2EM9A

Solution structure of the c2h2 type zinc finger (region 367-399) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 367-399) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em9A01
1ZU1A 4M9VC 2YTNA 4R2SA 2EM7A 2YSOA 2EPPA 2EN7A 2DMIA 2EE8A 4R2PA 2I13A 2MKDA 4WSGA 2PRTA 4FK5C 2CTDA 2HGHA 2A25A 2EMZA 1RMDA 2EOHA 2YTDA 1X6HA 4F6NA 2EQ3A 5KL6A 1X6EA 1ZR9A 1YUIA 2EM8A 2EMWA 5KL2A 1A1JA 2EPXA 1A1FA 2EOQA 2YU5A 1ZAAC 2JPAA 1X5WA 1X3CA 2BB8A 2EM0A 2EQ0A 2M9AA 2YTJA 2EMKA 2EPZA 2YTQA 2EM5A 2EMBA 2EMAA 2ELYA 2EMIA 1G2DC 4R2QA 1B69A 2EMCA 2YTGA 2EM6A 2EOOA 1A1HA 2GLIA 2ENHA 2ENCA 4GZNC 2LO3A 4R2CA 4X9JA 2EOYA 2EORA 2EJ4A 2DRPA 2LT7A 2RPCA 2CT1A 2EPAA 4IS1C 2EMHA 2EL6A 2R1FA 2EN3A 3MHSC 1TF3A 2DLKA 2NABA 1X6FA 2EQ1A 1Z1BA 1P47A 5KL7A 2EOJA 2EOFA 1A1LA 2RSIA 2EOXA 2EPCA 2EM9A 2E72A 1JK2A 5KL3A 2EMFA 1A1IA 2EM2A 1NCSA 2LVHA 4R2RA 2EL4A 1DGCA 1JK1A 2WCC3 1A1GA 2YTEA 4R2DA 2EN8A 3MHHC 1WJPA 2YTIA 1LLMC 1YSAC 5KL4A 2EL5A 2VRDA 2ENAA 2EPUA 2EM4A 1MEYC 2YRMA 2EMXA 2EOIA 1UBDC 2WBSA 2YRKA 2MKNA 2ELZA 1BBOA 1BB8A 2WBTA 3EPKA 1TN9A 2MDGA 2WBUA 4R2EA 3EPLA 2EPRA 3VHTB 3EPHA 3M99B 1UN6B 2EP3A 4F6MA 4IJDA 2D9HA 2EOSA 2ADRA 2LCEA 3UK3C 2EMYA 1A1KA 1KJKA 2EMLA 2EOEA 2YRHA 5KL5A 2LV2A 2EM3A 2EN1A 2YTFA 1TF6A 2YTOA 2YTPA 1F2IG 1YUJA 2GHFA 2EN6A 2YU8A 2YSPA 4R2AA 3EPJA 2EOMA 2CSHA 4F2JC 2EMGA 1G2FC 2JP9A 1AAYA 2EN4A 2DLQA 2J7JA 2DGCA 2EOZA 2EN2A
chains in the Genus database with same CATH superfamily
3BBGA 4M9VC 2YTNA 1PJQA 2DSYA 3C6MA 2B3TB 2DMIA 5A6AA 4O43A 4ZYGA 2EPKX 3MSWA 1EH6A 4DV6E 4FK5C 4JV5E 3DJWA 3J80C 4JI6E 1N34E 2L8TA 1IQOA 5A69A 2VQEE 4BC9A 1YYWA 4DR7E 2EM0A 2EMKA 2EPZA 1EKZA 1DQ3A 1L4SA 1PJTA 2EMAA 4JI7E 2L6MA 2NUFA 1O0WA 2EZ6A 2EMCA 4BHCA 1GQEA 4KWYA 2B7VA 2V86A 1SFEA 2EJ4A 2UXCE 1IBLE 4DR4E 3QG5C 2CT1A 2EMHA 2ODRC 4DKKA 1J5EE 4OOGC 2HJJA 2DB2A 2RTXA 2LMZA 1WHNA 5KL7A 1T38A 1A1LA 2RSIA 1WHQA 2V87A 2EPCA 2E72A 1T4OA 2EMFA 1DI2A 4LF4E 3OMLA 1DGCA 