2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
2HGHA 2ELZA 2EORA 2YU5A 1A1FA 2LVHA 2EOQA 4R2AA 3EPKA 2D9HA 2EM5A 1YUIA 2WCC3 2CSHA 2EOZA 2VRDA 2EN1A 1WJPA 2EM4A 2YRMA 2YTFA 1B69A 2DLQA 2YTQA 2EQ3A 2M9AA 2EOEA 2JP9A 2LV2A 2EMBA 4M9VC 1BBOA 4X9JA 4R2EA 2ELYA 2LCEA 1ZAAC 2EMXA 1TN9A 2EL6A 2EMZA 2RSIA 2PRTA 2CT1A 5KL5A 2EOIA 2EOXA 2EOYA 5KL3A 2ENHA 1P47A 2EMIA 1F2IG 2R1FA 2YTEA 1X3CA 1A1HA 5KL7A 1G2FC 1AAYA 1X5WA 4F6MA 2A25A 2ENAA 2EP3A 3EPJA 3EPHA 1RMDA 2EN6A 2EOMA 1YSAC 4R2CA 1A1IA 1X6EA 2DMIA 2MDGA 2YSOA 1MEYC 4R2QA 2LT7A 4GZNC 2NABA 1A1JA 2EPAA 1A1LA 2YTNA 3UK3C 2E72A 2EMHA 2EQ0A 2RPCA 2MKNA 1X6FA 3VHTB 2JPAA 1ZR9A 2GLIA 2EOFA 2BB8A 1UN6B 2EMWA 2EPPA 3EPLA 2CTDA 2YRKA 2YU8A 2I13A 2MKDA 1JK1A 2DGCA 5KL6A 3M99B 1DGCA 1TF6A 2EPUA 2EMFA 2LO3A 1TF3A 2EPRA 2J7JA 2EM3A 5KL4A 1KJKA 2EPZA 2EM8A 1ZU1A 2ADRA 2ENCA 2EL4A 2YTIA 5KL2A 3MHSC 2EMCA 1NCSA 4IJDA 2EOSA 2WBTA 1YUJA 4IS1C 2EM7A 1Z1BA 4F6NA 2EN4A 4R2PA 2EN8A 2YSPA 4FK5C 2EMAA 4R2RA 1BB8A 2EM9A 1G2DC 2DRPA 2EOJA 2EN7A 2YTOA 4WSGA 2WBSA 2YTDA 2YTJA 2EMLA 2EOOA 2YTGA 2EPCA 2EM2A 2EOHA 2EN3A 2DLKA 1LLMC 2EMKA 2EQ1A 2EMYA 4R2DA 2EM0A 4F2JC 2EJ4A 1UBDC 2EMGA 1JK2A 3MHHC 2GHFA 1X6HA 2YTPA 1A1GA 2YRHA 2EPXA 4R2SA 2EM6A 2EL5A 1A1KA 2EN2A 2WBUA 2EE8A
chains in the Genus database with same CATH superfamily
2ELZA 2ODRC 4F9AB 2EORA 2YU5A 1A1FA 2L6MA 2LVHA 4LU9A 4BC9A 2D9HA 2L2NA 2LJHA 2LBSB 4Q35B 1I94E 5FLXC 1PJSA 2R76A 2RSMA 1EH6A 2YTQA 3LMLA 4X66E 2JP9A 1X48A 1T4LB 1BBOA 1ZBTA 3F6GA 5IV8B 2EMXA 1J5EE 3IWDA 3T1YE 1XMOE 5KL5A 2EOYA 5KL3A 4DR1E 2UUCE 2R1FA 4DV3E 2V89A 3JU0A 4R8OA 3P1XA 4NXME 1X6EA 5TSEA 2FTXB 2L2MA 2MDGA 2YSOA 1MEYC 4NZVA 2LT7A 4DR4E 1O0WA 2V8QB 4YY3E 2NABA 5T6JA 2EPAA 2YTNA 3UK3C 2E72A 1ZBQA 2EMHA 4DUYE 2L8TA 4DV2E 2GLIA 1WXRA 1XNRE 1UHZA 2V88A 2UXCE 2BBGA 3EQ1A 2YU8A 3VYXA 2UXBE 4WFTA 1EKZA 1AH5A 1JK1A 1T4NA 2EPKX 1X47A 2I9IA 2EPMX 1TF6A 2EMFA 1DI2A 2NUGA 2EPRA 4NXNE 