2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
2EE8A 2EPRA 2EQ3A 2EMAA 1LLMC 2RSIA 2GLIA 2LO3A 2YU8A 4R2SA 2EPPA 4IJDA 4R2PA 2EOYA 5KL4A 2LVHA 2YRMA 2ELZA 2EM0A 4F6MA 1A1FA 1MEYC 2JPAA 2DRPA 1DGCA 2EN8A 2PRTA 2YTFA 2EMZA 2EN1A 1G2FC 1B69A 2EM9A 1X3CA 1X6HA 2EOJA 3M99B 2LV2A 2YTDA 2EMGA 2YTGA 4WSGA 2YSOA 2ENHA 2EM4A 1ZR9A 2ELYA 2YTIA 2EMIA 2EPZA 2EQ1A 2YTJA 1NCSA 1A1HA 1A1IA 1Z1BA 2EMHA 2EMXA 1X5WA 2I13A 2MKNA 2WBUA 2EN7A 2YTPA 2ENCA 1X6FA 2EOIA 5KL3A 2EMBA 4M9VC 2YRKA 2EM8A 2EM6A 4R2DA 2YRHA 4FK5C 3EPJA 3EPHA 4R2RA 1G2DC 2EPAA 2BB8A 2CSHA 2EM7A 3EPKA 2YTNA 1KJKA 2YU5A 2EPCA 2DLKA 2EM3A 2EM5A 2EOMA 2R1FA 2VRDA 3UK3C 3MHHC 2YTEA 2EN4A 2WBTA 1A1GA 1A1LA 2LT7A 1YUJA 2EPXA 1UN6B 2MDGA 1ZAAC 2D9HA 2EMYA 3VHTB 1ZU1A 1F2IG 4R2QA 1YSAC 4R2AA 1TF3A 1TN9A 2YTOA 2EMFA 1AAYA 2HGHA 4F6NA 2DGCA 3EPLA 4F2JC 5KL7A 1A1KA 1BB8A 2E72A 2RPCA 2CTDA 2EN3A 2J7JA 1JK1A 1TF6A 2EN6A 2WBSA 2WCC3 2EOSA 4IS1C 3MHSC 1BBOA 2EOXA 1A1JA 2EL5A 1X6EA 2EOZA 5KL6A 1JK2A 4R2CA 2JP9A 2YTQA 2EM2A 2MKDA 2GHFA 2EMLA 2EMCA 2EOFA 5KL2A 4X9JA 1P47A 2EORA 1YUIA 2DMIA 2CT1A 2DLQA 2EL4A 2EOHA 2A25A 2EOOA 2LCEA 1WJPA 2YSPA 5KL5A 1UBDC 2EL6A 2ENAA 2EJ4A 2EP3A 2NABA 2EMKA 4GZNC 2EN2A 2EOEA 2EPUA 2EMWA 1RMDA 2M9AA 4R2EA 2EOQA 2ADRA 2EQ0A
chains in the Genus database with same CATH superfamily
1WRJA 2EMAA 2RSIA 1WXRA 2GLIA 1N36E 2LO3A 2LBSB 3RMPA 4R2PA 1GZ6A 4I8OA 2ELZA 2LJHA 4DR3E 1YYWA 5AASA 2UUAE 2L3JA 5A6BA 2DB2A 2VQEE 2FTXB 3HPSA 1B69A 2JYAA 2EM9A 4DV7E 1HNZE 3M99B 3P1XA 2E1MA 2LV2A 1T39A 4JYAE 4DV3E 1ZR9A 2ELYA 2GPIA 2EMHA 3LMLA 5T6JA 3C6KA 5TSEA 2I13A 2MKNA 2L6MA 2FGGA 4Q35B 4NZVA 4LU9A 4BCAA 2EM8A 4GKJE 4R2DA 5AE2A 3KZYA 5A2QC 3EPJA 3HTXA 2B3TB 2VQFE 4BHBA 2L2NA 2YTNA 3K6QA 1KJKA 2LMZA 4BBYA 2DLKA 2K4VA 5FLXC 1N34E 4K0KE 2EM5A 3VYYA 2VRDA 3UK3C 1BBGA 3MHHC 2JY9A 2LT7A 2EPXA 1YFHA 4JV5E 1EH6A 2V85A 3LLHA 1SFEA 5IT9C 2L8TA 5CFFE 2Q8UA 2L33A 4DR7E 1YSAC 2LE2A 1TF3A 