2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
2EN3A 2YSPA 1A1KA 4R2EA 2CT1A 1ZR9A 2EMZA 2EMBA 3EPLA 2LCEA 2YTDA 2JPAA 1KJKA 2EOQA 2EM2A 2J7JA 4IS1C 1X6FA 1MEYC 1LLMC 4IJDA 2EM0A 2NABA 5KL5A 2EQ3A 2EOOA 2BB8A 4R2AA 2ELYA 2EE8A 2EOJA 2EPCA 1WJPA 2EMWA 2EL4A 2EOZA 2I13A 2EOIA 1RMDA 2EMGA 2EQ1A 2EMXA 1A1FA 2ENAA 2EMCA 2EMIA 1X6HA 2EL6A 4R2QA 2EN2A 2MKDA 2YTQA 2EORA 2WBSA 2EPPA 2EMFA 1A1LA 4F6MA 1BB8A 2GHFA 3MHHC 3VHTB 1G2DC 2EN7A 2EM9A 2EPZA 2YTGA 2YTFA 4F2JC 1JK1A 2EOFA 1DGCA 1UBDC 2YTEA 4R2SA 2EPAA 1BBOA 2EP3A 2CTDA 2EM8A 2EM4A 2ELZA 4R2PA 4X9JA 3UK3C 2EMHA 1UN6B 2ENHA 2D9HA 2YTIA 2EL5A 1YUJA 2EMYA 2EOYA 2EMKA 5KL6A 2EMLA 1YUIA 1B69A 1YSAC 1X3CA 5KL4A 2RPCA 2YRMA 2YU5A 2EN8A 2LV2A 2YTNA 2YRHA 2YTPA 4R2DA 3EPJA 2DMIA 5KL7A 2EPXA 1P47A 1TF3A 2LVHA 4FK5C 1F2IG 1A1GA 2DLQA 1X6EA 1X5WA 2PRTA 2EM7A 2EM6A 3M99B 2EN4A 2EM5A 2LO3A 2YTOA 2CSHA 2DGCA 1TN9A 2VRDA 2MDGA 2M9AA 1JK2A 2EQ0A 1ZAAC 4M9VC 2YTJA 2EJ4A 3EPKA 2WCC3 2WBTA 1TF6A 4R2RA 4WSGA 2YRKA 2EPUA 5KL3A 2EOEA 2EPRA 1ZU1A 2ENCA 2ADRA 1NCSA 1Z1BA 2RSIA 3MHSC 2YSOA 2EOHA 2WBUA 2GLIA 2A25A 2LT7A 2EN1A 4F6NA 1AAYA 1A1JA 1A1IA 2EOMA 4GZNC 2JP9A 2DLKA 2EN6A 2EM3A 5KL2A 1A1HA 4R2CA 2DRPA 1G2FC 2EOXA 3EPHA 2R1FA 2EOSA 2YU8A 2EMAA 2MKNA 2HGHA 2E72A
chains in the Genus database with same CATH superfamily
1AH5A 1IQSA 5ADZA 3THOB 4WPYA 2YSPA 4MLQA 3F6GA 3HPSA 1ZR9A 4RHBB 1XMOE 4TUIA 3EPLA 2LCEA 3BGHA 1KJKA 2L3CA 2EM2A 2VQEE 1MEYC 1FJGE 2KONA 2EQ3A 1DQ3A 2BB8A 5A6AA 3F6HA 4DV1E 2EOZA 1HNXE 1DI2A 2LBSB 2I13A 2UU9E 2R76A 5A6KA 2NUFA 2MKDA 2WBSA 2EORA 2EPPA 2MC5A 4DUYE 4DV2E 2UUAE 3JTZA 2UXBE 4LF7E 1IMUA 2LUPB 2N8XA 5IXMB 3IWCA 3H09A 4YY3E 1DGCA 4HEIA 4B3RE 1UBDC 4JI1E 4OX9E 2EPAA 1QNTA 1BBOA 4AQYE 5A6BA 2L2KB 4R2PA 2ELZA 3IWDA 3UK3C 1QU6A 1NEIA 4WXDA 4DR1E 1KYQA 2EMHA 2LJHA 2D9HA 5T6JA 4JI6E 2LMZA 4JV5E 4WFTA 1WHNA 4NHRA 1YUIA 4LF9E 4BBYA 2RPCA 2EN8A 2YTPA 4R2DA 2EPNA 4JYAE 5KL7A 1P47A 