2JY9A 1ZU1A 1N33E 2DIXA 2KONA 4TUGA 3H09A 2EMCA 4BHBA 5LL6R 2WBTA 4O4KA 4DR3E 2ODRD 1PKPA 2M7QA 4FK5C 4OOGC 2UUBE 1BB8A 4DV7E 4L5NC 2VQEE 4HEIA 1QU6A 1T39A 1IBLE 2YTDA 2RQLA 2YTGA 2EMKA 2EMYA 3BIDA 3T1HE 1HNXE 3MHHC 2GHFA 5AC5A 1A1GA 1N32E 2V85A 2HGHA 1PJTA 4ZYDA 2EOQA 1SFEA 2HC5A 3MSWA 1YUIA 2JR1A 4P7DA 4LFAE 2JOBA 1RQ0A 2IHR1 2EN1A 3DF6A 1IMUA 1WJPA 2YTFA 2LUQA 4JV5E 2M9AA 1FJGE 5BR8E 2NA2A 2ZM6E 1L4SA 4P78A 5IWAE 2ELYA 1FKAE 4K0KE 2EL6A 2LRSA 2K7IA 1F2IG 2EMIA 1HNWE 1MGTA 2MC5A 1AAYA 2GPIA 1X5WA 4BMJA 4F6MA 2ENAA 2EP3A 1T4OA 5F3WA 2B7TA 3EPJA 3EPHA 2EOMA 1YSAC 1WHQA 2VQFE 1A1IA 2JXPA 2DMIA 3ADJA 3VYYA 2V83A 4GZNC 2LJUA 4WPYA 2EQ0A 2RPCA 3VHTB 3F6HA 4B3ME 2EMWA 3K6QA 3ZOQB 2Q8UA 3BGHA 2DGCA 4DMIA 1STUA 2CPNA 2DB2A 4JI3E 1GQEA 2LO3A 4RH8A 2EM3A 3THNA 2EPZA 1EH8A 2ENCA 2EPNA 1XMQE 5KL2A 4LF9E 2H36X 1YUJA 4IS1C 4F6NA 2EN8A 4O5GA 2F4VE 4R2RA 2LTSA 1IBKE 5AC4A 2VE7C 5LLQA 4F9CB 1DQ3A 2EWLA 2LMZA 2RTXA 2WBSA 2EOOA 2LTRA 2EPCA 2E1MA 2HHHE 1GTKA 5CFFE 2DLKA 4NHRA 4X64E 2EQ1A 2NUFA 4R2DA 2EZ6A 4WSPA 2HJJA 4F2JC 4M2ZA 5A6BD 1KYQA 2JOXA 4B3SE 4F9BB 5ADZA 3C6MA 1YPNA 2YTPA 4LF5E 2YRHA 2KHXA 2E5LE 2FGGA 3KZZA 4JI7E 5A6BA 2EL5A 5A6AA 2DRPA 4DR2E 1N36E 3QG5C 4KZSA 2LUPB 3ECRA 2L3JA 4GKKE 4DV1E 3LLHA 4X62E 2M1SA 3EPKA 2WCC3 3JAMC 2JVAA 1B69A 4JI1E 1UILA 3L00A 2EQ3A 2LV2A 2EMBA 1IBME 1J26A 4X9JA 4R2EA 1NEIA 4X8WA 1ZAAC 5A6JA 4ZYHA 2N3GA 3C6KA 3IWCA 2YPNA 4M0VA 2YTEA 1A1HA 1G2FC 4OX9E 1PJQA 2YWQA 1HR0E 3AUZA 1GZ6A 3THOB 4KWYA 4R2QA 3HPZA 3HPSA 3OMLA 1WHNA 1A1JA 3TQMA 1A1LA 4JI5E 1N34E 3HXLA 1X6FA 2JPAA 1ZR9A 2BB8A 2NUEA 2EPPA 4ZYGA 3EPLA 3KZYA 2CTDA 2YRKA 4BS9A 3BF2A 4JI4E 2I13A 1HNZE 4RHBB 5A69A 5KL6A 3M99B 2KOUA 1SR9A 2EPUA 2F8BA 4L8NA 4DV0E 1TF3A 2J7JA 3IWBA 3J7AG 1KJKA 5LMUE 3AV0A 4X65E 2EL4A 2G7HA 2YTIA 4BCAA 4DV5E 1NCSA 2FV4B 4IJDA 5AE2A 4WXDA 3ADGA 2YSPA 2EMAA 2EM9A 3C4TA 1G2DC 2EOJA 2EN7A 2MC6A 5IT9C 4JI6E 2B7VA 5LMNE 2L3CA 2EM2A 