRKA 4CLYA 2CPZA 2W25A 3M2RB 2IBKA 2A25A 3A3NB 2YRHA 2WOMA 4NLVA 5HQLA 1D1UA 1PJQA 2KXNB 3RRHA 1PC4A 2AJ1A 1KQKA 1HW8A 1S1WB 2EPRA 3OTCA 3E01B 4WZQA 4IOBA 3JB9k 2K8GA 2V8QB 4JV5F 2EPXA 2NPIA 2LFVA 2EN8A 2J8SA 3PYGA 1Q8KA 4Z7CA 1VRTB 2UVRA 1S97A 3EVOA 3NMRA 2CJBA 2DGSA 3MTKA 2KU7A 3CDAA 4O44B 2DR7A 5AASA 1TVRB 5J2PB 3G96A 2D69A 4O0NA 4Y00A 3ITHB 1OJ4A 3UDVA 1MWZA 1RMDA 2MC5A 1VRUB 3QGHA 1ZH5A 1R6YA 3DNCA 3VQSA 4D3HA 1FF2A 4CYUA 1NDLA 3L9ZA 2KG1A 2FZKB 1C0UB 1U1LA 6FD1A 2J0WA 1VHFA 1C1CB 2LEPA 3TAMB 1UAWA 4DWIA 2HNZA 3NGRA 4DUZJ 1A0OB 3W64A 4NXNJ 2W2OP 4DFMA 4QZVB 3SIPB 5C25A 4C8YA 2HK2A 2RAQA 4DV0J 2GS8A 4M1KA 1PC5A 1ELOA 2QRRA 1MW7A 3PIOQ 4PUOB 5DS7A 5CD4A 3OTOJ 2C3PA 2X1BA 1WEZA 2NABA 4LF8J 4ICLA 5G0RA 1YJNS 3HPZA 1JJ2R 1CJVA 3V4MA 5AE1A 2BUNA 3D6FB 4HEA9 1U0HB 4EO6A 3TX0A 2BEFA 1A1FA 2HKEA 3OXLA 1X9MA 3HVWA 3VYYA 2K7IA 3T5LA 1VOMA 4OZ0A 2QLFB 4RW8A 1RSCA 1NJXA 3CCLS 2OPQA 2ODRD 2Y0SD 1NM2A 3HF5A 4I2PB 5DGAA 1IKWB 4X8WA 2RS2A 3K2YA 4ZITA 1IJEB 3G87A 5KT7A 4ZOSA 1T3NA 4PYDA 4M5IA 4QW9A 3T1HF 1SJ1A 4M63A 1J5EF 4N8OA 3SSQA 5B08A 1TFWA 1ZYQA 3BR9A 3PJWA 4EGLA 4DV7F 2FUG9 3GE9A 2ADRA 4QWCA 4CCHA 4LRBA 3IWXA 2IM0A 4RKUC 1ZA2B 1P47A 4O24A 2ZNYA 4JI5F 2Z56B 1U6FA 1HNWJ 4LBIA 1R0BG 1RAHB 4UOCA 4C9DA 2DXFA 2ASDA 3OD2A 1PGZA 2P6SA 1VCTA 2HWTA 1UW9A 4CRJA 2HC5A 3FQLA 2E1MC 2BA9A 3PM9A 2DGVA 2WB4A 2ZFHA 3UNGC 4EWTA 1U2CA 2JC1A 2LV2A 1KRPA 1PYOB 1XJWB 4FP9A 4WTYA 2YPZA 2ZH2A 4I56A 4WZMA 3HHKA 1BBGA 4JI1J 1S72S 5ETKA 1BQXA 4ZP8A 2OPSB 1KOOA 1EX8A 5KFHA 2RRAA 4TLRA 2F8HA 3BO4A 2M3DA 5CYMB 1T4OA 3MUMP 1SV5A 4NOHA 1HNZE 1T39A 1TELA 4F2SA 3FIGA 4N4RB 1KP6A 4USKA 4R2DA 2VFSA 4L6V3 4W92B 3E3XA 3KG0A 2DJWA 1SJ4P 5A69A 2RF2A 3HJVA 3O8WA 3V5RA 2VC1A 1F6TA 2VG6A 2UV8A 4JV2A 3E2EA 4ETZA 3PO5A 4JI4E 4B3RJ 1NNDA 2VFTA 3KOAA 3LWLA 1HNIB 2QLJB 1SL1A 1F9EB 2F3JA 4DUYJ 3QQCD 1K73T 2DGCA 2B7TA 1WI6A 5K9FA 4DSIA 2ZWPA 4DR1J 5KTQA 2ZDPA 3VYXA 2JP9A 2M4IA 4ZYEA 1YKWA 1RLDA 3MM8B 3WIVA 4DPXA 3Q89A 4NLSA 4XTTA 5D4NA 2RUSA 4LR9A 4ZYHA 2EN2A 4A46A 2VF3A 2UXDF 1UETA 4V1Ak 3OFFA 2B7CB 3UPFA 1F60B 3PG9A 5ETTA 4EZ6A 3G82A 3Q86A 2EOMA 3HZEA 1VS3A 4ILMA 4O5GA 4WE1B 4F26A 2EM0A 5M2UA 4JV5E 2OELA 2DGXA 4JB8B 3NL0A 3HDSA 1PKPA 4OI0A 4B3MJ 2C28A 2YNGA 4EBCA 3K17A 2E44A 3KJVB 1Q4RA 2AZ3A 2XHWA 2OEMA 3HHDA 4G1QB 5KFLA 2YRMA 4DV4J 1K1QA 1KDNA 4C7QA 5KT6A 3DOLA 5HMWA 1TF3A 1VYAA 3QMQA 2AV5A 4TYBA 2XULA 3R1HA 1TQLA 3Q0AA 1REVB 5KL5A 2DH9A 4CNZA 3MURP 2JEJA 3PXGa 4HT7A 3Q8YA 3DM2B 4FPIA 3UD5A 1PJ5A 4DSLA 3LMLA 1VIOA 2EFOA 1Y11A 2Y1IA 2W9AA 3MM9B 5D78A 1AW0A 2MQLA 2RSIA 3LAMA 3IWDA 2DHAA 2GVDA 1O0PA 3MM6B 5L39A 1ZOTA 3FNNA 3BBGA 1S57A 5ETPA 3J7YI 4M5DA 4A8XA 5IQ6A 2MSTA 5L38A 2BR0A 1G2DC 1DZ5A 4ZPWR 2QT7A 2BRKA 5HMZA 1B7FA 1FO1A 1XMOJ 2FJXA 2RDDA 4ZLNA 3MAAA 5IM0A 2XS5A 2UUBJ 3VTIA 3ZTSA 2MQQA 2UV8G 3IBWA 3G2XA 5E3RA 4DZDA 1EP4A 4NCGB 3LALA 2EW9A 1N33J 2RQMA 1YHQS 2ZD1B 2EN6A 3EGZA 4I4BA 2MQ8A 1OQ3A 2GZOA 1UWBB 1YJVA 2M70A 3WC0A 2F1FA 1FEEA 5DQGA 1YJ7A 4LF5J 3C6UB 2ZBQA 1ZU1A 4CO2A 5AXKA 2FJAB 2LLZA 4RNHA 2EQ1A 4KHPJ 4HTIA 3T1HE 1E6VA 4TXSA 5J1NA 1JX4A 4USHA 1J5EE 2KDOA 1RT4B 4Y0FA 1SC1B 4NYOA 2IJFA 1XMBA 3OW2R 5FJ4A 1LK7A 4DV7E 2AJFE 2FLLA 3R7BB 2AIRB 4X4PA 4P2SA 2WZ1A 3KWRA 4JOUA 3CUNA 1IWGA 1SFEA 3J81U 2ZVIA 4WFNQ 1KLMA 4DV3J 2VBZA 5L1KA 1B0PA 2PSZA 4DR7J 3BREA 2WOMB 1VK3A 1O8BA 3MEGA 1I6JA 1RCXB 2WVFA 3DLLQ 2KZMA 4DV2J 3QZ8A 1TV6A 1SQEA 2HS0A 3NMAA 4KPYA 3MSWA 