2YSPA

Solution structure of the c2h2 type zinc finger (region 507-539) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 507-539)of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yspA01
2LV2A 2YTEA 2EPAA 2YSOA 3VHTB 2VRDA 2EN4A 2EL5A 2RPCA 2EM8A 2EORA 2YTFA 2YU5A 1F2IG 3EPJA 4R2SA 2YTIA 2EM7A 1A1JA 2CSHA 2EOHA 5KL3A 2EM4A 4R2AA 2EE8A 2EOOA 2JP9A 2EN1A 2EOQA 2YRKA 1X3CA 2D9HA 4F6NA 2EPUA 2CTDA 2YTJA 1DGCA 1YUJA 2EM9A 1G2DC 2CT1A 1A1LA 2EL6A 1A1IA 1YUIA 4IS1C 1BB8A 1NCSA 2EOIA 2DMIA 2DGCA 2ELZA 2R1FA 1TF3A 2EQ3A 2WBUA 1G2FC 1A1GA 3EPLA 2EM2A 2EMZA 2EMXA 2EMFA 2EMIA 4R2QA 2ENAA 2EOJA 2DRPA 1X6EA 1KJKA 2EPCA 1X6HA 1TN9A 2YTQA 2A25A 2LVHA 1WJPA 2EN7A 2LCEA 1Z1BA 3UK3C 1YSAC 1MEYC 2EPRA 2EM3A 2YRHA 4R2CA 4R2DA 4R2PA 2GHFA 5KL7A 4X9JA 2EOYA 1UBDC 2PRTA 2EN2A 2RSIA 3M99B 2WBTA 4WSGA 2MKNA 2EJ4A 2EPZA 1ZR9A 2M9AA 4R2EA 5KL2A 1RMDA 2EMBA 2WBSA 2BB8A 2EPXA 2YRMA 2EOZA 4M9VC 2EQ1A 2LT7A 5KL6A 2EOFA 5KL5A 1A1KA 5KL4A 1LLMC 3EPHA 2YSPA 1AAYA 4FK5C 2YTNA 1P47A 2I13A 2EMWA 2ADRA 2YTGA 3MHHC 2EMCA 2EOEA 2JPAA 2ENCA 2EOSA 4R2RA 2J7JA 2EMKA 2EN8A 2MKDA 2HGHA 2YTPA 3EPKA 2EN3A 1X5WA 2ELYA 1B69A 2EN6A 2EM6A 1TF6A 1JK2A 4F6MA 2EOXA 2EM5A 2NABA 2EMYA 2LO3A 1X6FA 2EL4A 2DLQA 1JK1A 4F2JC 2EMLA 1A1FA 2YTDA 1ZU1A 2YTOA 2EMGA 4GZNC 2E72A 2YU8A 2EMAA 3MHSC 2EOMA 2MDGA 2EPPA 2DLKA 4IJDA 2EQ0A 2WCC3 2EM0A 1BBOA 2EMHA 1UN6B 2GLIA 2EP3A 1A1HA 1ZAAC 2ENHA
chains in the Genus database with same CATH superfamily
2EPAA 4HTGA 2YSOA 4F9AB 5LMNE 4LF9E 2DIXA 4GKKE 2EPMX 4WXCA 4X64E 4Q28A 5ADZA 3AV0A 3DF6A 2KHXA 4BHCA 2YT4A 1O0WA 5KL3A 5A6AA 4N4RB 3VYXA 2EN1A 5DNYA 4BS9A 2EPLX 1DGCA 2JXPA 2EM9A 1YUJA 3ADGA 2EL6A 4WX9A 1A1IA 2DMIA 2DGCA 2RTXA 4F9BB 5AC5A 4BC7A 2RSMA 4WXDA 2V88A 3HXLA 4ZYEA 4BCAA 4B3RE 4NHRA 4R2QA 2ENAA 4KWYA 4ZYDA 1KYQA 1PJQA 1WXRA 2A25A 4LF7E 4LFAE 2V85A 4DR3E 1N3GA 1MEYC 2UU9E 4JI6E 2EPRA 4BBYA 3C4BA 4ZYHA 4NXNE 2E1MA 2F4VE 2RSIA 2G7HA 3JTZA 4WSGA 1WRJA 3BIDA 