4LF6E 1LLMC 2JWOA 2DSYA 4WXCA 2EM0A 4M30A 2N3HA 2EJ4A 4BBYA 4R03A 2EM6A 4BHCA 1EH7A 1A1KA 2EN2A 2JYAA 5AE1A 4LFBE 4BC7A 4LF4E 1T38A 4TUIA 4I8OA 5AE3A 4R2AA 2EM5A 2CSHA 2EOZA 2VRDA 4DUZE 1PDAA 2UU9E 2EM4A 2YRMA 2DLQA 3KWRA 2EOEA 5IXMB 4AQYE 4M9VC 2LCEA 2YT4A 2L33A 1TN9A 1QNTA 1N3GA 2EMZA 2RSIA 2V86A 3J80C 2PRTA 2CT1A 2EOIA 2EOXA 2EPOA 1P47A 2ENHA 4LF8E 1X3CA 4WX9A 4LF7E 5KL7A 3RMPA 5AASA 2A25A 4DR7E 1X49A 2DMYA 1RMDA 2EN6A 4R2CA 4GEQB 4LFCE 4YHHE 5DNYA 1RC7A 1WRJA 4DV4E 3BBGA 2MKNA 2LE2A 2EOFA 2EPLX 1UN6B 4J8ZA 2WZOA 3HQ1A 2MKDA 3ADIA 1YYOA 1DGCA 4B3TE 2YZTA 5A6KA 4WYQB 4DR5E 5KL4A 4F54A 3DJWA 2UXDE 4O24A 2B9DA 2EM8A 2ADRA 4JI2E 4N4RB 4JYAE 3MHSC 4JI0E 3OTOE 2EOSA 1BBGA 2EM7A 1Z1BA 2EN4A 4R2PA 2VF1A 4Q28A 2RS6A 2K4VA 4DV6E 3JTZA 1YYWA 3C4BA 2YTOA 2N8XA 4WSGA 1YFHA 3VK6A 2YTJA 4JI8E 2EMLA 3ADLA 4DR6E 1YZ9A 2EOHA 1XNQE 2EN3A 3HTXA 2V87A 2L92A 2MDRA 3J7Yp 4MLQA 5A2QC 2UUAE 4DKKA 2L2KB 4ZYEA 3J81C 4KHPE 1IQSA 4GKJE 3FIGA 2M4IA 1UBDC 2EMGA 4HTGA 1JK2A 2B3TB 2RS7A 1IQOA 1X6HA 4O43A 2EPXA 4R2SA 4B3RE 4MLVA 4LTYA 1YYKA 2WBUA 2EE8A
chains in the Genus database with same CATH topology
2HGHA 2ELZA 2EORA 2YU5A 1A1FA 2LVHA 2EOQA 4R2AA 3EPKA 2D9HA 2EM5A 1YUIA 2WCC3 2CSHA 2EOZA 2VRDA 2EN1A 1WJPA 2EM4A 2YRMA 2YTFA 1B69A 2DLQA 2YTQA 2EQ3A 2M9AA 2EOEA 2JP9A 2LV2A 2EMBA 4M9VC 1BBOA 4X9JA 4R2EA 2ELYA 2LCEA 1ZAAC 2EMXA 1TN9A 2EL6A 2EMZA 2RSIA 2PRTA 2CT1A 5KL5A 2EOIA 2EOXA 2EOYA 5KL3A 2ENHA 1P47A 2EMIA 1F2IG 2R1FA 2YTEA 1X3CA 1A1HA 5KL7A 1G2FC 1AAYA 1X5WA 4F6MA 2A25A 2ENAA 2EP3A 3EPJA 3EPHA 1RMDA 2EN6A 2EOMA 1YSAC 4R2CA 1A1IA 1X6EA 2DMIA 2MDGA 2YSOA 1MEYC 4R2QA 2LT7A 4GZNC 2NABA 1A1JA 2EPAA 1A1LA 2YTNA 3UK3C 2E72A 2EMHA 2EQ0A 2RPCA 2MKNA 1X6FA 3VHTB 2JPAA 1ZR9A 2GLIA 2EOFA 2BB8A 1UN6B 2EMWA 2EPPA 3EPLA 2CTDA 2YRKA 2YU8A 2I13A 2MKDA 1JK1A 2DGCA 5KL6A 3M99B 1DGCA 1TF6A 2EPUA 2EMFA 2LO3A 1TF3A 2EPRA 2J7JA 2EM3A 5KL4A 1KJKA 2EPZA 2EM8A 1ZU1A 2ADRA 2ENCA 