4FK5C 3BBGA 2DLQA 1X5WA 1T4LB 4DUZE 4JI3E 2YWQA 3KZZA 4DR6E 1PJTA 2V88A 3HTXA 1JK2A 4DR2E 2EJ4A 4LF6E 2MC6A 3ADIA 2LRSA 4R2RA 1UHZA 2EPUA 2EOEA 2EPRA 4DR7E 2H36X 1RC7A 3JAMC 1X49A 3MHSC 5BR8E 2WBUA 2K7IA 2GLIA 1YYKA 4TUGA 2YZTA 2VQFE 2EOMA 2F4VE 4GKJE 2JWOA 5F3WA 1XNRE 2EN6A 1J26A 4F9BB 5KL2A 3C4BA 2V86A 1O0WA 2DIXA 4F9CB 2L92A 3ADJA 1RQ0A 2N3HA 2EN3A 4R2EA 2DMYA 2CT1A 2EMZA 2L8TA 3THNA 2EMBA 2YTDA 1MGTA 2JPAA 1PDAA 4LFBE 4IS1C 5AE3A 2UUCE 2NA2A 4BMJA 4BCAA 2EZ6A 1EH7A 4Q35B 2E1MA 5FLXC 2EOIA 3J80C 4X62E 4R2QA 1X6HA 2EL6A 4KWYA 2EN2A 1SR9A 2JVAA 2WZOA 1WHQA 2EMFA 1N3GA 3VHTB 4B3TE 4M0VA 2YTFA 2HC5A 2HHHE 1UILA 4NXME 1XNQE 2EWLA 2YTEA 4M30A 1N34E 1IBLE 3BIDA 4HTGA 4X8WA 5TSEA 1UN6B 2YTIA 2B3TB 2EOYA 4KHPE 4LF8E 2K4VA 2V83A 2V85A 5KL6A 1B69A 5KL4A 4R03A 2KOUA 2LV2A 2YTNA 1N36E 2B7TA 1SFEA 2DMIA 1ZBQA 2JOBA 2EPKX 1F2IG 4DV0E 2YPNA 5AC4A 1X6EA 1A1GA 2PRTA 4BHBA 4L8NA 2EM6A 2M4IA 3OTOE 2RS6A 2LO3A 2B7VA 2CSHA 2YTOA 4YHHE 2GPIA 2EQ0A 2LJUA 5AE1A 3C6KA 2WBTA 4X64E 1TF6A 3LMLA 4WSGA 5LLQA 5KL3A 2HJJA 5CFFE 2ENCA 3J7Yp 4LF5E 2LT7A 1YYOA 2EN1A 4O43A 5LMNE 4F6NA 2G7HA 1A1JA 1YPNA 1A1IA 1EKZA 2IHR1 3KWRA 4B3SE 3HPZA 2RTXA 1J5EE 2UXDE 3VK6A 2YT4A 2YU8A 4K0KE 4F9AB 2MKNA 2ODRC 3VYXA 4DV4E 2UUBE 4ZYHA 4LFCE 1A1KA 4B3ME 1IQOA 2J7JA 2LTSA 3AUZA 4JI5E 2M7QA 2BBGA 2V89A 3EQ1A 2EM0A 1LLMC 2NABA 4L5NC 3C6MA 3J81C 2JR1A 4R2AA 2ELYA 2EPCA 2EMWA 3AV0A 1N33E 1RMDA 2EMGA 2EQ1A 3MSWA 3T1HE 1A1FA 2E5LE 2CPNA 2EMCA 2YTQA 3DJWA 1YYWA 1BB8A 3MHHC 3JU0A 2EN7A 4BC7A 2EM9A 2L33A 4JI8E 5A2QC 1L4SA 5AE2A 4R2SA 1YZ9A 1N32E 4BS9A 2EM4A 2JY9A 1YFHA 4JI7E 4O4KA 2DB2A 1PJSA 2ENHA 1T39A 2MDRA 1YUJA 2EMYA 5DNYA 5A6BD 1HNZE 2EMLA 1X3CA 5IT9C 4WX9A 2YRHA 2M1SA 3HQ1A 3EPJA 1T4NA 1TF3A 1XMQE 1FKAE 3K6QA 1ZBTA 2RSMA 2EM7A 3M99B 2EN4A 2DGCA 1TN9A 3BF2A 4DV3E 2MDGA 2M9AA 5LMUE 2EPMX 3FIGA 2N3GA 2YTJA 2LTRA 2WCC3 2JYAA 1STUA 1IBKE 4LF4E 2ADRA 1BBGA 2L6MA 2JOXA 3T1YE 4WSPA 