2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
1ZAAC 2YTNA 1ZR9A 2EOSA 2YTFA 1X6FA 2YTEA 1A1LA 5KL2A 1RMDA 2VRDA 1A1HA 2EPPA 3EPJA 2EMGA 1X6EA 4R2PA 3MHHC 1TF3A 4M9VC 3EPHA 2EQ1A 2EPUA 3MHSC 2LT7A 2EOHA 2YSOA 2EOOA 2YSPA 2YTJA 2EN6A 2MKDA 5KL7A 4R2EA 2EM9A 2EPCA 4R2QA 2MDGA 1X6HA 2YTIA 1YUJA 4FK5C 2EL5A 4R2CA 2ENAA 1P47A 2RSIA 2LCEA 1YSAC 2DGCA 1B69A 2NABA 2EORA 2ENCA 1X3CA 2YTDA 2EL4A 2YTPA 2JP9A 2EMLA 2EQ0A 2YTQA 4R2AA 3EPLA 2WCC3 2LVHA 2YRHA 1WJPA 2EMIA 2MKNA 2EN2A 1A1IA 2E72A 2EOEA 2WBTA 1A1GA 4IS1C 1F2IG 2EM2A 2EOMA 2EMHA 1KJKA 2EN7A 2DMIA 1MEYC 2EMXA 2M9AA 2EN4A 1BBOA 2YU8A 2EQ3A 4X9JA 2EMCA 2EN1A 1A1FA 1A1JA 2HGHA 2EOQA 2GLIA 2EM5A 2EPXA 2A25A 5KL6A 1TN9A 2EN8A 2LO3A 4R2RA 1DGCA 1ZU1A 2CTDA 2EOFA 2EN3A 2RPCA 2EP3A 2YTGA 2EM7A 2EL6A 4IJDA 1A1KA 1X5WA 2DLKA 1TF6A 1BB8A 2BB8A 4F6NA 2ELYA 2EMAA 2EMZA 2EOYA 2EOIA 1LLMC 1JK2A 2EM8A 2EPZA 2YRKA 3M99B 2EE8A 2PRTA 2EPAA 2EMKA 2DLQA 4R2SA 2EM6A 4GZNC 2EMYA 2EOXA 4F2JC 1AAYA 2EM3A 2JPAA 2J7JA 2EMFA 1G2DC 2R1FA 2YRMA 5KL5A 2ELZA 3UK3C 2GHFA 1Z1BA 2EMBA 2YU5A 1UBDC 1UN6B 3VHTB 2EMWA 2D9HA 2CT1A 2WBUA 5KL3A 1JK1A 2ADRA 1NCSA 4WSGA 2EM0A 2I13A 2WBSA 2YTOA 3EPKA 5KL4A 2EOZA 2EJ4A 1G2FC 2LV2A 2DRPA 2EPRA 1YUIA 4R2DA 2CSHA 4F6MA 2EOJA 2ENHA 2EM4A
chains in the Genus database with same CATH superfamily
1NEIA 2YTNA 3LMLA 4AQYE 2EOSA 4JI2E 3HPSA 3ADIA 1HNZE 2LMZA 3EPJA 2N3HA 2LRSA 4HTGA 2I9IA 1X6EA 3MHHC 3EPHA 2EQ1A 4DV0E 3DJWA 2YSOA 2FGGA 2IHR1 2N8XA 2FV4B 2YTJA 2Q8UA 2V83A 5KL7A 2EM9A 2EPCA 2MDGA 1GQEA 1X6HA 5T6JA 1N32E 1RQ0A 4P78A 1WRJA 3BGHA 3ZOQB 4I8OA 5A6KA 5AC5A 2JR1A 1B69A 1EKZA 1AH5A 1X3CA 2VF1A 3C4TA 2EMLA 2EQ0A 2YTQA 3JAMC 1IBLE 2YRHA 5LL6R 1PJTA 2EOEA 1WXRA 5DNYA 4BHCA 2EOMA 2MC6A 2NUEA 1KJKA 2EN7A 1MEYC 2M9AA 2EN4A 4DR5E 1BBOA 2WZOA 4DV6E 2L3JA 4X9JA 2UXBE 2V86A 2DSYA 4KHPE 4JI3E 4R2RA 4NZVA 3DF6A 4ZYGA 2RSMA 4N4RB 1STUA 4L5NC 4ZYDA 3C6MA 2EM7A 2JVAA 2E5LE 1DI2A 1TF6A 