2YSPA

Solution structure of the c2h2 type zinc finger (region 507-539) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 507-539)of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yspA01
2YTPA 2RPCA 3EPHA 2EOHA 2DLKA 1A1FA 2YRKA 1DGCA 2RSIA 2WCC3 2YU5A 2EQ3A 2ENAA 2YTIA 2YTDA 1A1GA 2MDGA 2YRMA 1TF6A 2EOMA 2DLQA 2EMCA 2EMWA 2EM2A 2EPZA 2EMBA 2EMGA 2EM5A 2YTNA 1A1JA 1G2FC 2R1FA 2EN8A 4F6MA 1A1LA 2EOYA 1P47A 1BB8A 5KL4A 2GLIA 1AAYA 5KL2A 1YSAC 1NCSA 3MHHC 4F6NA 2EMFA 1X6FA 4R2CA 2EM4A 2EPXA 1A1IA 4R2AA 2LV2A 4X9JA 2CSHA 2EOXA 2EORA 2EM3A 1ZAAC 1UBDC 2EJ4A 2YTQA 4R2EA 2BB8A 4R2QA 1TN9A 2ENCA 2DRPA 1JK2A 2D9HA 1YUJA 5KL5A 2J7JA 1ZR9A 2EPPA 3VHTB 4R2PA 2EM0A 2JPAA 2EN7A 2EMHA 1LLMC 2EM7A 2EN3A 2A25A 2YSPA 3EPJA 2EL5A 2MKNA 2YU8A 3MHSC 2LO3A 2EOQA 2EMKA 3EPLA 2PRTA 1MEYC 4IS1C 2HGHA 2EOIA 2EMZA 2CT1A 4R2DA 2YTGA 1X6EA 1ZU1A 2EOOA 2ENHA 4IJDA 1TF3A 4M9VC 3M99B 2EE8A 4GZNC 1BBOA 2DGCA 2EOFA 2EM6A 2EPUA 2WBUA 2YTOA 2JP9A 4R2RA 2E72A 2EMYA 2MKDA 1JK1A 2DMIA 4WSGA 2EN6A 2EN1A 2ADRA 1KJKA 2EMIA 2YSOA 2EOZA 1B69A 2EMAA 2ELZA 1YUIA 2YTJA 2EMLA 2LCEA 2VRDA 2M9AA 1X6HA 4F2JC 2EM9A 1Z1BA 2EMXA 2EOJA 1X5WA 4R2SA 2LVHA 5KL6A 2EL4A 2I13A 1X3CA 2EPRA 1RMDA 2EP3A 2EN2A 2YRHA 2EN4A 1A1HA 4FK5C 1UN6B 2EQ1A 1A1KA 2EPCA 2EM8A 2YTFA 2WBSA 1G2DC 5KL3A 2GHFA 1WJPA 3UK3C 2CTDA 2EQ0A 2EOEA 2LT7A 3EPKA 2YTEA 1F2IG 2NABA 2ELYA 2EPAA 2WBTA 5KL7A 2EL6A 2EOSA
chains in the Genus database with same CATH superfamily
3EPHA 4WXCA 1SR9A 2V83A 2JY9A 4BHBA 4WX9A 1XMQE 2RSIA 2MDGA 3OMLA 4BCAA 4DR1E 2EMCA 2V87A 2EMBA 1A1JA 2UUBE 5A6BA 2L3CA 1A1LA 4DR6E 1J5EE 1BB8A 2JYAA 2E1MA 2EWLA 5KL2A 2FV4B 3J7Yp 2EPXA 1T4LB 3C6MA 2EORA 2EM3A 1FJGE 1XMOE 2L8TA 5LMUE 1WHNA 1TN9A 1GQEA 5KL5A 3VHTB 2HC5A 1YUJA 2LUPB 1X49A 4R2PA 2LRSA 4LTYA 3ADLA 4GEQB 4DMIA 2A25A 2F4VE 1DQ3A 3KWRA 2RS7A 1L4SA 2EL5A 4TUGA 2MKNA 2EOQA 2PRTA 1UILA 3C4TA 4WXDA 2YTGA 2ENHA 2EOOA 2FTXB 4IJDA 3C6KA 3BGHA 2JWOA 2EPOA 2E5LE 