2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
2EN8A 2EM5A 2EOJA 2EOXA 1TN9A 1MEYC 1NCSA 2EN6A 1B69A 2CT1A 2J7JA 1X5WA 2EORA 1F2IG 5KL2A 2YRKA 2EM4A 1UBDC 1ZR9A 2EOSA 4F6MA 1JK1A 2EL6A 2EMAA 2EMGA 3M99B 5KL6A 2LVHA 2YTJA 2EOIA 4WSGA 2EOHA 1KJKA 2YTDA 2EOYA 2EPZA 4X9JA 2CTDA 1RMDA 2YRMA 2LCEA 4M9VC 2DGCA 2ELZA 2EM7A 2EPXA 2LV2A 2EOEA 1YUIA 2EM3A 4R2CA 1BBOA 2YTPA 2YTFA 4GZNC 1ZAAC 2EMXA 1TF3A 2EM8A 2EOOA 2ENAA 1A1JA 4R2QA 4R2PA 2RSIA 2YTNA 2ADRA 2YTIA 2VRDA 2I13A 4R2AA 2EM0A 2LT7A 1ZU1A 2EMWA 2EQ3A 2YTGA 1X6FA 1UN6B 4R2SA 1DGCA 2YTQA 2EQ1A 2YU8A 2EMBA 4FK5C 3UK3C 1BB8A 2CSHA 2EJ4A 2JP9A 2HGHA 2MDGA 2EM2A 2EMLA 2NABA 2EP3A 2MKDA 1LLMC 2DMIA 2EMFA 2WBSA 2YTEA 1A1HA 1A1KA 1G2DC 1YSAC 2YRHA 2EPPA 2EOZA 5KL3A 1A1LA 2EQ0A 2EN3A 1YUJA 1JK2A 2EMHA 2EN4A 4R2RA 4IJDA 2EPCA 1WJPA 2EMZA 1Z1BA 2EM9A 1A1FA 2DRPA 2DLQA 2GHFA 2EN7A 2WBUA 3MHHC 2E72A 3EPHA 2EE8A 2YSPA 1P47A 1A1IA 1X3CA 2PRTA 2ENCA 2YU5A 2ENHA 2EL5A 2EMYA 1G2FC 1TF6A 2EMIA 2YTOA 5KL7A 3VHTB 1A1GA 2EOMA 2EOQA 3EPLA 3EPJA 2JPAA 4R2DA 1AAYA 4F6NA 2EMCA 2EOFA 2EPRA 2RPCA 4IS1C 2D9HA 2EN2A 4F2JC 1X6EA 2EMKA 2EPAA 2EL4A 2M9AA 2DLKA 2EN1A 2R1FA 2WBTA 3MHSC 2GLIA 1X6HA 4R2EA 2WCC3 3EPKA 2EPUA 2ELYA 2BB8A 2LO3A 2A25A 2YSOA 5KL5A 2EM6A 2MKNA 5KL4A
chains in the Genus database with same CATH superfamily
2EN8A 1YYOA 1MEYC 1NCSA 4LTYA 1B69A 2F4VE 2CT1A 2LRSA 3JU0A 5TSEA 3LMLA 2L33A 4HEIA 2L2MA 5A2QC 5CFFE 3ADGA 4GKJE 4ZYEA 1ZR9A 2EMGA 4OOGC 2RSMA 4DV1E 2FTXB 4WXDA 2YTJA 2LTRA 3KZYA 2EOHA 2YTDA 4X9JA 5LLQA 2YRMA 4ZYGA 5A69A 4M9VC 2EM7A 4BC7A 5AE2A 2EOEA 1FKAE 1YUIA 3BGHA 2YTFA 2M4IA 4O5GA 1T39A 4JI2E 3L00A 1YPNA 4R2QA 1IBKE 2KHXA 2V83A 2ADRA 2LJUA 2YTIA 1XNRE 2V8QB 2EM0A 2DMYA 2BBGA 2EQ3A 4JI1E 2DSYA 4M0VA 2YU8A 2KONA 2VQEE 1IQSA 4FK5C 4X64E 1ZBQA 2MDGA 2K4VA 3VYYA 1O0WA 2EP3A 1YFHA 2MKDA 1I94E 1LLMC 1WHNA 2DMIA 4WPYA 5FLXC 1A1LA 5KL3A 2EQ0A 3DF6A 1PJQA 1YUJA 1WHQA 2EPOA 1JK2A 2UU9E 