2A25A 3LLHA 2FTXB 5A6JA 2EM3A 1A1HA 4DMIA 2DRPA 2VE7C 4N4RB 3L00A 4LU9A 3EPHA 2R1FA 2EOSA 1I94E 2ODRD 4O24A 1T4OA 2E72A 2NUEA 5AASA 4JI4E 4O5GA 2VF1A 4F54A 3DF6A 2EOQA 2JXPA 1X6FA 3VYYA 4IJDA 4LTYA 1EH6A 4X65E 5KL5A 4ZYEA 2EOOA 1X48A 3ADGA 2EE8A 2EOJA 1WJPA 2EL4A 1T38A 2EMXA 1PJQA 2ENAA 4WYQB 4X66E 2EMIA 1IBME 3OMLA 2F8BA 4WXCA 2NUGA 2I9IA 2LE2A 2EPOA 2RS7A 1A1LA 4F6MA 4DR4E 2GHFA 1G2DC 4JI2E 4P78A 2L2NA 1WRJA 2EPZA 2YTGA 4F2JC 1JK1A 2EOFA 4RH8A 2ZM6E 3C4TA 2EP3A 4R8OA 2CTDA 4ZYDA 2EM8A 4DV6E 4X9JA 4DV5E 4LFAE 5IV8B 2EL5A 1X47A 2B9DA 3ECRA 2EMKA 1GQEA 1GTKA 3QG5C 1YSAC 2YRMA 2YU5A 3HXLA 4P7DA 2V8QB 3J7AG 2EPXA 1WXRA 2L2MA 2LVHA 3RMPA 2RQLA 1EH8A 4Q28A 1GZ6A 3IWBA 3TQMA 2L3JA 4JI0E 5LL6R 4BHCA 4BC9A 2EM5A 2VRDA 5A69A 4M2ZA 2LUQA 4ZYGA 1ZAAC 3ZOQB 4M9VC 3EPKA 4J8ZA 2V87A 1HNWE 3P1XA 2DSYA 4KZSA 2YRKA 4DV7E 1ZU1A 4I8OA 1NCSA 1Z1BA 2FGGA 2RSIA 2YSOA 2EOHA 4MLVA 5AC5A 1PKPA 1AAYA 4GKKE 1HR0E 4NZVA 4GZNC 2JP9A 2EPLX 2DLKA 4GEQB 4DKKA 4DR5E 4NXNE 4R2CA 4DR3E 1G2FC 2EOXA 2Q8UA 3ADLA 5IWAE 2UXCE 2FV4B 2KHXA 2EMAA 4OOGC 3KZYA 2HGHA
chains in the Genus database with same CATH topology
2EN3A 2YSPA 1A1KA 4R2EA 2CT1A 1ZR9A 2EMZA 2EMBA 3EPLA 2LCEA 2YTDA 2JPAA 1KJKA 2EOQA 2EM2A 2J7JA 4IS1C 1X6FA 1MEYC 1LLMC 4IJDA 2EM0A 2NABA 5KL5A 2EQ3A 2EOOA 2BB8A 4R2AA 2ELYA 2EE8A 2EOJA 2EPCA 1WJPA 2EMWA 2EL4A 2EOZA 2I13A 2EOIA 1RMDA 2EMGA 2EQ1A 2EMXA 1A1FA 2ENAA 2EMCA 2EMIA 1X6HA 2EL6A 4R2QA 2EN2A 2MKDA 2YTQA 2EORA 2WBSA 2EPPA 2EMFA 1A1LA 4F6MA 1BB8A 2GHFA 3MHHC 3VHTB 1G2DC 2EN7A 2EM9A 2EPZA 2YTGA 2YTFA 4F2JC 1JK1A 2EOFA 1DGCA 1UBDC 2YTEA 4R2SA 2EPAA 1BBOA 2EP3A 2CTDA 2EM8A 2EM4A 2ELZA 4R2PA 4X9JA 3UK3C 2EMHA 1UN6B 2ENHA 2D9HA 2YTIA 2EL5A 1YUJA 2EMYA 2EOYA 2EMKA 5KL6A 2EMLA 1YUIA 1B69A 1YSAC 1X3CA 5KL4A 2RPCA 2YRMA 2YU5A 2EN8A 2LV2A 2YTNA 2YRHA 2YTPA 4R2DA 3EPJA 2DMIA 5KL7A 2EPXA 1P47A 1TF3A 2LVHA 4FK5C 1F2IG 1A1GA 2DLQA 1X6EA 1X5WA 2PRTA 2EM7A 2EM6A 3M99B 