5A6KA 2EPUA 4WFTA 2JP9A 1JK1A 2DMIA 1KJKA 2ADRA 4Q28A 4F54A 2EMIA 2UXDE 2EOZA 1B69A 2EMAA 4DV1E 2EPLX 2WZOA 2VRDA 4F2JC 1X6HA 2EM9A 1YYKA 5LL6R 2LVHA 4GKKE 3THOB 2KOUA 1X3CA 5TSEA 2EPMX 2YRHA 1HNXE 4JI3E 4LF6E 2DMYA 2JOBA 1QNTA 2N3GA 4YHHE 1ZBQA 1BBGA 1ZBTA 2WBSA 4DV4E 4ZYEA 4DV0E 5A6JA 2UXCE 2HJJA 3EPKA 2ODRD 2VF1A 3ADGA 2VQEE 3EQ1A 3L00A 3T1YE 2RPCA 2VQFE 2V86A 1KYQA 2LTRA 2EOHA 2M4IA 2DLKA 2B9DA 1A1FA 1HR0E 1DGCA 2WCC3 2EQ3A 4DV5E 1A1GA 2YTDA 1PDAA 4DUYE 1TF6A 2EOMA 2EM2A 2EPZA 4DV6E 4DR7E 2YTNA 4OOGC 5DNYA 3TQMA 2UU9E 2RTXA 4F6MA 3FIGA 2EOYA 2MDRA 5AASA 2H36X 2R76A 1AAYA 1YSAC 4ZYDA 1GZ6A 2M7QA 1SFEA 1EH8A 2LBSB 2EMFA 1X6FA 4R2CA 4JI2E 1XNRE 1A1IA 4R2AA 4ZYHA 5ADZA 3HPSA 2LV2A 2NUEA 4KZSA 4LFCE 1DI2A 2EJ4A 3LLHA 2YPNA 4R2EA 4DV7E 2BB8A 3T1HE 4DV2E 2B3TB 1N3GA 4M30A 4B3TE 1LLMC 3HTXA 4TUIA 2EN3A 1PKPA 4RH8A 1T39A 2LTSA 1WRJA 3BBGA 3MHSC 1WXRA 2HGHA 5CFFE 4YY3E 4WPYA 2EOIA 2UUAE 3H09A 2BBGA 4R2DA 1X6EA 4B3ME 4M9VC 1TF3A 4F9BB 4LF5E 4BHCA 2EOFA 2RSMA 2EM6A 2YTOA 4NZVA 1QU6A 2EN6A 2EN1A 3F6GA 4DKKA 4BBYA 2ELZA 5AE2A 4P78A 2YTJA 2EMLA 1EH7A 2I9IA 3IWDA 1Z1BA 3F6HA 3DJWA 1YFHA 2RQLA 4X62E 1MGTA 2B7VA 2EQ1A 1EH6A 2L2MA 4JI1E 4BC9A 2GHFA 4OX9E 1X48A 2EOEA 1EKZA 3IWBA 2YTEA 2ELYA 3J80C 5IV8B 4WYQB 5KL7A 2EL6A 3J81C 2K7IA 4JI6E 3THNA 4JYAE 5A69A 4JI4E 4B3RE 1PJSA 3BF2A 3JAMC 2ENAA 2MC5A 4X64E 2YRMA 2V88A 4LF4E 5T6JA 3AV0A 2EMWA 4M0VA 2EM5A 1G2FC 2R1FA 5IWAE 2EN8A 3IWCA 4WSPA 1P47A 2JR1A 5FLXC 2GLIA 3VYYA 3AUZA 1PJQA 4BMJA 4O24A 2EM4A 2UUCE 3ZOQB 2JVAA 2CSHA 2EOXA 1UBDC 2EPKX 3MSWA 2EZ6A 4NXME 4JI7E 4R2QA 2DRPA 4P7DA 2D9HA 4ZYGA 2EM0A 2JPAA 2EN7A 1YYOA 2EM7A 1X47A 2NA2A 2YT4A 4B3SE 2YU8A 2LO3A 1MEYC 2EMKA 3EPLA 4KHPE 2N3HA 1IBME 1ZU1A 1FKAE 4GZNC 2DGCA 4J8ZA 3OTOE 1PJTA 2EMYA 2L6MA 2MKDA 4DR5E 1I94E 5A6AA 2K4VA 3HPZA 1HNWE 5AE3A 4BC7A 2YSOA 1RC7A 2L92A 1AH5A 2VE7C 2L3JA 3QG5C 1J26A 2LCEA 2L2NA 2M9AA 1IBKE 2GPIA 2EMXA 1T38A 4R2SA 2RS6A 1T4NA 3ECRA 