2HHHE 3JAMC 3J7AG 2EMFA 3JU0A 4YHHE 1AAYA 3T1HE 3BIDA 4F2JC 1NEIA 3T1YE 1A1KA 2DGCA 4JI4E 2J7JA 4DUZE 4LF6E 2RS7A 2WCC3 2VE7C 3MHSC 2YWQA 3J80C 4R2CA 2UXCE 4JI2E 2EMCA 1YZ9A 4X65E 1IBKE 2DLQA 3KWRA 1GTKA 2YSPA 4BHCA 2LCEA 4DR5E 4GZNC 2EOEA 2M1SA 1PJTA 4O43A 1PKPA 2EQ0A 2LTSA 2CPNA 2EPRA 4WPYA 2EQ3A 1YYOA 1DQ3A 2YU8A 5IWAE 4R2SA 3ECRA 1J5EE 2LTRA 1FJGE 1SR9A 2MDRA 4DKKA 4DV6E 2KONA 4F6MA 4BMJA 3F6HA 2F4VE 2RSMA 2EMZA 2EN1A 5AC4A 3THNA 4F9AB 2B9DA 4RH8A 2M4IA 1IQSA 1YYKA 2LUPB 1WHNA 2YTGA 4M30A 3C4BA 2M7QA 1XNRE 4LF4E 2EPZA 2V87A 2EQ1A 4LFAE 1NCSA 1A1HA 3THOB 1IBLE 4J8ZA 1X5WA 2B7TA 4HEIA 4F9BB 3HXLA 2ZM6E 2ENCA 1X6FA 5IV8B 2RS6A 3HQ1A 5A6JA 4O5GA 4DV5E 2N8XA 4FK5C 1N32E 1FKAE 4B3RE 4R8OA 5LMUE 4KHPE 2EWLA 1PJSA 2EOMA 4BS9A 2BBGA 5LL6R 1UILA 2EN4A 2EPMX 1X49A 2VF1A 4WYQB 3HPZA 2MDGA 1ZAAC 2KHXA 1KYQA 2EMYA 1ZU1A 2YPNA 2JOBA 4R2AA 1TN9A 2YTOA 4JI7E 3EQ1A 3EPLA 2E72A 2EPNA 1TF6A 1UHZA 2EN3A 1JK1A 2UU9E 4X62E 3MSWA 3VK6A 1A1JA 1T4OA 2EL5A 2N3GA 5KL6A 1HNXE 4JI1E 2JP9A 5BR8E 1T38A 2DMYA 2JXPA 5IXMB 2EOFA 3IWDA 4X9JA 1HR0E 1P47A 4N4RB 4DUYE 2EORA 1WHQA 2F8BA 5ADZA 1YUIA 3F6GA 4F54A 2EOHA 1IBME 3BGHA 2L2KB 3J7Yp 3ADGA 2ENAA 4ZYEA 4B3SE 4BC7A 2EN2A 2EPOA 2EMWA 2EOQA 2V86A 4Q28A 2MC5A 1LLMC 2JOXA 4B3TE 1AH5A 4ZYDA 5A6KA 4JI3E 1I94E 3OTOE 5KL4A 4X66E 2LVHA 4OOGC 1XMOE 1A1FA 2JVAA 2JPAA 2MC6A 4P78A 1DGCA 2EN8A 2PRTA 2YTFA 5AE1A 4LTYA 4TUGA 4KWYA 1STUA 2L92A 2E5LE 4DR1E 2EMGA 4M0VA 4WSGA 3ADIA 2KOUA 2EM4A 1YPNA 1IMUA 5LLQA 1A1IA 4NXME 1Z1BA 4DV4E 5F3WA 4DMIA 4JI5E 2HJJA 3OMLA 1T4NA 2WBUA 2EN7A 2YTPA 4M2ZA 4ZYHA 1J26A 2EOIA 5KL3A 2EMBA 4WXDA 2ODRD 2YRKA 4WFTA 2NUEA 2B7VA 3EPHA 4JI6E 2EPAA 2BB8A 2CSHA 4LFBE 5DNYA 5LMNE 4R03A 1O0WA 1IQOA 4NXNE 3C4TA 2DSYA 4DR2E 4L8NA 2EM3A 4DR6E 2R1FA 2NUFA 4LFCE 2YTEA 4F9CB 1A1GA 4MLVA 1YUJA 3H09A 4NHRA 4JI8E 4JI0E 2EPKX 4LF5E 2D9HA 4O4KA 3JTZA 3VHTB 4DV0E 2UUCE 2L2MA 4R2QA 1X47A 1ZBTA 2HGHA 4F6NA 2G7HA 