4ZYDA 4R2RA 3ADLA 1NEIA 4DV7E 2JR1A 4OX9E 5LMNE 3KWRA 1STUA 1DQ3A 4X65E 2DRPA 2GHFA 3THOB 2E72A 2RQLA 4X62E 2RTXA 4WFTA 2IHR1 2EL5A 4BMJA 2EMIA 5KL7A 3VHTB 1A1GA 4NXME 4WSPA 1T4LB 3HTXA 2MDRA 2WZOA 3JAMC 1WXRA 3TQMA 2EMCA 3C4TA 2RPCA 2HJJA 5T6JA 2N3GA 2V87A 4KWYA 4JI4E 4TUIA 2G7HA 4B3RE 2EN1A 5AC4A 4O4KA 2WBTA 3ADIA 4R2EA 2WCC3 1SR9A 2YSOA 3C6KA 2FGGA 3VYXA 2ODRC 4DR6E 5AASA 4YY3E 1KYQA 3DJWA 2UUAE 2LBSB 4WXCA 1F2IG 5KL2A 4JI8E 1L4SA 2N8XA 2EM4A 2EOSA 4F6MA 2EL6A 2EMAA 3M99B 5KL6A 4JI3E 1ZBTA 2EOIA 2RS7A 2FV4B 1KJKA 2EOYA 5LMUE 2EPZA 2L8TA 3AUZA 3THNA 2VQFE 1RMDA 5A6BD 4DR4E 2LUPB 2JOXA 2EPXA 4DMIA 4BBYA 3BF2A 1GQEA 3HPZA 4R2CA 5A6BA 2YZTA 2NA2A 4BCAA 1UHZA 2RSIA 2VRDA 2YT4A 3K6QA 4R2AA 4NXNE 3IWDA 4WYQB 2EPMX 2EMWA 2JY9A 1X6FA 1UN6B 4R2SA 4P7DA 3C4BA 5AE1A 5A6KA 4DV3E 1BB8A 5A6AA 4O24A 2JP9A 4BS9A 4DR3E 4BHCA 2NABA 3ECRA 2YPNA 2WBSA 1A1HA 1A1KA 3IWBA 2YRHA 4O43A 2LJHA 2EN3A 3KZZA 2UXBE 4J8ZA 2DB2A 2EPCA 2CPNA 1Z1BA 3IWCA 4ZYHA 2DLQA 5F3WA 2I9IA 2L92A 4M2ZA 2PRTA 2ENCA 2H36X 2ENHA 2DIXA 1TF6A 2YTOA 3EPLA 4JI5E 1DI2A 3FIGA 4X8WA 1AAYA 4BHBA 2D9HA 2UXCE 1X6EA 2EMKA 2EPAA 2L3JA 2EL4A 1GZ6A 2DLKA 2R1FA 4DUYE 4JI0E 4LFAE 1HNWE 2EPUA 2HC5A 1HNZE 2BB8A 4LFBE 2L6MA 5KL5A 5A6JA 5IV8B 4N4RB 2MKNA 1QNTA 2V88A 2EOJA 4DKKA 1PDAA 2J7JA 5BR8E 1HR0E 3HPSA 2JXPA 1N34E 1JK1A 1EKZA 2LVHA 1IQOA 4TUGA 4WSGA 2NUGA 4LF5E 1EH6A 1IBLE 2UUBE 3HXLA 2CTDA 1T4NA 2JWOA 1PJSA 2ELZA 2LV2A 2DGCA 3C6MA 2EM3A 2EPNA 4KZSA 2EMXA 4WX9A 1TF3A 4LFCE 2EOOA 2ENAA 1A1JA 5DNYA 3OMLA 3VK6A 4R2PA 2YWQA 2I13A 5AE3A 4AQYE 2LT7A 1ZU1A 4YHHE 2LUQA 2R76A 1N32E 1DGCA 2L2NA 4F9BB 3T1HE 4L5NC 2B9DA 2EMLA 1QU6A 1X49A 2UXDE 3QG5C 2YTEA 3EQ1A 4M30A 1YSAC 2UUCE 3J7AG 3OTOE 1SFEA 2EN4A 2VE7C 1WJPA 4LF6E 2EM9A 2E1MA 2NUEA 4NZVA 1YYWA 2ZM6E 1X48A 2EN7A 4LF7E 3BIDA 3EPHA 2E5LE 3F6HA 2Q8UA 1P47A 2M1SA 2EMYA 1G2FC 2V89A 4JI7E 2JOBA 4DV2E 2EOMA 1AH5A 2KOUA 2JPAA 4DR7E 4R2DA 4B3TE 4F6NA 