2LMZA 2ODRC 2EPRA 4BS9A 4FK5C 1UN6B 2KHXA 2M1SA 1A1KA 3HQ1A 2EPCA 4O5GA 1G2DC 5KL3A 1WJPA 3UK3C 5F3WA 4O43A 4L5NC 2CTDA 4K0KE 2JOXA 4X66E 2LJHA 2LT7A 2HHHE 4X65E 2DIXA 2EPAA 2EOSA 3RMPA 2DSYA 4R8OA 2YTPA 5AC4A 2NUFA 2YZTA 1O0WA 4O4KA 4X8WA 4LF9E 2G7HA 2YRKA 3KZYA 5A2QC 3VK6A 2MC6A 1YYWA 2YU5A 5BR8E 2YTIA 4Q35B 2DLQA 2V85A 1UHZA 2EMGA 4HEIA 1T4OA 2IHR1 5KL4A 3KZZA 2L33A 1N33E 1NCSA 4DR4E 4HTGA 3MHHC 1IQSA 4F6NA 4DUZE 1NEIA 5AC5A 5A6BD 2B7TA 3ADJA 4X9JA 1IQOA 1ZAAC 1IMUA 3K6QA 2YTQA 2UXBE 3HXLA 1N32E 3LMLA 2ENCA 4MLVA 1JK2A 2J7JA 1ZR9A 2EPPA 3VYXA 1RQ0A 4LF7E 5IT9C 4F9AB 4LF8E 2LE2A 2ZM6E 2EMHA 3P1XA 3EPJA 2YSPA 4JI8E 4JI0E 3ADIA 2KONA 4JV5E 2V89A 5LMNE 4IS1C 2EMZA 2CT1A 1N36E 1GTKA 4DR2E 4NHRA 2YWQA 4LFBE 5AE1A 4MLQA 2NUGA 2FGGA 3M99B 2EE8A 2LJUA 1BBOA 4NXNE 2CPNA 3BIDA 3DF6A 2WBUA 1YPNA 4R2RA 2E72A 4WSGA 2L2KB 5IXMB 4RHBB 1YUIA 2V8QB 4F9CB 1YZ9A 2F8BA 1STUA 2DB2A 4R03A 2JXPA 2EOJA 1X5WA 2N8XA 3JU0A 5KL6A 2EL4A 3C4BA 2I13A 4KWYA 4N4RB 1RMDA 2EP3A 4LU9A 2EN2A 2EN4A 4AQYE 1A1HA 4M2ZA 4LFAE 4JI5E 3J7AG 4L8NA 2EM8A 2YTFA 4DV3E 4GKJE 4I8OA 2LUQA 1HNZE 2EPNA 2EQ0A 1F2IG 2NABA 2WBTA 5LLQA 1IBLE 4DR3E 1N34E 1XNQE 3JTZA 2Q8UA 1WHQA
chains in the Genus database with same CATH topology
2YTPA 2RPCA 3EPHA 2EOHA 2DLKA 1A1FA 2YRKA 1DGCA 2RSIA 2WCC3 2YU5A 2EQ3A 2ENAA 2YTIA 2YTDA 1A1GA 2MDGA 2YRMA 1TF6A 2EOMA 2DLQA 2EMCA 2EMWA 2EM2A 2EPZA 2EMBA 2EMGA 2EM5A 2YTNA 1A1JA 1G2FC 2R1FA 2EN8A 4F6MA 1A1LA 2EOYA 1P47A 1BB8A 5KL4A 2GLIA 1AAYA 5KL2A 1YSAC 1NCSA 3MHHC 4F6NA 2EMFA 1X6FA 4R2CA 2EM4A 2EPXA 1A1IA 4R2AA 2LV2A 4X9JA 2CSHA 2EOXA 2EORA 2EM3A 1ZAAC 1UBDC 2EJ4A 2YTQA 4R2EA 2BB8A 4R2QA 1TN9A 2ENCA 2DRPA 1JK2A 2D9HA 1YUJA 5KL5A 2J7JA 1ZR9A 2EPPA 3VHTB 4R2PA 2EM0A 2JPAA 2EN7A 2EMHA 1LLMC 2EM7A 2EN3A 2A25A 2YSPA 3EPJA 2EL5A 2MKNA 2YU8A 3MHSC 2LO3A 2EOQA 2EMKA 3EPLA 2PRTA 1MEYC 4IS1C 2HGHA 2EOIA 2EMZA 2CT1A 4R2DA 2YTGA 1X6EA 1ZU1A 2EOOA 2ENHA 4IJDA 1TF3A 4M9VC 3M99B 2EE8A 