3NOCA 2LTSA 3Q8QB 2YT4A 5HQ8A 2J9DE 2KN4A 4DOZA 1NZAA 4A8WA 2QLWA 2CNOB 3CCTA 3UDCA 5J2MA 1VC0A 3M9NB 2ZC4A 4LFAJ 5KFJA 1V3ZA 1SVDA 3M99B 2GV1A 4HDHA 3JQMA 4ZN3A 1NJYA 4OJHA 4EU0A 4X84A 1S4FA 2VBWA 4OX9J 4IRDA 4FKXA 2MLYA 3N4WA 3DGVA 2HMIA 2FJDB 2C2EA 2UXCJ 1BE4A 1G6BA 1NPKA 4K4SA 2OEJA 5A2QY 1SIWB 3KLIA 2FGGA 3J7YU 2YTQA 2UXBF 3BS9A 3LO3A 1U8SA 3DRYA 1X9SA 4NZVA 2ZDOA 3HI9A 1K9MT 4FYYB 2JYAA 3BN7A 1RAOA 4CO3A 3IWNC 4X65J 4IUFA 4ICLB 5G0RB 2UXDE 1CQNA 5H9EJ 4K4WA 2RDIA 1CJVB 2AWZA 3DOKA 4IS1C 3AJDA 3KTQA 4OQJA 4J9SA 1RACB 4F4KA 1ZBQA 3N5BA 3R3TA 1NUEA 5DM6Q 3TAQA 3Q2SC 2Q79A 2QGFB 3G8SA 3GG1A 4Q43A 3R6LB 1VQ5S 1SC6A 2HRYA 4RW8B 4V19J 4LIRA 5C2CA 2KM8B 1AXQA 2OPQB 2WB1D 5IC4B 3QT7A 3LP0A 5HBMA 2G7HA 3H5SA 3CO9A 4WFBQ 1HBUA 2XI3A 3C3LA 1LKZA 2EWHA 2RQCA 2GMJA 4RWXA 2FVRA 1S9GB 3MFIA 4MKYA 4DV6F 2VKRA 2K2PA 3P5BP 2HJJA 1KVIA 1VHIA 1XQIA 3UW1A 4FXDA 3H40A 4DR2F 3BF4A 4R2CA 5KT2A 2BE9B 1NK0A 1H2TZ 1X5TA 2J5AA 2H5IB 2CFXA 4DPUA 2JLEA 2ZHAA 2J0QD 5G4DA 4CWBA 2OPPA 1YJTA 1F5CA 1W25A 4YN3B 3QJLA 4DS5A 4IFVB 3HTXA 3EUNA 2DH8A 4C3KA 2ACYA 1DI2A 1LWEB 3MD1A 2HW3A 3W3SA 4A8FA 1ZAAC 3GIKA 1DY3A 3CCRS 3L7PA 1SV5B 1SXLA 4F9CB 2MPUA 4DG1A 3BQ2A 5DLGA 2XSJA 2RSMA 2RF2B 1TUVA 1V5IB 2EE8A 3TEHB 3HSJA 2RUGA 2U1AA 2FHMA 3C6KA 1Z4UA 1V5VA 2J7KA 3Q8RB 4Y2MA 2BVZA 3RB4A 5T41A 1CG2A 1U4BA 3W9JA 4EYHB 2DO0A 4DQIA 1PBAA 3C14A 4ED3A 2I5JB 4P78A 1FXRA 5JVGQ 1UVIA 5CA5A 1Q8BA 1U45A 1S59A 4Z7YA 4F25A 1X6HA 1QTNB 2EI5A 3H59A 3W7BA 1TAQA 2AGPA 2C1EB 2JWNA 2VV5A 1CC8A 3B54A 2NXUA 3VAIA 3PY8A 5AT1B 3G82B 2KHXA 1PO6A 4U7CA 3K57A 2YTCA 2BW2A 3LOUA 4H54A 2XLJA 3NRBA 2XNRA 3UK3C 2MB0B 1JXLA 2E1RA 3CPWR 1WF1A 4A47A 3H2VE 4BMJA 3LTOA 2YNGB 2OTLS 2POKA 5IWAJ 2EOSA 5GMDA 1G4CA 3DOLB 2HQFA 3R97A 1FVQA 2YNFB 4C11A 2HHSA 4OI3A 3C15B 2AJ2A 2V6AA 2YH1A 5AJ3J 4ZVFA 1HWIA 3K5NA 3RYLA 1XR5A 3GYXB 3VF0B 2HZAA 2MJNA 1UPMB 2WBRA 1G2EA 3ET6A 5CZVA 4NLUA 1NAQA 4B3SF 3MTJA 4CLWA 4Q0BB 3EX7B 2CQ2A 4BLGA 2GVDB 2RDJA 2C2MB 4QBUA 5DDRC 2YTEA 4R03A 5KFFA 1A1HA 2KRRA 1WEXA 1C0TB 2V87A 2C3MA 2KYXA 1SI9A 4KT0C 2EFQA 2UXBE 4WPYA 2YWGA 3TP2A 3W5YA 3HHLC 4J37A 3HXMA 4U8VA 4DN9A 4N47A 3ULHA 2HHTA 3NBPB 4RLEA 2DR8A 3GMGA 3RB0A 1RGVA 3MAAB 1V3RA 5IM0B 1VC5A 3RJMB 1RT1A 3K5PA 4EZ9A 4P2MA 3D1OA 1WC1A 2B9DA 1EP4B 1R6VA 2RVJA 4OLOA 4FF1A 5ITHA 2E9RX 1HWLA 3CJSA 1DQ9A 4KH0B 3GR0A 1QUPA 4F04B 1K8AT 5DG9A 5LMUF 4UQGA 2AKWB 4HDGA 5A2QC 3LLHA 4J9KA 2FD2A 2PIIA 3KLEA 1PYSB 4K4ZA 3M2UA 3P4UB 3UN3A 2B9YA 2MTLA 4HI2A 4MYUA 3ZZ0A 3Q23A 2MQMA 3FMBA 2VOPA 2V88A 1OSCA 4C3MA 2BQ3A 2XWYA 4B9TA 4YOEA 2EPKX 1E6VB 3HVAA 4B9SA 2RS8A 1VK8A 2G2YA 4TU9A 4F36A 4QYRA 3QWUA 2OSQA 1QD1A 3V81A 1UVJA 4KAIA 4NL5A 4DV6E 2CQIA 2PDAA 1NPRA 1OY6A 4DBQA 2KZZA 2NLWA 4CT8A 2BX6A 5J2QA 2AW0A 5AC4A 2EMYA 1KLMB 4DR2E 2ZE2A 3BDPA 4PRFA 3BGHA 2CTDA 4ANDA 1WKKA 3DLGA 3NNHA 1SR9A 4F3OA 2JHEA 2HAFA 1D09B 4G3IA 4KQZA 3C46A 3LAKA 4LRCA 5CCLA 3OVSA 1ZM4A 3X1LB 3SSRA 2KJWA 3M2VA 5J2MB 1T02A 1T4LB 3BM7A 1NSKL 2VG7B 3THVA 3N5FA 3NAIA 1FXDA 3M4XA 4GKJF 2DNQA 2IA6A 2NSBA 3A8IA 4RJVA 3ZTOA 3NCQA 3K8WA 1YSAC 4KGMA 5EWFA 3SCJE 2IRYA 2R2UA 4N41A 1WJPA 4NCBA 2EM3A 2YX4A 2ROGA 4KZSA 2FVPA 2DIUA 2BKOA 1P27B 3TJ8A 1X4CA 5LL6R 2DYAA 4ZPTR 3DLKA 1URNA 2HHPA 1W2BR 3OHAA 3HFVA 3W8GA 1FWLA 4X4VA 3UQSA 2GCFA 1DTQA 3M1VA 5CD4H 1GMUA 1NLKL 2EN1A 1RTZA 1PBUA 5ADZA 1QE1A 1P1LA 1Q95G 1T03A 1T11A 4WFZA 3IAM9 3K58A 3DOKB 1XERA 4DMZA 1YI2S 4GC6A 2NYIA 