2ODRC 5IXMB 2NUEA 2LE2A 4B3ME 4P78A 4NXME 4M9VC 2DSYA 2EQ1A 4DKKA 1AAYA 1XMOE 4R8OA 4JI5E 3MHHC 4Q35B 2DMYA 4DMIA 1ZBTA 2FV4B 3EPKA 2EN3A 2L92A 2YPNA 4JYAE 4DV0E 1B69A 2EM6A 2I9IA 2NUFA 2M1SA 3HPZA 3HQ1A 1XNQE 2RS6A 5LLQA 4F2JC 5AC4A 3FIGA 1ZU1A 5AE3A 2E72A 3BGHA 1PJSA 2N3GA 4DUYE 2M7QA 3C4TA 3BBGA 4WPYA 4RH8A 3VYYA 4IJDA 1N32E 4ZYGA 4O5GA 1HR0E 2WCC3 4DV1E 4JI4E 3BF2A 2GLIA 2EP3A 2HHHE 1PKPA 1Z1BA 2YTEA 4OX9E 2VRDA 2EN4A 2HJJA 2EM8A 2DB2A 2YTFA 3ECRA 2UUAE 1F2IG 2F8BA 4X65E 2YTIA 2EM7A 4JI3E 2JVAA 2EPOA 3F6GA 2EM4A 1IBLE 2EE8A 2B7TA 1FJGE 2YRKA 1X3CA 4BHBA 4DV6E 3J7Yp 2L2KB 4IS1C 2IHR1 2EOIA 5F3WA 2B9DA 2R1FA 2WBUA 1RQ0A 4F9CB 1SR9A 2EMXA 4BMJA 2EMFA 4YHHE 2LUPB 2EWLA 2DRPA 2E5LE 1DI2A 4WYQB 1X6HA 2LTSA 2YTQA 1N33E 2V86A 1SFEA 1WJPA 2KOUA 3ZOQB 4X62E 4JI0E 2LCEA 4LF4E 3EQ1A 3VK6A 3L00A 4R2CA 4R2PA 3THOB 3KWRA 5AASA 4X66E 4DV5E 4DUZE 2B7VA 2JOXA 1BBGA 1T4NA 2PRTA 2WBTA 5TSEA 2MKNA 3C6MA 2EPZA 2KONA 2M9AA 5KL2A 2FTXB 4DR6E 4O43A 4LTYA 2VQFE 1QNTA 4B3TE 4R03A 2L3JA 2LT7A 5A6JA 2EOFA 1A1KA 5AE1A 5KL4A 2R76A 2YSPA 3IWDA 4DV7E 3MSWA 4OOGC 4FK5C 3LMLA 4O4KA 2UXBE 2I13A 2GPIA 2ADRA 2YTGA 1EH6A 2EMCA 2V87A 1GTKA 2ENCA 4LFCE 5IV8B 4L8NA 2N3HA 2MKDA 5LMUE 1T38A 2YTPA 1X5WA 1XNRE 2ELYA 2BBGA 2EN6A 3P1XA 1X49A 1JK2A 4F6MA 2EOXA 3QG5C 2L3CA 2EM5A 2V8QB 1X6FA 2EL4A 2VF1A 2L33A 3THNA 1A1FA 3LLHA 2CPNA 3DJWA 1J26A 1YZ9A 1X48A 2EMGA 4GZNC 1L4SA 5A6KA 2YU8A 2MDGA 2JY9A 1NEIA 1T4LB 1BBOA 2EPKX 2JR1A 1EKZA 4DR7E 4F54A 1A1HA 3JU0A 2UXDE 2N8XA 3J80C 2ENHA 2LV2A 3OMLA 1HNWE 2UUCE 3VHTB 4DV4E 4DV3E 4JI7E 2EL5A 2RPCA 2EORA 5LL6R 1YYKA 1HNXE 3EPJA 2FGGA 5CFFE 2Q8UA 2L8TA 2EOHA 1GZ6A 4R2AA 2EOOA 2JP9A 3RMPA 4JV5E 1YYOA 1T4OA 4JI2E 1G2DC 2CT1A 1A1LA 5FLXC 1YUIA 1BB8A 1NCSA 2LJUA 2EPNA 2ELZA 2EQ3A 3EPLA 2EM2A 1PDAA 2EMIA 3H09A 1T39A 2RQLA 1WHQA 2VE7C 2ODRD 2LVHA 2B3TB 1IBKE 3UK3C 4KZSA 1N34E 4TUGA 2L2NA 1YYWA 2YRHA 1EH7A 4R2DA 2H36X 5A2QC 5KL7A 4O24A 2EOYA 4LU9A 3M99B 