4GZNC 1BBOA 2DGCA 2EOFA 2EM6A 2EPUA 2WBUA 2YTOA 2JP9A 4R2RA 2E72A 2EMYA 2MKDA 1JK1A 2DMIA 4WSGA 2EN6A 2EN1A 2ADRA 1KJKA 2EMIA 2YSOA 2EOZA 1B69A 2EMAA 2ELZA 1YUIA 2YTJA 2EMLA 2LCEA 2VRDA 2M9AA 1X6HA 4F2JC 2EM9A 1Z1BA 2EMXA 2EOJA 1X5WA 4R2SA 2LVHA 5KL6A 2EL4A 2I13A 1X3CA 2EPRA 1RMDA 2EP3A 2EN2A 2YRHA 2EN4A 1A1HA 4FK5C 1UN6B 2EQ1A 1A1KA 2EPCA 2EM8A 2YTFA 2WBSA 1G2DC 5KL3A 2GHFA 1WJPA 3UK3C 2CTDA 2EQ0A 2EOEA 2LT7A 3EPKA 2YTEA 1F2IG 2NABA 2ELYA 2EPAA 2WBTA 5KL7A 2EL6A 2EOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTP A;  2RPC A;  3EPH A;  2EOH A;  2DLK A;  1A1F A;  2YRK A;  1DGC A;  2RSI A;  2WCC 3;  2YU5 A;  2EQ3 A;  2ENA A;  2YTI A;  2YTD A;  1A1G A;  2MDG A;  2YRM A;  1TF6 A;  2EOM A;  2DLQ A;  2EMC A;  2EMW A;  2EM2 A;  2EPZ A;  2EMB A;  2EMG A;  2EM5 A;  2YTN A;  1A1J A;  1G2F C;  2R1F A;  2EN8 A;  4F6M A;  1A1L A;  2EOY A;  1P47 A;  1BB8 A;  5KL4 A;  2GLI A;  1AAY A;  5KL2 A;  1YSA C;  1NCS A;  3MHH C;  4F6N A;  2EMF A;  1X6F A;  4R2C A;  2EM4 A;  2EPX A;  1A1I A;  4R2A A;  2LV2 A;  4X9J A;  2CSH A;  2EOX A;  2EOR A;  2EM3 A;  1ZAA C;  1UBD C;  2EJ4 A;  2YTQ A;  4R2E A;  2BB8 A;  4R2Q A;  1TN9 A;  2ENC A;  2DRP A;  1JK2 A;  2D9H A;  1YUJ A;  5KL5 A;  2J7J A;  1ZR9 A;  2EPP A;  3VHT B;  4R2P A;  2EM0 A;  2JPA A;  2EN7 A;  2EMH A;  1LLM C;  2EM7 A;  2EN3 A;  2A25 A;  2YSP A;  3EPJ A;  2EL5 A;  2MKN A;  2YU8 A;  3MHS C;  2LO3 A;  2EOQ A;  2EMK A;  3EPL A;  2PRT A;  1MEY C;  4IS1 C;  2HGH A;  2EOI A;  2EMZ A;  2CT1 A;  4R2D A;  2YTG A;  1X6E A;  1ZU1 A;  2EOO A;  2ENH A;  4IJD A;  1TF3 A;  4M9V C;  3M99 B;  2EE8 A;  4GZN C;  1BBO A;  2DGC A;  2EOF A;  2EM6 A;  2EPU A;  2WBU A;  2YTO A;  2JP9 A;  4R2R A;  2E72 A;  2EMY A;  2MKD A;  1JK1 A;  2DMI A;  4WSG A;  2EN6 A;  2EN1 A;  2ADR A;  1KJK A;  2EMI A;  2YSO A;  2EOZ A;  1B69 A;  2EMA A;  2ELZ A;  1YUI A;  2YTJ A;  2EML A;  2LCE A;  2VRD A;  2M9A A;  1X6H A;  4F2J C;  2EM9 A;  1Z1B A;  2EMX