2DRAA 5ETMA 2ZITA 1VBYA 4TNOA 3HVTA 4WX9A 1VIXA 4ECXA 3GTYX 1RU1A 1CPZA 4ECVA 4AYBD 2O01C 1LOUA 1KHWA 2PGCA 3SFUA 2KT2A 1RAEB 3LP0B 5HBMB 2CPFA 2L92A 2DEJA 1PJ6A 3NEKA 3J80Y 2CRLA 2ODRC 2L3MA 1HBUB 2JY9A 4KO0A 4CM2A 2XYHB 2XMWA 1LW2B 5A6BA 5IQQA 3VGVA 3DF6A 1DBDA 3GJQB 3ONQA 2DR5A 2RQ4A 4YEAA 3KHHA 3CMQA 4MIAA 1DGCA 4K8RA 3ADIA 2BJEA 3DRPA 1RWOB 2DNGA 4B3SE 2ZH4A 2MDAA 2XLIA 3CD0A 5E33A 4R5PB 4R8UA 1LW0A 3JTZA 2CPDA 3BEGB 4M5GA 5D6GA 7FD1A 2RD5C 3OSNA 2CWKA 1AZSA 3LWMA 2W7PA 1TL1A 1SPBP 2OPPB 2R8IA 3MR7A 2B9WA 1J5OA 3HCXA 2CJYB 1G7CB 3DYAA 1J26A 4OI4A 2KXFA 3I32A 2H3EB 3MCNA 2EXUA 4DI6A 5D3GA 5JXSA 2M1SA 1UVKA 4RW4A 1IMUA 2B5JA 4DG1B 4ZP6A 2LP4A 4P7TA 2B4OA 5LMUE 2B7VA 4HHUA 2FLNA 2XSJB 3HK2A 1XNRJ 2EPLX 1FESA 3Q8SB 4U7UK 3AB2B 4JI8F 1S7IA 2UXDJ 3I87A 4OHYA 1FJ7A 2GJIA 5J1EB 4KGKA 4EUVA 2ATCB 2P2CB 1IXKA 1T9UA 4P7VA 3OR2B 6AT1B 2ZC3A 2MKKA 1AT1B 3WC2A 4DUTA 3C14B 2WCC3 2KB2A 1KC8T 1Q7YT 3O1LA 1X6EA 4EBDA 1EETB 3J7Z5 1HNVA 1CQMA 3C16A 1F0XA 4NEYA 4YDXA 1HQEA 4ES1A 4WBFA 4YR0A 1B3TA 2NA2A 1U1NA 3LH2S 1CBKA 3E8OA 2D1CA 3ENQA 1FTRA 1SH0A 4DFPA 5AE3A 2YWKA 1R27B 4URQU 2IAJB 3AT1B 3V6KA 4EBEA 5B0DA 1Y5NB 1U24A 3OR1B 3MWBA 1M1KT 4ZPDA 2VL1A 5CH7B 4DL4A 2ZNZA 2XEXA 2KXHA 1IKVA 3P8BB 4LREA 1UVMA 1R0AA 3CCQS 2V9WA 3JSBA 4C11B 3CD5A 4I8OA 3MR2A 5C5JA 4B17A 3W61A 4GKJE 3VCDA 3PYFA 2JSXA 4DR5F 2GHFA 2DB1A 1EZZB 2HQGA 1H7XA 1D9AA 4M94A 2HHQA 4TN2A 4OHVA 1AA1B 4YS2A 2ASYA 2IA0A 4DQPA 3H90A 1N88A 4OMFG 3DLHA 4H4MA 5CYJA 3TRGA 2VICA 4PG8A 2KT5A 1SJQA 4AQYF 3CNQP 5T7LA 2CIMA 2YRKA 2W4DA 2RSQA 5HAOA 1JKHA 4O4KA 4ZVPB 1CC7A 3B78A 1RZMA 1N5TA 4KHRA 2VD3A 2A18A 1R0CB 3FCWA 3DLEA 2HWHA 4NLWA 1H98A 2J9CA 2F8BA 1RT5A 2FIUA 5A0YA 4O3OA 2WONA 2HEKA 1WI8A 3OXGA 5HQMA 3H7HB 4A8QA 1IBCB 1KKHA 2J0SD 2IM1A 5IV8B 1G3OA 2EC2A 2GVZA 3ENWA 4IYQA 3R7NB 3G86A 4IO1A 1DQ8A 1RT6A 4OLPA 4WKYA 3HHNB 2EL6A 5LMNF 2CZVC 2QC3A 1MG7A 4GKKF 1N4LA 2Y9HA 4O3QA 2QLBB 5DZ7A 5A8KA 4A48A 1YJ9S 3V6JA 4L75A 3BR8A 4R2AA 4FYWB 3VR1A 3A1YG 4WXCA 2W01A 1RU2A 3V81B 1AFJA 2QMWA 2MZQA 4MIWA 1XTZA 1VC6A 4QU7A 1SC4B 4F02A 4ZPBA 5J2QB 1WUUA 1FTCA 4ATNA 1HLWA 2KG0A 2VQFE 1RBLA 2EPZA 7FDRA 2EMIA 3J7Yp 4E0DA 5KOWA 3DLGB 4IRCA 1TP7A 4TLQA 5JVHQ 5A6AA 2UVWA 3OV7A 4F9BB 2QE5A 3J80C 2DRPA 2CZ4A 3TZWA 2R4FA 3BV8A 4CI0B 3EZOA 3SV3A 2PEHA 4RW6A 3D5MA 1SJRA 2GW8A 4OZ3A 5KG4A 3FUYA 4LF7F 5GMEA 1Q78A 1X0PA 2FJWA 2Y8YA 3CSKA 5RUBA 5F0WA 4LFBF 4QWAA 1GX5A 2RHSB 4WSGA 4KKOA 3EVWA 2UXBJ 1N5SA 1YYWA 3TA2A 1HMVB 2EN4A 4HR2A 4CLUA 4ES2A 3VVTA 2XMAA 3PW0A 3BZQA 4PWDA 3BO2A 4X4OA 4JI8E 3LP2B 3M8RA 3I5AA 3CJRA 1X0FA 1FFGB 3HKWA 4L5NC 3CDWA 5MLCV 3DLKB 1RTDB 2EPPA 4P73A 1ZS6A 1KD1T 1B7YB 3UWTA 3IR5B 1UZDA 1D8YA 2OD6A 3PYEA 1Q16B 2WHOA 1DTQB 4OHXA 4MTPA 4ZVEA 2QYCA 3PNIA 3M1VB 2QA1A 3W9HA 3W66A 1NKBA 3MHSC 1H6KX 1SBRA 4ZIVA 2GQCA 1U49A 1FRIA 2CWXA 3QGGA 1QE1B 5KFRA 3AD8C 4YFUA 2DVIA 4DCJB 2YY3A 1SQGA 3CCMS 1KHVA 2J6UA 4MKBA 3M8WA 4DFKA 5KG7A 2IMOA 2NZCA 3PIPQ 1R8HA 4KIAA 1DRZA 1J27A 1G1XA 4PQUA 4XPCA 2ERRA 3HVTB 1M5PC 2QZ8A 2BKNA 5THWA 3R7SB 2Z0GA 4HKQA 2EM8A 2H5EA 4OYXA 3M8SA 3DDIA 2ILZA 2XZWA 1DJ0A 2LXFA 4C2MA 3R5DA 3H0PA 3BGUA 2Z2YB 2XO7A 2OTJS 2F5GA 4KO0B 2DK2A 3UD4P 4M95A 4DR5E 4CLSA 1ZBTA 2V34A 1QVFR 2WVCA 4GVLA 1YZ6A 3IP0A 1CVJA 3FBFA 1MU2A 3HLUA 3KYLA 4B9MA 3KLHB 2IRXA 1AFIA 5JMNA 1JK2A 3TARA 3WIUA 1U1RA 3R5CA 2MKJA 5KFCA 4R8UB 1LW0B 3KJQB 1RBAA 1IN0A 4LF6F 4QWBA 4AQYE 4P72A 1HR0F 4NZ7A 2J76E 