2EL4A 2YTIA 5KL2A 3MHSC 2EMCA 1NCSA 4IJDA 2EOSA 2WBTA 1YUJA 4IS1C 2EM7A 1Z1BA 4F6NA 2EN4A 4R2PA 2EN8A 2YSPA 4FK5C 2EMAA 4R2RA 1BB8A 2EM9A 1G2DC 2DRPA 2EOJA 2EN7A 2YTOA 4WSGA 2WBSA 2YTDA 2YTJA 2EMLA 2EOOA 2YTGA 2EPCA 2EM2A 2EOHA 2EN3A 2DLKA 1LLMC 2EMKA 2EQ1A 2EMYA 4R2DA 2EM0A 4F2JC 2EJ4A 1UBDC 2EMGA 1JK2A 3MHHC 2GHFA 1X6HA 2YTPA 1A1GA 2YRHA 2EPXA 4R2SA 2EM6A 2EL5A 1A1KA 2EN2A 2WBUA 2EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  2ELZ A;  2EOR A;  2YU5 A;  1A1F A;  2LVH A;  2EOQ A;  4R2A A;  3EPK A;  2D9H A;  2EM5 A;  1YUI A;  2WCC 3;  2CSH A;  2EOZ A;  2VRD A;  2EN1 A;  1WJP A;  2EM4 A;  2YRM A;  2YTF A;  1B69 A;  2DLQ A;  2YTQ A;  2EQ3 A;  2M9A A;  2EOE A;  2JP9 A;  2LV2 A;  2EMB A;  4M9V C;  1BBO A;  4X9J A;  4R2E A;  2ELY A;  2LCE A;  1ZAA C;  2EMX A;  1TN9 A;  2EL6 A;  2EMZ A;  2RSI A;  2PRT A;  2CT1 A;  5KL5 A;  2EOI A;  2EOX A;  2EOY A;  5KL3 A;  2ENH A;  1P47 A;  2EMI A;  1F2I G;  2R1F A;  2YTE A;  1X3C A;  1A1H A;  5KL7 A;  1G2F C;  1AAY A;  1X5W A;  4F6M A;  2A25 A;  2ENA A;  2EP3 A;  3EPJ A;  3EPH A;  1RMD A;  2EN6 A;  2EOM A;  1YSA C;  4R2C A;  1A1I A;  1X6E A;  2DMI A;  2MDG A;  2YSO A;  1MEY C;  4R2Q A;  2LT7 A;  4GZN C;  2NAB A;  1A1J A;  2EPA A;  1A1L A;  2YTN A;  3UK3 C;  2E72 A;  2EMH A;  2EQ0 A;  2RPC A;  2MKN A;  1X6F A;  3VHT B;  2JPA A;  1ZR9 A;  2GLI A;  2EOF A;  2BB8 A;  1UN6 B;  2EMW A;  2EPP A;  3EPL A;  2CTD A;  2YRK A;  2YU8 A;  2I13 A;  2MKD A;  1JK1 A;  2DGC A;  5KL6 A;  3M99 B;  1DGC A;  1TF6 A;  2EPU A;  2EMF A;  2LO3 A;  1TF3 A;  2EPR A;  2J7J A;  2EM3 A;  5KL4 A;  1KJK A;  2EPZ A;  2EM8 A;  1ZU1 A;  2ADR A;  2ENC A;  2EL4 A;  2YTI A;  5KL2 A;  3MHS C;  2EMC A;  1NCS A;  4IJD A;  2EOS A;  2WBT A;  1YUJ A;  4IS1 C;  2EM7 A;  1Z1B A;  4F6N A;  2EN4 A;  4R2P A;  2EN8 A;  2YSP A;  4FK5 C;  2EMA A;  4R2R A;  1BB8 A;  2EM9 A;  1G2D C;  2DRP A;  2EOJ A;  2EN7 A;  2YTO A;  4WSG A;  2WBS A;  2YTD