4X8WA 1RC7A 5KL7A 2CTDA 2L3CA 2V89A 3TQMA 4IS1C 1N33E 4O24A 2EOXA 3J81C 1X6EA 2EOZA 2NA2A 3ADLA 2MKDA 2GHFA 2EMLA 4DV2E 1XNQE 2UUBE 5A6BD 2WZOA 2EOOA 5A6AA 1DI2A 2EJ4A 4OX9E 2EP3A 4L5NC 2UXDE 1ZBQA 2EMKA 2M9AA 4R2EA 1RMDA 3IWCA 2ADRA 1JK2A 2EE8A 1EKZA 2YZTA 1GQEA 4GEQB 3FIGA 3BBGA 2EPPA 1N3GA 4IJDA 2EOYA 2YRMA 2JR1A 2EM0A 3QG5C 4AQYE 1MEYC 3IWBA 2DRPA 4RHBB 1G2FC 1X3CA 2JWOA 2YT4A 2LUQA 3C6MA 1X6HA 2EOJA 2YTDA 2V8QB 4WX9A 3AUZA 1XMQE 2YSOA 2ENHA 2FV4B 1RQ0A 2YTIA 2EMIA 2YTJA 1T4LB 1EH8A 2RQLA 2EMXA 4LF8E 4LF7E 2EZ6A 2LJUA 2IHR1 4GKKE 4HTGA 4DR4E 4P7DA 4M9VC 5AC5A 2EM6A 2YRHA 2ODRC 4R2RA 1G2DC 3KZZA 2H36X 2EM7A 2I9IA 5A69A 3EPKA 4BC9A 2YU5A 3BF2A 3DJWA 4TUIA 3VYXA 2EPCA 2NUGA 3ADJA 2EPLX 2LRSA 1MGTA 2WBTA 1A1LA 3ZOQB 1UN6B 1EH7A 4YY3E 2V88A 2K7IA 4WSPA 1PJQA 2R76A 1PDAA 4WXCA 2RTXA 1F2IG 1HNWE 2N3HA 4X64E 1BB8A 2RPCA 1L4SA 2EN6A 2WBSA 2EOSA 1BBOA 5AE3A 1QU6A 2V83A 2EM2A 2YTQA 4ZYGA 5KL2A 2DIXA 3AV0A 2DMIA 2CT1A 2EL4A 4MLQA 2A25A 1QNTA 1WJPA 5KL5A 1UBDC 4DV1E 3DF6A 4LF9E 2UXBE 1X48A 2EL6A 2NABA 4B3ME 4KZSA 3L00A 2EPUA 2HC5A
chains in the Genus database with same CATH topology
2EE8A 2EPRA 2EQ3A 2EMAA 1LLMC 2RSIA 2GLIA 2LO3A 2YU8A 4R2SA 2EPPA 4IJDA 4R2PA 2EOYA 5KL4A 2LVHA 2YRMA 2ELZA 2EM0A 4F6MA 1A1FA 1MEYC 2JPAA 2DRPA 1DGCA 2EN8A 2PRTA 2YTFA 2EMZA 2EN1A 1G2FC 1B69A 2EM9A 1X3CA 1X6HA 2EOJA 3M99B 2LV2A 2YTDA 2EMGA 2YTGA 4WSGA 2YSOA 2ENHA 2EM4A 1ZR9A 2ELYA 2YTIA 2EMIA 2EPZA 2EQ1A 2YTJA 1NCSA 1A1HA 1A1IA 1Z1BA 2EMHA 2EMXA 1X5WA 2I13A 2MKNA 2WBUA 2EN7A 2YTPA 2ENCA 1X6FA 2EOIA 5KL3A 2EMBA 4M9VC 2YRKA 2EM8A 2EM6A 4R2DA 2YRHA 4FK5C 3EPJA 3EPHA 4R2RA 1G2DC 2EPAA 2BB8A 2CSHA 2EM7A 3EPKA 2YTNA 1KJKA 2YU5A 2EPCA 2DLKA 2EM3A 2EM5A 2EOMA 2R1FA 2VRDA 3UK3C 3MHHC 2YTEA 2EN4A 2WBTA 1A1GA 1A1LA 2LT7A 1YUJA 2EPXA 1UN6B 2MDGA 1ZAAC 2D9HA 2EMYA 3VHTB 1ZU1A 1F2IG 4R2QA 1YSAC 4R2AA 1TF3A 1TN9A 2YTOA 2EMFA 1AAYA 2HGHA 4F6NA 2DGCA 3EPLA 4F2JC 5KL7A 