2EN4A 2EM5A 2LO3A 2YTOA 2CSHA 2DGCA 1TN9A 2VRDA 2MDGA 2M9AA 1JK2A 2EQ0A 1ZAAC 4M9VC 2YTJA 2EJ4A 3EPKA 2WCC3 2WBTA 1TF6A 4R2RA 4WSGA 2YRKA 2EPUA 5KL3A 2EOEA 2EPRA 1ZU1A 2ENCA 2ADRA 1NCSA 1Z1BA 2RSIA 3MHSC 2YSOA 2EOHA 2WBUA 2GLIA 2A25A 2LT7A 2EN1A 4F6NA 1AAYA 1A1JA 1A1IA 2EOMA 4GZNC 2JP9A 2DLKA 2EN6A 2EM3A 5KL2A 1A1HA 4R2CA 2DRPA 1G2FC 2EOXA 3EPHA 2R1FA 2EOSA 2YU8A 2EMAA 2MKNA 2HGHA 2E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN3 A;  2YSP A;  1A1K A;  4R2E A;  2CT1 A;  1ZR9 A;  2EMZ A;  2EMB A;  3EPL A;  2LCE A;  2YTD A;  2JPA A;  1KJK A;  2EOQ A;  2EM2 A;  2J7J A;  4IS1 C;  1X6F A;  1MEY C;  1LLM C;  4IJD A;  2EM0 A;  2NAB A;  5KL5 A;  2EQ3 A;  2EOO A;  2BB8 A;  4R2A A;  2ELY A;  2EE8 A;  2EOJ A;  2EPC A;  1WJP A;  2EMW A;  2EL4 A;  2EOZ A;  2I13 A;  2EOI A;  1RMD A;  2EMG A;  2EQ1 A;  2EMX A;  1A1F A;  2ENA A;  2EMC A;  2EMI A;  1X6H A;  2EL6 A;  4R2Q A;  2EN2 A;  2MKD A;  2YTQ A;  2EOR A;  2WBS A;  2EPP A;  2EMF A;  1A1L A;  4F6M A;  1BB8 A;  2GHF A;  3MHH C;  3VHT B;  1G2D C;  2EN7 A;  2EM9 A;  2EPZ A;  2YTG A;  2YTF A;  4F2J C;  1JK1 A;  2EOF A;  1DGC A;  1UBD C;  2YTE A;  4R2S A;  2EPA A;  1BBO A;  2EP3 A;  2CTD A;  2EM8 A;  2EM4 A;  2ELZ A;  4R2P A;  4X9J A;  3UK3 C;  2EMH A;  1UN6 B;  2ENH A;  2D9H A;  2YTI A;  2EL5 A;  1YUJ A;  2EMY A;  2EOY A;  2EMK A;  5KL6 A;  2EML A;  1YUI A;  1B69 A;  1YSA C;  1X3C A;  5KL4 A;  2RPC A;  2YRM A;  2YU5 A;  2EN8 A;  2LV2 A;  2YTN A;  2YRH A;  2YTP A;  4R2D A;  3EPJ A;  2DMI A;  5KL7 A;  2EPX A;  1P47 A;  1TF3 A;  2LVH A;  4FK5 C;  1F2I G;  1A1G A;  2DLQ A;  1X6E A;  1X5W A;  2PRT A;  2EM7 A;  2EM6 A;  3M99 B;  2EN4 A;  2EM5 A;  2LO3 A;  2YTO A;  2CSH A;  2DGC A;  1TN9 A;  2VRD A;  2MDG A;  2M9A A;  1JK2 A;  2EQ0 A;  1ZAA C;  4M9V C;  2YTJ A;  2EJ4 A;  3EPK A;  2WCC 3;  2WBT A;  1TF6 A;  4R2R A;  4WSG A;  2YRK A;  2EPU A;  5KL3 A;  2EOE A;  2EPR A;  1ZU1 A;  2ENC A;  2ADR