2ZM6E 5A2QC 1ZBTA 2CPNA 1LLMC 2JXPA 3F6GA 2YWQA 4MLQA 2YZTA 4Q35B 2EPAA 2EMKA 1PJSA 2EOXA 4F2JC 2EM3A 3VYXA 3AUZA 2R1FA 4WXCA 2ELZA 3T1HE 4DUYE 4JV5E 1PKPA 1XNQE 1IBME 1J5EE 1KYQA 5KL3A 4DR3E 4L8NA 2I13A 1YYKA 5KL4A 3JTZA 2DRPA 2LV2A 2YT4A 2VE7C 1YUIA 2CSHA 4LF6E 4F6MA 2EN3A 4LFCE 1HNWE 4DV2E 2EWLA 4RH8A 4DR7E 5A6AA 2F4VE 4DR4E 4OX9E 4M0VA 5KL2A 1A1HA 1UILA 2EMGA 3HTXA 4R2PA 1TF3A 2LT7A 1T39A 3BBGA 1T4LB 2EOOA 3VK6A 2EN6A 4F54A 4LF8E 2B3TB 3KWRA 4R2EA 4R2QA 2LJUA 2VQEE 4JI7E 2EPNA 4O4KA 4WYQB 4B3ME 2EPOA 2EL5A 1P47A 2RSIA 1YYWA 2LCEA 3AV0A 4X8WA 2G7HA 2M7QA 4LF5E 1YZ9A 2K4VA 2EORA 2JP9A 4R2AA 3EPLA 4MLVA 2EMIA 2EPLX 4HEIA 1F2IG 4JI4E 1N33E 1XMQE 2EMHA 1HNXE 4B3RE 4WXDA 3HPZA 2BBGA 1T4NA 2DMIA 2EMXA 1YYOA 1YPNA 1GZ6A 4Q28A 4DV5E 2EN1A 4O5GA 2EPMX 2HGHA 3J7AG 2EOQA 2GLIA 2EM5A 2EPXA 4DV4E 1TN9A 2HJJA 2RS7A 4JI5E 2HC5A 3J81C 2CTDA 3ADGA 3KZZA 2YTGA 3RMPA 4DV3E 4WPYA 1MGTA 2JY9A 2BB8A 3T1YE 2DMYA 4BC9A 3L00A 2LUPB 2EOIA 1JK2A 1QU6A 2EPZA 3M99B 2RQLA 2EE8A 2K7IA 2PRTA 4DR2E 5AC4A 4R2SA 2EM6A 4DUZE 2EMYA 1FJGE 2EMFA 1SFEA 1G2DC 2L8TA 4BCAA 1HR0E 2L33A 2GHFA 2EZ6A 3C4BA 2EMBA 2YU5A 1EH6A 1O0WA 1UBDC 4DR6E 4TUGA 2M1SA 1X48A 2ADRA 2EM0A 4P7DA 1WHNA 3EPKA 2GPIA 1XMOE 2EPRA 4R8OA 3HXLA 3EQ1A 3K6QA 4GEQB 1SR9A 1ZAAC 5A6BD 1X6FA 1N34E 2EPPA 4BS9A 4R03A 2LTRA 3OMLA 2L2NA 5AE2A 2UU9E 4M9VC 1GTKA 2EPUA 4X64E 2YSPA 1DQ3A 4BHBA 1UHZA 2YTIA 1YUJA 3OTOE 4R2CA 2ENAA 4LU9A 3F6HA 2NABA 4NHRA 2ENCA 2YTPA 5AE1A 2WCC3 2LVHA 4JI6E 2EN2A 4M30A 2B7TA 3ADLA 1A1IA 2WBTA 4IS1C 2EM2A 1YFHA 3J7Yp 2YU8A 3LLHA 5A6JA 2EQ3A 1EH8A 2EMCA 1A1FA 1X47A 2MC5A 2R76A 5KL6A 2EN8A 2LO3A 2F8BA 1ZU1A 1RC7A 1BBGA 3VYYA 2UUBE 2RPCA 4BBYA 2EP3A 4F9CB 1PJQA 2EL6A 1A1KA 1X5WA 1BB8A 2KHXA 4F6NA 2ELYA 2EMAA 4OOGC 2HHHE 2UUCE 4LF9E 3TQMA 2EOYA 2V89A 4F9BB 5AE3A 1WHQA 2LUQA 2DLQA 2KONA 4GZNC 4M2ZA 2J7JA 1IMUA 3UK3C 3P1XA 2DIXA 1Z1BA 5IXMB 2VQFE 1UN6B 2RS6A 2ODRD 4JYAE 5AASA 2FTXB 5A6BA 