2YSPA

Solution structure of the c2h2 type zinc finger (region 507-539) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 507-539)of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yspA01
4M9VC 2LT7A 1Z1BA 2WBSA 3EPHA 2EPPA 1YUJA 2LCEA 5KL6A 2EOXA 2EPXA 3VHTB 2DLQA 1X6HA 2EPZA 4IJDA 2MKNA 1BB8A 2EP3A 1X6FA 2ELYA 2EPRA 2EOEA 2EOYA 2DRPA 2EM7A 2EOHA 2EOQA 1BBOA 2J7JA 1YSAC 1ZU1A 4R2CA 3MHSC 3UK3C 2EMGA 2EOMA 2EM2A 3M99B 1UBDC 1RMDA 2A25A 5KL3A 2BB8A 3EPJA 2EM6A 4GZNC 2EN3A 1ZAAC 4F6NA 1A1JA 2GLIA 2LVHA 2YSPA 1ZR9A 2EORA 2RSIA 2EPAA 1A1GA 1G2DC 2E72A 5KL5A 2GHFA 4WSGA 1A1HA 5KL2A 2YRHA 2CTDA 1P47A 2EMFA 3MHHC 2EL4A 1A1KA 2LV2A 2EN1A 2EMYA 2ENCA 2EOIA 2VRDA 2EN6A 2HGHA 2EM3A 2PRTA 1LLMC 2WBUA 1A1LA 2EN7A 2YTJA 2EL6A 2D9HA 1A1FA 5KL4A 2EPCA 2YTNA 1NCSA 1AAYA 4X9JA 2EOJA 2EN8A 2WBTA 2EQ1A 2YU5A 1TN9A 2LO3A 2DGCA 5KL7A 1X6EA 1X5WA 2EL5A 2ELZA 2EOFA 2YTGA 1F2IG 2ENHA 2EM4A 2YTFA 4R2SA 1KJKA 2YTPA 1UN6B 3EPLA 1YUIA 2CT1A 2EMXA 2R1FA 1JK1A 2JP9A 1X3CA 2EQ3A 2DMIA 4FK5C 4R2PA 2YTIA 2YTDA 1TF3A 2EMHA 1B69A 2EJ4A 2EM0A 4F6MA 2EMBA 2EMCA 2EMIA 2EMLA 2WCC3 2YTQA 4R2EA 2YU8A 2EMZA 2EMWA 2YRMA 1G2FC 2NABA 1WJPA 2EQ0A 2EMKA 4R2QA 1JK2A 2EM8A 2EOZA 2RPCA 2EMAA 2EOOA 2YTEA 2YTOA 4R2RA 2YRKA 4R2AA 2M9AA 2ADRA 2JPAA 3EPKA 4IS1C 2CSHA 1MEYC 2EE8A 2MDGA 2EN4A 2YSOA 2EPUA 4R2DA 1A1IA 1TF6A 4F2JC 1DGCA 2EOSA 2EM5A 2MKDA 2DLKA 2ENAA 2EM9A 2EN2A 2I13A
chains in the Genus database with same CATH superfamily
2LT7A 4LTYA 2IHR1 4JI0E 2L3CA 3TQMA 2KOUA 3J80C 1XMOE 2V86A 3KZYA 1X6HA 2EPZA 4O5GA 1PJQA 1X47A 5T6JA 4JI8E 1YSAC 4AQYE 1PDAA 4DKKA 5BR8E 1RMDA 2FGGA 4WFTA 5KL3A 4BCAA 3J7Yp 2WZOA 2LMZA 3J81C 2LRSA 4Q35B 2GPIA 2NA2A 4GKJE 2RSIA 3HXLA 2FV4B 2N3GA 2E72A 3C6MA 5KL5A 1A1HA 2B9DA 2CTDA 2I9IA 4DR6E 1HNXE 1PJSA 2NUEA 2EMFA 4X62E 1QNTA 2EMYA 1GTKA 2EN1A 2EOIA 4DUZE 1HNZE 2L8TA 1T4NA 1LLMC 2B3TB 4WYQB 2JYAA 2D9HA 1IBLE 2EPCA 2HHHE 2JOBA 2YTNA 1AAYA 2FTXB 2EOJA 1EH7A 2YU5A 