2EJ4A 2JYAA 5IT9C 1RMDA 2WBSA 1QU6A 4BC9A 4M30A 2MC5A 2EOZA 1YPNA 5A6BA 5T6JA 5A69A 2WZOA 5KL6A 4AQYE 4WSPA 1LLMC 3KZZA 1P47A 1STUA 2EOEA 2EOSA 5IWAE 4P7DA 3ADIA 2V83A 1TF6A 2LBSB 1YFHA 2UUBE 2M4IA 3HPSA 2JWOA 2K7IA 3K6QA 2L6MA 2EMAA 4KHPE 1DQ3A 3MHSC 2EOMA 1IQSA 2EPPA 2DLKA 2EQ0A 1I94E 3KZYA 2EMHA 4DR5E 2LUQA 4X8WA 4LF8E 1ZAAC 4GKJE 1WHNA 4DR4E 5BR8E 2K4VA 2YU5A 2NUGA 1IMUA 3JAMC 4R2SA 2V89A 1A1JA 2CSHA 3OTOE 1N36E 2MDRA 2LTRA 4MLQA 4DR1E 1FKAE 3ADJA 2EOQA 2D9HA 4F6NA 3C6KA 3T1HE 2EPUA 2CTDA 2YTJA 2LMZA 1RC7A 3IWCA 4M0VA 4RHBB 4YY3E 1TF3A 1G2FC 4MLVA 1A1GA 4J8ZA 2EMZA 2YZTA 1UILA 4K0KE 2EOJA 1KJKA 1X6EA 1J5EE 4LF5E 2EPCA 1TN9A 2JOBA 1IQOA 3AUZA 2EN7A 2MC6A 4LFBE 1YSAC 2LRSA 2ZM6E 3HTXA 2EM3A 2L2MA 2GHFA 1ZBQA 3T1YE 2UXCE 4X9JA 1UBDC 2EN2A 5A6BD 1EH8A 4LF6E 1ZR9A 4R2EA 2EMBA 2BB8A 2EPXA 2YRMA 1PJTA 4JI1E 4I8OA 5KL5A 4JI8E 4L5NC 3EPHA 4NZVA 2YTNA 4M2ZA 2EMWA 4B3SE 2JPAA 2EZ6A 4R2RA 2J7JA 1HNZE 1X47A 2EMKA 2EN8A 2VQEE 2HGHA 1IBME 3ADLA 1UHZA 4DR2E 2LJHA 2NABA 2EMYA 2LO3A 2DLQA 1JK1A 2EMLA 3TQMA 1AH5A 2YTDA 3J81C 4GEQB 2YTOA 4TUIA 3IWBA 1GQEA 2HC5A 2YWQA 2NA2A 4HEIA 2RS7A 3J7AG 5AE2A 2EM0A 3F6HA 1XMQE 1UN6B 1MGTA 4DV2E 4WFTA
chains in the Genus database with same CATH topology
2LV2A 2YTEA 2EPAA 2YSOA 3VHTB 2VRDA 2EN4A 2EL5A 2RPCA 2EM8A 2EORA 2YTFA 2YU5A 1F2IG 3EPJA 4R2SA 2YTIA 2EM7A 1A1JA 2CSHA 2EOHA 5KL3A 2EM4A 4R2AA 2EE8A 2EOOA 2JP9A 2EN1A 2EOQA 2YRKA 1X3CA 2D9HA 4F6NA 2EPUA 2CTDA 2YTJA 1DGCA 1YUJA 2EM9A 1G2DC 2CT1A 1A1LA 2EL6A 1A1IA 1YUIA 4IS1C 1BB8A 1NCSA 2EOIA 2DMIA 2DGCA 2ELZA 2R1FA 1TF3A 2EQ3A 2WBUA 1G2FC 1A1GA 3EPLA 2EM2A 2EMZA 2EMXA 2EMFA 2EMIA 4R2QA 2ENAA 2EOJA 2DRPA 1X6EA 1KJKA 2EPCA 1X6HA 1TN9A 2YTQA 2A25A 2LVHA 1WJPA 2EN7A 2LCEA 1Z1BA 3UK3C 1YSAC 1MEYC 2EPRA 2EM3A 2YRHA 4R2CA 4R2DA 4R2PA 2GHFA 5KL7A 4X9JA 2EOYA 1UBDC 2PRTA 2EN2A 2RSIA 3M99B 2WBTA 4WSGA 2MKNA 2EJ4A 2EPZA 1ZR9A 2M9AA 4R2EA 5KL2A 1RMDA 2EMBA 2WBSA 2BB8A 2EPXA 2YRMA 2EOZA 