2CT1A 2JWOA 2WBUA 5LMUE 1NCSA 4WSGA 5FLXC 2EJ4A 2ODRC 4YHHE 2MDRA 4X66E 1G2FC 4K0KE 2NUGA 2EM4A 3KZYA 4X65E 4WSPA 3BF2A 1ZR9A 2YTFA 4WX9A 2YTEA 1A1LA 2UUAE 3BIDA 4JI0E 1RMDA 2VRDA 3HQ1A 4JI1E 3J80C 4BMJA 2H36X 3MHSC 2EOHA 2L3CA 2MKDA 2UXDE 3THOB 3IWCA 3IWBA 5IV8B 2RTXA 5A69A 4F9AB 4FK5C 1FKAE 2YPNA 4WFTA 2LE2A 1T4OA 5F3WA 5CFFE 3FIGA 1YSAC 2DGCA 1IQSA 2E1MA 4B3SE 2YTDA 2EL4A 2LTSA 2LBSB 1IBKE 5IT9C 4GKKE 4NXME 5BR8E 1ZBQA 1WJPA 2MKNA 2V88A 4ZYHA 2L2KB 2UXCE 2EPKX 2E72A 1A1GA 4LF7E 3IWDA 1XNRE 1I94E 5IWAE 4J8ZA 2V8QB 2NA2A 4B3TE 1N3GA 2L2MA 3MSWA 3ECRA 2JYAA 1IQOA 2L92A 1A1JA 4O24A 1T38A 2A25A 2JOBA 4X62E 4ZYEA 5LLQA 4NXNE 1N36E 1DGCA 4RHBB 2L6MA 2N3GA 2EOFA 1EH7A 5TSEA 4IJDA 1L4SA 2DLKA 2V85A 4O43A 2EMZA 1J26A 4LTYA 2KOUA 2M4IA 4GKJE 2EM8A 3C6KA 4LF4E 1X49A 2YRKA 3JU0A 4LFBE 4YY3E 4DV1E 4DMIA 2B7VA 3QG5C 1AAYA 4BC7A 2JPAA 2YRMA 3ADJA 5KL5A 2B9DA 2NUFA 3VHTB 2EMWA 2JOXA 4LFAE 2D9HA 4KZSA 5LMNE 1JK1A 2DB2A 1QNTA 2WBSA 4KWYA 2YTOA 4TUIA 2LJHA 3THNA 2EOZA 4DR1E 4DV7E 3H09A 1PDAA 2V87A 4DKKA 4R2DA 5ADZA 4JI8E 2EOJA 2ENHA
chains in the Genus database with same CATH topology
1ZAAC 2YTNA 1ZR9A 2EOSA 2YTFA 1X6FA 2YTEA 1A1LA 5KL2A 1RMDA 2VRDA 1A1HA 2EPPA 3EPJA 2EMGA 1X6EA 4R2PA 3MHHC 1TF3A 4M9VC 3EPHA 2EQ1A 2EPUA 3MHSC 2LT7A 2EOHA 2YSOA 2EOOA 2YSPA 2YTJA 2EN6A 2MKDA 5KL7A 4R2EA 2EM9A 2EPCA 4R2QA 2MDGA 1X6HA 2YTIA 1YUJA 4FK5C 2EL5A 4R2CA 2ENAA 1P47A 2RSIA 2LCEA 1YSAC 2DGCA 1B69A 2NABA 2EORA 2ENCA 1X3CA 2YTDA 2EL4A 2YTPA 2JP9A 2EMLA 2EQ0A 2YTQA 4R2AA 3EPLA 2WCC3 2LVHA 2YRHA 1WJPA 2EMIA 2MKNA 2EN2A 1A1IA 2E72A 2EOEA 2WBTA 1A1GA 4IS1C 1F2IG 2EM2A 2EOMA 2EMHA 1KJKA 2EN7A 2DMIA 1MEYC 2EMXA 2M9AA 2EN4A 1BBOA 2YU8A 2EQ3A 4X9JA 2EMCA 2EN1A 1A1FA 1A1JA 2HGHA 2EOQA 2GLIA 2EM5A 2EPXA 2A25A 5KL6A 1TN9A 2EN8A 2LO3A 4R2RA 1DGCA 1ZU1A 2CTDA 2EOFA 2EN3A 2RPCA 2EP3A 2YTGA 2EM7A 2EL6A 4IJDA 1A1KA 1X5WA 2DLKA 1TF6A 1BB8A 2BB8A 4F6NA 2ELYA 2EMAA 2EMZA 2EOYA 