A;  2EOJ A;  1X5W A;  4R2S A;  2LVH A;  5KL6 A;  2EL4 A;  2I13 A;  1X3C A;  2EPR A;  1RMD A;  2EP3 A;  2EN2 A;  2YRH A;  2EN4 A;  1A1H A;  4FK5 C;  1UN6 B;  2EQ1 A;  1A1K A;  2EPC A;  2EM8 A;  2YTF A;  2WBS A;  1G2D C;  5KL3 A;  2GHF A;  1WJP A;  3UK3 C;  2CTD A;  2EQ0 A;  2EOE A;  2LT7 A;  3EPK A;  2YTE A;  1F2I G;  2NAB A;  2ELY A;  2EPA A;  2WBT A;  5KL7 A;  2EL6 A;  2EOS A; 
#chains in the Genus database with same CATH topology
 3EPH A;  4WXC A;  1SR9 A;  2V83 A;  2JY9 A;  4BHB A;  4WX9 A;  1XMQ E;  2RSI A;  2MDG A;  3OML A;  4BCA A;  4DR1 E;  2EMC A;  2V87 A;  2EMB A;  1A1J A;  2UUB E;  5A6B A;  2L3C A;  1A1L A;  4DR6 E;  1J5E E;  1BB8 A;  2JYA A;  2E1M A;  2EWL A;  5KL2 A;  2FV4 B;  3J7Y p;  2EPX A;  1T4L B;  3C6M A;  2EOR A;  2EM3 A;  1FJG E;  1XMO E;  2L8T A;  5LMU E;  1WHN A;  1TN9 A;  1GQE A;  5KL5 A;  3VHT B;  2HC5 A;  1YUJ A;  2LUP B;  1X49 A;  4R2P A;  2LRS A;  4LTY A;  3ADL A;  4GEQ B;  4DMI A;  2A25 A;  2F4V E;  1DQ3 A;  3KWR A;  2RS7 A;  1L4S A;  2EL5 A;  4TUG A;  2MKN A;  2EOQ A;  2PRT A;  1UIL A;  3C4T A;  4WXD A;  2YTG A;  2ENH A;  2EOO A;  2FTX B;  4IJD A;  3C6K A;  3BGH A;  2JWO A;  2EPO A;  2E5L E;  5A6K A;  2EPU A;  4WFT A;  2JP9 A;  1JK1 A;  2DMI A;  1KJK A;  2ADR A;  4Q28 A;  4F54 A;  2EMI A;  2UXD E;  2EOZ A;  1B69 A;  2EMA A;  4DV1 E;  2EPL X;  2WZO A;  2VRD A;  4F2J C;  1X6H A;  2EM9 A;  1YYK A;  5LL6 R;  2LVH A;  4GKK E;  3THO B;  2KOU A;  1X3C A;  5TSE A;  2EPM X;  2YRH A;  1HNX E;  4JI3 E;  4LF6 E;  2DMY A;  2JOB A;  1QNT A;  2N3G A;  4YHH E;  1ZBQ A;  1BBG A;  1ZBT A;  2WBS A;  4DV4 E;  4ZYE A;  4DV0 E;  5A6J A;  2UXC E;  2HJJ A;  3EPK A;  2ODR D;  2VF1 A;  3ADG A;  2VQE E;  3EQ1 A;  3L00 A;  3T1Y E;  2RPC A;  2VQF E;  2V86 A;  1KYQ A;  2LTR A;  2EOH A;  2M4I A;  2DLK A;  2B9D A;  1A1F A;  1HR0 E;  1DGC A;  2WCC 3;  2EQ3 A;  4DV5 E;  1A1G A;  2YTD A;  1PDA A;  4DUY E;  1TF6 A;  2EOM A;  2EM2 A;  2EPZ A;  4DV6 