2DGCA 1X6EA 2E5LE 2EM4A 1RQ0A 2YTPA 5IWAE 1EH6A 2CT1A 1ZBQA 2VQFE 3IWDA 2EQ3A 4FK5C 2EZ6A 2YTIA 3L00A 4B3SE 3THOB 4F6MA 2LJHA 2EMIA 5A2QC 2L2KB 2WCC3 4JI6E 2YTQA 1T38A 5A6BD 2DSYA 2EOZA 4B3ME 2K7IA 4R2RA 2CPNA 4R2AA 4X8WA 2UUBE 2JPAA 4LF6E 2RS7A 1MEYC 2YWQA 2MDGA 1A1IA 4HEIA 4JI4E 3HPZA 4DV4E 4JI5E 1YYOA 2ENAA 4M9VC 3EPHA 4KHPE 1WHQA 2EPPA 4DR1E 1RC7A 4M2ZA 2L2NA 2DLQA 2E1MA 1YPNA 1YYKA 3BBGA 2EWLA 1J5EE 2EOYA 2DRPA 4Q28A 2EM7A 1STUA 2EOQA 3F6GA 1ZU1A 2YT4A 3MHSC 3ADJA 2EM2A 5LMNE 1UBDC 5IV8B 2VE7C 4GEQB 3DF6A 2EM6A 4DV5E 2H36X 2V85A 2EN3A 1ZAAC 1XNQE 3HPSA 2GLIA 4OX9E 2LVHA 4KWYA 4LF4E 1HR0E 1ZR9A 2EORA 4YHHE 4DMIA 1A1GA 2M1SA 3H09A 2MC5A 2GHFA 1N34E 4F9AB 4JI2E 1UHZA 1QU6A 3JU0A 1YYWA 2V88A 2UU9E 4X64E 5LLQA 2VRDA 2EN6A 4LF5E 2G7HA 2PRTA 2WBUA 4DV7E 4BS9A 1T39A 2KHXA 1IBKE 5KL4A 1FJGE 1NCSA 5TSEA 2UXBE 2V83A 5FLXC 1XMQE 5AE3A 2JWOA 4K0KE 2YTGA 2L3JA 1F2IG 1N36E 4M30A 3RMPA 2LBSB 5F3WA 1KJKA 1UN6B 3KWRA 1XNRE 2M7QA 2F4VE 3EQ1A 5A6KA 2EMXA 3HQ1A 4ZYDA 1YFHA 1JK1A 1TF3A 2EJ4A 2EMCA 4BC7A 2EMLA 4R8OA 2JOXA 2B7VA 2YU8A 2YRMA 2LUPB 1N33E 1GQEA 5CFFE 1JK2A 2EM8A 2V87A 4BBYA 3OMLA 3VYYA 1J26A 2M9AA 4DV2E 3ADIA 1AH5A 4KZSA 4DV6E 2EPMX 2YSOA 2EPUA 2DB2A 1DI2A 3LMLA 1N32E 2VQEE 2N3HA 1PJTA 5ADZA 2EOSA 4LU9A 2EM5A 4GKKE 4DR5E 2EN2A 2ODRD 2YTOA 4F54A 1WRJA 1N3GA 3F6HA 2WBSA 2HJJA 1KYQA 2V89A 3JAMC 4WPYA 2EOXA 2M4IA 2RS6A 3VHTB 4P78A 1IQOA 2LTSA 2L92A 3T1YE 4IJDA 2MKNA 1BB8A 2EP3A 1X6FA 2ELYA 2EOEA 3OTOE 2MDRA 3THNA 1BBOA 2J7JA 2LJUA 4R2CA 3AUZA 2EMGA 3M99B 3KZZA 3IWBA 3T1HE 2BB8A 3EPJA 3HTXA 3C4BA 4LF8E 2EPKX 4F6NA 2ZM6E 4LF7E 3ADLA 4JI7E 3VK6A 2KONA 2EPAA 4J8ZA 3ECRA 1G2DC 4I8OA 2UUCE 1NEIA 1P47A 3AV0A 4RHBB 1WXRA 3MHHC 1A1KA 2LV2A 2HGHA 4LFAE 4MLVA 4R03A 1A1FA 1I94E 2NUGA 4JI3E 4X9JA 4X65E 2LTRA 2EN8A 2YZTA 1T4LB 1TN9A 2LO3A 3BF2A 5KL7A 1X5WA 4RH8A 2EL5A 2ELZA 2EOFA 4LF9E 4YY3E 4WXCA 3C4TA 1SR9A 2DIXA 4ZYGA 4JI1E 4M0VA 5AC5A 2L33A 1T4OA 2R1FA 2RQLA 