2EOIA 1LLMC 1JK2A 2EM8A 2EPZA 2YRKA 3M99B 2EE8A 2PRTA 2EPAA 2EMKA 2DLQA 4R2SA 2EM6A 4GZNC 2EMYA 2EOXA 4F2JC 1AAYA 2EM3A 2JPAA 2J7JA 2EMFA 1G2DC 2R1FA 2YRMA 5KL5A 2ELZA 3UK3C 2GHFA 1Z1BA 2EMBA 2YU5A 1UBDC 1UN6B 3VHTB 2EMWA 2D9HA 2CT1A 2WBUA 5KL3A 1JK1A 2ADRA 1NCSA 4WSGA 2EM0A 2I13A 2WBSA 2YTOA 3EPKA 5KL4A 2EOZA 2EJ4A 1G2FC 2LV2A 2DRPA 2EPRA 1YUIA 4R2DA 2CSHA 4F6MA 2EOJA 2ENHA 2EM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAA C;  2YTN A;  1ZR9 A;  2EOS A;  2YTF A;  1X6F A;  2YTE A;  1A1L A;  5KL2 A;  1RMD A;  2VRD A;  1A1H A;  2EPP A;  3EPJ A;  2EMG A;  1X6E A;  4R2P A;  3MHH C;  1TF3 A;  4M9V C;  3EPH A;  2EQ1 A;  2EPU A;  3MHS C;  2LT7 A;  2EOH A;  2YSO A;  2EOO A;  2YSP A;  2YTJ A;  2EN6 A;  2MKD A;  5KL7 A;  4R2E A;  2EM9 A;  2EPC A;  4R2Q A;  2MDG A;  1X6H A;  2YTI A;  1YUJ A;  4FK5 C;  2EL5 A;  4R2C A;  2ENA A;  1P47 A;  2RSI A;  2LCE A;  1YSA C;  2DGC A;  1B69 A;  2NAB A;  2EOR A;  2ENC A;  1X3C A;  2YTD A;  2EL4 A;  2YTP A;  2JP9 A;  2EML A;  2EQ0 A;  2YTQ A;  4R2A A;  3EPL A;  2WCC 3;  2LVH A;  2YRH A;  1WJP A;  2EMI A;  2MKN A;  2EN2 A;  1A1I A;  2E72 A;  2EOE A;  2WBT A;  1A1G A;  4IS1 C;  1F2I G;  2EM2 A;  2EOM A;  2EMH A;  1KJK A;  2EN7 A;  2DMI A;  1MEY C;  2EMX A;  2M9A A;  2EN4 A;  1BBO A;  2YU8 A;  2EQ3 A;  4X9J A;  2EMC A;  2EN1 A;  1A1F A;  1A1J A;  2HGH A;  2EOQ A;  2GLI A;  2EM5 A;  2EPX A;  2A25 A;  5KL6 A;  1TN9 A;  2EN8 A;  2LO3 A;  4R2R A;  1DGC A;  1ZU1 A;  2CTD A;  2EOF A;  2EN3 A;  2RPC A;  2EP3 A;  2YTG A;  2EM7 A;  2EL6 A;  4IJD A;  1A1K A;  1X5W A;  2DLK A;  1TF6 A;  1BB8 A;  2BB8 A;  4F6N A;  2ELY A;  2EMA A;  2EMZ A;  2EOY A;  2EOI A;  1LLM C;  1JK2 A;  2EM8 A;  2EPZ A;  2YRK A;  3M99 B;  2EE8 A;  2PRT A;  2EPA A;  2EMK A;  2DLQ A;  4R2S A;  2EM6 A;  4GZN C;  2EMY A;  2EOX A;  4F2J C;  1AAY A;  2EM3 A;  2JPA A;  2J7J A;  2EMF A;  1G2D C;  2R1F A;  2YRM A;  5KL5 A;  2ELZ A;  3UK3 C;  