4P78A 4YHHE 4DR6E 2JVAA 4DR1E 2YT4A 1IBKE 1FJGE 3THNA 5KL4A 2VRDA 2ENAA 2L92A 2E1MA 2N3HA 1IMUA 5IV8B 3BIDA 1I94E 2K7IA 2WBTA 2EPOA 1TN9A 2MDGA 3HTXA 2UUAE 2ZM6E 1N33E 2V85A 3VHTB 1YPNA 4BMJA 4X8WA 2KOUA 5IT9C 4R03A 1RC7A 1YZ9A 1XNQE 2YRHA 3BGHA 2EN1A 5LMNE 1AH5A 1F2IG 2I9IA 2GHFA 4BS9A 3EQ1A 2EWLA 1G2FC 4BC7A 2J7JA 1ZU1A 2EM7A 2EPPA 4LFBE 2HHHE 4AQYE 4R2PA 4WSGA 2M4IA 1RMDA 2YTDA 4F6NA 5DNYA 2YWQA 2V8QB 2M1SA 1X48A 4GEQB 2EOQA 4O24A 2K4VA 3THOB 5IWAE 4DV1E 1HNZE 1YFHA 2M9AA 2LUQA 2EMBA 5AC4A 1HNXE 4X62E 1IQSA 1X49A 4WFTA 3ADGA 4JYAE 2CPNA 4N4RB 2UXBE 2EOOA 2NA2A 1PKPA 2EPLX 2ENCA 4X9JA 2LTSA 1N3GA 2EORA 2LBSB 2JXPA 4BBYA 1IBME 4DUZE 4IS1C 2YZTA 3IWCA 2EL6A 2EN3A 2ODRD 4HEIA 4F9AB 1UHZA 3AUZA 1GTKA 2NABA 1X6FA 2EOJA 3H09A 4JI1E 1NCSA 4R2RA 1QNTA 2HC5A 2V89A 4K0KE 2JYAA 4B3TE 4R2DA 2YTIA 4X64E 2L2KB 1STUA 1WXRA 2KONA 3KWRA 2N8XA 2EOIA 1UBDC 3HPSA 2GPIA 1XMOE 2LJHA 2ELZA 2M7QA 2WZOA 2L33A 4MLQA 2WBUA 2EPMX 4JI4E 4WXCA 3EPLA 2EPRA 2MDRA 4F9BB 1WRJA 4JI5E 3OTOE 3L00A 2ADRA 2RQLA 3ZOQB 2EMYA 2KHXA 3UK3C 1KJKA 1PDAA 2MC6A 5BR8E 2YTPA 1YUJA 2EN6A 2UXDE 2EPNA 3ECRA 4M30A 4NXNE 4DV0E 3FIGA 3VYYA 1T39A 1AAYA 4M2ZA 2DGCA 2EOZA 2EN2A 3IWBA 4R2SA 2YSOA 3J7AG 2IHR1 2BBGA 3HPZA 2CTDA 2HGHA 2A25A 2EMZA 5A6BD 4NHRA 5A6JA 5LMUE 5KL6A 4BHBA 1ZR9A 4DV2E 3K6QA 1YUIA 1EH7A 2EMWA 5KL2A 1YYOA 2DMYA 4DR2E 4LFAE 3TQMA 1ZAAC 2JPAA 2FGGA 2YTJA 3P1XA 2R76A 2H36X 3BF2A 5LLQA 4DV3E 2ELYA 5FLXC 2EMIA 3KZYA 2EM6A 1A1HA 2GLIA 2E5LE 2ENHA 2EOYA 1ZBQA 3DF6A 2F8BA 3IWDA 2Q8UA 4DR3E 1J26A 3RMPA 4F9CB 2LT7A 2LJUA 2RPCA 2B9DA 3JAMC 1NEIA 1EH8A 1BBGA 1Z1BA 4NZVA 1N32E 4TUIA 2EM9A 5KL3A 5AASA 1A1IA 3HXLA 4I8OA 1YYKA 2B7TA 4TUGA 3ADLA 2EN8A 2DIXA 3MHHC 4ZYHA 4KZSA 4Q28A 4DV4E 3T1YE 2LRSA 4BCAA 4M0VA 1N36E 1MEYC 2YRMA 2EMXA 2UUBE 2WBSA 2MKNA 2F4VE 4O5GA 1BB8A 4MLVA 4J8ZA 4B3RE 4R2EA 4JI2E 2FTXB 5T6JA 3M99B 2JY9A 1UN6B 2EP3A 4F6MA 4IJDA 2EOSA 5AE2A 4O4KA 2LCEA 4LF5E 5ADZA 1A1KA 4B3SE 