A;  2YTJ A;  2EML A;  2EOO A;  2YTG A;  2EPC A;  2EM2 A;  2EOH A;  2EN3 A;  2DLK A;  1LLM C;  2EMK A;  2EQ1 A;  2EMY A;  4R2D A;  2EM0 A;  4F2J C;  2EJ4 A;  1UBD C;  2EMG A;  1JK2 A;  3MHH C;  2GHF A;  1X6H A;  2YTP A;  1A1G A;  2YRH A;  2EPX A;  4R2S A;  2EM6 A;  2EL5 A;  1A1K A;  2EN2 A;  2WBU A;  2EE8 A; 
#chains in the Genus database with same CATH topology
 2ELZ A;  2ODR C;  4F9A B;  2EOR A;  2YU5 A;  1A1F A;  2L6M A;  2LVH A;  4LU9 A;  4BC9 A;  2D9H A;  2L2N A;  2LJH A;  2LBS B;  4Q35 B;  1I94 E;  5FLX C;  1PJS A;  2R76 A;  2RSM A;  1EH6 A;  2YTQ A;  3LML A;  4X66 E;  2JP9 A;  1X48 A;  1T4L B;  1BBO A;  1ZBT A;  3F6G A;  5IV8 B;  2EMX A;  1J5E E;  3IWD A;  3T1Y E;  1XMO E;  5KL5 A;  2EOY A;  5KL3 A;  4DR1 E;  2UUC E;  2R1F A;  4DV3 E;  2V89 A;  3JU0 A;  4R8O A;  3P1X A;  4NXM E;  1X6E A;  5TSE A;  2FTX B;  2L2M A;  2MDG A;  2YSO A;  1MEY C;  4NZV A;  2LT7 A;  4DR4 E;  1O0W A;  2V8Q B;  4YY3 E;  2NAB A;  5T6J A;  2EPA A;  2YTN A;  3UK3 C;  2E72 A;  1ZBQ A;  2EMH A;  4DUY E;  2L8T A;  4DV2 E;  2GLI A;  1WXR A;  1XNR E;  1UHZ A;  2V88 A;  2UXC E;  2BBG A;  3EQ1 A;  2YU8 A;  3VYX A;  2UXB E;  4WFT A;  1EKZ A;  1AH5 A;  1JK1 A;  1T4N A;  2EPK X;  1X47 A;  2I9I A;  2EPM X;  1TF6 A;  2EMF A;  1DI2 A;  2NUG A;  2EPR A;  4NXN E;  2JY9 A;  1ZU1 A;  1N33 E;  2DIX A;  2KON A;  4TUG A;  3H09 A;  2EMC A;  4BHB A;  5LL6 R;  2WBT A;  4O4K A;  4DR3 E;  2ODR D;  1PKP A;  2M7Q A;  4FK5 C;  4OOG C;  2UUB E;  1BB8 A;  4DV7 E;  4L5N C;  2VQE E;  4HEI A;  1QU6 A;  1T39 A;  1IBL E;  2YTD A;  2RQL A;  2YTG A;  2EMK A;  2EMY A;  3BID A;  3T1H E;  1HNX E;  3MHH C;  2GHF A;  5AC5 A;  1A1G A;  1N32 E;  2V85 A;  2HGH A;  1PJT A;  4ZYD A;  2EOQ A;  1SFE A;  2HC5 A;  3MSW A;  1YUI A;  2JR1 A;  4P7D A;  4LFA E;  2JOB A;  1RQ0 A;  2IHR 1;  2EN1 A;  3DF6 A;  1IMU A;  1WJP A;  2YTF A;  2LUQ A;  4JV5 E;  2M9A A;  1FJG E;  5BR8 E;  2NA2 A;  2ZM6 E;  1L4S