2HC5A 1EKZA 2DMIA 4R2PA 2EPNA 2V8QB 4NHRA 4O24A 4WXDA 4L5NC 4BC9A 1HNWE 2JR1A 4R2EA 2VF1A 2EMWA 1G2FC 2NABA 1WJPA 2EQ0A 4NXME 5A6BA 4R2QA 2RPCA 5A6AA 2EOOA 2YRKA 4N4RB 2K4VA 3EPKA 4DV3E 4MLQA 2CSHA 2EE8A 4HTGA 2UUAE 4DR4E 1TF6A 5AC4A 1O0WA 3DJWA 4F9BB 4O43A 2JVAA 1A1JA 2EM9A 4DR7E 1FKAE 1Z1BA 4B3RE 1YUJA 1BBGA 2LCEA 5KL6A 1IMUA 2EPXA 2R76A 1WHNA 4OOGC 2EPLX 2EPRA 2EOHA 4WX9A 4JYAE 5AE2A 3UK3C 2EOMA 2A25A 2UXCE 4GZNC 4DR3E 1DQ3A 4JV5E 3BIDA 3C6KA 4DV0E 4BHBA 2YSPA 4B3TE 5IT9C 3LLHA 4NZVA 2EPOA 2L2MA 2BBGA 3JTZA 3FIGA 5AE1A 4WSGA 5KL2A 2YRHA 1IQSA 5AASA 4BHCA 2EL4A 4DUYE 2YPNA 2JY9A 2ENCA 1IBME 2F8BA 1YZ9A 4WSPA 2DMYA 2EM3A 1A1LA 2EN7A 2YTJA 2EL6A 3MSWA 2LUQA 1ZBTA 2WBTA 4TUGA 3VYXA 2EQ1A 2N8XA 4TUIA 1EH8A 4BMJA 2L6MA 4LFCE 2ENHA 5A69A 4DR2E 2YTFA 3K6QA 2NUFA 1UILA 4R2SA 3EPLA 4L8NA 1YUIA 1X49A 4ZYEA 3ADGA 2JP9A 1X3CA 2ODRC 4F9CB 5DNYA 1PKPA 2YTDA 2EMHA 1B69A 2EM0A 4NXNE 2EMBA 5A6JA 1MGTA 4LFBE 3IWCA 2MC6A 4O4KA 1X48A 2EMZA 3J7AG 4X66E 1L4SA 2EMKA 2UXDE 3P1XA 2Q8UA 2EMAA 1SFEA 5LMUE 2YTEA 5IXMB 4DV1E 2ADRA 4ZYHA 4P7DA 4IS1C 3QG5C 2LE2A 2RSMA 3BGHA 2EN4A 4R2DA 1GZ6A 3ZOQB 2B7TA 4F2JC 1DGCA 2JXPA 2MKDA 2RTXA 2DLKA 2I13A 5LL6R
chains in the Genus database with same CATH topology
4M9VC 2LT7A 1Z1BA 2WBSA 3EPHA 2EPPA 1YUJA 2LCEA 5KL6A 2EOXA 2EPXA 3VHTB 2DLQA 1X6HA 2EPZA 4IJDA 2MKNA 1BB8A 2EP3A 1X6FA 2ELYA 2EPRA 2EOEA 2EOYA 2DRPA 2EM7A 2EOHA 2EOQA 1BBOA 2J7JA 1YSAC 1ZU1A 4R2CA 3MHSC 3UK3C 2EMGA 2EOMA 2EM2A 3M99B 1UBDC 1RMDA 2A25A 5KL3A 2BB8A 3EPJA 2EM6A 4GZNC 2EN3A 1ZAAC 4F6NA 1A1JA 2GLIA 2LVHA 2YSPA 1ZR9A 2EORA 2RSIA 2EPAA 1A1GA 1G2DC 2E72A 5KL5A 2GHFA 4WSGA 1A1HA 5KL2A 2YRHA 2CTDA 1P47A 2EMFA 3MHHC 2EL4A 1A1KA 2LV2A 2EN1A 2EMYA 2ENCA 2EOIA 2VRDA 2EN6A 2HGHA 2EM3A 2PRTA 1LLMC 2WBUA 1A1LA 2EN7A 2YTJA 2EL6A 2D9HA 1A1FA 5KL4A 2EPCA 2YTNA 1NCSA 1AAYA 4X9JA 2EOJA 2EN8A 2WBTA 2EQ1A 2YU5A 1TN9A 2LO3A 2DGCA 5KL7A 1X6EA 1X5WA 2EL5A 2ELZA 2EOFA 2YTGA 1F2IG 