2EPRA 4P78A 2L2KB 4IS1C 2LE2A 2EN2A 2JVAA 1T38A 3MSWA 2EPLX 1HNXE 2M9AA 3MHSC 2EWLA 5IXMB 2ELYA 4JI6E 4DR1E 2EM6A 1XMOE 1XMQE 5AC5A 4HTGA 5KL4A 2NUFA 1YYKA 2EOXA 2EM5A 1T4OA 1TN9A 4DV6E 1J26A 2EN6A 4X66E 2ODRD 3ADJA 4LU9A 1X5WA 2LMZA 2EORA 4R8OA 2YRKA 2LTSA 1UBDC 3BBGA 3F6GA 3J81C 4RHBB 1X47A 4F9CB 4B3SE 4K0KE 2B7VA 1J5EE 3LLHA 2V86A 5LL6R 2LCEA 1N33E 4Q35B 4LF4E 1BBOA 2YTPA 1MGTA 4GZNC 1ZAAC 2EM8A 3P1XA 1UILA 2M7QA 3ZOQB 3J80C 1IMUA 2VF1A 2YTNA 2MC6A 3HQ1A 2V85A 1GTKA 2YTGA 2F8BA 1YZ9A 2YTQA 2EQ1A 2B7TA 2EMBA 2JYAA 3RMPA 4MLQA 1BBGA 3UK3C 4DV4E 2CSHA 2EJ4A 4RH8A 4BC9A 2HGHA 4LF9E 1N3GA 4DUZE 2EM2A 1RQ0A 2EPKX 2EMFA 2L3CA 4DV0E 4LF8E 1G2DC 3J7Yp 2EPPA 2EOZA 4DR5E 4NHRA 2EMHA 1IBME 3T1YE 4IJDA 2EMZA 4F9AB 4JYAE 1A1FA 4Q28A 4B3ME 1EH7A 4GEQB 4R03A 4L8NA 5IWAE 2WBUA 3MHHC 4DV5E 2EZ6A 1FJGE 2EE8A 4F54A 4DR2E 4GKKE 2YSPA 1A1IA 1X3CA 2YU5A 3H09A 1RC7A 1PJTA 2N3HA 2EOQA 2K7IA 3EPJA 2RS6A 2EOFA 4I8OA 4F2JC 1EH8A 3JTZA 1N36E 2GLIA 1X6HA 1PKPA 5IT9C 3EPKA 1WRJA 4KHPE 2GPIA 2LO3A 3AV0A 5ADZA 1XNQE 2HHHE 4JV5E 2A25A 4MLVA 2B3TB 2MC5A
chains in the Genus database with same CATH topology
2EN8A 2EM5A 2EOJA 2EOXA 1TN9A 1MEYC 1NCSA 2EN6A 1B69A 2CT1A 2J7JA 1X5WA 2EORA 1F2IG 5KL2A 2YRKA 2EM4A 1UBDC 1ZR9A 2EOSA 4F6MA 1JK1A 2EL6A 2EMAA 2EMGA 3M99B 5KL6A 2LVHA 2YTJA 2EOIA 4WSGA 2EOHA 1KJKA 2YTDA 2EOYA 2EPZA 4X9JA 2CTDA 1RMDA 2YRMA 2LCEA 4M9VC 2DGCA 2ELZA 2EM7A 2EPXA 2LV2A 2EOEA 1YUIA 2EM3A 4R2CA 1BBOA 2YTPA 2YTFA 4GZNC 1ZAAC 2EMXA 1TF3A 2EM8A 2EOOA 2ENAA 1A1JA 4R2QA 4R2PA 2RSIA 2YTNA 2ADRA 2YTIA 2VRDA 2I13A 4R2AA 2EM0A 2LT7A 1ZU1A 2EMWA 2EQ3A 2YTGA 1X6FA 1UN6B 4R2SA 1DGCA 2YTQA 2EQ1A 2YU8A 2EMBA 4FK5C 3UK3C 1BB8A 2CSHA 2EJ4A 2JP9A 2HGHA 2MDGA 2EM2A 2EMLA 2NABA 2EP3A 2MKDA 1LLMC 2DMIA 2EMFA 2WBSA 2YTEA 1A1HA 1A1KA 1G2DC 1YSAC 2YRHA 2EPPA 2EOZA 5KL3A 1A1LA 2EQ0A 2EN3A 1YUJA 1JK2A 2EMHA 2EN4A 4R2RA 4IJDA 2EPCA 1WJPA 2EMZA 1Z1BA 2EM9A 1A1FA 2DRPA 