4UF4A 4PPDA 4KJIA 2C2KB 4F7VA 4ERDA 4RPFA 1TL1B 4FF4A 3V2UC 1SIZA 3NOGA 2IRUA 1F9FA 3VALA 2P5VA 2ZBCA 3DYAB 4K0KF 3CTRA 2ACMA 1HIYA 4RX6A 1I94F 1RISA 3UN5A 4ETXA 2OEKA 5F8MA 2J6TA 1RT3A 1U2FA 2YTNA 1PYTA 5D3GB 3VGUA 1NDPA 4R2RA 4XIUA 2B43A 3TUJC 1VBXA 3DMJA 2B5JB 5EX3A 4IH6A 1HNXF 2QL7B 4C8ZA 2LDIA 2XY7A 2N3GA 5E5NA 5LMNE 2HIQA 3FMWA 1G2FC 2CG4A 4IOCQ 1WHWA 3ZZYA 4GKKE 5JUMA 5M2RA 2BJ7A 2V85A 1Q8LA 1KN6A 3MGJA 1S6QA 3R8YA 1IUJA 1IBKJ 1LK5A 3TJAA 2YKAA 5KFKA 4BC9A 3FDSA 1NK9A 2QMUB 3U7JA 2YQ3A 3KHLA 4WYLA 3CCSS 3GIJA 4DPWA 3DRRA 1OY9A 3LF0A 1KR4A 1X4GA 3CULA 3C16B 2E1AA 1MMDA 3DGPA 2V63A 1HI1A 1HQEB 4EK2A 2HQIA 1RT7B 1WHNA 1ZPWX 4E8UA 1S1TA 3T5KA 1GTEA 4RHBB 3D66A 2DGQA 3LQVA 1K47A 2C2RA 2OD4A 4M5MA 1OS5A 2H51B 2YKMB 2KHDA 4YMEA 3KK1A 3M6UA 1X6FA 2KFZA 5CFFE 1PG5B 3HMJG 4RUAA 1R0AB 4LF7E 2M4MA 1HBNB 1Y5IB 3DCAA 3TQEA 4MIBA 4ID5A 2ADBA 3PHTA 4LFBE 5ETRA 3U1MA 1TUGB 3OFGA 2MKCA 5DDOC 1I51B 3T1YJ 5DRKA 4RBVA 4RH8A 3JTNA 3CJ5A 3MMBB 2CQPA 2ZKTA 9ATCB 3OUYA 3JSYA 3VAFA 4B9NA 4H4MB 2EOHA 1X3CA 2FPHX 3QWPA 4B3OA 3OVBA 5T7LB 3ZXWA 3KUGA 4LSLA 3TW0A 5IC6B 1X8DA 1RAGB 4G1PA 4QW8A 2EPCA 1R8PA 2DR6A 4PKDB 4I6YA 4J9QA 4DLGA 1KTQA 3HJFA 5EHHA 2MZJA 4FS1A 2BRLA 2VG5B 4PQAA 3DLEB 4KB7A 3M2RA 3O6QA 2EG1A 1UW4A 4YUDA 3IC1A 4KGXB 1RT5B 3I0RA 2HZVA 4ZN1A 5A0YB 5GADI 2WONB 2ELZA 4AXJA 2KM8C 3B6BA 4ED7A 1YZ9A 3UN2A 2VODA 1VGYA 5KG1A 1VLOA 5A6BD 5D4OA 4ECSA 3CC7S 2ALZA 4P75A 3MM5A 1RT6B 1A9NB 2HVHA 4RZRA 1TL7A 1VRTA 4DCOB 3CCES 2LVWA 1VI7A 3ADAC 3M6WA 4JV1A 3IA0A 1R8CA 5A8KB 4IQXA 4R2PA 2FTRA 4O44A 4Y2CA 1TVRA 1WOOA 5J2PA 5ETQA 3VAJA 4ZKAA 3K59A 2I8EA 4IDKB 2R2SA 3QATA 1GMVA 3KMQA 3HSDA 1VQ6S 2JPAA 4WIQA 1XC9A 1MWYA 1GMWA 3EJMA 2MGZA 4CQ1A 5DG8A 3CCUS 3DDNA 4OHZA 5AXMA 3CC4S 4NLTA 3MMCA 3W1YC 2M2BA 4ZMMA 1C0UA 3C6MA 2HLTA 4LF6E 4GKJJ 1FDAA 3K89A 3TAMA 1HR0E 2GIRA 2G4BA 3OPKA 1MSWD 4JI2F 4OV1A 4O3NA 5D0HA 3Q8PB 4FVMA 1TN9A 3IFEA 4Q44A 3TOQA 3EWGA 2ADCA 1GT8A 4PUOA 3FGVA 3A3PB 2XSFA 4DPOA 3GU0A 3MPDA 4YB7A 5IV4A 1IR1A 4K0KE 4ZCMA 4OOGC 4DR6J 5BYSA 1I94E 1AYEA 4RW6B 3EICA 1IR0A 4DL3A 4WTOB 3K6QA 1FJGJ 4K4VA 1UKUA 1XMQF 4MMOA 4KKOB 2BE2A 1IQOA 3MI7X 4QJVA 1FRKA 2L8TA 1RUSA 4Y2IA 2EORA 1RWXB 3IAS9 1HNXE 2XB2D 2R7WA 1QM9A 2HURA 2CNLB 1WJ9A 2BJ1A 3VZIA 3BGOP 1NK5A 4QWEA 5E3QA 3FBBA 2OPRB 3ZZUA 3KUHA 2IY5B 4BBYA 4CM0A 2AP6A 3CCVS 4DSEA 3KDOA 2LJUA 4M2ZA 2NXNA 4X66F 4HYKA 1NSAA 2HGMA 4PG7A 1TL4A 4ZLLA 1Z2LA 4OJGA 2V8PA 3OXFA 2DO4A 2G0JA 2MKYA 3PDNA 4DLEA 2AYBA 1WKJA 4AFFA 2SXLA 3JQJA 1VJQA 3MXHP 2L3CA 3T1AA 2DXDA 2JJ4D 2BM1A 2MQOA 2EP3A 3VGTA 4FZVA 4PQUB 1UBDC 3T9NA 4OZLA 4O3SA 4HTJA 1IR2A 1H38A 2CNNB 3L7OA 1MGTA 2BBEA 4X64F 3SXLA 4USVA 1T9XA 2DMIA 2EN7A 2KYZA 2VQFJ 2ILYA 3RAQA 1S0NA 2YXLA 1T4NA 1BB8A 5D0GA 2GGPA 5C24A 2HFUA 3CMAS 3RR8A 3FK4A 2XMKA 4JI3F 3KLGA 4DPYA 4H4OA 4J91A 1MU2B 4G65A 5F8NA 5BR8J 3PJ9A 2X7IA 4KBIA 3D9BA 1FX4A 1CJTA 2F8MA 5K14A 4DKKA 4CLKA 2AT1B 1W7WA 2EOEA 3DLJA 5HP1B 3TZZA 3RR7A 3JSMA 2DPJA 4RR5A 4NLPA 4CO0A 2JOBA 2HS3A 1SUQA 3OQ2A 1IVZA 4NPOA 4K7QA 2MKNA 4UQTA 3G4SS 1FE4A 3MF5A 2EPOA 3PR4A 3MECA 1S9FA 4JI8J 1FT8A 5EWEA 3C66A 1C4CA 1RT3B 4XDCA 2JEIA 1PJ7A 3RUBL 1U6BA 3G6VA 4QCLA 2C2ZB 4K4UA 2YVSA 4NRUA 4N5SA 4DX5A 2W9CB 3DMJB 1VQMS 3I96A 3ZZPA 2EM9A 2LMZA 4WE1A 3KMSA 1SKSA 2N7YA 2A2CA 3OL7A 4G1QA 3E51A 2MXYA 1L3VA 3JAMU 3N28A 3F44A 1CJUA 1WC3A 3KHRA 1DQAA 3DFEA 1REVA 4JI7J 1S6QB 1RYRA 4F3QA 4BHQA 4F4YA 1TU0B 5KFXA 