2ENHA 2EM4A 2YTFA 4R2SA 1KJKA 2YTPA 1UN6B 3EPLA 1YUIA 2CT1A 2EMXA 2R1FA 1JK1A 2JP9A 1X3CA 2EQ3A 2DMIA 4FK5C 4R2PA 2YTIA 2YTDA 1TF3A 2EMHA 1B69A 2EJ4A 2EM0A 4F6MA 2EMBA 2EMCA 2EMIA 2EMLA 2WCC3 2YTQA 4R2EA 2YU8A 2EMZA 2EMWA 2YRMA 1G2FC 2NABA 1WJPA 2EQ0A 2EMKA 4R2QA 1JK2A 2EM8A 2EOZA 2RPCA 2EMAA 2EOOA 2YTEA 2YTOA 4R2RA 2YRKA 4R2AA 2M9AA 2ADRA 2JPAA 3EPKA 4IS1C 2CSHA 1MEYC 2EE8A 2MDGA 2EN4A 2YSOA 2EPUA 4R2DA 1A1IA 1TF6A 4F2JC 1DGCA 2EOSA 2EM5A 2MKDA 2DLKA 2ENAA 2EM9A 2EN2A 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9V C;  2LT7 A;  1Z1B A;  2WBS A;  3EPH A;  2EPP A;  1YUJ A;  2LCE A;  5KL6 A;  2EOX A;  2EPX A;  3VHT B;  2DLQ A;  1X6H A;  2EPZ A;  4IJD A;  2MKN A;  1BB8 A;  2EP3 A;  1X6F A;  2ELY A;  2EPR A;  2EOE A;  2EOY A;  2DRP A;  2EM7 A;  2EOH A;  2EOQ A;  1BBO A;  2J7J A;  1YSA C;  1ZU1 A;  4R2C A;  3MHS C;  3UK3 C;  2EMG A;  2EOM A;  2EM2 A;  3M99 B;  1UBD C;  1RMD A;  2A25 A;  5KL3 A;  2BB8 A;  3EPJ A;  2EM6 A;  4GZN C;  2EN3 A;  1ZAA C;  4F6N A;  1A1J A;  2GLI A;  2LVH A;  2YSP A;  1ZR9 A;  2EOR A;  2RSI A;  2EPA A;  1A1G A;  1G2D C;  2E72 A;  5KL5 A;  2GHF A;  4WSG A;  1A1H A;  5KL2 A;  2YRH A;  2CTD A;  1P47 A;  2EMF A;  3MHH C;  2EL4 A;  1A1K A;  2LV2 A;  2EN1 A;  2EMY A;  2ENC A;  2EOI A;  2VRD A;  2EN6 A;  2HGH A;  2EM3 A;  2PRT A;  1LLM C;  2WBU A;  1A1L A;  2EN7 A;  2YTJ A;  2EL6 A;  2D9H A;  1A1F A;  5KL4 A;  2EPC A;  2YTN A;  1NCS A;  1AAY A;  4X9J A;  2EOJ A;  2EN8 A;  2WBT A;  2EQ1 A;  2YU5 A;  1TN9 A;  2LO3 A;  2DGC A;  5KL7 A;  1X6E A;  1X5W A;  2EL5 A;  2ELZ A;  2EOF A;  2YTG A;  1F2I G;  2ENH A;  2EM4 A;  2YTF A;  4R2S A;  1KJK A;  2YTP A;  1UN6 B;  3EPL A;  1YUI A;  2CT1 A;  2EMX A;  2R1F A;  1JK1 A;  2JP9 A;  1X3C A;  2EQ3 A;  2DMI A;  4FK5 C;  4R2P A;  2YTI A;  2YTD A;  1TF3 A;  2EMH A;  1B69 A;  2EJ4 A;  2EM0 A;  4F6M A;  2EMB A;  2EMC A;  2EMI A;  2EML A;  2WCC 3;  2YTQ A;  4R2E A;  2YU8 A;  2EMZ A;  2EMW A;  