4M9VC 2EQ1A 2LT7A 5KL6A 2EOFA 5KL5A 1A1KA 5KL4A 1LLMC 3EPHA 2YSPA 1AAYA 4FK5C 2YTNA 1P47A 2I13A 2EMWA 2ADRA 2YTGA 3MHHC 2EMCA 2EOEA 2JPAA 2ENCA 2EOSA 4R2RA 2J7JA 2EMKA 2EN8A 2MKDA 2HGHA 2YTPA 3EPKA 2EN3A 1X5WA 2ELYA 1B69A 2EN6A 2EM6A 1TF6A 1JK2A 4F6MA 2EOXA 2EM5A 2NABA 2EMYA 2LO3A 1X6FA 2EL4A 2DLQA 1JK1A 4F2JC 2EMLA 1A1FA 2YTDA 1ZU1A 2YTOA 2EMGA 4GZNC 2E72A 2YU8A 2EMAA 3MHSC 2EOMA 2MDGA 2EPPA 2DLKA 4IJDA 2EQ0A 2WCC3 2EM0A 1BBOA 2EMHA 1UN6B 2GLIA 2EP3A 1A1HA 1ZAAC 2ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV2 A;  2YTE A;  2EPA A;  2YSO A;  3VHT B;  2VRD A;  2EN4 A;  2EL5 A;  2RPC A;  2EM8 A;  2EOR A;  2YTF A;  2YU5 A;  1F2I G;  3EPJ A;  4R2S A;  2YTI A;  2EM7 A;  1A1J A;  2CSH A;  2EOH A;  5KL3 A;  2EM4 A;  4R2A A;  2EE8 A;  2EOO A;  2JP9 A;  2EN1 A;  2EOQ A;  2YRK A;  1X3C A;  2D9H A;  4F6N A;  2EPU A;  2CTD A;  2YTJ A;  1DGC A;  1YUJ A;  2EM9 A;  1G2D C;  2CT1 A;  1A1L A;  2EL6 A;  1A1I A;  1YUI A;  4IS1 C;  1BB8 A;  1NCS A;  2EOI A;  2DMI A;  2DGC A;  2ELZ A;  2R1F A;  1TF3 A;  2EQ3 A;  2WBU A;  1G2F C;  1A1G A;  3EPL A;  2EM2 A;  2EMZ A;  2EMX A;  2EMF A;  2EMI A;  4R2Q A;  2ENA A;  2EOJ A;  2DRP A;  1X6E A;  1KJK A;  2EPC A;  1X6H A;  1TN9 A;  2YTQ A;  2A25 A;  2LVH A;  1WJP A;  2EN7 A;  2LCE A;  1Z1B A;  3UK3 C;  1YSA C;  1MEY C;  2EPR A;  2EM3 A;  2YRH A;  4R2C A;  4R2D A;  4R2P A;  2GHF A;  5KL7 A;  4X9J A;  2EOY A;  1UBD C;  2PRT A;  2EN2 A;  2RSI A;  3M99 B;  2WBT A;  4WSG A;  2MKN A;  2EJ4 A;  2EPZ A;  1ZR9 A;  2M9A A;  4R2E A;  5KL2 A;  1RMD A;  2EMB A;  2WBS A;  2BB8 A;  2EPX A;  2YRM A;  2EOZ A;  4M9V C;  2EQ1 A;  2LT7 A;  5KL6 A;  2EOF A;  5KL5 A;  1A1K A;  5KL4 A;  1LLM C;  3EPH A;  2YSP A;  1AAY A;  4FK5 C;  2YTN A;  1P47 A;  2I13 A;  2EMW A;  2ADR A;  2YTG A;  3MHH C;  2EMC A;  2EOE A;  2JPA A;  2ENC A;  2EOS A;  4R2R A;  2J7J A;  2EMK A;  2EN8 A;  2MKD A;  2HGH A;  2YTP A;  3EPK A;  2EN3 A;  1X5W A;  2ELY A;  1B69 