1A1KA 1BB8A 2E72A 2RPCA 2CTDA 2EN3A 2J7JA 1JK1A 1TF6A 2EN6A 2WBSA 2WCC3 2EOSA 4IS1C 3MHSC 1BBOA 2EOXA 1A1JA 2EL5A 1X6EA 2EOZA 5KL6A 1JK2A 4R2CA 2JP9A 2YTQA 2EM2A 2MKDA 2GHFA 2EMLA 2EMCA 2EOFA 5KL2A 4X9JA 1P47A 2EORA 1YUIA 2DMIA 2CT1A 2DLQA 2EL4A 2EOHA 2A25A 2EOOA 2LCEA 1WJPA 2YSPA 5KL5A 1UBDC 2EL6A 2ENAA 2EJ4A 2EP3A 2NABA 2EMKA 4GZNC 2EN2A 2EOEA 2EPUA 2EMWA 1RMDA 2M9AA 4R2EA 2EOQA 2ADRA 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE8 A;  2EPR A;  2EQ3 A;  2EMA A;  1LLM C;  2RSI A;  2GLI A;  2LO3 A;  2YU8 A;  4R2S A;  2EPP A;  4IJD A;  4R2P A;  2EOY A;  5KL4 A;  2LVH A;  2YRM A;  2ELZ A;  2EM0 A;  4F6M A;  1A1F A;  1MEY C;  2JPA A;  2DRP A;  1DGC A;  2EN8 A;  2PRT A;  2YTF A;  2EMZ A;  2EN1 A;  1G2F C;  1B69 A;  2EM9 A;  1X3C A;  1X6H A;  2EOJ A;  3M99 B;  2LV2 A;  2YTD A;  2EMG A;  2YTG A;  4WSG A;  2YSO A;  2ENH A;  2EM4 A;  1ZR9 A;  2ELY A;  2YTI A;  2EMI A;  2EPZ A;  2EQ1 A;  2YTJ A;  1NCS A;  1A1H A;  1A1I A;  1Z1B A;  2EMH A;  2EMX A;  1X5W A;  2I13 A;  2MKN A;  2WBU A;  2EN7 A;  2YTP A;  2ENC A;  1X6F A;  2EOI A;  5KL3 A;  2EMB A;  4M9V C;  2YRK A;  2EM8 A;  2EM6 A;  4R2D A;  2YRH A;  4FK5 C;  3EPJ A;  3EPH A;  4R2R A;  1G2D C;  2EPA A;  2BB8 A;  2CSH A;  2EM7 A;  3EPK A;  2YTN A;  1KJK A;  2YU5 A;  2EPC A;  2DLK A;  2EM3 A;  2EM5 A;  2EOM A;  2R1F A;  2VRD A;  3UK3 C;  3MHH C;  2YTE A;  2EN4 A;  2WBT A;  1A1G A;  1A1L A;  2LT7 A;  1YUJ A;  2EPX A;  1UN6 B;  2MDG A;  1ZAA C;  2D9H A;  2EMY A;  3VHT B;  1ZU1 A;  1F2I G;  4R2Q A;  1YSA C;  4R2A A;  1TF3 A;  1TN9 A;  2YTO A;  2EMF A;  1AAY A;  2HGH A;  4F6N A;  2DGC A;  3EPL A;  4F2J C;  5KL7 A;  1A1K A;  1BB8 A;  2E72 A;  2RPC A;  2CTD A;  2EN3 A;  2J7J A;  1JK1 A;  1TF6 A;  2EN6 A;  2WBS A;  2WCC 3;  2EOS A;  4IS1 C;  3MHS C;  1BBO A;  2EOX A;  1A1J A;  2EL5 A;  1X6E A;  2EOZ A;  5KL6 A;  1JK2 A;  4R2C A;  2JP9 A;  2YTQ A;  2EM2 A;  2MKD A;  2GHF A;  2EML A;  2EMC