2DLQA 2GHFA 2EN7A 2WBUA 3MHHC 2E72A 3EPHA 2EE8A 2YSPA 1P47A 1A1IA 1X3CA 2PRTA 2ENCA 2YU5A 2ENHA 2EL5A 2EMYA 1G2FC 1TF6A 2EMIA 2YTOA 5KL7A 3VHTB 1A1GA 2EOMA 2EOQA 3EPLA 3EPJA 2JPAA 4R2DA 1AAYA 4F6NA 2EMCA 2EOFA 2EPRA 2RPCA 4IS1C 2D9HA 2EN2A 4F2JC 1X6EA 2EMKA 2EPAA 2EL4A 2M9AA 2DLKA 2EN1A 2R1FA 2WBTA 3MHSC 2GLIA 1X6HA 4R2EA 2WCC3 3EPKA 2EPUA 2ELYA 2BB8A 2LO3A 2A25A 2YSOA 5KL5A 2EM6A 2MKNA 5KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  2EM5 A;  2EOJ A;  2EOX A;  1TN9 A;  1MEY C;  1NCS A;  2EN6 A;  1B69 A;  2CT1 A;  2J7J A;  1X5W A;  2EOR A;  1F2I G;  5KL2 A;  2YRK A;  2EM4 A;  1UBD C;  1ZR9 A;  2EOS A;  4F6M A;  1JK1 A;  2EL6 A;  2EMA A;  2EMG A;  3M99 B;  5KL6 A;  2LVH A;  2YTJ A;  2EOI A;  4WSG A;  2EOH A;  1KJK A;  2YTD A;  2EOY A;  2EPZ A;  4X9J A;  2CTD A;  1RMD A;  2YRM A;  2LCE A;  4M9V C;  2DGC A;  2ELZ A;  2EM7 A;  2EPX A;  2LV2 A;  2EOE A;  1YUI A;  2EM3 A;  4R2C A;  1BBO A;  2YTP A;  2YTF A;  4GZN C;  1ZAA C;  2EMX A;  1TF3 A;  2EM8 A;  2EOO A;  2ENA A;  1A1J A;  4R2Q A;  4R2P A;  2RSI A;  2YTN A;  2ADR A;  2YTI A;  2VRD A;  2I13 A;  4R2A A;  2EM0 A;  2LT7 A;  1ZU1 A;  2EMW A;  2EQ3 A;  2YTG A;  1X6F A;  1UN6 B;  4R2S A;  1DGC A;  2YTQ A;  2EQ1 A;  2YU8 A;  2EMB A;  4FK5 C;  3UK3 C;  1BB8 A;  2CSH A;  2EJ4 A;  2JP9 A;  2HGH A;  2MDG A;  2EM2 A;  2EML A;  2NAB A;  2EP3 A;  2MKD A;  1LLM C;  2DMI A;  2EMF A;  2WBS A;  2YTE A;  1A1H A;  1A1K A;  1G2D C;  1YSA C;  2YRH A;  2EPP A;  2EOZ A;  5KL3 A;  1A1L A;  2EQ0 A;  2EN3 A;  1YUJ A;  1JK2 A;  2EMH A;  2EN4 A;  4R2R A;  4IJD A;  2EPC A;  1WJP A;  2EMZ A;  1Z1B A;  2EM9 A;  1A1F A;  2DRP A;  2DLQ A;  2GHF A;  2EN7 A;  2WBU A;  3MHH C;  2E72 A;  3EPH A;  2EE8 A;  2YSP A;  1P47 A;  1A1I A;  1X3C A;  2PRT A;  2ENC A;  2YU5 A;  2ENH A;  2EL5 A;  2EMY A;  1G2F C;  1TF6 A;  2EMI A;  2YTO A;  5KL7 A;  3VHT B;  1A1G A;  2EOM A;  2EOQ A;  3EPL A;  3EPJ A;  2JPA A;  4R2D