2GHF A;  1Z1B A;  2EMB A;  2YU5 A;  1UBD C;  1UN6 B;  3VHT B;  2EMW A;  2D9H A;  2CT1 A;  2WBU A;  5KL3 A;  1JK1 A;  2ADR A;  1NCS A;  4WSG A;  2EM0 A;  2I13 A;  2WBS A;  2YTO A;  3EPK A;  5KL4 A;  2EOZ A;  2EJ4 A;  1G2F C;  2LV2 A;  2DRP A;  2EPR A;  1YUI A;  4R2D A;  2CSH A;  4F6M A;  2EOJ A;  2ENH A;  2EM4 A; 
#chains in the Genus database with same CATH topology
 1NEI A;  2YTN A;  3LML A;  4AQY E;  2EOS A;  4JI2 E;  3HPS A;  3ADI A;  1HNZ E;  2LMZ A;  3EPJ A;  2N3H A;  2LRS A;  4HTG A;  2I9I A;  1X6E A;  3MHH C;  3EPH A;  2EQ1 A;  4DV0 E;  3DJW A;  2YSO A;  2FGG A;  2IHR 1;  2N8X A;  2FV4 B;  2YTJ A;  2Q8U A;  2V83 A;  5KL7 A;  2EM9 A;  2EPC A;  2MDG A;  1GQE A;  1X6H A;  5T6J A;  1N32 E;  1RQ0 A;  4P78 A;  1WRJ A;  3BGH A;  3ZOQ B;  4I8O A;  5A6K A;  5AC5 A;  2JR1 A;  1B69 A;  1EKZ A;  1AH5 A;  1X3C A;  2VF1 A;  3C4T A;  2EML A;  2EQ0 A;  2YTQ A;  3JAM C;  1IBL E;  2YRH A;  5LL6 R;  1PJT A;  2EOE A;  1WXR A;  5DNY A;  4BHC A;  2EOM A;  2MC6 A;  2NUE A;  1KJK A;  2EN7 A;  1MEY C;  2M9A A;  2EN4 A;  4DR5 E;  1BBO A;  2WZO A;  4DV6 E;  2L3J A;  4X9J A;  2UXB E;  2V86 A;  2DSY A;  4KHP E;  4JI3 E;  4R2R A;  4NZV A;  3DF6 A;  4ZYG A;  2RSM A;  4N4R B;  1STU A;  4L5N C;  4ZYD A;  3C6M A;  2EM7 A;  2JVA A;  2E5L E;  1DI2 A;  1TF6 A;  2ZM6 E;  5A2Q C;  1ZBT A;  2CPN A;  1LLM C;  2JXP A;  3F6G A;  2YWQ A;  4MLQ A;  2YZT A;  4Q35 B;  2EPA A;  2EMK A;  1PJS A;  2EOX A;  4F2J C;  2EM3 A;  3VYX A;  3AUZ A;  2R1F A;  4WXC A;  2ELZ A;  3T1H E;  4DUY E;  4JV5 E;  1PKP A;  1XNQ E;  1IBM E;  1J5E E;  1KYQ A;  5KL3 A;  4DR3 E;  4L8N A;  2I13 A;  1YYK A;  5KL4 A;  3JTZ A;  2DRP A;  2LV2 A;  2YT4 A;  2VE7 C;  1YUI A;  2CSH A;  4LF6 E;  4F6M A;  2EN3 A;  4LFC E;  1HNW E;  4DV2 E;  2EWL A;  4RH8 A;  4DR7 E;  5A6A A;  2F4V E;  4DR4 E;  4OX9 E;  4M0V A;  5KL2 A;  1A1H A;  1UIL A;  2EMG A;  3HTX A;  4R2P A;  1TF3 A;  2LT7 A;  1T39 A;  3BBG A;  1T4L