A;  2EOF A;  5KL2 A;  4X9J A;  1P47 A;  2EOR A;  1YUI A;  2DMI A;  2CT1 A;  2DLQ A;  2EL4 A;  2EOH A;  2A25 A;  2EOO A;  2LCE A;  1WJP A;  2YSP A;  5KL5 A;  1UBD C;  2EL6 A;  2ENA A;  2EJ4 A;  2EP3 A;  2NAB A;  2EMK A;  4GZN C;  2EN2 A;  2EOE A;  2EPU A;  2EMW A;  1RMD A;  2M9A A;  4R2E A;  2EOQ A;  2ADR A;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 1WRJ A;  2EMA A;  2RSI A;  1WXR A;  2GLI A;  1N36 E;  2LO3 A;  2LBS B;  3RMP A;  4R2P A;  1GZ6 A;  4I8O A;  2ELZ A;  2LJH A;  4DR3 E;  1YYW A;  5AAS A;  2UUA E;  2L3J A;  5A6B A;  2DB2 A;  2VQE E;  2FTX B;  3HPS A;  1B69 A;  2JYA A;  2EM9 A;  4DV7 E;  1HNZ E;  3M99 B;  3P1X A;  2E1M A;  2LV2 A;  1T39 A;  4JYA E;  4DV3 E;  1ZR9 A;  2ELY A;  2GPI A;  2EMH A;  3LML A;  5T6J A;  3C6K A;  5TSE A;  2I13 A;  2MKN A;  2L6M A;  2FGG A;  4Q35 B;  4NZV A;  4LU9 A;  4BCA A;  2EM8 A;  4GKJ E;  4R2D A;  5AE2 A;  3KZY A;  5A2Q C;  3EPJ A;  3HTX A;  2B3T B;  2VQF E;  4BHB A;  2L2N A;  2YTN A;  3K6Q A;  1KJK A;  2LMZ A;  4BBY A;  2DLK A;  2K4V A;  5FLX C;  1N34 E;  4K0K E;  2EM5 A;  3VYY A;  2VRD A;  3UK3 C;  1BBG A;  3MHH C;  2JY9 A;  2LT7 A;  2EPX A;  1YFH A;  4JV5 E;  1EH6 A;  2V85 A;  3LLH A;  1SFE A;  5IT9 C;  2L8T A;  5CFF E;  2Q8U A;  2L33 A;  4DR7 E;  1YSA C;  2LE2 A;  1TF3 A;  2HHH E;  3JAM C;  3J7A G;  2EMF A;  3JU0 A;  4YHH E;  1AAY A;  3T1H E;  3BID A;  4F2J C;  1NEI A;  3T1Y E;  1A1K A;  2DGC A;  4JI4 E;  2J7J A;  4DUZ E;  4LF6 E;  2RS7 A;  2WCC 3;  2VE7 C;  3MHS C;  2YWQ A;  3J80 C;  4R2C A;  2UXC E;  4JI2 E;  2EMC A;  1YZ9 A;  4X65 E;  1IBK E;  2DLQ A;  3KWR A;  1GTK A;  2YSP A;  4BHC A;  2LCE A;  4DR5 E;  4GZN C;  2EOE A;  2M1S A;  1PJT A;  4O43 A;  1PKP A;  2EQ0 A;  2LTS A;  2CPN A;  2EPR A;  4WPY A;  2EQ3 A;  1YYO A;  1DQ3 A;  2YU8 A;  5IWA E;  4R2S A;  3ECR A;  1J5E E;  2LTR A;  1FJG E;  1SR9 A;  2MDR A;  4DKK A;  4DV6 E;  2KON A;  4F6M A;  4BMJ A;  3F6H A;  2F4V