A;  1AAY A;  4F6N A;  2EMC A;  2EOF A;  2EPR A;  2RPC A;  4IS1 C;  2D9H A;  2EN2 A;  4F2J C;  1X6E A;  2EMK A;  2EPA A;  2EL4 A;  2M9A A;  2DLK A;  2EN1 A;  2R1F A;  2WBT A;  3MHS C;  2GLI A;  1X6H A;  4R2E A;  2WCC 3;  3EPK A;  2EPU A;  2ELY A;  2BB8 A;  2LO3 A;  2A25 A;  2YSO A;  5KL5 A;  2EM6 A;  2MKN A;  5KL4 A; 
#chains in the Genus database with same CATH topology
 2EN8 A;  1YYO A;  1MEY C;  1NCS A;  4LTY A;  1B69 A;  2F4V E;  2CT1 A;  2LRS A;  3JU0 A;  5TSE A;  3LML A;  2L33 A;  4HEI A;  2L2M A;  5A2Q C;  5CFF E;  3ADG A;  4GKJ E;  4ZYE A;  1ZR9 A;  2EMG A;  4OOG C;  2RSM A;  4DV1 E;  2FTX B;  4WXD A;  2YTJ A;  2LTR A;  3KZY A;  2EOH A;  2YTD A;  4X9J A;  5LLQ A;  2YRM A;  4ZYG A;  5A69 A;  4M9V C;  2EM7 A;  4BC7 A;  5AE2 A;  2EOE A;  1FKA E;  1YUI A;  3BGH A;  2YTF A;  2M4I A;  4O5G A;  1T39 A;  4JI2 E;  3L00 A;  1YPN A;  4R2Q A;  1IBK E;  2KHX A;  2V83 A;  2ADR A;  2LJU A;  2YTI A;  1XNR E;  2V8Q B;  2EM0 A;  2DMY A;  2BBG A;  2EQ3 A;  4JI1 E;  2DSY A;  4M0V A;  2YU8 A;  2KON A;  2VQE E;  1IQS A;  4FK5 C;  4X64 E;  1ZBQ A;  2MDG A;  2K4V A;  3VYY A;  1O0W A;  2EP3 A;  1YFH A;  2MKD A;  1I94 E;  1LLM C;  1WHN A;  2DMI A;  4WPY A;  5FLX C;  1A1L A;  5KL3 A;  2EQ0 A;  3DF6 A;  1PJQ A;  1YUJ A;  1WHQ A;  2EPO A;  1JK2 A;  2UU9 E;  4ZYD A;  4R2R A;  3ADL A;  1NEI A;  4DV7 E;  2JR1 A;  4OX9 E;  5LMN E;  3KWR A;  1STU A;  1DQ3 A;  4X65 E;  2DRP A;  2GHF A;  3THO B;  2E72 A;  2RQL A;  4X62 E;  2RTX A;  4WFT A;  2IHR 1;  2EL5 A;  4BMJ A;  2EMI A;  5KL7 A;  3VHT B;  1A1G A;  4NXM E;  4WSP A;  1T4L B;  3HTX A;  2MDR A;  2WZO A;  3JAM C;  1WXR A;  3TQM A;  2EMC A;  3C4T A;  2RPC A;  2HJJ A;  5T6J A;  2N3G A;  2V87 A;  4KWY A;  4JI4 E;  4TUI A;  2G7H A;  4B3R E;  2EN1 A;  5AC4 A;  4O4K A;  2WBT A;  3ADI A;  4R2E A;  2WCC 3;  1SR9 A;  2YSO A;  3C6K A;  2FGG A;  3VYX A;  2ODR C;  4DR6 E;  5AAS A;  4YY3 E;  1KYQ A;  3DJW A;  2UUA