A;  2EN6 A;  2EM6 A;  1TF6 A;  1JK2 A;  4F6M A;  2EOX A;  2EM5 A;  2NAB A;  2EMY A;  2LO3 A;  1X6F A;  2EL4 A;  2DLQ A;  1JK1 A;  4F2J C;  2EML A;  1A1F A;  2YTD A;  1ZU1 A;  2YTO A;  2EMG A;  4GZN C;  2E72 A;  2YU8 A;  2EMA A;  3MHS C;  2EOM A;  2MDG A;  2EPP A;  2DLK A;  4IJD A;  2EQ0 A;  2WCC 3;  2EM0 A;  1BBO A;  2EMH A;  1UN6 B;  2GLI A;  2EP3 A;  1A1H A;  1ZAA C;  2ENH A; 
#chains in the Genus database with same CATH topology
 2EPA A;  4HTG A;  2YSO A;  4F9A B;  5LMN E;  4LF9 E;  2DIX A;  4GKK E;  2EPM X;  4WXC A;  4X64 E;  4Q28 A;  5ADZ A;  3AV0 A;  3DF6 A;  2KHX A;  4BHC A;  2YT4 A;  1O0W A;  5KL3 A;  5A6A A;  4N4R B;  3VYX A;  2EN1 A;  5DNY A;  4BS9 A;  2EPL X;  1DGC A;  2JXP A;  2EM9 A;  1YUJ A;  3ADG A;  2EL6 A;  4WX9 A;  1A1I A;  2DMI A;  2DGC A;  2RTX A;  4F9B B;  5AC5 A;  4BC7 A;  2RSM A;  4WXD A;  2V88 A;  3HXL A;  4ZYE A;  4BCA A;  4B3R E;  4NHR A;  4R2Q A;  2ENA A;  4KWY A;  4ZYD A;  1KYQ A;  1PJQ A;  1WXR A;  2A25 A;  4LF7 E;  4LFA E;  2V85 A;  4DR3 E;  1N3G A;  1MEY C;  2UU9 E;  4JI6 E;  2EPR A;  4BBY A;  3C4B A;  4ZYH A;  4NXN E;  2E1M A;  2F4V E;  2RSI A;  2G7H A;  3JTZ A;  4WSG A;  1WRJ A;  3BID A;  2ODR C;  5IXM B;  2NUE A;  2LE2 A;  4B3M E;  4P78 A;  4NXM E;  4M9V C;  2DSY A;  2EQ1 A;  4DKK A;  1AAY A;  1XMO E;  4R8O A;  4JI5 E;  3MHH C;  4Q35 B;  2DMY A;  4DMI A;  1ZBT A;  2FV4 B;  3EPK A;  2EN3 A;  2L92 A;  2YPN A;  4JYA E;  4DV0 E;  1B69 A;  2EM6 A;  2I9I A;  2NUF A;  2M1S A;  3HPZ A;  3HQ1 A;  1XNQ E;  2RS6 A;  5LLQ A;  4F2J C;  5AC4 A;  3FIG A;  1ZU1 A;  5AE3 A;  2E72 A;  3BGH A;  1PJS A;  2N3G A;  4DUY E;  2M7Q A;  3C4T A;  3BBG A;  4WPY A;  4RH8 A;  3VYY A;  4IJD A;  1N32 E;  4ZYG A;  4O5G A;  1HR0 E;  2WCC 3;  4DV1 E;  4JI4 E;  3BF2 A;  2GLI A;  2EP3 A;  2HHH E;  1PKP A;  1Z1B A;  2YTE A;  4OX9 E;  2VRD A;  2EN4 A;  2HJJ A;  2EM8 A;  2DB2 A;  2YTF A;  3ECR A;  2UUA E;  1F2I G;  2F8B A;  4X65 E;  2YTI A;  2EM7 