A;  1NCS A;  1Z1B A;  2RSI A;  3MHS C;  2YSO A;  2EOH A;  2WBU A;  2GLI A;  2A25 A;  2LT7 A;  2EN1 A;  4F6N A;  1AAY A;  1A1J A;  1A1I A;  2EOM A;  4GZN C;  2JP9 A;  2DLK A;  2EN6 A;  2EM3 A;  5KL2 A;  1A1H A;  4R2C A;  2DRP A;  1G2F C;  2EOX A;  3EPH A;  2R1F A;  2EOS A;  2YU8 A;  2EMA A;  2MKN A;  2HGH A;  2E72 A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  1IQS A;  5ADZ A;  3THO B;  4WPY A;  2YSP A;  4MLQ A;  3F6G A;  3HPS A;  1ZR9 A;  4RHB B;  1XMO E;  4TUI A;  3EPL A;  2LCE A;  3BGH A;  1KJK A;  2L3C A;  2EM2 A;  2VQE E;  1MEY C;  1FJG E;  2KON A;  2EQ3 A;  1DQ3 A;  2BB8 A;  5A6A A;  3F6H A;  4DV1 E;  2EOZ A;  1HNX E;  1DI2 A;  2LBS B;  2I13 A;  2UU9 E;  2R76 A;  5A6K A;  2NUF A;  2MKD A;  2WBS A;  2EOR A;  2EPP A;  2MC5 A;  4DUY E;  4DV2 E;  2UUA E;  3JTZ A;  2UXB E;  4LF7 E;  1IMU A;  2LUP B;  2N8X A;  5IXM B;  3IWC A;  3H09 A;  4YY3 E;  1DGC A;  4HEI A;  4B3R E;  1UBD C;  4JI1 E;  4OX9 E;  2EPA A;  1QNT A;  1BBO A;  4AQY E;  5A6B A;  2L2K B;  4R2P A;  2ELZ A;  3IWD A;  3UK3 C;  1QU6 A;  1NEI A;  4WXD A;  4DR1 E;  1KYQ A;  2EMH A;  2LJH A;  2D9H A;  5T6J A;  4JI6 E;  2LMZ A;  4JV5 E;  4WFT A;  1WHN A;  4NHR A;  1YUI A;  4LF9 E;  4BBY A;  2RPC A;  2EN8 A;  2YTP A;  4R2D A;  2EPN A;  4JYA E;  5KL7 A;  1P47 A;  4FK5 C;  3BBG A;  2DLQ A;  1X5W A;  1T4L B;  4DUZ E;  4JI3 E;  2YWQ A;  3KZZ A;  4DR6 E;  1PJT A;  2V88 A;  3HTX A;  1JK2 A;  4DR2 E;  2EJ4 A;  4LF6 E;  2MC6 A;  3ADI A;  2LRS A;  4R2R A;  1UHZ A;  2EPU A;  2EOE A;  2EPR A;  4DR7 E;  2H36 X;  1RC7 A;  3JAM C;  1X49 A;  3MHS C;  5BR8 E;  2WBU A;  2K7I A;  2GLI A;  1YYK A;  4TUG A;  2YZT A;  2VQF E;  2EOM A;  2F4V E;  4GKJ E;  2JWO A;  5F3W A;  1XNR E;  2EN6 A;  1J26 A;  4F9B B;  5KL2 A;  3C4B A;  2V86 A;  1O0W A;  2DIX A;  4F9C B;  2L92 A;  3ADJ A;  1RQ0 A;  2N3H A;  2EN3 A;  4R2E A;  2DMY A;  2CT1 A;  2EMZ A;  2L8T A;  3THN A;  2EMB A;  2YTD A;  1MGT A;  