E;  2RSM A;  2EMZ A;  2EN1 A;  5AC4 A;  3THN A;  4F9A B;  2B9D A;  4RH8 A;  2M4I A;  1IQS A;  1YYK A;  2LUP B;  1WHN A;  2YTG A;  4M30 A;  3C4B A;  2M7Q A;  1XNR E;  4LF4 E;  2EPZ A;  2V87 A;  2EQ1 A;  4LFA E;  1NCS A;  1A1H A;  3THO B;  1IBL E;  4J8Z A;  1X5W A;  2B7T A;  4HEI A;  4F9B B;  3HXL A;  2ZM6 E;  2ENC A;  1X6F A;  5IV8 B;  2RS6 A;  3HQ1 A;  5A6J A;  4O5G A;  4DV5 E;  2N8X A;  4FK5 C;  1N32 E;  1FKA E;  4B3R E;  4R8O A;  5LMU E;  4KHP E;  2EWL A;  1PJS A;  2EOM A;  4BS9 A;  2BBG A;  5LL6 R;  1UIL A;  2EN4 A;  2EPM X;  1X49 A;  2VF1 A;  4WYQ B;  3HPZ A;  2MDG A;  1ZAA C;  2KHX A;  1KYQ A;  2EMY A;  1ZU1 A;  2YPN A;  2JOB A;  4R2A A;  1TN9 A;  2YTO A;  4JI7 E;  3EQ1 A;  3EPL A;  2E72 A;  2EPN A;  1TF6 A;  1UHZ A;  2EN3 A;  1JK1 A;  2UU9 E;  4X62 E;  3MSW A;  3VK6 A;  1A1J A;  1T4O A;  2EL5 A;  2N3G A;  5KL6 A;  1HNX E;  4JI1 E;  2JP9 A;  5BR8 E;  1T38 A;  2DMY A;  2JXP A;  5IXM B;  2EOF A;  3IWD A;  4X9J A;  1HR0 E;  1P47 A;  4N4R B;  4DUY E;  2EOR A;  1WHQ A;  2F8B A;  5ADZ A;  1YUI A;  3F6G A;  4F54 A;  2EOH A;  1IBM E;  3BGH A;  2L2K B;  3J7Y p;  3ADG A;  2ENA A;  4ZYE A;  4B3S E;  4BC7 A;  2EN2 A;  2EPO A;  2EMW A;  2EOQ A;  2V86 A;  4Q28 A;  2MC5 A;  1LLM C;  2JOX A;  4B3T E;  1AH5 A;  4ZYD A;  5A6K A;  4JI3 E;  1I94 E;  3OTO E;  5KL4 A;  4X66 E;  2LVH A;  4OOG C;  1XMO E;  1A1F A;  2JVA A;  2JPA A;  2MC6 A;  4P78 A;  1DGC A;  2EN8 A;  2PRT A;  2YTF A;  5AE1 A;  4LTY A;  4TUG A;  4KWY A;  1STU A;  2L92 A;  2E5L E;  4DR1 E;  2EMG A;  4M0V A;  4WSG A;  3ADI A;  2KOU A;  2EM4 A;  1YPN A;  1IMU A;  5LLQ A;  1A1I A;  4NXM E;  1Z1B A;  4DV4 E;  5F3W A;  4DMI A;  4JI5 E;  2HJJ A;  3OML A;  1T4N A;  2WBU A;  2EN7 A;  2YTP A;  4M2Z A;  4ZYH A;  1J26 A;  2EOI A;  5KL3 A;  2EMB A;  4WXD A;  2ODR D;  2YRK A;  4WFT A;  2NUE A;  2B7V A;  3EPH A;  4JI6 E;  2EPA A;  2BB8 A;  2CSH A;  4LFB E;  5DNY A;  5LMN E;  4R03 A;  1O0W A;  