A;  4JI3 E;  2JVA A;  2EPO A;  3F6G A;  2EM4 A;  1IBL E;  2EE8 A;  2B7T A;  1FJG E;  2YRK A;  1X3C A;  4BHB A;  4DV6 E;  3J7Y p;  2L2K B;  4IS1 C;  2IHR 1;  2EOI A;  5F3W A;  2B9D A;  2R1F A;  2WBU A;  1RQ0 A;  4F9C B;  1SR9 A;  2EMX A;  4BMJ A;  2EMF A;  4YHH E;  2LUP B;  2EWL A;  2DRP A;  2E5L E;  1DI2 A;  4WYQ B;  1X6H A;  2LTS A;  2YTQ A;  1N33 E;  2V86 A;  1SFE A;  1WJP A;  2KOU A;  3ZOQ B;  4X62 E;  4JI0 E;  2LCE A;  4LF4 E;  3EQ1 A;  3VK6 A;  3L00 A;  4R2C A;  4R2P A;  3THO B;  3KWR A;  5AAS A;  4X66 E;  4DV5 E;  4DUZ E;  2B7V A;  2JOX A;  1BBG A;  1T4N A;  2PRT A;  2WBT A;  5TSE A;  2MKN A;  3C6M A;  2EPZ A;  2KON A;  2M9A A;  5KL2 A;  2FTX B;  4DR6 E;  4O43 A;  4LTY A;  2VQF E;  1QNT A;  4B3T E;  4R03 A;  2L3J A;  2LT7 A;  5A6J A;  2EOF A;  1A1K A;  5AE1 A;  5KL4 A;  2R76 A;  2YSP A;  3IWD A;  4DV7 E;  3MSW A;  4OOG C;  4FK5 C;  3LML A;  4O4K A;  2UXB E;  2I13 A;  2GPI A;  2ADR A;  2YTG A;  1EH6 A;  2EMC A;  2V87 A;  1GTK A;  2ENC A;  4LFC E;  5IV8 B;  4L8N A;  2N3H A;  2MKD A;  5LMU E;  1T38 A;  2YTP A;  1X5W A;  1XNR E;  2ELY A;  2BBG A;  2EN6 A;  3P1X A;  1X49 A;  1JK2 A;  4F6M A;  2EOX A;  3QG5 C;  2L3C A;  2EM5 A;  2V8Q B;  1X6F A;  2EL4 A;  2VF1 A;  2L33 A;  3THN A;  1A1F A;  3LLH A;  2CPN A;  3DJW A;  1J26 A;  1YZ9 A;  1X48 A;  2EMG A;  4GZN C;  1L4S A;  5A6K A;  2YU8 A;  2MDG A;  2JY9 A;  1NEI A;  1T4L B;  1BBO A;  2EPK X;  2JR1 A;  1EKZ A;  4DR7 E;  4F54 A;  1A1H A;  3JU0 A;  2UXD E;  2N8X A;  3J80 C;  2ENH A;  2LV2 A;  3OML A;  1HNW E;  2UUC E;  3VHT B;  4DV4 E;  4DV3 E;  4JI7 E;  2EL5 A;  2RPC A;  2EOR A;  5LL6 R;  1YYK A;  1HNX E;  3EPJ A;  2FGG A;  5CFF E;  2Q8U A;  2L8T A;  2EOH A;  1GZ6 A;  4R2A A;  2EOO A;  2JP9 A;  3RMP A;  4JV5 E;  1YYO A;  1T4O A;  4JI2 E;  1G2D C;  2CT1 A;  1A1L A;  5FLX C;  1YUI A;  1BB8 A;  1NCS A;  2LJU A;  2EPN A;  2ELZ A;  2EQ3 A;  3EPL A;  2EM2 A;  1PDA A;  2EMI A;  3H09 A;  1T39 A;  2RQL A;  