3GQCA 2IC3A 1S79A 1QJHA 3K5MA 1ZA1B 3L7UA 2VDIA 1AAYA 1U48A 1UZHA 2OUGA 2NXEA 2XCAA 2BYCA 3DRRB 4LRDA 2B9EA 3O44A 5KL4A 1VFJA 3CMES 3MM6A 4AL7A 4ECRA 3GP9A 3NGUA 2E5LJ 4J9UE 1KQFB 1S1TB 3ILIA 2HHWA 1L5UA 3DXBA 4JI2E 4YY3F 4DR5J 3TX8A 2PI5A 4F6NA 4JI6J 4UW2A 2OMLA 4EI2A 2MQPA 3OFEA 1WRJA 1FK9B 2AYGA 3T5JA 3THTA 1RI7A 4GRSA 1VQPS 3KK3A 4B08A 5C2GA 4XAKA 3HD1A 3OJUA 3GFZA 1BY9A 2J9DA 3IM8A 3KK1B 4WYQB 1N5QA 2EFVA 1NEEA 4ID5B 2G2ZA 1XMQE 2HGLA 1OPIA 2YTJA 3NKYA 3UCZP 2ZOGA 4PCQA 4M30A 2FLOA 4NMXA 3CJ2A 4NXMF 3Q8VA 1S48A 1SB6A 5K8OA 3QT5A 2DHXA 4V19X 1JLBA 2KOUA 3D0IE 4ZVSB 3BF2A 1CSJA 3R2CJ 5FDLA 2UVVA 4WXDA 2YTFA 4ES3A 2L2NA 1T95A 4B3OB 4X66E 1IBLE 2CQBA 5HI7A 3PRBA 4LSLB 4TU8A 2ENCA 4DL6A 4OYAA 1X7VA 1ZTWA 2Q8UA 2M7SA 2L2KB 2IFXA 4FNHA 4Q2LA 2D7SA 1U09A 2Y8WA 4IOAQ 1QLNA 1UEVA 2NS1B 1LFPA 5KFDA 3CCWA 1QUVA 2B8QA 2QV6A 2XY5A 3CVKA 4GKKJ 2COLA 4ZCIA 3C4TA 2XGPA 3JYTA 3I0RB 4ILLA 4GEQB 1R8BA 2MHNA 2R7OA 2OI2A 2ZHOA 5DNYA 4U9RA 1LV5A 3NS7B 4OZ2A 3M32B 1L3UA 1XWLA 2RQKA 5J2NA 3B4DA 5A6KA 3M6VA 4I67A 3CCJS 3MM5B 2RRBA 4OYMA 4X64E 1NKCA 4OX7A 2RRNA 1TL7B 1T7PA 3QRRA 1NJWA 2YWFA 5A8RA 2IVMA 1X48A 3ZOQB 2EMLA 3GFHA 4ANCA 2AEFA 5HMYA 1A7GE 2I9IA 5LXYA 1KVJA 1ZPVA 3W5ZA 4I6AA 4JI3E 2MGZB 1FI4A 4ILRA 4RW7A 1GXTA 1P9QC 2B0GA 3GV5B 3DI6A 5I3PA 5HO4A 3W60A 3MMCB 2EKYA 4LF7J 3VK6A 2ZOMA 4U6PA 1CULA 5KFBA 4J9RA 2CJQA 1KQSR 2EM5A 1BMQB 3UDEA 4DUZF 4NXNF 3WHIA 3TZYA 2FC8A 3MCMA 3MM7A 5IZHA 3F0NA 4USJC 3R6GB 2HHXA 4J9VA 3HXLA 3AD7C 3IWCA 2MDGA 2N3OA 1NH7A 3F56A 1JLAB 1UFKA 5IT0A 3P96A 1FDBA 4A4JA 4LF8F 2HK3A 3CJKA 3L09A 1SH3A 5C7PA 2XYPB 2RNEA 2LMIA 3R5JB 3EZUA 3KFWX 1XR6A 3PZPA 1YTYA 3HQ1A 1YWXA 3AQOA 4E98A 1WC4A 2BE2B 3TUIC 1X4EA 3QIDA 2H54B 4CNYA 2EOQA 2R8JA 1R31A 2GQQA 3HT0A 2BACA 2C2OB 3N6MA 5KG6A 3EPKA 1VQ8S 1GK8A 2ZWOA 2EMHA 4RUCA 3ZZZA 1IBMJ 3WZ0A 2QL9B 3VV2B 2KFNA 5ETLA 5F3WA 2K06A 4QIEA 1NO8A 1JJHA 1LXJA 2RB7A 9RUBA 2DNHA 2E7VA 3H2LA 2YWEA 1CLFA 3CIZA 1S9GA 5B0EA 1OPZA 4O23A 1RA7A 2WTFA 1OQ6A 4UZBA 2CDQA 1E6YA 1N34F 4PEOA 3PW7A 2X51A 5H9FK 3THNA 1EIYB 2GO8A 3AA9A 3JQKA 1FXLA 1RWUA 4AL5A 4M9VC 3DLBA 1EAYC 4YY3E 3QLHB 4WK1A 5I3QA 3M8YA 5AXLA 3S1TA 1HKAA 4JI0E 1EJ7L 3AXKA 1HQUB 2MKSA 4MFBB 2IVFB 2XM3A 4B3TJ 4IFVA 2GMHA 1DTTA 1O51A 4JI1F 2O67A 4HL9A 2NUUG 3BYRA 3QJJA 3OVAA 1LWEA 1C1BA 2N7CA 4WFXA 2FY8A 4LQ9A 1UILA 2VPXB 2GGPB 5FD1A 1T0TV 4USUA 4P71A 3LPYA 5C24B 2W2QP 5F8GA 3S6EA 2HG4A 3T41A 3GLJA 2GJFA 2I13A 2D3OR 4N7TA 2HFVA 4C8LA 3KLGB 2Y3YA 3CT9A 4H4OB 2R7XA 4NXME 4QPTA 4K0KJ 1I94J 4PXBA 1TTHB 4B3RF 2FTXB 4X62J 5B0FA 5K14B 1CJTB 2RKIB 2FYXA 2C22A 2ZHBA 3H25A 4DUYF 2JVRA 1APSA 3JSMB 1GFWB 2M8HA 4DR1F 1SUQB 2CPIA 4JBCA 3MHYA 3RRKA 2I5JA 2KVIA 2EZ6A 1HYSA 2MLXA 3C8YA 4NI2A 2DITA 3RBXA 2BKPA 3MECB 2EM4A 4DN0A 4LF9F 1FEHA 3O3LA 1PILA 4OX8A 2FC9A 2XI2A 3TJ9A 4LSZB 1PJTA 3ECRA 1FNXH 2MZTA 3CB4A 4Y2KA 5BYQA 5KL6A 2GPIA 2QIFA 4ED4A 2JDJA 4P52A 4B3MF 3CE8A 2AJ0A 3I56S 2KKHA 3NNAA 5D0EA 1GMWD 1FRXA 3AJ1A 4YDDB 2GHWA 2DNZA 3RB6A 3Q83A 1ZM2A 3ELHA 4Y3CA 3D0HE 4ED6A 2XZDB 2YNFA 4KC5A 2LUPB 1CJUB 3C15A 4MT1A 1S1VA 1RT2B 2YKPA 4K2JA 1JLFA 2IMWP 3D7SB 3H20A 2IC3B 2J7UA 3I6PA 3W2WB 3IRXA 3CXCR 2LCEA 3ENVA 5E3CA 4CLZA 1HD1A 4CH7A 2W1BA 3D68A 4XO0A 4LMZA 4Q0BA 2ALYB 2NQPA 3SEOA 2R7VA 2B6AB 3UR0A 4DUZE 2L3JA 3U1NA 2EM7A 3ZO7A 4NXNE 4CLLA 2YNIA 1C0TA 3RW6A 3D6TB 1RWVB 2EMZA 4NMLA 3GYNA 3G9CA 1HARA 1HHSA 4OYZA 3SSSA 4DS4A 1XMOF 3NBPA 3KK3B 