2YRM A;  1G2F C;  2NAB A;  1WJP A;  2EQ0 A;  2EMK A;  4R2Q A;  1JK2 A;  2EM8 A;  2EOZ A;  2RPC A;  2EMA A;  2EOO A;  2YTE A;  2YTO A;  4R2R A;  2YRK A;  4R2A A;  2M9A A;  2ADR A;  2JPA A;  3EPK A;  4IS1 C;  2CSH A;  1MEY C;  2EE8 A;  2MDG A;  2EN4 A;  2YSO A;  2EPU A;  4R2D A;  1A1I A;  1TF6 A;  4F2J C;  1DGC A;  2EOS A;  2EM5 A;  2MKD A;  2DLK A;  2ENA A;  2EM9 A;  2EN2 A;  2I13 A; 
#chains in the Genus database with same CATH topology
 2LT7 A;  4LTY A;  2IHR 1;  4JI0 E;  2L3C A;  3TQM A;  2KOU A;  3J80 C;  1XMO E;  2V86 A;  3KZY A;  1X6H A;  2EPZ A;  4O5G A;  1PJQ A;  1X47 A;  5T6J A;  4JI8 E;  1YSA C;  4AQY E;  1PDA A;  4DKK A;  5BR8 E;  1RMD A;  2FGG A;  4WFT A;  5KL3 A;  4BCA A;  3J7Y p;  2WZO A;  2LMZ A;  3J81 C;  2LRS A;  4Q35 B;  2GPI A;  2NA2 A;  4GKJ E;  2RSI A;  3HXL A;  2FV4 B;  2N3G A;  2E72 A;  3C6M A;  5KL5 A;  1A1H A;  2B9D A;  2CTD A;  2I9I A;  4DR6 E;  1HNX E;  1PJS A;  2NUE A;  2EMF A;  4X62 E;  1QNT A;  2EMY A;  1GTK A;  2EN1 A;  2EOI A;  4DUZ E;  1HNZ E;  2L8T A;  1T4N A;  1LLM C;  2B3T B;  4WYQ B;  2JYA A;  2D9H A;  1IBL E;  2EPC A;  2HHH E;  2JOB A;  2YTN A;  1AAY A;  2FTX B;  2EOJ A;  1EH7 A;  2YU5 A;  2DGC A;  1X6E A;  2E5L E;  2EM4 A;  1RQ0 A;  2YTP A;  5IWA E;  1EH6 A;  2CT1 A;  1ZBQ A;  2VQF E;  3IWD A;  2EQ3 A;  4FK5 C;  2EZ6 A;  2YTI A;  3L00 A;  4B3S E;  3THO B;  4F6M A;  2LJH A;  2EMI A;  5A2Q C;  2L2K B;  2WCC 3;  4JI6 E;  2YTQ A;  1T38 A;  5A6B D;  2DSY A;  2EOZ A;  4B3M E;  2K7I A;  4R2R A;  2CPN A;  4R2A A;  4X8W A;  2UUB E;  2JPA A;  4LF6 E;  2RS7 A;  1MEY C;  2YWQ A;  2MDG A;  1A1I A;  4HEI A;  4JI4 E;  3HPZ A;  4DV4 E;  4JI5 E;  1YYO A;  2ENA A;  4M9V C;  3EPH A;  4KHP E;  1WHQ A;  2EPP A;  4DR1 E;  1RC7 A;  4M2Z A;  2L2N A;  2DLQ A;  2E1M A;  1YPN A;  1YYK A;  3BBG A;  2EWL A;  1J5E E;  2EOY A;  2DRP A;  4Q28 A;  2EM7 A;  1STU A;  2EOQ A;  3F6G A;  1ZU1 A;  2YT4 A;  3MHS C;  3ADJ A;  2EM2 A;  5LMN E;  1UBD