2JPA A;  1PDA A;  4LFB E;  4IS1 C;  5AE3 A;  2UUC E;  2NA2 A;  4BMJ A;  4BCA A;  2EZ6 A;  1EH7 A;  4Q35 B;  2E1M A;  5FLX C;  2EOI A;  3J80 C;  4X62 E;  4R2Q A;  1X6H A;  2EL6 A;  4KWY A;  2EN2 A;  1SR9 A;  2JVA A;  2WZO A;  1WHQ A;  2EMF A;  1N3G A;  3VHT B;  4B3T E;  4M0V A;  2YTF A;  2HC5 A;  2HHH E;  1UIL A;  4NXM E;  1XNQ E;  2EWL A;  2YTE A;  4M30 A;  1N34 E;  1IBL E;  3BID A;  4HTG A;  4X8W A;  5TSE A;  1UN6 B;  2YTI A;  2B3T B;  2EOY A;  4KHP E;  4LF8 E;  2K4V A;  2V83 A;  2V85 A;  5KL6 A;  1B69 A;  5KL4 A;  4R03 A;  2KOU A;  2LV2 A;  2YTN A;  1N36 E;  2B7T A;  1SFE A;  2DMI A;  1ZBQ A;  2JOB A;  2EPK X;  1F2I G;  4DV0 E;  2YPN A;  5AC4 A;  1X6E A;  1A1G A;  2PRT A;  4BHB A;  4L8N A;  2EM6 A;  2M4I A;  3OTO E;  2RS6 A;  2LO3 A;  2B7V A;  2CSH A;  2YTO A;  4YHH E;  2GPI A;  2EQ0 A;  2LJU A;  5AE1 A;  3C6K A;  2WBT A;  4X64 E;  1TF6 A;  3LML A;  4WSG A;  5LLQ A;  5KL3 A;  2HJJ A;  5CFF E;  2ENC A;  3J7Y p;  4LF5 E;  2LT7 A;  1YYO A;  2EN1 A;  4O43 A;  5LMN E;  4F6N A;  2G7H A;  1A1J A;  1YPN A;  1A1I A;  1EKZ A;  2IHR 1;  3KWR A;  4B3S E;  3HPZ A;  2RTX A;  1J5E E;  2UXD E;  3VK6 A;  2YT4 A;  2YU8 A;  4K0K E;  4F9A B;  2MKN A;  2ODR C;  3VYX A;  4DV4 E;  2UUB E;  4ZYH A;  4LFC E;  1A1K A;  4B3M E;  1IQO A;  2J7J A;  2LTS A;  3AUZ A;  4JI5 E;  2M7Q A;  2BBG A;  2V89 A;  3EQ1 A;  2EM0 A;  1LLM C;  2NAB A;  4L5N C;  3C6M A;  3J81 C;  2JR1 A;  4R2A A;  2ELY A;  2EPC A;  2EMW A;  3AV0 A;  1N33 E;  1RMD A;  2EMG A;  2EQ1 A;  3MSW A;  3T1H E;  1A1F A;  2E5L E;  2CPN A;  2EMC A;  2YTQ A;  3DJW A;  1YYW A;  1BB8 A;  3MHH C;  3JU0 A;  2EN7 A;  4BC7 A;  2EM9 A;  2L33 A;  4JI8 E;  5A2Q C;  1L4S A;  5AE2 A;  4R2S A;  1YZ9 A;  1N32 E;  4BS9 A;  2EM4 A;  2JY9 A;  1YFH A;  4JI7 E;  4O4K A;  2DB2 A;  1PJS A;  2ENH A;  1T39 A;  2MDR A;  1YUJ A;  2EMY A;  5DNY A;  5A6B D;  1HNZ E;  2EML A;  1X3C A;  5IT9 C;  4WX9 A;  2YRH A;  2M1S A;  