E;  4DR7 E;  2YTN A;  4OOG C;  5DNY A;  3TQM A;  2UU9 E;  2RTX A;  4F6M A;  3FIG A;  2EOY A;  2MDR A;  5AAS A;  2H36 X;  2R76 A;  1AAY A;  1YSA C;  4ZYD A;  1GZ6 A;  2M7Q A;  1SFE A;  1EH8 A;  2LBS B;  2EMF A;  1X6F A;  4R2C A;  4JI2 E;  1XNR E;  1A1I A;  4R2A A;  4ZYH A;  5ADZ A;  3HPS A;  2LV2 A;  2NUE A;  4KZS A;  4LFC E;  1DI2 A;  2EJ4 A;  3LLH A;  2YPN A;  4R2E A;  4DV7 E;  2BB8 A;  3T1H E;  4DV2 E;  2B3T B;  1N3G A;  4M30 A;  4B3T E;  1LLM C;  3HTX A;  4TUI A;  2EN3 A;  1PKP A;  4RH8 A;  1T39 A;  2LTS A;  1WRJ A;  3BBG A;  3MHS C;  1WXR A;  2HGH A;  5CFF E;  4YY3 E;  4WPY A;  2EOI A;  2UUA E;  3H09 A;  2BBG A;  4R2D A;  1X6E A;  4B3M E;  4M9V C;  1TF3 A;  4F9B B;  4LF5 E;  4BHC A;  2EOF A;  2RSM A;  2EM6 A;  2YTO A;  4NZV A;  1QU6 A;  2EN6 A;  2EN1 A;  3F6G A;  4DKK A;  4BBY A;  2ELZ A;  5AE2 A;  4P78 A;  2YTJ A;  2EML A;  1EH7 A;  2I9I A;  3IWD A;  1Z1B A;  3F6H A;  3DJW A;  1YFH A;  2RQL A;  4X62 E;  1MGT A;  2B7V A;  2EQ1 A;  1EH6 A;  2L2M A;  4JI1 E;  4BC9 A;  2GHF A;  4OX9 E;  1X48 A;  2EOE A;  1EKZ A;  3IWB A;  2YTE A;  2ELY A;  3J80 C;  5IV8 B;  4WYQ B;  5KL7 A;  2EL6 A;  3J81 C;  2K7I A;  4JI6 E;  3THN A;  4JYA E;  5A69 A;  4JI4 E;  4B3R E;  1PJS A;  3BF2 A;  3JAM C;  2ENA A;  2MC5 A;  4X64 E;  2YRM A;  2V88 A;  4LF4 E;  5T6J A;  3AV0 A;  2EMW A;  4M0V A;  2EM5 A;  1G2F C;  2R1F A;  5IWA E;  2EN8 A;  3IWC A;  4WSP A;  1P47 A;  2JR1 A;  5FLX C;  2GLI A;  3VYY A;  3AUZ A;  1PJQ A;  4BMJ A;  4O24 A;  2EM4 A;  2UUC E;  3ZOQ B;  2JVA A;  2CSH A;  2EOX A;  1UBD C;  2EPK X;  3MSW A;  2EZ6 A;  4NXM E;  4JI7 E;  4R2Q A;  2DRP A;  4P7D A;  2D9H A;  4ZYG A;  2EM0 A;  2JPA A;  2EN7 A;  1YYO A;  2EM7 A;  1X47 A;  2NA2 A;  2YT4 A;  4B3S E;  2YU8 A;  2LO3 A;  1MEY C;  2EMK A;  3EPL A;  4KHP E;  2N3H A;  1IBM E;  1ZU1 A;  1FKA E;  4GZN C;  2DGC A;  4J8Z A;  3OTO E;  1PJT A;  2EMY A;  2L6M A;  2MKD A;  4DR5 E;  1I94 E;  5A6A A;  2K4V A;  3HPZ A;  