A;  4P78 A;  5IWA E;  2ELY A;  1FKA E;  4K0K E;  2EL6 A;  2LRS A;  2K7I A;  1F2I G;  2EMI A;  1HNW E;  1MGT A;  2MC5 A;  1AAY A;  2GPI A;  1X5W A;  4BMJ A;  4F6M A;  2ENA A;  2EP3 A;  1T4O A;  5F3W A;  2B7T A;  3EPJ A;  3EPH A;  2EOM A;  1YSA C;  1WHQ A;  2VQF E;  1A1I A;  2JXP A;  2DMI A;  3ADJ A;  3VYY A;  2V83 A;  4GZN C;  2LJU A;  4WPY A;  2EQ0 A;  2RPC A;  3VHT B;  3F6H A;  4B3M E;  2EMW A;  3K6Q A;  3ZOQ B;  2Q8U A;  3BGH A;  2DGC A;  4DMI A;  1STU A;  2CPN A;  2DB2 A;  4JI3 E;  1GQE A;  2LO3 A;  4RH8 A;  2EM3 A;  3THN A;  2EPZ A;  1EH8 A;  2ENC A;  2EPN A;  1XMQ E;  5KL2 A;  4LF9 E;  2H36 X;  1YUJ A;  4IS1 C;  4F6N A;  2EN8 A;  4O5G A;  2F4V E;  4R2R A;  2LTS A;  1IBK E;  5AC4 A;  2VE7 C;  5LLQ A;  4F9C B;  1DQ3 A;  2EWL A;  2LMZ A;  2RTX A;  2WBS A;  2EOO A;  2LTR A;  2EPC A;  2E1M A;  2HHH E;  1GTK A;  5CFF E;  2DLK A;  4NHR A;  4X64 E;  2EQ1 A;  2NUF A;  4R2D A;  2EZ6 A;  4WSP A;  2HJJ A;  4F2J C;  4M2Z A;  5A6B D;  1KYQ A;  2JOX A;  4B3S E;  4F9B B;  5ADZ A;  3C6M A;  1YPN A;  2YTP A;  4LF5 E;  2YRH A;  2KHX A;  2E5L E;  2FGG A;  3KZZ A;  4JI7 E;  5A6B A;  2EL5 A;  5A6A A;  2DRP A;  4DR2 E;  1N36 E;  3QG5 C;  4KZS A;  2LUP B;  3ECR A;  2L3J A;  4GKK E;  4DV1 E;  3LLH A;  4X62 E;  2M1S A;  3EPK A;  2WCC 3;  3JAM C;  2JVA A;  1B69 A;  4JI1 E;  1UIL A;  3L00 A;  2EQ3 A;  2LV2 A;  2EMB A;  1IBM E;  1J26 A;  4X9J A;  4R2E A;  1NEI A;  4X8W A;  1ZAA C;  5A6J A;  4ZYH A;  2N3G A;  3C6K A;  3IWC A;  2YPN A;  4M0V A;  2YTE A;  1A1H A;  1G2F C;  4OX9 E;  1PJQ A;  2YWQ A;  1HR0 E;  3AUZ A;  1GZ6 A;  3THO B;  4KWY A;  4R2Q A;  3HPZ A;  3HPS A;  3OML A;  1WHN A;  1A1J A;  3TQM A;  1A1L A;  4JI5 E;  1N34 E;  3HXL A;  1X6F A;  2JPA A;  1ZR9 A;  2BB8 A;  2NUE A;  2EPP A;  4ZYG A;  3EPL A;  3KZY A;  2CTD A;  2YRK A;  4BS9 A;  3BF2 A;  4JI4 E;  2I13 A;  1HNZ E;  4RHB B;  5A69 A;  5KL6 A;  3M99 B;  2KOU A;  1SR9 A;  2EPU A;  2F8B A;  