C;  5IV8 B;  2VE7 C;  4GEQ B;  3DF6 A;  2EM6 A;  4DV5 E;  2H36 X;  2V85 A;  2EN3 A;  1ZAA C;  1XNQ E;  3HPS A;  2GLI A;  4OX9 E;  2LVH A;  4KWY A;  4LF4 E;  1HR0 E;  1ZR9 A;  2EOR A;  4YHH E;  4DMI A;  1A1G A;  2M1S A;  3H09 A;  2MC5 A;  2GHF A;  1N34 E;  4F9A B;  4JI2 E;  1UHZ A;  1QU6 A;  3JU0 A;  1YYW A;  2V88 A;  2UU9 E;  4X64 E;  5LLQ A;  2VRD A;  2EN6 A;  4LF5 E;  2G7H A;  2PRT A;  2WBU A;  4DV7 E;  4BS9 A;  1T39 A;  2KHX A;  1IBK E;  5KL4 A;  1FJG E;  1NCS A;  5TSE A;  2UXB E;  2V83 A;  5FLX C;  1XMQ E;  5AE3 A;  2JWO A;  4K0K E;  2YTG A;  2L3J A;  1F2I G;  1N36 E;  4M30 A;  3RMP A;  2LBS B;  5F3W A;  1KJK A;  1UN6 B;  3KWR A;  1XNR E;  2M7Q A;  2F4V E;  3EQ1 A;  5A6K A;  2EMX A;  3HQ1 A;  4ZYD A;  1YFH A;  1JK1 A;  1TF3 A;  2EJ4 A;  2EMC A;  4BC7 A;  2EML A;  4R8O A;  2JOX A;  2B7V A;  2YU8 A;  2YRM A;  2LUP B;  1N33 E;  1GQE A;  5CFF E;  1JK2 A;  2EM8 A;  2V87 A;  4BBY A;  3OML A;  3VYY A;  1J26 A;  2M9A A;  4DV2 E;  3ADI A;  1AH5 A;  4KZS A;  4DV6 E;  2EPM X;  2YSO A;  2EPU A;  2DB2 A;  1DI2 A;  3LML A;  1N32 E;  2VQE E;  2N3H A;  1PJT A;  5ADZ A;  2EOS A;  4LU9 A;  2EM5 A;  4GKK E;  4DR5 E;  2EN2 A;  2ODR D;  2YTO A;  4F54 A;  1WRJ A;  1N3G A;  3F6H A;  2WBS A;  2HJJ A;  1KYQ A;  2V89 A;  3JAM C;  4WPY A;  2EOX A;  2M4I A;  2RS6 A;  3VHT B;  4P78 A;  1IQO A;  2LTS A;  2L92 A;  3T1Y E;  4IJD A;  2MKN A;  1BB8 A;  2EP3 A;  1X6F A;  2ELY A;  2EOE A;  3OTO E;  2MDR A;  3THN A;  1BBO A;  2J7J A;  2LJU A;  4R2C A;  3AUZ A;  2EMG A;  3M99 B;  3KZZ A;  3IWB A;  3T1H E;  2BB8 A;  3EPJ A;  3HTX A;  3C4B A;  4LF8 E;  2EPK X;  4F6N A;  2ZM6 E;  4LF7 E;  3ADL A;  4JI7 E;  3VK6 A;  2KON A;  2EPA A;  4J8Z A;  3ECR A;  1G2D C;  4I8O A;  2UUC E;  1NEI A;  1P47 A;  3AV0 A;  4RHB B;  1WXR A;  3MHH C;  1A1K A;  2LV2 A;  2HGH A;  4LFA E;  4MLV A;  4R03 A;  1A1F A;  1I94 E;  2NUG A;  4JI3 E;  4X9J A;  4X65 E;  2LTR A;  2EN8 A;  2YZT A;  1T4L B;  1TN9 