3HQ1 A;  3EPJ A;  1T4N A;  1TF3 A;  1XMQ E;  1FKA E;  3K6Q A;  1ZBT A;  2RSM A;  2EM7 A;  3M99 B;  2EN4 A;  2DGC A;  1TN9 A;  3BF2 A;  4DV3 E;  2MDG A;  2M9A A;  5LMU E;  2EPM X;  3FIG A;  2N3G A;  2YTJ A;  2LTR A;  2WCC 3;  2JYA A;  1STU A;  1IBK E;  4LF4 E;  2ADR A;  1BBG A;  2L6M A;  2JOX A;  3T1Y E;  4WSP A;  2A25 A;  3LLH A;  2FTX B;  5A6J A;  2EM3 A;  1A1H A;  4DMI A;  2DRP A;  2VE7 C;  4N4R B;  3L00 A;  4LU9 A;  3EPH A;  2R1F A;  2EOS A;  1I94 E;  2ODR D;  4O24 A;  1T4O A;  2E72 A;  2NUE A;  5AAS A;  4JI4 E;  4O5G A;  2VF1 A;  4F54 A;  3DF6 A;  2EOQ A;  2JXP A;  1X6F A;  3VYY A;  4IJD A;  4LTY A;  1EH6 A;  4X65 E;  5KL5 A;  4ZYE A;  2EOO A;  1X48 A;  3ADG A;  2EE8 A;  2EOJ A;  1WJP A;  2EL4 A;  1T38 A;  2EMX A;  1PJQ A;  2ENA A;  4WYQ B;  4X66 E;  2EMI A;  1IBM E;  3OML A;  2F8B A;  4WXC A;  2NUG A;  2I9I A;  2LE2 A;  2EPO A;  2RS7 A;  1A1L A;  4F6M A;  4DR4 E;  2GHF A;  1G2D C;  4JI2 E;  4P78 A;  2L2N A;  1WRJ A;  2EPZ A;  2YTG A;  4F2J C;  1JK1 A;  2EOF A;  4RH8 A;  2ZM6 E;  3C4T A;  2EP3 A;  4R8O A;  2CTD A;  4ZYD A;  2EM8 A;  4DV6 E;  4X9J A;  4DV5 E;  4LFA E;  5IV8 B;  2EL5 A;  1X47 A;  2B9D A;  3ECR A;  2EMK A;  1GQE A;  1GTK A;  3QG5 C;  1YSA C;  2YRM A;  2YU5 A;  3HXL A;  4P7D A;  2V8Q B;  3J7A G;  2EPX A;  1WXR A;  2L2M A;  2LVH A;  3RMP A;  2RQL A;  1EH8 A;  4Q28 A;  1GZ6 A;  3IWB A;  3TQM A;  2L3J A;  4JI0 E;  5LL6 R;  4BHC A;  4BC9 A;  2EM5 A;  2VRD A;  5A69 A;  4M2Z A;  2LUQ A;  4ZYG A;  1ZAA C;  3ZOQ B;  4M9V C;  3EPK A;  4J8Z A;  2V87 A;  1HNW E;  3P1X A;  2DSY A;  4KZS A;  2YRK A;  4DV7 E;  1ZU1 A;  4I8O A;  1NCS A;  1Z1B A;  2FGG A;  2RSI A;  2YSO A;  2EOH A;  4MLV A;  5AC5 A;  1PKP A;  1AAY A;  4GKK E;  1HR0 E;  4NZV A;  4GZN C;  2JP9 A;  2EPL X;  2DLK A;  4GEQ B;  4DKK A;  4DR5 E;  4NXN E;  4R2C A;  4DR3 E;  1G2F C;  2EOX A;  2Q8U A;  3ADL A;  5IWA E;  2UXC E;  2FV4 B;  2KHX A;  2EMA A;  4OOG C;  3KZY A;  2HGH A; 