B;  2EOO A;  3VK6 A;  2EN6 A;  4F54 A;  4LF8 E;  2B3T B;  3KWR A;  4R2E A;  4R2Q A;  2LJU A;  2VQE E;  4JI7 E;  2EPN A;  4O4K A;  4WYQ B;  4B3M E;  2EPO A;  2EL5 A;  1P47 A;  2RSI A;  1YYW A;  2LCE A;  3AV0 A;  4X8W A;  2G7H A;  2M7Q A;  4LF5 E;  1YZ9 A;  2K4V A;  2EOR A;  2JP9 A;  4R2A A;  3EPL A;  4MLV A;  2EMI A;  2EPL X;  4HEI A;  1F2I G;  4JI4 E;  1N33 E;  1XMQ E;  2EMH A;  1HNX E;  4B3R E;  4WXD A;  3HPZ A;  2BBG A;  1T4N A;  2DMI A;  2EMX A;  1YYO A;  1YPN A;  1GZ6 A;  4Q28 A;  4DV5 E;  2EN1 A;  4O5G A;  2EPM X;  2HGH A;  3J7A G;  2EOQ A;  2GLI A;  2EM5 A;  2EPX A;  4DV4 E;  1TN9 A;  2HJJ A;  2RS7 A;  4JI5 E;  2HC5 A;  3J81 C;  2CTD A;  3ADG A;  3KZZ A;  2YTG A;  3RMP A;  4DV3 E;  4WPY A;  1MGT A;  2JY9 A;  2BB8 A;  3T1Y E;  2DMY A;  4BC9 A;  3L00 A;  2LUP B;  2EOI A;  1JK2 A;  1QU6 A;  2EPZ A;  3M99 B;  2RQL A;  2EE8 A;  2K7I A;  2PRT A;  4DR2 E;  5AC4 A;  4R2S A;  2EM6 A;  4DUZ E;  2EMY A;  1FJG E;  2EMF A;  1SFE A;  1G2D C;  2L8T A;  4BCA A;  1HR0 E;  2L33 A;  2GHF A;  2EZ6 A;  3C4B A;  2EMB A;  2YU5 A;  1EH6 A;  1O0W A;  1UBD C;  4DR6 E;  4TUG A;  2M1S A;  1X48 A;  2ADR A;  2EM0 A;  4P7D A;  1WHN A;  3EPK A;  2GPI A;  1XMO E;  2EPR A;  4R8O A;  3HXL A;  3EQ1 A;  3K6Q A;  4GEQ B;  1SR9 A;  1ZAA C;  5A6B D;  1X6F A;  1N34 E;  2EPP A;  4BS9 A;  4R03 A;  2LTR A;  3OML A;  2L2N A;  5AE2 A;  2UU9 E;  4M9V C;  1GTK A;  2EPU A;  4X64 E;  2YSP A;  1DQ3 A;  4BHB A;  1UHZ A;  2YTI A;  1YUJ A;  3OTO E;  4R2C A;  2ENA A;  4LU9 A;  3F6H A;  2NAB A;  4NHR A;  2ENC A;  2YTP A;  5AE1 A;  2WCC 3;  2LVH A;  4JI6 E;  2EN2 A;  4M30 A;  2B7T A;  3ADL A;  1A1I A;  2WBT A;  4IS1 C;  2EM2 A;  1YFH A;  3J7Y p;  2YU8 A;  3LLH A;  5A6J A;  2EQ3 A;  1EH8 A;  2EMC A;  1A1F A;  1X47 A;  2MC5 A;  2R76 A;  5KL6 A;  2EN8 A;  2LO3 A;  2F8B A;  1ZU1 A;  1RC7 A;  1BBG A;  3VYY A;  2UUB E;  2RPC A;  4BBY A;  2EP3 A;  4F9C B;  1PJQ A;  2EL6 A;  1A1K A;  