2GHVC 4C48A 2FHJA 2UUBF 2VF1A 4USIA 2R8KA 2FV4B 4LF8E 3Q22A 4C98A 1I1GA 1T3OA 1DURA 2JH3A 1L3TA 1YUIA 3AXMA 3QGIA 3GJRB 3D2WA 1YRXA 1Z1ZA 4OZ1A 1FWPA 2HVEA 5DLFA 3N6LA 1X4HA 4ZA1A 2DIVA 5KL7A 4CLTA 4LF5F 3M9MB 2CA9A 1ZM9A 2R7SA 2YNHB 2MY8A 1X4DA 1JLBB 3GCWP 4MYTA 5DDPC 2QFIA 3W2VA 1NXIA 4C8MA 2WRMA 4W90B 2NCKL 1MEYC 5FDLB 5KL3A 3SI8A 3W62A 4WXOA 3OL9A 3TVYA 1FJCA 4Z37A 1NSPA 4X4NA 4EYIB 4DSFA 4ZVOB 1N34E 5TSEA 4DXLA 4DV3F 3EQ1A 4JI5E 4DR7F 2DRDA 2HHHJ 2UUWA 3JYTB 1D8ZA 2F63A 1VDHA 3QIPA 1BUXA 2OH2A 2CQ4A 3R2DJ 1O0WA 4PWWA 2MZRA 5J2NB 4F0KA 4ELTA 3AV0A 2WW8A 3QAUA 2H4YB 2EK6A 5GAGI 2HQ3A 5LSLA 2QA2A 3NLCA 4JI1E 4OZ5A 3ILOA 4NEZA 3A3OB 1EH6A 3FC9A 4LFAF 2VG7A 2Y1RI 1QSYA 2HNYA 2G0IA 3ICLA 4ZVQB 5A8RB 5C42A 4NHRA 4KR0B 1NB7A 1S0VA 1VQLS 1ZZNA 3IRWP 3HHEA 3BDEA 2B3TB 2BOPA 1F2GA 4F4ZA 2YWQA 4ZVUB 1PAUB 1TAUA 4L76A 2HRUA 1FDNA 3GPAA 4OX9F 2LDYA 2HVDA 1LWCA 1JLCB 4RW7B 2ZH5A 3DI6B 2LE2A 4B3RE 1S12A 2UXCF 1CULB 2WCXA 5L46A 5M2PA 2EMBA 4J9LA 2P6TA 4DUYE 1KBRA 2MZSA 3IN5A 1RHMB 2HS4A 3MM7B 4ZLJA 2V69A 4M0VA 2CPHA 1N36J 1TKDA 5A76A 4HHHA 4OI1A 4FF2A 1UP1A 2OMOA 4IH7A 2VPYB 4NE9C 5HROA 4LF9E 4CO4A 5KFUA 1UJ4A 3CJKB 5CQGA 1FRHA 1UTAA 1Y10A 3ILLA 1KSPA 2ZH3A 5HMXA 1IBLJ 3J7ZT 2KONA 4LF4J 4RNNA 1GXLA 1FNOA 2MHEA 3GWCA 4B3ME 4KSEB 1RHKB 4ZHRA 2HGHA 2R8HA 2V86A 3L4BC 4PWUA 1NEIA 3U1LA 2KTQA 5A2QU 2MMYA 3ISND 4F8RA 2A2DA 3WQPA 1FJEB 1WHYA 1FERA 1RWMB 2CQCA 1YX2A 3PX4A 3GSIA 4UOFA 1A1GA 3I5CA 2EFPA 1R3NA 2LQJA 2EPNA 1LW2A 2CUYA 2V8DA 3ZZOA 2JL9A 1RADB 3PACA 2H9ZA 5KFPA 3MEKA 4X64J 1N0UA 2DGUA 1E6YB 1A1LA 4A8KA 5L1JA 4RNMA 4QIGA 4R5PA 2EFGA 4W98A 4F4XA 2V50A 3K8VA 3BIDA 2OO4A 2HGNA 8ATCB 4S0MA 3MDFA 3LW5C 1WSVA 4K4TA 3BPDA 1I3OB 4KFBA 1KFSA 3GFYA 4NLDA 1MN9A 4JI3J 2CDRB 4FDFA 1PSDA 1NDCA 4NRTA 4GZNC 1XMOE 1DTTB 2H1YA 2XNQA 2UUBE 4FYVB 4BWJA 3T9ZA 3AHPA 3MUTP 1C1BB 4EFAC 2JZ5A 2PMWA 3UVJB 4BHCA 2HFNA 3FJ2A 5KG5A 5ETOA 2FGOA 1N6QB 3JAMY 1X4BA 1HA1A 3TZXA 1AH5A 1YFHA 4WYWA 4NLXA 3MUVP 1Q1KA 1KNZA 2I2YA 3SQGA 4FYXB 4DSJA 4FYDA 1EARA 4LF5E 3DU6A 2WZOA 3OLAA 4DSKA 4CH0S 4TYAA 5KFZA 4BS9A 3N01A 1F1BB 3I9V9 4I1TA 4OJ1A 2I0XA 1CS4B 2JVOA 3ZC4A 5J1EA 5GAEI 1KQGB 3GSDA 2XQCA 3OR2A 1TKXB 2R2TA 8AT1B 2Q6BA 4WFYA 3X3UA 1VQKS 4AUKA 3IXQA 3FKBA 2D74B 1QAYA 4MKAA 1QAIA 3FFIA 1HYSB 2OSRA 3MAHA 5HLFB 1HL6A 2V4JA 4NI2B 5EUHA 2PC6A 4WXWA 3PX0A 1EETA 1BWVA 4DV3E 4DR7E 4DU7A 3JS9A 3GV8B 4DEZA 1UA1A 3K7RA 2J7WA 1FKPA 2JVAA 4J9OA 2BANA 2GMLA 2IAJA 1R43A 2L08A 3ZZRA 4G1IA 4I7FB 5KT3A 4GC7A 3OR1A 3OTDA 4J9PA 2RTXA 2O3DA 5IWAF 1N48A 1S99A 4NA3A 4NLQA 1RAJA 1UPPA 1UVLA 3EDQB 4LFAE 4XDDA 3DKDA 4NCAA 3OFHA 2MKDA 3ZFVA 1NKEA 5L8RC 1QAJA 1YJRA 1S1VB 2CQ3A 4OYPA 1JLFB 1CJKA 4JI0J 1U0SA 5KFYA 1RJJA 3KNGA 5T14A 4M5NA 1FA0A 4IRKA 2LEBA 1L3SA 2QYGA 2EMGA 2CPEA 3MHHC 2EBGA 3IRXB 1W2IA 2ZJRQ 3ADGA 4OX9E 2ROEA 1P6TA 4UOHA 3KG1A 3R5GA 1P1TA 2UXCE 1Y0HA 3MPWA 3RTVA 3P49B 2EKNA 1Y9OA 3QO9B 1HNZJ 3D0GE 2FZCB 5H9EK 2R76A 4QPXA 2EOYA 2YNIB 2VA3A 5DJBA 4LUBA 3THOB 4WFTA 4UOGA 2DSYA 4C3LA 2DNYA 4JYAF 3QT6A 4NXMJ 2YTPA 1RABB 4ZJOA 3PO4A 1RTJB 4Y34A 2EMFA 4JI4J 2AU0A 1WELA 3H4BA 4ENOA 1KLNA 2DNKA 2BM0A 5F8JA 1RAAB 3IS9A 3I0SA 4HT5A 2MDRA 4M8LA 2QN6B 2BV3A 4J9MA 4ZVHA 3TQMA 2YU8A 3AA8A 3D3CJ 5KT5A 4MLQA 2BOAA 4XK8C 4X9JA 2ZVSA 1IKXA 5HVFA 2GIQA 3EVMA 1H2VZ 2VBYA 5ETSA 3W2VB 1YJWS 2LQ9A 4G6VB 2YQ1A 3IM9A 1RC7A 2ZJPQ 2G1HA 5GAEU 1GTKA 2YWWA 3K5OA 4DQRA 2JOQA 3HKZD 1U6ZA 2BABA 4WFAQ 