1WHQ A;  2VE7 C;  2ODR D;  2LVH A;  2B3T B;  1IBK E;  3UK3 C;  4KZS A;  1N34 E;  4TUG A;  2L2N A;  1YYW A;  2YRH A;  1EH7 A;  4R2D A;  2H36 X;  5A2Q C;  5KL7 A;  4O24 A;  2EOY A;  4LU9 A;  3M99 B;  2EJ4 A;  2JYA A;  5IT9 C;  1RMD A;  2WBS A;  1QU6 A;  4BC9 A;  4M30 A;  2MC5 A;  2EOZ A;  1YPN A;  5A6B A;  5T6J A;  5A69 A;  2WZO A;  5KL6 A;  4AQY E;  4WSP A;  1LLM C;  3KZZ A;  1P47 A;  1STU A;  2EOE A;  2EOS A;  5IWA E;  4P7D A;  3ADI A;  2V83 A;  1TF6 A;  2LBS B;  1YFH A;  2UUB E;  2M4I A;  3HPS A;  2JWO A;  2K7I A;  3K6Q A;  2L6M A;  2EMA A;  4KHP E;  1DQ3 A;  3MHS C;  2EOM A;  1IQS A;  2EPP A;  2DLK A;  2EQ0 A;  1I94 E;  3KZY A;  2EMH A;  4DR5 E;  2LUQ A;  4X8W A;  4LF8 E;  1ZAA C;  4GKJ E;  1WHN A;  4DR4 E;  5BR8 E;  2K4V A;  2YU5 A;  2NUG A;  1IMU A;  3JAM C;  4R2S A;  2V89 A;  1A1J A;  2CSH A;  3OTO E;  1N36 E;  2MDR A;  2LTR A;  4MLQ A;  4DR1 E;  1FKA E;  3ADJ A;  2EOQ A;  2D9H A;  4F6N A;  3C6K A;  3T1H E;  2EPU A;  2CTD A;  2YTJ A;  2LMZ A;  1RC7 A;  3IWC A;  4M0V A;  4RHB B;  4YY3 E;  1TF3 A;  1G2F C;  4MLV A;  1A1G A;  4J8Z A;  2EMZ A;  2YZT A;  1UIL A;  4K0K E;  2EOJ A;  1KJK A;  1X6E A;  1J5E E;  4LF5 E;  2EPC A;  1TN9 A;  2JOB A;  1IQO A;  3AUZ A;  2EN7 A;  2MC6 A;  4LFB E;  1YSA C;  2LRS A;  2ZM6 E;  3HTX A;  2EM3 A;  2L2M A;  2GHF A;  1ZBQ A;  3T1Y E;  2UXC E;  4X9J A;  1UBD C;  2EN2 A;  5A6B D;  1EH8 A;  4LF6 E;  1ZR9 A;  4R2E A;  2EMB A;  2BB8 A;  2EPX A;  2YRM A;  1PJT A;  4JI1 E;  4I8O A;  5KL5 A;  4JI8 E;  4L5N C;  3EPH A;  4NZV A;  2YTN A;  4M2Z A;  2EMW A;  4B3S E;  2JPA A;  2EZ6 A;  4R2R A;  2J7J A;  1HNZ E;  1X47 A;  2EMK A;  2EN8 A;  2VQE E;  2HGH A;  1IBM E;  3ADL A;  1UHZ A;  4DR2 E;  2LJH A;  2NAB A;  2EMY A;  2LO3 A;  2DLQ A;  1JK1 A;  2EML A;  3TQM A;  1AH5 A;  2YTD A;  3J81 C;  4GEQ B;  2YTO A;  4TUI A;  3IWB A;  1GQE A;  2HC5 A;  2YWQ A;  2NA2 A;  4HEI A;  2RS7 A;  3J7A G;  5AE2 A;  2EM0 A;  3F6H A;  1XMQ E;  1UN6 B;  1MGT A;  4DV2 E;  4WFT A; 