A;  2LO3 A;  3BF2 A;  5KL7 A;  1X5W A;  4RH8 A;  2EL5 A;  2ELZ A;  2EOF A;  4LF9 E;  4YY3 E;  4WXC A;  3C4T A;  1SR9 A;  2DIX A;  4ZYG A;  4JI1 E;  4M0V A;  5AC5 A;  2L33 A;  1T4O A;  2R1F A;  2RQL A;  2HC5 A;  1EKZ A;  2DMI A;  4R2P A;  2EPN A;  2V8Q B;  4NHR A;  4O24 A;  4WXD A;  4L5N C;  4BC9 A;  1HNW E;  2JR1 A;  4R2E A;  2VF1 A;  2EMW A;  1G2F C;  2NAB A;  1WJP A;  2EQ0 A;  4NXM E;  5A6B A;  4R2Q A;  2RPC A;  5A6A A;  2EOO A;  2YRK A;  4N4R B;  2K4V A;  3EPK A;  4DV3 E;  4MLQ A;  2CSH A;  2EE8 A;  4HTG A;  2UUA E;  4DR4 E;  1TF6 A;  5AC4 A;  1O0W A;  3DJW A;  4F9B B;  4O43 A;  2JVA A;  1A1J A;  2EM9 A;  4DR7 E;  1FKA E;  1Z1B A;  4B3R E;  1YUJ A;  1BBG A;  2LCE A;  5KL6 A;  1IMU A;  2EPX A;  2R76 A;  1WHN A;  4OOG C;  2EPL X;  2EPR A;  2EOH A;  4WX9 A;  4JYA E;  5AE2 A;  3UK3 C;  2EOM A;  2A25 A;  2UXC E;  4GZN C;  4DR3 E;  1DQ3 A;  4JV5 E;  3BID A;  3C6K A;  4DV0 E;  4BHB A;  2YSP A;  4B3T E;  5IT9 C;  3LLH A;  4NZV A;  2EPO A;  2L2M A;  2BBG A;  3JTZ A;  3FIG A;  5AE1 A;  4WSG A;  5KL2 A;  2YRH A;  1IQS A;  5AAS A;  4BHC A;  2EL4 A;  4DUY E;  2YPN A;  2JY9 A;  2ENC A;  1IBM E;  2F8B A;  1YZ9 A;  4WSP A;  2DMY A;  2EM3 A;  1A1L A;  2EN7 A;  2YTJ A;  2EL6 A;  3MSW A;  2LUQ A;  1ZBT A;  2WBT A;  4TUG A;  3VYX A;  2EQ1 A;  2N8X A;  4TUI A;  1EH8 A;  4BMJ A;  2L6M A;  4LFC E;  2ENH A;  5A69 A;  4DR2 E;  2YTF A;  3K6Q A;  2NUF A;  1UIL A;  4R2S A;  3EPL A;  4L8N A;  1YUI A;  1X49 A;  4ZYE A;  3ADG A;  2JP9 A;  1X3C A;  2ODR C;  4F9C B;  5DNY A;  1PKP A;  2YTD A;  2EMH A;  1B69 A;  2EM0 A;  4NXN E;  2EMB A;  5A6J A;  1MGT A;  4LFB E;  3IWC A;  2MC6 A;  4O4K A;  1X48 A;  2EMZ A;  3J7A G;  4X66 E;  1L4S A;  2EMK A;  2UXD E;  3P1X A;  2Q8U A;  2EMA A;  1SFE A;  5LMU E;  2YTE A;  5IXM B;  4DV1 E;  2ADR A;  4ZYH A;  4P7D A;  4IS1 C;  3QG5 C;  2LE2 A;  2RSM A;  3BGH A;  2EN4 A;  4R2D A;  1GZ6 A;  3ZOQ B;  2B7T A;  4F2J C;  1DGC A;  2JXP A;  2MKD A;  2RTX A;  2DLK A;  2I13 A;  5LL6 R; 