1X5W A;  1BB8 A;  2KHX A;  4F6N A;  2ELY A;  2EMA A;  4OOG C;  2HHH E;  2UUC E;  4LF9 E;  3TQM A;  2EOY A;  2V89 A;  4F9B B;  5AE3 A;  1WHQ A;  2LUQ A;  2DLQ A;  2KON A;  4GZN C;  4M2Z A;  2J7J A;  1IMU A;  3UK3 C;  3P1X A;  2DIX A;  1Z1B A;  5IXM B;  2VQF E;  1UN6 B;  2RS6 A;  2ODR D;  4JYA E;  5AAS A;  2FTX B;  5A6B A;  2CT1 A;  2JWO A;  2WBU A;  5LMU E;  1NCS A;  4WSG A;  5FLX C;  2EJ4 A;  2ODR C;  4YHH E;  2MDR A;  4X66 E;  1G2F C;  4K0K E;  2NUG A;  2EM4 A;  3KZY A;  4X65 E;  4WSP A;  3BF2 A;  1ZR9 A;  2YTF A;  4WX9 A;  2YTE A;  1A1L A;  2UUA E;  3BID A;  4JI0 E;  1RMD A;  2VRD A;  3HQ1 A;  4JI1 E;  3J80 C;  4BMJ A;  2H36 X;  3MHS C;  2EOH A;  2L3C A;  2MKD A;  2UXD E;  3THO B;  3IWC A;  3IWB A;  5IV8 B;  2RTX A;  5A69 A;  4F9A B;  4FK5 C;  1FKA E;  2YPN A;  4WFT A;  2LE2 A;  1T4O A;  5F3W A;  5CFF E;  3FIG A;  1YSA C;  2DGC A;  1IQS A;  2E1M A;  4B3S E;  2YTD A;  2EL4 A;  2LTS A;  2LBS B;  1IBK E;  5IT9 C;  4GKK E;  4NXM E;  5BR8 E;  1ZBQ A;  1WJP A;  2MKN A;  2V88 A;  4ZYH A;  2L2K B;  2UXC E;  2EPK X;  2E72 A;  1A1G A;  4LF7 E;  3IWD A;  1XNR E;  1I94 E;  5IWA E;  4J8Z A;  2V8Q B;  2NA2 A;  4B3T E;  1N3G A;  2L2M A;  3MSW A;  3ECR A;  2JYA A;  1IQO A;  2L92 A;  1A1J A;  4O24 A;  1T38 A;  2A25 A;  2JOB A;  4X62 E;  4ZYE A;  5LLQ A;  4NXN E;  1N36 E;  1DGC A;  4RHB B;  2L6M A;  2N3G A;  2EOF A;  1EH7 A;  5TSE A;  4IJD A;  1L4S A;  2DLK A;  2V85 A;  4O43 A;  2EMZ A;  1J26 A;  4LTY A;  2KOU A;  2M4I A;  4GKJ E;  2EM8 A;  3C6K A;  4LF4 E;  1X49 A;  2YRK A;  3JU0 A;  4LFB E;  4YY3 E;  4DV1 E;  4DMI A;  2B7V A;  3QG5 C;  1AAY A;  4BC7 A;  2JPA A;  2YRM A;  3ADJ A;  5KL5 A;  2B9D A;  2NUF A;  3VHT B;  2EMW A;  2JOX A;  4LFA E;  2D9H A;  4KZS A;  5LMN E;  1JK1 A;  2DB2 A;  1QNT A;  2WBS A;  4KWY A;  2YTO A;  4TUI A;  2LJH A;  3THN A;  2EOZ A;  4DR1 E;  4DV7 E;  3H09 A;  1PDA A;  2V87 A;  4DKK A;  4R2D A;  5ADZ A;  4JI8 E;  2EOJ A;  2ENH A; 