E;  2LBS B;  4WXC A;  1F2I G;  5KL2 A;  4JI8 E;  1L4S A;  2N8X A;  2EM4 A;  2EOS A;  4F6M A;  2EL6 A;  2EMA A;  3M99 B;  5KL6 A;  4JI3 E;  1ZBT A;  2EOI A;  2RS7 A;  2FV4 B;  1KJK A;  2EOY A;  5LMU E;  2EPZ A;  2L8T A;  3AUZ A;  3THN A;  2VQF E;  1RMD A;  5A6B D;  4DR4 E;  2LUP B;  2JOX A;  2EPX A;  4DMI A;  4BBY A;  3BF2 A;  1GQE A;  3HPZ A;  4R2C A;  5A6B A;  2YZT A;  2NA2 A;  4BCA A;  1UHZ A;  2RSI A;  2VRD A;  2YT4 A;  3K6Q A;  4R2A A;  4NXN E;  3IWD A;  4WYQ B;  2EPM X;  2EMW A;  2JY9 A;  1X6F A;  1UN6 B;  4R2S A;  4P7D A;  3C4B A;  5AE1 A;  5A6K A;  4DV3 E;  1BB8 A;  5A6A A;  4O24 A;  2JP9 A;  4BS9 A;  4DR3 E;  4BHC A;  2NAB A;  3ECR A;  2YPN A;  2WBS A;  1A1H A;  1A1K A;  3IWB A;  2YRH A;  4O43 A;  2LJH A;  2EN3 A;  3KZZ A;  2UXB E;  4J8Z A;  2DB2 A;  2EPC A;  2CPN A;  1Z1B A;  3IWC A;  4ZYH A;  2DLQ A;  5F3W A;  2I9I A;  2L92 A;  4M2Z A;  2PRT A;  2ENC A;  2H36 X;  2ENH A;  2DIX A;  1TF6 A;  2YTO A;  3EPL A;  4JI5 E;  1DI2 A;  3FIG A;  4X8W A;  1AAY A;  4BHB A;  2D9H A;  2UXC E;  1X6E A;  2EMK A;  2EPA A;  2L3J A;  2EL4 A;  1GZ6 A;  2DLK A;  2R1F A;  4DUY E;  4JI0 E;  4LFA E;  1HNW E;  2EPU A;  2HC5 A;  1HNZ E;  2BB8 A;  4LFB E;  2L6M A;  5KL5 A;  5A6J A;  5IV8 B;  4N4R B;  2MKN A;  1QNT A;  2V88 A;  2EOJ A;  4DKK A;  1PDA A;  2J7J A;  5BR8 E;  1HR0 E;  3HPS A;  2JXP A;  1N34 E;  1JK1 A;  1EKZ A;  2LVH A;  1IQO A;  4TUG A;  4WSG A;  2NUG A;  4LF5 E;  1EH6 A;  1IBL E;  2UUB E;  3HXL A;  2CTD A;  1T4N A;  2JWO A;  1PJS A;  2ELZ A;  2LV2 A;  2DGC A;  3C6M A;  2EM3 A;  2EPN A;  4KZS A;  2EMX A;  4WX9 A;  1TF3 A;  4LFC E;  2EOO A;  2ENA A;  1A1J A;  5DNY A;  3OML A;  3VK6 A;  4R2P A;  2YWQ A;  2I13 A;  5AE3 A;  4AQY E;  2LT7 A;  1ZU1 A;  4YHH E;  2LUQ A;  2R76 A;  1N32 E;  1DGC A;  2L2N A;  4F9B B;  3T1H E;  4L5N C;  2B9D A;  2EML A;  1QU6 A;  1X49 A;  2UXD E;  3QG5 C;  2YTE A;  3EQ1 A;  4M30 A;  1YSA C;  2UUC E;  3J7A G;  