3VYXA 2EMLA 4R8OA 5KL5A 2LV2A 2EM3A 1HR0E 4DUYE 1UILA 2MC5A 1TF6A 5AC5A 5F3WA 5TSEA 1FKAE 2VE7C 4R2AA 2EOMA 4F2JC 2EMGA 1GZ6A 4RH8A 4JI8E 2JP9A 2DLQA 3JU0A 4L5NC 4WPYA 2VF1A 4HTGA 1QU6A 4LF7E 2EN7A 4OX9E 3J7Yp 2EE8A 3J81C 2I13A 2MKDA 3C6KA 3VK6A 2PRTA 4Q35B 2EOHA 1X6HA 2EQ3A 2NUGA 3C4TA 1X6EA 2EM8A 5A2QC 1T4LB 1A1JA 2EPXA 2L2MA 1A1FA 2YU5A 2UU9E 4DMIA 1X5WA 4LU9A 4F54A 1X3CA 1RQ0A 2BB8A 2EQ0A 3LLHA 3C4BA 2YTQA 5IXMB 2EM5A 4LTYA 5A6BA 4RHBB 4X65E 4X66E 1G2DC 4WXDA 5CFFE 2LTRA 4R2QA 1B69A 2YTGA 1KYQA 3HQ1A 4LFCE 3F6GA 4GZNC 2LO3A 4R2CA 4JI3E 1T4NA 2JOBA 4ZYEA 4LF9E 2RS6A 4B3ME 2DRPA 2L3JA 4DV5E 2V83A 2N3GA 2EPAA 2R1FA 3MHSC 5AE1A 3KZZA 4WSPA 1TF3A 2DLKA 3F6HA 2L3CA 1HNWE 2EQ1A 2JOXA 1P47A 2EOFA 4KHPE 2EOXA 1JK2A 4P7DA 2G7HA 2EM2A 2LVHA 3ADJA 2EL4A 4LF6E 2RS7A 1JK1A 2WCC3 1A1GA 2YTEA 1ZBTA 2L2NA 4DR5E 1WJPA 5AE3A 1LLMC 1YSAC 2JWOA 4DV7E 2EL5A 1SR9A 2EPUA 2RSMA 1XMQE 2NUEA 2EM4A 3JTZA 1PJSA 2YRKA 2LUPB 1BBOA 2V88A 4YY3E 3EPKA 4NXME 1XNRE 4WYQB 4GKKE 2YPNA 3EPHA 4L8NA 2D9HA 2JR1A 2UUCE 2LE2A 4ZYDA 2EOEA 5A6KA 4GKJE 2YTFA 3LMLA 4LF8E 1MGTA 2YTOA 3AV0A 1X47A 3T1HE 2FV4B 2YU8A 2YSPA 2VQFE 4WX9A 4JI0E 3ADIA 3EPJA 2CSHA 2EN4A 5LL6R
chains in the Genus database with same CATH topology
1ZU1A 4M9VC 2YTNA 4R2SA 2EM7A 2YSOA 2EPPA 2EN7A 2DMIA 2EE8A 4R2PA 2I13A 2MKDA 4WSGA 2PRTA 4FK5C 2CTDA 2HGHA 2A25A 2EMZA 1RMDA 2EOHA 2YTDA 1X6HA 4F6NA 2EQ3A 5KL6A 1X6EA 1ZR9A 1YUIA 2EM8A 2EMWA 5KL2A 1A1JA 2EPXA 1A1FA 2EOQA 2YU5A 1ZAAC 2JPAA 1X5WA 1X3CA 2BB8A 2EM0A 2EQ0A 2M9AA 2YTJA 2EMKA 2EPZA 2YTQA 2EM5A 2EMBA 2EMAA 2ELYA 2EMIA 1G2DC 4R2QA 1B69A 2EMCA 2YTGA 2EM6A 2EOOA 1A1HA 2GLIA 2ENHA 2ENCA 4GZNC 2LO3A 4R2CA 4X9JA 2EOYA 2EORA 2EJ4A 2DRPA 2LT7A 2RPCA 2CT1A 2EPAA 4IS1C 2EMHA 2EL6A 2R1FA 2EN3A 3MHSC 1TF3A 2DLKA 2NABA 1X6FA 2EQ1A 1Z1BA 1P47A 5KL7A 2EOJA 2EOFA 1A1LA 2RSIA 2EOXA 2EPCA 2EM9A 2E72A 1JK2A 5KL3A 2EMFA 1A1IA 2EM2A 1NCSA 2LVHA 4R2RA 2EL4A 1DGCA 1JK1A 2WCC3 1A1GA 