#chains in the Genus database with same CATH homology
 1ZAA C;  2YTN A;  1ZR9 A;  2EOS A;  2YTF A;  1X6F A;  2YTE A;  1A1L A;  5KL2 A;  1RMD A;  2VRD A;  1A1H A;  2EPP A;  3EPJ A;  2EMG A;  1X6E A;  4R2P A;  3MHH C;  1TF3 A;  4M9V C;  3EPH A;  2EQ1 A;  2EPU A;  3MHS C;  2LT7 A;  2EOH A;  2YSO A;  2EOO A;  2YSP A;  2YTJ A;  2EN6 A;  2MKD A;  5KL7 A;  4R2E A;  2EM9 A;  2EPC A;  4R2Q A;  2MDG A;  1X6H A;  2YTI A;  1YUJ A;  4FK5 C;  2EL5 A;  4R2C A;  2ENA A;  1P47 A;  2RSI A;  2LCE A;  1YSA C;  2DGC A;  1B69 A;  2NAB A;  2EOR A;  2ENC A;  1X3C A;  2YTD A;  2EL4 A;  2YTP A;  2JP9 A;  2EML A;  2EQ0 A;  2YTQ A;  4R2A A;  3EPL A;  2WCC 3;  2LVH A;  2YRH A;  1WJP A;  2EMI A;  2MKN A;  2EN2 A;  1A1I A;  2E72 A;  2EOE A;  2WBT A;  1A1G A;  4IS1 C;  1F2I G;  2EM2 A;  2EOM A;  2EMH A;  1KJK A;  2EN7 A;  2DMI A;  1MEY C;  2EMX A;  2M9A A;  2EN4 A;  1BBO A;  2YU8 A;  2EQ3 A;  4X9J A;  2EMC A;  2EN1 A;  1A1F A;  1A1J A;  2HGH A;  2EOQ A;  2GLI A;  2EM5 A;  2EPX A;  2A25 A;  5KL6 A;  1TN9 A;  2EN8 A;  2LO3 A;  4R2R A;  1DGC A;  1ZU1 A;  2CTD A;  2EOF A;  2EN3 A;  2RPC A;  2EP3 A;  2YTG A;  2EM7 A;  2EL6 A;  4IJD A;  1A1K A;  1X5W A;  2DLK A;  1TF6 A;  1BB8 A;  2BB8 A;  4F6N A;  2ELY A;  2EMA A;  2EMZ A;  2EOY A;  2EOI A;  1LLM C;  1JK2 A;  2EM8 A;  2EPZ A;  2YRK A;  3M99 B;  2EE8 A;  2PRT A;  2EPA A;  2EMK A;  2DLQ A;  4R2S A;  2EM6 A;  4GZN C;  2EMY A;  2EOX A;  4F2J C;  1AAY A;  2EM3 A;  2JPA A;  2J7J A;  2EMF A;  1G2D C;  2R1F A;  2YRM A;  5KL5 A;  2ELZ A;  3UK3 C;  2GHF A;  1Z1B A;  2EMB A;  2YU5 A;  1UBD C;  1UN6 B;  3VHT B;  2EMW A;  2D9H A;  2CT1 A;  2WBU A;  5KL3 A;  1JK1 A;  2ADR A;  1NCS A;  4WSG A;  2EM0 A;  2I13 A;  2WBS A;  2YTO A;  3EPK A;  5KL4 A;  2EOZ A;  2EJ4 A;  1G2F C;  2LV2 A;  2DRP A;  2EPR A;  1YUI A;  4R2D A;  2CSH A;  4F6M A;  2EOJ A;  2ENH A;  2EM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...