1HNW E;  5AE3 A;  4BC7 A;  2YSO A;  1RC7 A;  2L92 A;  1AH5 A;  2VE7 C;  2L3J A;  3QG5 C;  1J26 A;  2LCE A;  2L2N A;  2M9A A;  1IBK E;  2GPI A;  2EMX A;  1T38 A;  4R2S A;  2RS6 A;  1T4N A;  3ECR A;  2LMZ A;  2ODR C;  2EPR A;  4BS9 A;  4FK5 C;  1UN6 B;  2KHX A;  2M1S A;  1A1K A;  3HQ1 A;  2EPC A;  4O5G A;  1G2D C;  5KL3 A;  1WJP A;  3UK3 C;  5F3W A;  4O43 A;  4L5N C;  2CTD A;  4K0K E;  2JOX A;  4X66 E;  2LJH A;  2LT7 A;  2HHH E;  4X65 E;  2DIX A;  2EPA A;  2EOS A;  3RMP A;  2DSY A;  4R8O A;  2YTP A;  5AC4 A;  2NUF A;  2YZT A;  1O0W A;  4O4K A;  4X8W A;  4LF9 E;  2G7H A;  2YRK A;  3KZY A;  5A2Q C;  3VK6 A;  2MC6 A;  1YYW A;  2YU5 A;  5BR8 E;  2YTI A;  4Q35 B;  2DLQ A;  2V85 A;  1UHZ A;  2EMG A;  4HEI A;  1T4O A;  2IHR 1;  5KL4 A;  3KZZ A;  2L33 A;  1N33 E;  1NCS A;  4DR4 E;  4HTG A;  3MHH C;  1IQS A;  4F6N A;  4DUZ E;  1NEI A;  5AC5 A;  5A6B D;  2B7T A;  3ADJ A;  4X9J A;  1IQO A;  1ZAA C;  1IMU A;  3K6Q A;  2YTQ A;  2UXB E;  3HXL A;  1N32 E;  3LML A;  2ENC A;  4MLV A;  1JK2 A;  2J7J A;  1ZR9 A;  2EPP A;  3VYX A;  1RQ0 A;  4LF7 E;  5IT9 C;  4F9A B;  4LF8 E;  2LE2 A;  2ZM6 E;  2EMH A;  3P1X A;  3EPJ A;  2YSP A;  4JI8 E;  4JI0 E;  3ADI A;  2KON A;  4JV5 E;  2V89 A;  5LMN E;  4IS1 C;  2EMZ A;  2CT1 A;  1N36 E;  1GTK A;  4DR2 E;  4NHR A;  2YWQ A;  4LFB E;  5AE1 A;  4MLQ A;  2NUG A;  2FGG A;  3M99 B;  2EE8 A;  2LJU A;  1BBO A;  4NXN E;  2CPN A;  3BID A;  3DF6 A;  2WBU A;  1YPN A;  4R2R A;  2E72 A;  4WSG A;  2L2K B;  5IXM B;  4RHB B;  1YUI A;  2V8Q B;  4F9C B;  1YZ9 A;  2F8B A;  1STU A;  2DB2 A;  4R03 A;  2JXP A;  2EOJ A;  1X5W A;  2N8X A;  3JU0 A;  5KL6 A;  2EL4 A;  3C4B A;  2I13 A;  4KWY A;  4N4R B;  1RMD A;  2EP3 A;  4LU9 A;  2EN2 A;  2EN4 A;  4AQY E;  1A1H A;  4M2Z A;  4LFA E;  4JI5 E;  3J7A G;  4L8N A;  2EM8 A;  2YTF A;  4DV3 E;  4GKJ E;  4I8O A;  2LUQ A;  1HNZ E;  2EPN A;  2EQ0 A;  1F2I G;  2NAB A;  2WBT A;  5LLQ A;  1IBL E;  4DR3 E;  1N34 E;  1XNQ E;  3JTZ A;  2Q8U A;  1WHQ A; 