2YTEA 4R2DA 2EN8A 3MHHC 1WJPA 2YTIA 1LLMC 1YSAC 5KL4A 2EL5A 2VRDA 2ENAA 2EPUA 2EM4A 1MEYC 2YRMA 2EMXA 2EOIA 1UBDC 2WBSA 2YRKA 2MKNA 2ELZA 1BBOA 1BB8A 2WBTA 3EPKA 1TN9A 2MDGA 2WBUA 4R2EA 3EPLA 2EPRA 3VHTB 3EPHA 3M99B 1UN6B 2EP3A 4F6MA 4IJDA 2D9HA 2EOSA 2ADRA 2LCEA 3UK3C 2EMYA 1A1KA 1KJKA 2EMLA 2EOEA 2YRHA 5KL5A 2LV2A 2EM3A 2EN1A 2YTFA 1TF6A 2YTOA 2YTPA 1F2IG 1YUJA 2GHFA 2EN6A 2YU8A 2YSPA 4R2AA 3EPJA 2EOMA 2CSHA 4F2JC 2EMGA 1G2FC 2JP9A 1AAYA 2EN4A 2DLQA 2J7JA 2DGCA 2EOZA 2EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  4M9V C;  2YTN A;  4R2S A;  2EM7 A;  2YSO A;  2EPP A;  2EN7 A;  2DMI A;  2EE8 A;  4R2P A;  2I13 A;  2MKD A;  4WSG A;  2PRT A;  4FK5 C;  2CTD A;  2HGH A;  2A25 A;  2EMZ A;  1RMD A;  2EOH A;  2YTD A;  1X6H A;  4F6N A;  2EQ3 A;  5KL6 A;  1X6E A;  1ZR9 A;  1YUI A;  2EM8 A;  2EMW A;  5KL2 A;  1A1J A;  2EPX A;  1A1F A;  2EOQ A;  2YU5 A;  1ZAA C;  2JPA A;  1X5W A;  1X3C A;  2BB8 A;  2EM0 A;  2EQ0 A;  2M9A A;  2YTJ A;  2EMK A;  2EPZ A;  2YTQ A;  2EM5 A;  2EMB A;  2EMA A;  2ELY A;  2EMI A;  1G2D C;  4R2Q A;  1B69 A;  2EMC A;  2YTG A;  2EM6 A;  2EOO A;  1A1H A;  2GLI A;  2ENH A;  2ENC A;  4GZN C;  2LO3 A;  4R2C A;  4X9J A;  2EOY A;  2EOR A;  2EJ4 A;  2DRP A;  2LT7 A;  2RPC A;  2CT1 A;  2EPA A;  4IS1 C;  2EMH A;  2EL6 A;  2R1F A;  2EN3 A;  3MHS C;  1TF3 A;  2DLK A;  2NAB A;  1X6F A;  2EQ1 A;  1Z1B A;  1P47 A;  5KL7 A;  2EOJ A;  2EOF A;  1A1L A;  2RSI A;  2EOX A;  2EPC A;  2EM9 A;  2E72 A;  1JK2 A;  5KL3 A;  2EMF A;  1A1I A;  2EM2 A;  1NCS A;  2LVH A;  4R2R A;  2EL4 A;  1DGC A;  1JK1 A;  2WCC 3;  1A1G A;  2YTE A;  4R2D A;  2EN8 A;  3MHH C;  1WJP A;  2YTI A;  1LLM C;  1YSA C;  5KL4 A;  2EL5 A;  2VRD A;  2ENA A;  2EPU A;  2EM4 A;  1MEY C;  2YRM A;  2EMX A;  2EOI A;  1UBD C;  2WBS A;  2YRK A;  2MKN A;  2ELZ A;  1BBO A;  1BB8 A;  2WBT A;  3EPK A;  1TN9 A;  2MDG A;  2WBU A;  4R2E A;  3EPL A;  2EPR A;  3VHT B;  3EPH A;  3M99 B;  1UN6 B;  