3OTO E;  1SFE A;  2EN4 A;  2VE7 C;  1WJP A;  4LF6 E;  2EM9 A;  2E1M A;  2NUE A;  4NZV A;  1YYW A;  2ZM6 E;  1X48 A;  2EN7 A;  4LF7 E;  3BID A;  3EPH A;  2E5L E;  3F6H A;  2Q8U A;  1P47 A;  2M1S A;  2EMY A;  1G2F C;  2V89 A;  4JI7 E;  2JOB A;  4DV2 E;  2EOM A;  1AH5 A;  2KOU A;  2JPA A;  4DR7 E;  4R2D A;  4B3T E;  4F6N A;  2EPR A;  4P78 A;  2L2K B;  4IS1 C;  2LE2 A;  2EN2 A;  2JVA A;  1T38 A;  3MSW A;  2EPL X;  1HNX E;  2M9A A;  3MHS C;  2EWL A;  5IXM B;  2ELY A;  4JI6 E;  4DR1 E;  2EM6 A;  1XMO E;  1XMQ E;  5AC5 A;  4HTG A;  5KL4 A;  2NUF A;  1YYK A;  2EOX A;  2EM5 A;  1T4O A;  1TN9 A;  4DV6 E;  1J26 A;  2EN6 A;  4X66 E;  2ODR D;  3ADJ A;  4LU9 A;  1X5W A;  2LMZ A;  2EOR A;  4R8O A;  2YRK A;  2LTS A;  1UBD C;  3BBG A;  3F6G A;  3J81 C;  4RHB B;  1X47 A;  4F9C B;  4B3S E;  4K0K E;  2B7V A;  1J5E E;  3LLH A;  2V86 A;  5LL6 R;  2LCE A;  1N33 E;  4Q35 B;  4LF4 E;  1BBO A;  2YTP A;  1MGT A;  4GZN C;  1ZAA C;  2EM8 A;  3P1X A;  1UIL A;  2M7Q A;  3ZOQ B;  3J80 C;  1IMU A;  2VF1 A;  2YTN A;  2MC6 A;  3HQ1 A;  2V85 A;  1GTK A;  2YTG A;  2F8B A;  1YZ9 A;  2YTQ A;  2EQ1 A;  2B7T A;  2EMB A;  2JYA A;  3RMP A;  4MLQ A;  1BBG A;  3UK3 C;  4DV4 E;  2CSH A;  2EJ4 A;  4RH8 A;  4BC9 A;  2HGH A;  4LF9 E;  1N3G A;  4DUZ E;  2EM2 A;  1RQ0 A;  2EPK X;  2EMF A;  2L3C A;  4DV0 E;  4LF8 E;  1G2D C;  3J7Y p;  2EPP A;  2EOZ A;  4DR5 E;  4NHR A;  2EMH A;  1IBM E;  3T1Y E;  4IJD A;  2EMZ A;  4F9A B;  4JYA E;  1A1F A;  4Q28 A;  4B3M E;  1EH7 A;  4GEQ B;  4R03 A;  4L8N A;  5IWA E;  2WBU A;  3MHH C;  4DV5 E;  2EZ6 A;  1FJG E;  2EE8 A;  4F54 A;  4DR2 E;  4GKK E;  2YSP A;  1A1I A;  1X3C A;  2YU5 A;  3H09 A;  1RC7 A;  1PJT A;  2N3H A;  2EOQ A;  2K7I A;  3EPJ A;  2RS6 A;  2EOF A;  4I8O A;  4F2J C;  1EH8 A;  3JTZ A;  1N36 E;  2GLI A;  1X6H A;  1PKP A;  5IT9 C;  3EPK A;  1WRJ A;  4KHP E;  2GPI A;  2LO3 A;  3AV0 A;  5ADZ A;  1XNQ E;  2HHH E;  4JV5 E;  2A25 A;  