#chains in the Genus database with same CATH homology
 2LV2 A;  2YTE A;  2EPA A;  2YSO A;  3VHT B;  2VRD A;  2EN4 A;  2EL5 A;  2RPC A;  2EM8 A;  2EOR A;  2YTF A;  2YU5 A;  1F2I G;  3EPJ A;  4R2S A;  2YTI A;  2EM7 A;  1A1J A;  2CSH A;  2EOH A;  5KL3 A;  2EM4 A;  4R2A A;  2EE8 A;  2EOO A;  2JP9 A;  2EN1 A;  2EOQ A;  2YRK A;  1X3C A;  2D9H A;  4F6N A;  2EPU A;  2CTD A;  2YTJ A;  1DGC A;  1YUJ A;  2EM9 A;  1G2D C;  2CT1 A;  1A1L A;  2EL6 A;  1A1I A;  1YUI A;  4IS1 C;  1BB8 A;  1NCS A;  2EOI A;  2DMI A;  2DGC A;  2ELZ A;  2R1F A;  1TF3 A;  2EQ3 A;  2WBU A;  1G2F C;  1A1G A;  3EPL A;  2EM2 A;  2EMZ A;  2EMX A;  2EMF A;  2EMI A;  4R2Q A;  2ENA A;  2EOJ A;  2DRP A;  1X6E A;  1KJK A;  2EPC A;  1X6H A;  1TN9 A;  2YTQ A;  2A25 A;  2LVH A;  1WJP A;  2EN7 A;  2LCE A;  1Z1B A;  3UK3 C;  1YSA C;  1MEY C;  2EPR A;  2EM3 A;  2YRH A;  4R2C A;  4R2D A;  4R2P A;  2GHF A;  5KL7 A;  4X9J A;  2EOY A;  1UBD C;  2PRT A;  2EN2 A;  2RSI A;  3M99 B;  2WBT A;  4WSG A;  2MKN A;  2EJ4 A;  2EPZ A;  1ZR9 A;  2M9A A;  4R2E A;  5KL2 A;  1RMD A;  2EMB A;  2WBS A;  2BB8 A;  2EPX A;  2YRM A;  2EOZ A;  4M9V C;  2EQ1 A;  2LT7 A;  5KL6 A;  2EOF A;  5KL5 A;  1A1K A;  5KL4 A;  1LLM C;  3EPH A;  2YSP A;  1AAY A;  4FK5 C;  2YTN A;  1P47 A;  2I13 A;  2EMW A;  2ADR A;  2YTG A;  3MHH C;  2EMC A;  2EOE A;  2JPA A;  2ENC A;  2EOS A;  4R2R A;  2J7J A;  2EMK A;  2EN8 A;  2MKD A;  2HGH A;  2YTP A;  3EPK A;  2EN3 A;  1X5W A;  2ELY A;  1B69 A;  2EN6 A;  2EM6 A;  1TF6 A;  1JK2 A;  4F6M A;  2EOX A;  2EM5 A;  2NAB A;  2EMY A;  2LO3 A;  1X6F A;  2EL4 A;  2DLQ A;  1JK1 A;  4F2J C;  2EML A;  1A1F A;  2YTD A;  1ZU1 A;  2YTO A;  2EMG A;  4GZN C;  2E72 A;  2YU8 A;  2EMA A;  3MHS C;  2EOM A;  2MDG A;  2EPP A;  2DLK A;  4IJD A;  2EQ0 A;  2WCC 3;  2EM0 A;  1BBO A;  2EMH A;  1UN6 B;  2GLI A;  2EP3 A;  1A1H A;  1ZAA C;  2ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...