#chains in the Genus database with same CATH homology
 2YTP A;  2RPC A;  3EPH A;  2EOH A;  2DLK A;  1A1F A;  2YRK A;  1DGC A;  2RSI A;  2WCC 3;  2YU5 A;  2EQ3 A;  2ENA A;  2YTI A;  2YTD A;  1A1G A;  2MDG A;  2YRM A;  1TF6 A;  2EOM A;  2DLQ A;  2EMC A;  2EMW A;  2EM2 A;  2EPZ A;  2EMB A;  2EMG A;  2EM5 A;  2YTN A;  1A1J A;  1G2F C;  2R1F A;  2EN8 A;  4F6M A;  1A1L A;  2EOY A;  1P47 A;  1BB8 A;  5KL4 A;  2GLI A;  1AAY A;  5KL2 A;  1YSA C;  1NCS A;  3MHH C;  4F6N A;  2EMF A;  1X6F A;  4R2C A;  2EM4 A;  2EPX A;  1A1I A;  4R2A A;  2LV2 A;  4X9J A;  2CSH A;  2EOX A;  2EOR A;  2EM3 A;  1ZAA C;  1UBD C;  2EJ4 A;  2YTQ A;  4R2E A;  2BB8 A;  4R2Q A;  1TN9 A;  2ENC A;  2DRP A;  1JK2 A;  2D9H A;  1YUJ A;  5KL5 A;  2J7J A;  1ZR9 A;  2EPP A;  3VHT B;  4R2P A;  2EM0 A;  2JPA A;  2EN7 A;  2EMH A;  1LLM C;  2EM7 A;  2EN3 A;  2A25 A;  2YSP A;  3EPJ A;  2EL5 A;  2MKN A;  2YU8 A;  3MHS C;  2LO3 A;  2EOQ A;  2EMK A;  3EPL A;  2PRT A;  1MEY C;  4IS1 C;  2HGH A;  2EOI A;  2EMZ A;  2CT1 A;  4R2D A;  2YTG A;  1X6E A;  1ZU1 A;  2EOO A;  2ENH A;  4IJD A;  1TF3 A;  4M9V C;  3M99 B;  2EE8 A;  4GZN C;  1BBO A;  2DGC A;  2EOF A;  2EM6 A;  2EPU A;  2WBU A;  2YTO A;  2JP9 A;  4R2R A;  2E72 A;  2EMY A;  2MKD A;  1JK1 A;  2DMI A;  4WSG A;  2EN6 A;  2EN1 A;  2ADR A;  1KJK A;  2EMI A;  2YSO A;  2EOZ A;  1B69 A;  2EMA A;  2ELZ A;  1YUI A;  2YTJ A;  2EML A;  2LCE A;  2VRD A;  2M9A A;  1X6H A;  4F2J C;  2EM9 A;  1Z1B A;  2EMX A;  2EOJ A;  1X5W A;  4R2S A;  2LVH A;  5KL6 A;  2EL4 A;  2I13 A;  1X3C A;  2EPR A;  1RMD A;  2EP3 A;  2EN2 A;  2YRH A;  2EN4 A;  1A1H A;  4FK5 C;  1UN6 B;  2EQ1 A;  1A1K A;  2EPC A;  2EM8 A;  2YTF A;  2WBS A;  1G2D C;  5KL3 A;  2GHF A;  1WJP A;  3UK3 C;  2CTD A;  2EQ0 A;  2EOE A;  2LT7 A;  3EPK A;  2YTE A;  1F2I G;  2NAB A;  2ELY A;  2EPA A;  2WBT A;  5KL7 A;  2EL6 A;  2EOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...