#chains in the Genus database with same CATH homology
 4M9V C;  2LT7 A;  1Z1B A;  2WBS A;  3EPH A;  2EPP A;  1YUJ A;  2LCE A;  5KL6 A;  2EOX A;  2EPX A;  3VHT B;  2DLQ A;  1X6H A;  2EPZ A;  4IJD A;  2MKN A;  1BB8 A;  2EP3 A;  1X6F A;  2ELY A;  2EPR A;  2EOE A;  2EOY A;  2DRP A;  2EM7 A;  2EOH A;  2EOQ A;  1BBO A;  2J7J A;  1YSA C;  1ZU1 A;  4R2C A;  3MHS C;  3UK3 C;  2EMG A;  2EOM A;  2EM2 A;  3M99 B;  1UBD C;  1RMD A;  2A25 A;  5KL3 A;  2BB8 A;  3EPJ A;  2EM6 A;  4GZN C;  2EN3 A;  1ZAA C;  4F6N A;  1A1J A;  2GLI A;  2LVH A;  2YSP A;  1ZR9 A;  2EOR A;  2RSI A;  2EPA A;  1A1G A;  1G2D C;  2E72 A;  5KL5 A;  2GHF A;  4WSG A;  1A1H A;  5KL2 A;  2YRH A;  2CTD A;  1P47 A;  2EMF A;  3MHH C;  2EL4 A;  1A1K A;  2LV2 A;  2EN1 A;  2EMY A;  2ENC A;  2EOI A;  2VRD A;  2EN6 A;  2HGH A;  2EM3 A;  2PRT A;  1LLM C;  2WBU A;  1A1L A;  2EN7 A;  2YTJ A;  2EL6 A;  2D9H A;  1A1F A;  5KL4 A;  2EPC A;  2YTN A;  1NCS A;  1AAY A;  4X9J A;  2EOJ A;  2EN8 A;  2WBT A;  2EQ1 A;  2YU5 A;  1TN9 A;  2LO3 A;  2DGC A;  5KL7 A;  1X6E A;  1X5W A;  2EL5 A;  2ELZ A;  2EOF A;  2YTG A;  1F2I G;  2ENH A;  2EM4 A;  2YTF A;  4R2S A;  1KJK A;  2YTP A;  1UN6 B;  3EPL A;  1YUI A;  2CT1 A;  2EMX A;  2R1F A;  1JK1 A;  2JP9 A;  1X3C A;  2EQ3 A;  2DMI A;  4FK5 C;  4R2P A;  2YTI A;  2YTD A;  1TF3 A;  2EMH A;  1B69 A;  2EJ4 A;  2EM0 A;  4F6M A;  2EMB A;  2EMC A;  2EMI A;  2EML A;  2WCC 3;  2YTQ A;  4R2E A;  2YU8 A;  2EMZ A;  2EMW A;  2YRM A;  1G2F C;  2NAB A;  1WJP A;  2EQ0 A;  2EMK A;  4R2Q A;  1JK2 A;  2EM8 A;  2EOZ A;  2RPC A;  2EMA A;  2EOO A;  2YTE A;  2YTO A;  4R2R A;  2YRK A;  4R2A A;  2M9A A;  2ADR A;  2JPA A;  3EPK A;  4IS1 C;  2CSH A;  1MEY C;  2EE8 A;  2MDG A;  2EN4 A;  2YSO A;  2EPU A;  4R2D A;  1A1I A;  1TF6 A;  4F2J C;  1DGC A;  2EOS A;  2EM5 A;  2MKD A;  2DLK A;  2ENA A;  2EM9 A;  2EN2 A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...