4L8N A;  4DV0 E;  1TF3 A;  2J7J A;  3IWB A;  3J7A G;  1KJK A;  5LMU E;  3AV0 A;  4X65 E;  2EL4 A;  2G7H A;  2YTI A;  4BCA A;  4DV5 E;  1NCS A;  2FV4 B;  4IJD A;  5AE2 A;  4WXD A;  3ADG A;  2YSP A;  2EMA A;  2EM9 A;  3C4T A;  1G2D C;  2EOJ A;  2EN7 A;  2MC6 A;  5IT9 C;  4JI6 E;  2B7V A;  5LMN E;  2L3C A;  2EM2 A;  4LF6 E;  1LLM C;  2JWO A;  2DSY A;  4WXC A;  2EM0 A;  4M30 A;  2N3H A;  2EJ4 A;  4BBY A;  4R03 A;  2EM6 A;  4BHC A;  1EH7 A;  1A1K A;  2EN2 A;  2JYA A;  5AE1 A;  4LFB E;  4BC7 A;  4LF4 E;  1T38 A;  4TUI A;  4I8O A;  5AE3 A;  4R2A A;  2EM5 A;  2CSH A;  2EOZ A;  2VRD A;  4DUZ E;  1PDA A;  2UU9 E;  2EM4 A;  2YRM A;  2DLQ A;  3KWR A;  2EOE A;  5IXM B;  4AQY E;  4M9V C;  2LCE A;  2YT4 A;  2L33 A;  1TN9 A;  1QNT A;  1N3G A;  2EMZ A;  2RSI A;  2V86 A;  3J80 C;  2PRT A;  2CT1 A;  2EOI A;  2EOX A;  2EPO A;  1P47 A;  2ENH A;  4LF8 E;  1X3C A;  4WX9 A;  4LF7 E;  5KL7 A;  3RMP A;  5AAS A;  2A25 A;  4DR7 E;  1X49 A;  2DMY A;  1RMD A;  2EN6 A;  4R2C A;  4GEQ B;  4LFC E;  4YHH E;  5DNY A;  1RC7 A;  1WRJ A;  4DV4 E;  3BBG A;  2MKN A;  2LE2 A;  2EOF A;  2EPL X;  1UN6 B;  4J8Z A;  2WZO A;  3HQ1 A;  2MKD A;  3ADI A;  1YYO A;  1DGC A;  4B3T E;  2YZT A;  5A6K A;  4WYQ B;  4DR5 E;  5KL4 A;  4F54 A;  3DJW A;  2UXD E;  4O24 A;  2B9D A;  2EM8 A;  2ADR A;  4JI2 E;  4N4R B;  4JYA E;  3MHS C;  4JI0 E;  3OTO E;  2EOS A;  1BBG A;  2EM7 A;  1Z1B A;  2EN4 A;  4R2P A;  2VF1 A;  4Q28 A;  2RS6 A;  2K4V A;  4DV6 E;  3JTZ A;  1YYW A;  3C4B A;  2YTO A;  2N8X A;  4WSG A;  1YFH A;  3VK6 A;  2YTJ A;  4JI8 E;  2EML A;  3ADL A;  4DR6 E;  1YZ9 A;  2EOH A;  1XNQ E;  2EN3 A;  3HTX A;  2V87 A;  2L92 A;  2MDR A;  3J7Y p;  4MLQ A;  5A2Q C;  2UUA E;  4DKK A;  2L2K B;  4ZYE A;  3J81 C;  4KHP E;  1IQS A;  4GKJ E;  3FIG A;  2M4I A;  1UBD C;  2EMG A;  4HTG A;  1JK2 A;  2B3T B;  2RS7 A;  1IQO A;  1X6H A;  4O43 A;  2EPX A;  4R2S A;  4B3R E;  4MLV A;  4LTY A;  1YYK A;  2WBU A;  2EE8 A; 