2EP3 A;  4F6M A;  4IJD A;  2D9H A;  2EOS A;  2ADR A;  2LCE A;  3UK3 C;  2EMY A;  1A1K A;  1KJK A;  2EML A;  2EOE A;  2YRH A;  5KL5 A;  2LV2 A;  2EM3 A;  2EN1 A;  2YTF A;  1TF6 A;  2YTO A;  2YTP A;  1F2I G;  1YUJ A;  2GHF A;  2EN6 A;  2YU8 A;  2YSP A;  4R2A A;  3EPJ A;  2EOM A;  2CSH A;  4F2J C;  2EMG A;  1G2F C;  2JP9 A;  1AAY A;  2EN4 A;  2DLQ A;  2J7J A;  2DGC A;  2EOZ A;  2EN2 A; 
#chains in the Genus database with same CATH topology
 3BBG A;  4M9V C;  2YTN A;  1PJQ A;  2DSY A;  3C6M A;  2B3T B;  2DMI A;  5A6A A;  4O43 A;  4ZYG A;  2EPK X;  3MSW A;  1EH6 A;  4DV6 E;  4FK5 C;  4JV5 E;  3DJW A;  3J80 C;  4JI6 E;  1N34 E;  2L8T A;  1IQO A;  5A69 A;  2VQE E;  4BC9 A;  1YYW A;  4DR7 E;  2EM0 A;  2EMK A;  2EPZ A;  1EKZ A;  1DQ3 A;  1L4S A;  1PJT A;  2EMA A;  4JI7 E;  2L6M A;  2NUF A;  1O0W A;  2EZ6 A;  2EMC A;  4BHC A;  1GQE A;  4KWY A;  2B7V A;  2V86 A;  1SFE A;  2EJ4 A;  2UXC E;  1IBL E;  4DR4 E;  3QG5 C;  2CT1 A;  2EMH A;  2ODR C;  4DKK A;  1J5E E;  4OOG C;  2HJJ A;  2DB2 A;  2RTX A;  2LMZ A;  1WHN A;  5KL7 A;  1T38 A;  1A1L A;  2RSI A;  1WHQ A;  2V87 A;  2EPC A;  2E72 A;  1T4O A;  2EMF A;  1DI2 A;  4LF4 E;  3OML A;  1DGC A;  4P78 A;  4YHH E;  4DR6 E;  2JVA A;  4DR1 E;  2YT4 A;  1IBK E;  1FJG E;  3THN A;  5KL4 A;  2VRD A;  2ENA A;  2L92 A;  2E1M A;  2N3H A;  1IMU A;  5IV8 B;  3BID A;  1I94 E;  2K7I A;  2WBT A;  2EPO A;  1TN9 A;  2MDG A;  3HTX A;  2UUA E;  2ZM6 E;  1N33 E;  2V85 A;  3VHT B;  1YPN A;  4BMJ A;  4X8W A;  2KOU A;  5IT9 C;  4R03 A;  1RC7 A;  1YZ9 A;  1XNQ E;  2YRH A;  3BGH A;  2EN1 A;  5LMN E;  1AH5 A;  1F2I G;  2I9I A;  2GHF A;  4BS9 A;  3EQ1 A;  2EWL A;  1G2F C;  4BC7 A;  2J7J A;  1ZU1 A;  2EM7 A;  2EPP A;  4LFB E;  2HHH E;  4AQY E;  4R2P A;  4WSG A;  2M4I A;  1RMD A;  2YTD A;  4F6N A;  5DNY A;  2YWQ A;  2V8Q B;  2M1S A;  1X48 A;  4GEQ B;  2EOQ A;  4O24 A;  2K4V A;  3THO B;  5IWA E;  4DV1 E;  1HNZ E;  1YFH A;  2M9A A;  2LUQ A;  