4MLV A;  2B3T B;  2MC5 A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  2EM5 A;  2EOJ A;  2EOX A;  1TN9 A;  1MEY C;  1NCS A;  2EN6 A;  1B69 A;  2CT1 A;  2J7J A;  1X5W A;  2EOR A;  1F2I G;  5KL2 A;  2YRK A;  2EM4 A;  1UBD C;  1ZR9 A;  2EOS A;  4F6M A;  1JK1 A;  2EL6 A;  2EMA A;  2EMG A;  3M99 B;  5KL6 A;  2LVH A;  2YTJ A;  2EOI A;  4WSG A;  2EOH A;  1KJK A;  2YTD A;  2EOY A;  2EPZ A;  4X9J A;  2CTD A;  1RMD A;  2YRM A;  2LCE A;  4M9V C;  2DGC A;  2ELZ A;  2EM7 A;  2EPX A;  2LV2 A;  2EOE A;  1YUI A;  2EM3 A;  4R2C A;  1BBO A;  2YTP A;  2YTF A;  4GZN C;  1ZAA C;  2EMX A;  1TF3 A;  2EM8 A;  2EOO A;  2ENA A;  1A1J A;  4R2Q A;  4R2P A;  2RSI A;  2YTN A;  2ADR A;  2YTI A;  2VRD A;  2I13 A;  4R2A A;  2EM0 A;  2LT7 A;  1ZU1 A;  2EMW A;  2EQ3 A;  2YTG A;  1X6F A;  1UN6 B;  4R2S A;  1DGC A;  2YTQ A;  2EQ1 A;  2YU8 A;  2EMB A;  4FK5 C;  3UK3 C;  1BB8 A;  2CSH A;  2EJ4 A;  2JP9 A;  2HGH A;  2MDG A;  2EM2 A;  2EML A;  2NAB A;  2EP3 A;  2MKD A;  1LLM C;  2DMI A;  2EMF A;  2WBS A;  2YTE A;  1A1H A;  1A1K A;  1G2D C;  1YSA C;  2YRH A;  2EPP A;  2EOZ A;  5KL3 A;  1A1L A;  2EQ0 A;  2EN3 A;  1YUJ A;  1JK2 A;  2EMH A;  2EN4 A;  4R2R A;  4IJD A;  2EPC A;  1WJP A;  2EMZ A;  1Z1B A;  2EM9 A;  1A1F A;  2DRP A;  2DLQ A;  2GHF A;  2EN7 A;  2WBU A;  3MHH C;  2E72 A;  3EPH A;  2EE8 A;  2YSP A;  1P47 A;  1A1I A;  1X3C A;  2PRT A;  2ENC A;  2YU5 A;  2ENH A;  2EL5 A;  2EMY A;  1G2F C;  1TF6 A;  2EMI A;  2YTO A;  5KL7 A;  3VHT B;  1A1G A;  2EOM A;  2EOQ A;  3EPL A;  3EPJ A;  2JPA A;  4R2D A;  1AAY A;  4F6N A;  2EMC A;  2EOF A;  2EPR A;  2RPC A;  4IS1 C;  2D9H A;  2EN2 A;  4F2J C;  1X6E A;  2EMK A;  2EPA A;  2EL4 A;  2M9A A;  2DLK A;  2EN1 A;  2R1F A;  2WBT A;  3MHS C;  2GLI A;  1X6H A;  4R2E A;  2WCC 3;  3EPK A;  2EPU A;  2ELY A;  2BB8 A;  2LO3 A;  2A25 A;  2YSO A;  5KL5 A;  2EM6 A;  2MKN A;  5KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...