1IQO A;  4NXN E;  3C4T A;  2DSY A;  4DR2 E;  4L8N A;  2EM3 A;  4DR6 E;  2R1F A;  2NUF A;  4LFC E;  2YTE A;  4F9C B;  1A1G A;  4MLV A;  1YUJ A;  3H09 A;  4NHR A;  4JI8 E;  4JI0 E;  2EPK X;  4LF5 E;  2D9H A;  4O4K A;  3JTZ A;  3VHT B;  4DV0 E;  2UUC E;  2L2M A;  4R2Q A;  1X47 A;  1ZBT A;  2HGH A;  4F6N A;  2G7H A;  4X8W A;  1RC7 A;  5KL7 A;  2CTD A;  2L3C A;  2V89 A;  3TQM A;  4IS1 C;  1N33 E;  4O24 A;  2EOX A;  3J81 C;  1X6E A;  2EOZ A;  2NA2 A;  3ADL A;  2MKD A;  2GHF A;  2EML A;  4DV2 E;  1XNQ E;  2UUB E;  5A6B D;  2WZO A;  2EOO A;  5A6A A;  1DI2 A;  2EJ4 A;  4OX9 E;  2EP3 A;  4L5N C;  2UXD E;  1ZBQ A;  2EMK A;  2M9A A;  4R2E A;  1RMD A;  3IWC A;  2ADR A;  1JK2 A;  2EE8 A;  1EKZ A;  2YZT A;  1GQE A;  4GEQ B;  3FIG A;  3BBG A;  2EPP A;  1N3G A;  4IJD A;  2EOY A;  2YRM A;  2JR1 A;  2EM0 A;  3QG5 C;  4AQY E;  1MEY C;  3IWB A;  2DRP A;  4RHB B;  1G2F C;  1X3C A;  2JWO A;  2YT4 A;  2LUQ A;  3C6M A;  1X6H A;  2EOJ A;  2YTD A;  2V8Q B;  4WX9 A;  3AUZ A;  1XMQ E;  2YSO A;  2ENH A;  2FV4 B;  1RQ0 A;  2YTI A;  2EMI A;  2YTJ A;  1T4L B;  1EH8 A;  2RQL A;  2EMX A;  4LF8 E;  4LF7 E;  2EZ6 A;  2LJU A;  2IHR 1;  4GKK E;  4HTG A;  4DR4 E;  4P7D A;  4M9V C;  5AC5 A;  2EM6 A;  2YRH A;  2ODR C;  4R2R A;  1G2D C;  3KZZ A;  2H36 X;  2EM7 A;  2I9I A;  5A69 A;  3EPK A;  4BC9 A;  2YU5 A;  3BF2 A;  3DJW A;  4TUI A;  3VYX A;  2EPC A;  2NUG A;  3ADJ A;  2EPL X;  2LRS A;  1MGT A;  2WBT A;  1A1L A;  3ZOQ B;  1UN6 B;  1EH7 A;  4YY3 E;  2V88 A;  2K7I A;  4WSP A;  1PJQ A;  2R76 A;  1PDA A;  4WXC A;  2RTX A;  1F2I G;  1HNW E;  2N3H A;  4X64 E;  1BB8 A;  2RPC A;  1L4S A;  2EN6 A;  2WBS A;  2EOS A;  1BBO A;  5AE3 A;  1QU6 A;  2V83 A;  2EM2 A;  2YTQ A;  4ZYG A;  5KL2 A;  2DIX A;  3AV0 A;  2DMI A;  2CT1 A;  2EL4 A;  4MLQ A;  2A25 A;  1QNT A;  1WJP A;  5KL5 A;  1UBD C;  4DV1 E;  3DF6 A;  4LF9 E;  2UXB E;  1X48 A;  2EL6 A;  2NAB A;  4B3M E;  4KZS A;  3L00 A;  2EPU A;  2HC5 A; 