2EMB A;  5AC4 A;  1HNX E;  4X62 E;  1IQS A;  1X49 A;  4WFT A;  3ADG A;  4JYA E;  2CPN A;  4N4R B;  2UXB E;  2EOO A;  2NA2 A;  1PKP A;  2EPL X;  2ENC A;  4X9J A;  2LTS A;  1N3G A;  2EOR A;  2LBS B;  2JXP A;  4BBY A;  1IBM E;  4DUZ E;  4IS1 C;  2YZT A;  3IWC A;  2EL6 A;  2EN3 A;  2ODR D;  4HEI A;  4F9A B;  1UHZ A;  3AUZ A;  1GTK A;  2NAB A;  1X6F A;  2EOJ A;  3H09 A;  4JI1 E;  1NCS A;  4R2R A;  1QNT A;  2HC5 A;  2V89 A;  4K0K E;  2JYA A;  4B3T E;  4R2D A;  2YTI A;  4X64 E;  2L2K B;  1STU A;  1WXR A;  2KON A;  3KWR A;  2N8X A;  2EOI A;  1UBD C;  3HPS A;  2GPI A;  1XMO E;  2LJH A;  2ELZ A;  2M7Q A;  2WZO A;  2L33 A;  4MLQ A;  2WBU A;  2EPM X;  4JI4 E;  4WXC A;  3EPL A;  2EPR A;  2MDR A;  4F9B B;  1WRJ A;  4JI5 E;  3OTO E;  3L00 A;  2ADR A;  2RQL A;  3ZOQ B;  2EMY A;  2KHX A;  3UK3 C;  1KJK A;  1PDA A;  2MC6 A;  5BR8 E;  2YTP A;  1YUJ A;  2EN6 A;  2UXD E;  2EPN A;  3ECR A;  4M30 A;  4NXN E;  4DV0 E;  3FIG A;  3VYY A;  1T39 A;  1AAY A;  4M2Z A;  2DGC A;  2EOZ A;  2EN2 A;  3IWB A;  4R2S A;  2YSO A;  3J7A G;  2IHR 1;  2BBG A;  3HPZ A;  2CTD A;  2HGH A;  2A25 A;  2EMZ A;  5A6B D;  4NHR A;  5A6J A;  5LMU E;  5KL6 A;  4BHB A;  1ZR9 A;  4DV2 E;  3K6Q A;  1YUI A;  1EH7 A;  2EMW A;  5KL2 A;  1YYO A;  2DMY A;  4DR2 E;  4LFA E;  3TQM A;  1ZAA C;  2JPA A;  2FGG A;  2YTJ A;  3P1X A;  2R76 A;  2H36 X;  3BF2 A;  5LLQ A;  4DV3 E;  2ELY A;  5FLX C;  2EMI A;  3KZY A;  2EM6 A;  1A1H A;  2GLI A;  2E5L E;  2ENH A;  2EOY A;  1ZBQ A;  3DF6 A;  2F8B A;  3IWD A;  2Q8U A;  4DR3 E;  1J26 A;  3RMP A;  4F9C B;  2LT7 A;  2LJU A;  2RPC A;  2B9D A;  3JAM C;  1NEI A;  1EH8 A;  1BBG A;  1Z1B A;  4NZV A;  1N32 E;  4TUI A;  2EM9 A;  5KL3 A;  5AAS A;  1A1I A;  3HXL A;  4I8O A;  1YYK A;  2B7T A;  4TUG A;  3ADL A;  2EN8 A;  2DIX A;  3MHH C;  4ZYH A;  4KZS A;  4Q28 A;  4DV4 E;  3T1Y E;  2LRS A;  4BCA A;  4M0V A;  1N36 E;  1MEY C;  2YRM A;  2EMX A;  2UUB E;  2WBS A;  2MKN A;  2F4V E;  