#chains in the Genus database with same CATH homology
 2EN3 A;  2YSP A;  1A1K A;  4R2E A;  2CT1 A;  1ZR9 A;  2EMZ A;  2EMB A;  3EPL A;  2LCE A;  2YTD A;  2JPA A;  1KJK A;  2EOQ A;  2EM2 A;  2J7J A;  4IS1 C;  1X6F A;  1MEY C;  1LLM C;  4IJD A;  2EM0 A;  2NAB A;  5KL5 A;  2EQ3 A;  2EOO A;  2BB8 A;  4R2A A;  2ELY A;  2EE8 A;  2EOJ A;  2EPC A;  1WJP A;  2EMW A;  2EL4 A;  2EOZ A;  2I13 A;  2EOI A;  1RMD A;  2EMG A;  2EQ1 A;  2EMX A;  1A1F A;  2ENA A;  2EMC A;  2EMI A;  1X6H A;  2EL6 A;  4R2Q A;  2EN2 A;  2MKD A;  2YTQ A;  2EOR A;  2WBS A;  2EPP A;  2EMF A;  1A1L A;  4F6M A;  1BB8 A;  2GHF A;  3MHH C;  3VHT B;  1G2D C;  2EN7 A;  2EM9 A;  2EPZ A;  2YTG A;  2YTF A;  4F2J C;  1JK1 A;  2EOF A;  1DGC A;  1UBD C;  2YTE A;  4R2S A;  2EPA A;  1BBO A;  2EP3 A;  2CTD A;  2EM8 A;  2EM4 A;  2ELZ A;  4R2P A;  4X9J A;  3UK3 C;  2EMH A;  1UN6 B;  2ENH A;  2D9H A;  2YTI A;  2EL5 A;  1YUJ A;  2EMY A;  2EOY A;  2EMK A;  5KL6 A;  2EML A;  1YUI A;  1B69 A;  1YSA C;  1X3C A;  5KL4 A;  2RPC A;  2YRM A;  2YU5 A;  2EN8 A;  2LV2 A;  2YTN A;  2YRH A;  2YTP A;  4R2D A;  3EPJ A;  2DMI A;  5KL7 A;  2EPX A;  1P47 A;  1TF3 A;  2LVH A;  4FK5 C;  1F2I G;  1A1G A;  2DLQ A;  1X6E A;  1X5W A;  2PRT A;  2EM7 A;  2EM6 A;  3M99 B;  2EN4 A;  2EM5 A;  2LO3 A;  2YTO A;  2CSH A;  2DGC A;  1TN9 A;  2VRD A;  2MDG A;  2M9A A;  1JK2 A;  2EQ0 A;  1ZAA C;  4M9V C;  2YTJ A;  2EJ4 A;  3EPK A;  2WCC 3;  2WBT A;  1TF6 A;  4R2R A;  4WSG A;  2YRK A;  2EPU A;  5KL3 A;  2EOE A;  2EPR A;  1ZU1 A;  2ENC A;  2ADR A;  1NCS A;  1Z1B A;  2RSI A;  3MHS C;  2YSO A;  2EOH A;  2WBU A;  2GLI A;  2A25 A;  2LT7 A;  2EN1 A;  4F6N A;  1AAY A;  1A1J A;  1A1I A;  2EOM A;  4GZN C;  2JP9 A;  2DLK A;  2EN6 A;  2EM3 A;  5KL2 A;  1A1H A;  4R2C A;  2DRP A;  1G2F C;  2EOX A;  3EPH A;  2R1F A;  2EOS A;  2YU8 A;  2EMA A;  2MKN A;  2HGH A;  2E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...