#chains in the Genus database with same CATH homology
 2EE8 A;  2EPR A;  2EQ3 A;  2EMA A;  1LLM C;  2RSI A;  2GLI A;  2LO3 A;  2YU8 A;  4R2S A;  2EPP A;  4IJD A;  4R2P A;  2EOY A;  5KL4 A;  2LVH A;  2YRM A;  2ELZ A;  2EM0 A;  4F6M A;  1A1F A;  1MEY C;  2JPA A;  2DRP A;  1DGC A;  2EN8 A;  2PRT A;  2YTF A;  2EMZ A;  2EN1 A;  1G2F C;  1B69 A;  2EM9 A;  1X3C A;  1X6H A;  2EOJ A;  3M99 B;  2LV2 A;  2YTD A;  2EMG A;  2YTG A;  4WSG A;  2YSO A;  2ENH A;  2EM4 A;  1ZR9 A;  2ELY A;  2YTI A;  2EMI A;  2EPZ A;  2EQ1 A;  2YTJ A;  1NCS A;  1A1H A;  1A1I A;  1Z1B A;  2EMH A;  2EMX A;  1X5W A;  2I13 A;  2MKN A;  2WBU A;  2EN7 A;  2YTP A;  2ENC A;  1X6F A;  2EOI A;  5KL3 A;  2EMB A;  4M9V C;  2YRK A;  2EM8 A;  2EM6 A;  4R2D A;  2YRH A;  4FK5 C;  3EPJ A;  3EPH A;  4R2R A;  1G2D C;  2EPA A;  2BB8 A;  2CSH A;  2EM7 A;  3EPK A;  2YTN A;  1KJK A;  2YU5 A;  2EPC A;  2DLK A;  2EM3 A;  2EM5 A;  2EOM A;  2R1F A;  2VRD A;  3UK3 C;  3MHH C;  2YTE A;  2EN4 A;  2WBT A;  1A1G A;  1A1L A;  2LT7 A;  1YUJ A;  2EPX A;  1UN6 B;  2MDG A;  1ZAA C;  2D9H A;  2EMY A;  3VHT B;  1ZU1 A;  1F2I G;  4R2Q A;  1YSA C;  4R2A A;  1TF3 A;  1TN9 A;  2YTO A;  2EMF A;  1AAY A;  2HGH A;  4F6N A;  2DGC A;  3EPL A;  4F2J C;  5KL7 A;  1A1K A;  1BB8 A;  2E72 A;  2RPC A;  2CTD A;  2EN3 A;  2J7J A;  1JK1 A;  1TF6 A;  2EN6 A;  2WBS A;  2WCC 3;  2EOS A;  4IS1 C;  3MHS C;  1BBO A;  2EOX A;  1A1J A;  2EL5 A;  1X6E A;  2EOZ A;  5KL6 A;  1JK2 A;  4R2C A;  2JP9 A;  2YTQ A;  2EM2 A;  2MKD A;  2GHF A;  2EML A;  2EMC A;  2EOF A;  5KL2 A;  4X9J A;  1P47 A;  2EOR A;  1YUI A;  2DMI A;  2CT1 A;  2DLQ A;  2EL4 A;  2EOH A;  2A25 A;  2EOO A;  2LCE A;  1WJP A;  2YSP A;  5KL5 A;  1UBD C;  2EL6 A;  2ENA A;  2EJ4 A;  2EP3 A;  2NAB A;  2EMK A;  4GZN C;  2EN2 A;  2EOE A;  2EPU A;  2EMW A;  1RMD A;  2M9A A;  4R2E A;  2EOQ A;  2ADR A;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...