#chains in the Genus database with same CATH homology
 2HGH A;  2ELZ A;  2EOR A;  2YU5 A;  1A1F A;  2LVH A;  2EOQ A;  4R2A A;  3EPK A;  2D9H A;  2EM5 A;  1YUI A;  2WCC 3;  2CSH A;  2EOZ A;  2VRD A;  2EN1 A;  1WJP A;  2EM4 A;  2YRM A;  2YTF A;  1B69 A;  2DLQ A;  2YTQ A;  2EQ3 A;  2M9A A;  2EOE A;  2JP9 A;  2LV2 A;  2EMB A;  4M9V C;  1BBO A;  4X9J A;  4R2E A;  2ELY A;  2LCE A;  1ZAA C;  2EMX A;  1TN9 A;  2EL6 A;  2EMZ A;  2RSI A;  2PRT A;  2CT1 A;  5KL5 A;  2EOI A;  2EOX A;  2EOY A;  5KL3 A;  2ENH A;  1P47 A;  2EMI A;  1F2I G;  2R1F A;  2YTE A;  1X3C A;  1A1H A;  5KL7 A;  1G2F C;  1AAY A;  1X5W A;  4F6M A;  2A25 A;  2ENA A;  2EP3 A;  3EPJ A;  3EPH A;  1RMD A;  2EN6 A;  2EOM A;  1YSA C;  4R2C A;  1A1I A;  1X6E A;  2DMI A;  2MDG A;  2YSO A;  1MEY C;  4R2Q A;  2LT7 A;  4GZN C;  2NAB A;  1A1J A;  2EPA A;  1A1L A;  2YTN A;  3UK3 C;  2E72 A;  2EMH A;  2EQ0 A;  2RPC A;  2MKN A;  1X6F A;  3VHT B;  2JPA A;  1ZR9 A;  2GLI A;  2EOF A;  2BB8 A;  1UN6 B;  2EMW A;  2EPP A;  3EPL A;  2CTD A;  2YRK A;  2YU8 A;  2I13 A;  2MKD A;  1JK1 A;  2DGC A;  5KL6 A;  3M99 B;  1DGC A;  1TF6 A;  2EPU A;  2EMF A;  2LO3 A;  1TF3 A;  2EPR A;  2J7J A;  2EM3 A;  5KL4 A;  1KJK A;  2EPZ A;  2EM8 A;  1ZU1 A;  2ADR A;  2ENC A;  2EL4 A;  2YTI A;  5KL2 A;  3MHS C;  2EMC A;  1NCS A;  4IJD A;  2EOS A;  2WBT A;  1YUJ A;  4IS1 C;  2EM7 A;  1Z1B A;  4F6N A;  2EN4 A;  4R2P A;  2EN8 A;  2YSP A;  4FK5 C;  2EMA A;  4R2R A;  1BB8 A;  2EM9 A;  1G2D C;  2DRP A;  2EOJ A;  2EN7 A;  2YTO A;  4WSG A;  2WBS A;  2YTD A;  2YTJ A;  2EML A;  2EOO A;  2YTG A;  2EPC A;  2EM2 A;  2EOH A;  2EN3 A;  2DLK A;  1LLM C;  2EMK A;  2EQ1 A;  2EMY A;  4R2D A;  2EM0 A;  4F2J C;  2EJ4 A;  1UBD C;  2EMG A;  1JK2 A;  3MHH C;  2GHF A;  1X6H A;  2YTP A;  1A1G A;  2YRH A;  2EPX A;  4R2S A;  2EM6 A;  2EL5 A;  1A1K A;  2EN2 A;  2WBU A;  2EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...