2GFFA 2VOOA 4JV5J 1XIQA 4ZPAA 2XG8A 1L4SA 1KTVA 5KFMA 1F5AA 4O4RA 3M9OB 2HFSA 3UE2A 3RMPA 2HYIB 3QIPB 1JK1A 2YX1A 4JP8A 1T94A 3NGKA 4YB5A 1X47A 2AX0A 4ZYDA 3CC2S 3NWRA 1T05B 1EKSA 4LVOP 2DNLA 4F4WA 5IT9U 2KO1A 3KK2A 2CPJA 5HL7Q 4E2FB 2VFUA 3BGFA 5LXRA 4ED5A 1U47A 1A1JA 3AB4B 5T6JA 3PW4A 1NCSA 5MAOA 2HNYB 5C42B 2W7AA 3DHWC 5KL2A 3F6GA 1DHMA 5F9LA 5J1PA 3DRSA 4ELVA 3LPEA 1FD2A 2UUAF 1HMVA 1WC5A 3GONA 2GLIA 1RP5A 2CZ9A 2V8GA 1LWCB 1KVKA 2YH0A 4D3GA 2MLZA 4C8KA 3LP2A 5DGBA 1B70B 1HW9A 3ZTQA 2WW4A 1UMJA 2RE1A 2XZTB 1RTDA 1U1PA 3TAPA 1M1HA 2AQ4A 3FQKA 4UY85 2M5YA 1U1MA 1SQFA 1JXVA 4LBHA 4LF2A 1GEHA 3BBFA 3JAMC 1M5SA 3RAXA 3VAHA 5HROB 1PAEX 4ITSA 5LSRA 3OL8A 2H48B 1TL5A 2C2DA 2W2MP 3GIIA 1NZ8A 3TUPA 1HBMA 2LCWA 4C8NA 3P3DA 4IFYA 3A12A 6FDRA 1PDAA 4I6WA 2KH9A 3T1HJ 3NNCA 3FSIA 3CWJA 5K20B 5KFWA 4X4UA 2YZTA 1J5EJ 2M9KA 2V8HA 2G13A 4L72B 4DV7J 2LRSA 2CJKA 2JX2A 4RNOA 2B4UA 2L48A 2IBOA 5IWAE 4Y6IA 4ZHRB 1N34J 3I55S 3H2UB 3KLFA 4CT9A 2DNNA 1F5BA 4JI5J 5DG7A 5IXMB 1X5OA 2JWOA 2L9WA 3UDLA 2IJNA 2W4PA 3FBEA 1VQSA 1JLQA 2F8EX 2Y1LB 4UUXA 4DFJA 2RMLA 1RTIA 2UUCF 3AAWB 3GCXP 1N5VA 4X2BA 3JU0A 3JTPA 4KWYA 2CQ0A 1CEZA 2RPCA 2N8XA 2YX7A 1N32F 4IQMA 3KLHA 2AGOA 3P45B 1R8AA 1WF0A 2ZBRA 4LTYA 2FHJD 3TANA 1EHWA 1RQ0A 1HD0A 2XWXA 2HQCA 1DFDA 2EG2A 2VUGA 5F8HA 4I68A 2IYIA 4KFBB 1KJKA 4DZ6A 4F67A 2DGOA 4LIWA 3WX8A 4JYAE 2PA8D 1WG4A 2E7WA 4OZNA 3J80U 4ZIWA 1S1XA 1K1SA 4QR1A 1ZTTA 1J2VA 2CPXA 3GILA 2L41A 3AUZA 4QQBA 1ITPA 3MPYA 3AOBA 2CNKB 1NJIT 2WVDA 4Q35B 2AZ1A 1WNEA 3SCKE 3BGRB 3LGNA 5I42B 2ZBPA 4FXWA 3SQGB 1LWFB 1XNRF 4UT4A 4LF9J 3FEXB 3EPJA 2PFFB 3FZ2A 2V2ZA 1RDRA 5KFQA 2VONA 1F3VA 5GMKa 3QFWA 2E29A 2NUGA 2PD1A 2EOIA 1XNQF 5DO2A 2ZKUA 3ADLA 2XY6A 3FFIB 2R9LA 1ICEB 2V4JB 3NXZA 2BJ3A 4HHJA 1R7IA 3VAGA 5KG3A 3U02A 2YTDA 2EWLA 2VJVA 2CQHA 3MCOA 3RRGA 1RT7A 3FEZA 1FKPB 4PG5A 2Q43A 2BANB 4ZCLA 4O0IA 3EGVA 1M1GA 5GAHI 3G6XA 2WBUA 3IGNA 3LP1A 4OYBA 2EN3A 4HI1A 3CD7A 3SFGA 2BXJA 4RUHA 2YKMA 5KOXA 2QL5B 4YB6A 2WSEC 2LT7A 4DL2A 2EPMX 2M7QA 3BH6B 3D28A 1EKRA 4ED8A 1HBNA 1T9YA 1WXRA 1JQGA 2CJ9A 2VE7C 3WX4A 4B9LA 1CJKB 2UUAE 2ZH1A 2OP5A 1GXUA 5B09A 1N52B 3DRXA 3MZIA 3GV7B 1RTHA 1OMSA 3UNYA 1U25A 1IWAA 5K8PA 2C42A 3HP6A 3HM9A 3MMBA 3NCRA 4QOTA 2DXEA 3HPOA 3QGPA 3QRPA 3DJWA 4AXIA 2EEYA 4F50A 1QNTA 3D4JA 4DCPB 4Y65A 1DLOA 3J81Y 2ZEJA 2AGQA 4KYZA 3S01A 2ZH9A 4MK8A 1VQYA 2AHOB 4DX7A 4ID8A 2DD8S 2VPZB 4GO5X 5E3PA 4DV5F 1VR6A 2IPOB 2LYVA 1P8GA 4F3MA 2V83A 3T19A 2Z57B 5I3UB 2EL5A 4P6QA 2HSEB 3A8KA 2VG5A 4F4AA 4IG0A 3EGNA 1S10A 1B0VA 1GH8A 1KYQA 3HSGA 4ZK7M 2VBXA 3IS9B 2GAGC 3I0SB 1WWHA 4URSA 2JEFA 4ECZA 2XS7A 4FXVA 3LANA 5D15A 1KEKA 2EMXA 2F7VA 3MPVA 2CPYA 4HLBA 4AT1B 1IKXB 1FE0A 4U7UD 2ENAA 2DT9A 2B4PA 4WF9Q 4H4KA 5IT4A 4Q2MA 4PZVA 2YTGA 2B7BB 5EGYA 1VBKA 1W26A 1VQ9S 5L9NA 3S8SA 4CP5A 2LA6A 4BC7A 2GJ2A
chains in the Genus database with same CATH topology
3B4DA 3M6VA 3OBIA 4HVZA 2AW0A 5J2QA 3EPGA 4I67A 3C2PA 1Q8IA 3CCJS 1S6PA 2XMUA 2HLUA 4DV2F 3V6DB 1KLMB 2WSCC 3MM5B 2RRBA 4X64E 4DR2E 2ZE2A 4IDKA 3BDPA 1NKCA 2UUCE 2OFHX 4KRWA 3MFHA 1H7WA 4PRFA 4OX7A 4LSNA 2RRNA 3ITHA 5A6WA 2GO9A 4N56A 2L2MA 1T7PA 5D77A 4X4TA 1GX6A 1GNKA 1VRUA 5JJBA 3DLGA 3NNHA 1YG0A 3DHXA 4PXDA 1NJWA 1T05A 1N32E 1SR9A 3PEHA 2OAUA 4F3OA 2YWFA 5A8RA 4TQSA 2JHEA 2IVMA 1X48A 2BDPA 3C6TA 3H8YA 5F0UA 1V3SA 4G3IA 3SDEB 4B3TE 3ZOQB 4KQZA 5BYRA 2DNOA 3ETOA 3C46A 3LAKA 5CCLA 2ZM6F 3OVSA 3GFHA 