4O5G A;  1BB8 A;  4MLV A;  4J8Z A;  4B3R E;  4R2E A;  4JI2 E;  2FTX B;  5T6J A;  3M99 B;  2JY9 A;  1UN6 B;  2EP3 A;  4F6M A;  4IJD A;  2EOS A;  5AE2 A;  4O4K A;  2LCE A;  4LF5 E;  5ADZ A;  1A1K A;  4B3S E;  3VYX A;  2EML A;  4R8O A;  5KL5 A;  2LV2 A;  2EM3 A;  1HR0 E;  4DUY E;  1UIL A;  2MC5 A;  1TF6 A;  5AC5 A;  5F3W A;  5TSE A;  1FKA E;  2VE7 C;  4R2A A;  2EOM A;  4F2J C;  2EMG A;  1GZ6 A;  4RH8 A;  4JI8 E;  2JP9 A;  2DLQ A;  3JU0 A;  4L5N C;  4WPY A;  2VF1 A;  4HTG A;  1QU6 A;  4LF7 E;  2EN7 A;  4OX9 E;  3J7Y p;  2EE8 A;  3J81 C;  2I13 A;  2MKD A;  3C6K A;  3VK6 A;  2PRT A;  4Q35 B;  2EOH A;  1X6H A;  2EQ3 A;  2NUG A;  3C4T A;  1X6E A;  2EM8 A;  5A2Q C;  1T4L B;  1A1J A;  2EPX A;  2L2M A;  1A1F A;  2YU5 A;  2UU9 E;  4DMI A;  1X5W A;  4LU9 A;  4F54 A;  1X3C A;  1RQ0 A;  2BB8 A;  2EQ0 A;  3LLH A;  3C4B A;  2YTQ A;  5IXM B;  2EM5 A;  4LTY A;  5A6B A;  4RHB B;  4X65 E;  4X66 E;  1G2D C;  4WXD A;  5CFF E;  2LTR A;  4R2Q A;  1B69 A;  2YTG A;  1KYQ A;  3HQ1 A;  4LFC E;  3F6G A;  4GZN C;  2LO3 A;  4R2C A;  4JI3 E;  1T4N A;  2JOB A;  4ZYE A;  4LF9 E;  2RS6 A;  4B3M E;  2DRP A;  2L3J A;  4DV5 E;  2V83 A;  2N3G A;  2EPA A;  2R1F A;  3MHS C;  5AE1 A;  3KZZ A;  4WSP A;  1TF3 A;  2DLK A;  3F6H A;  2L3C A;  1HNW E;  2EQ1 A;  2JOX A;  1P47 A;  2EOF A;  4KHP E;  2EOX A;  1JK2 A;  4P7D A;  2G7H A;  2EM2 A;  2LVH A;  3ADJ A;  2EL4 A;  4LF6 E;  2RS7 A;  1JK1 A;  2WCC 3;  1A1G A;  2YTE A;  1ZBT A;  2L2N A;  4DR5 E;  1WJP A;  5AE3 A;  1LLM C;  1YSA C;  2JWO A;  4DV7 E;  2EL5 A;  1SR9 A;  2EPU A;  2RSM A;  1XMQ E;  2NUE A;  2EM4 A;  3JTZ A;  1PJS A;  2YRK A;  2LUP B;  1BBO A;  2V88 A;  4YY3 E;  3EPK A;  4NXM E;  1XNR E;  4WYQ B;  4GKK E;  2YPN A;  3EPH A;  4L8N A;  2D9H A;  2JR1 A;  2UUC E;  2LE2 A;  4ZYD A;  2EOE A;  5A6K A;  4GKJ E;  2YTF A;  3LML A;  4LF8 E;  1MGT A;  2YTO A;  3AV0 A;  1X47 A;  3T1H E;  2FV4 B;  2YU8 A;  2YSP A;  2VQF E;  4WX9 A;  4JI0 E;  