4DDFA 3CJ4A 1ZM4A 1NK8A 5HMYA 1A7GE 2CKWA 3HO1A 5LXYA 1N56A 1KVJA 2V9KA 3X1LB 1ZPVA 4KTQA 3SSRA 5D8HB 4WU3A 2KJWA 1C1CA 3M2VA 5J2MB 3FCHA 4I6AA 5A8WA 4JI3E 2AYEA 1S7HA 1T02A 4NLGA 1T4LB 3GZ7A 2MGZB 1QVGR 3BM7A 2VG7B 3THVA 3F73A 1A6LA 1TL3A 4ILRA 3N5FA 2RU9A 1GXTA 4RW7A 3AQPA 2V4QA 1P9QC 2B0GA 3NAIA 3GV5B 1FXDA 3GG0A 5GAHU 3DI6A 3KK2B 5I3PA 3M4XA 1HI8A 5HO4A 4GKJF 2DNQA 4DL0C 3MMCB 2EKYA 2NSBA 2IA6A 1S9EA 4ED0A 2QMXA 3VK6A 2ZOMA 3B8HA 4U6PA 4NA1A 3SCLE 5KFBA 4KE5A 4J9RA 2CJQA 1KQSR 1WF2A 4DUZF 1NJZA 2EPIA 3NCQA 3I4PA 3K8WA 4NXNF 4XPEA 4KGMA 1NU4A 2FC8A 5EWFA 2HNZB 3BB5A 3MM7A 3SCJE 5IZHA 3TNVA 1U1KA 2IRYA 4USJC 4NYPA 2HHXA 4X62E 1YJUA 3OL6A 1D9DA 3QJPA 3MR5A 4YR2A 2R2UA 4N41A 3MD3A 3J7A1 1S6OA 3M8QA 1M5KC 3HXLA 3IWCA 3HHLB 4NCBA 3DRSB 2ROPA 1UL3A 1WTFA 2YX4A 5C25B 2N3OA 1XR7A 1NH7A 2ROGA 1XN9A 3F56A 2UVUA 4KZSA 2FVPA 1JLAB 4CO5A 5IT0A 2DIUA 1NHUA 3P96A 1FDBA 4A4JA 1YGYA 2HFOA 1P27B 2F9DA 4OI6A 1X4CA 1XNRE 3POTA 4LF8F 5LL6R 4PR6A 4ZPTR 3JSRA 3DLKA 1URNA 2ZOFA 1N36F 3SYZA 3CJKA 3L09A 4DQQA 1HI0P 2DRBA 5U47A 2DHGA 1SH3A 2V2KA 2HHPA 3UI3A 1W2BR 3OHAA 4DR1E 3A8EA 2K7JA 3R27A 2RNEA 2LMIA 4X4VA 3EZUA 3KFWX 3BSNA 3IGVA 3UQSA 2GCFA 1FRJA 1XR6A 4BDPA 4LU9A 2OPRA 3M8PB 2D3UA 3PZPA 1YTYA 1STUA 3HQ1A 1DTQA 4PWDB 3R5BA 1S0OA 1IQTA 1YWXA 3M1VA 3AQOA 2E1CA 4E98A 3PKYA 4I2PA 2BE2B 5CD4H 3G8TA 3TUIC 3FRYA 1IKWA 1S1UA 1UFLA 1X4EA 3QIDA 3CCZA 3HVRA 5CHCB 1QSLA 4X65F 4CNYA 1GQEA 2R8JA 1UVNA 4Y2AA 5ADZA 1R31A 2NR0A 1QE1A 2WSFC 4TU7A 1BD6A 2GQQA 5K8NA 3RBDA 1P1LA 1FHTA 2DB2A 1IBLF 1U1QA 1T03A 2BACA 1FVSA 1OO0B 2RS7A 1XNQE 1Y3KA 3TQ1A 1YYKA 3PEJA 4WFZA 2W8KA 3N6MA 5KG6A 3IAM9 4N77A 5F8IA 1VQ8S 4LF4F 2YKOA 3K58A 3QAEA 4RUCA 1YYOA 3ZZZA 2ZH7A 3DOKB 4YB1P 4URGA 1XERA 4DMZA 1YI2S 4GC6A 2NYIA 4FBTA 1OSDA 1YSJA 3QYYA 2B4VA 3WZ0A 2KFNA 3GB0A 2DRAA 2ZITA 2X3GA 1VBYA 3T3FA 2JLFA 1EKZA 4TNOA 1FNMA 1WHQA 5F3WA 3UD3P 3HVTA 1VIXA 4QIEA 4ECXA 4QR2A 1NO8A 1JJHA 1HBMB 1LXJA 2RB7A 2J6SA 1CPZA 4PXEA 2DNHA 4QR0A 2LUQA 2R7TA 3H2LA 4ECVA 4IFYB 2XS2A 4AYBD 2YWEA 1DARA 2O01C 2V94A 1CLFA 3CIZA 1S9GA 4DV4E 5B0EA 1OPZA 4O23A 1LOUA 1KHWA 1RA7A 1RK8A 4EO8A 2PGCA 3T6BA 2WTFA 1OQ6A 2NPFA 3SFUA 3BO3A 2W8LA 2KT2A 2CDQA 2FHOB 3LP0B 5HBMB 2CPFA 2D9PA 1E6YA 3TUZC 1SJ3P 4PG6A 1N34F 2L92A 3J80Y 4YQWA 3PW7A 2Q66A 3K5LA 2X51A 2IHR1 3KHGA 3IWBA 2CRLA 2ODRC 2GO8A 2GQ2A 4ELUA 2L3MA 3AA9A 2X1FA 1HBUB 4TUGA 2JY9A 4KO0A 3KLVA 3BSOA 2QO3A 2XMWA 3KLFB 1FXLA 1LW2B 2KI2A 3OTEA 5DQIA 1RWUA 4TY8A 3DC2A 1FKOA 4AL5A 2J8AA 5IQQA 3DLBA 3DF6A 1DBDA 1BWEA 1K0TA 3ONQA 5E3AA 2DR5A 2RQ4A 3AJ2A 2JEGA 4YY3E 1X4AA 1LXNA 3QLHB 4NZ0A 4QIFA 4WK1A 4YEAA 5I3QA 2LQBA 5AXLA 3S1TA 1VBZA 2V5HG 4JI0E 3KHHA 2XGQA 3SZ2A 4MIAA 3ISNC 2BJEA 3ADIA 3DRPA 3Q2TC 1HQUB 2OPSA 3UR3C 3QZ7A 2HAIA 2DNGA 4B3SE 1JLQB 2ZH4A 2MKSA 3MOZA 4MFBB 2IVFB 1QTMA 2R7QA 2MDAA 2XLIA 5CYMA 3CD0A 5E33A 4R5PB 4R8UA 1LW0A 4IFVA 2GMHA 1DTTA 1O51A 2CPDA 1Q86T 4NA2A 1RTIB 1N0VC 3JTZA 4DR4F 4JI1F 3MEDB 3G6ES 2O67A 3V6HA 4HL9A 1TK0A 2P9EA 2NUUG 1NK4A 4RBTA 3QJJA 3BEGB 2FGCA 3OVAA 5D6GA 2FVQA 4AE5A 1ZETA 1LWEA 1C1BA 2N7CA 7FD1A 2RD5C 5A6PA 4WFXA 3OSNA 2XCPA 3NCPA 3LGMA 1UJ6A 4LQ9A 2C3OA 4ZPCA 3DXSX 2L33A 3LWMA 2W7PA 1UILA 2VPXB 3IG1A 1TL1A 2GGPB 5FD1A 4PXCA 2OPPB 2K4VA 2XMTA 5KFAA 3MMJA 2R8IA 2WK4A 3LPYA 5F41A 5KG2A 5C24B 5F8GA 2B9WA 2HG4A 3S6EA 1J5OA 4TKTA 5CYQA 2JOXA 1NHVA 1Q7LB 1G7CB 2O66A 1JMTA 1HNIA 2M52A 1BQMA 5GAGU 3DYAA 1J26A 4OI4A 1Z2ZA