3ADI A;  3EPJ A;  2CSH A;  2EN4 A;  5LL6 R; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  4M9V C;  2YTN A;  4R2S A;  2EM7 A;  2YSO A;  2EPP A;  2EN7 A;  2DMI A;  2EE8 A;  4R2P A;  2I13 A;  2MKD A;  4WSG A;  2PRT A;  4FK5 C;  2CTD A;  2HGH A;  2A25 A;  2EMZ A;  1RMD A;  2EOH A;  2YTD A;  1X6H A;  4F6N A;  2EQ3 A;  5KL6 A;  1X6E A;  1ZR9 A;  1YUI A;  2EM8 A;  2EMW A;  5KL2 A;  1A1J A;  2EPX A;  1A1F A;  2EOQ A;  2YU5 A;  1ZAA C;  2JPA A;  1X5W A;  1X3C A;  2BB8 A;  2EM0 A;  2EQ0 A;  2M9A A;  2YTJ A;  2EMK A;  2EPZ A;  2YTQ A;  2EM5 A;  2EMB A;  2EMA A;  2ELY A;  2EMI A;  1G2D C;  4R2Q A;  1B69 A;  2EMC A;  2YTG A;  2EM6 A;  2EOO A;  1A1H A;  2GLI A;  2ENH A;  2ENC A;  4GZN C;  2LO3 A;  4R2C A;  4X9J A;  2EOY A;  2EOR A;  2EJ4 A;  2DRP A;  2LT7 A;  2RPC A;  2CT1 A;  2EPA A;  4IS1 C;  2EMH A;  2EL6 A;  2R1F A;  2EN3 A;  3MHS C;  1TF3 A;  2DLK A;  2NAB A;  1X6F A;  2EQ1 A;  1Z1B A;  1P47 A;  5KL7 A;  2EOJ A;  2EOF A;  1A1L A;  2RSI A;  2EOX A;  2EPC A;  2EM9 A;  2E72 A;  1JK2 A;  5KL3 A;  2EMF A;  1A1I A;  2EM2 A;  1NCS A;  2LVH A;  4R2R A;  2EL4 A;  1DGC A;  1JK1 A;  2WCC 3;  1A1G A;  2YTE A;  4R2D A;  2EN8 A;  3MHH C;  1WJP A;  2YTI A;  1LLM C;  1YSA C;  5KL4 A;  2EL5 A;  2VRD A;  2ENA A;  2EPU A;  2EM4 A;  1MEY C;  2YRM A;  2EMX A;  2EOI A;  1UBD C;  2WBS A;  2YRK A;  2MKN A;  2ELZ A;  1BBO A;  1BB8 A;  2WBT A;  3EPK A;  1TN9 A;  2MDG A;  2WBU A;  4R2E A;  3EPL A;  2EPR A;  3VHT B;  3EPH A;  3M99 B;  1UN6 B;  2EP3 A;  4F6M A;  4IJD A;  2D9H A;  2EOS A;  2ADR A;  2LCE A;  3UK3 C;  2EMY A;  1A1K A;  1KJK A;  2EML A;  2EOE A;  2YRH A;  5KL5 A;  2LV2 A;  2EM3 A;  2EN1 A;  2YTF A;  1TF6 A;  2YTO A;  2YTP A;  1F2I G;  1YUJ A;  2GHF A;  2EN6 A;  2YU8 A;  2YSP A;  4R2A A;  3EPJ A;  2EOM A;  2CSH A;  4F2J C;  2EMG A;  1G2F C;  2JP9 A;  1AAY A;  2EN4 A;  2DLQ A;  2J7J A;  2DGC A;  2EOZ A;  2EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...