2RS6A

Solution structure of the n-terminal dsrbd from rna helicase a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase A
total genus 22
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs6A01
2LTSA 2UXBE 4B3RE 5LMUE 2MDRA 2N3GA 4M2ZA 2JVAA 1N34E 1UHZA 4X62E 5CFFE 4X65E 4JI2E 1FKAE 1X48A 2UUCE 4DR2E 2B7VA 2L2NA 4YY3E 1GQEA 2F4VE 4JV5E 2LRSA 4DUYE 4B3ME 4JI6E 4B3SE 4LF6E 3T1HE 3ADLA 4DV4E 1X49A 4JI8E 2L3JA 2RSMA 2JY9A 4GKKE 4DV2E 3C4TA 1RC7A 2YT4A 2NUFA 4LF7E 1IBKE 4JI1E 1HNZE 2NUEA 3VYYA 3ADIA 2E5LE 4LFCE 1T4NA 1YYWA 1N33E 4DV3E 4DV7E 3HTXA 2LJHA 2CPNA 4X8WA 3ADJA 2L3CA 4KHPE 4LF8E 1XNQE 4NXME 1RQ0A 1UILA 5IWAE 1PKPA 1N36E 4DR3E 2UU9E 4DR7E 2UUAE 1EKZA 2NA2A 1YYOA 1T4LB 4JI7E 2UUBE 1J26A 2L33A 1YYKA 2DMYA 2VQEE 4YHHE 5LMNE 1XMOE 1YZ9A 4WFTA 4DR6E 2B7TA 4DV1E 1T4OA 2IHR1 4JI5E 2N3HA 1N32E 1STUA 4B3TE 2UXDE 1O0WA 4OOGC 2VQFE 4DV6E 2DB2A 4DR5E 2RS7A 1XNRE 3LLHA 2UXCE 4DR1E 4LFAE 1X47A 4JI3E 1IBME 2ZM6E 3ADGA 4LF9E 4NXNE 2RTXA 3T1YE 2LBSB 2EZ6A 2HHHE 1HNXE 4OX9E 4WYQB 2LUQA 1XMQE 2DIXA 2L2KB 4LF4E 4DV0E 4X64E 1WHQA 1J5EE 2LTRA 1WHNA 1ZBTA 4LFBE 2LUPB 3VYXA 4GKJE 4K0KE 2B3TB 1QU6A 3P1XA 2RS6A 4DV5E 5BR8E 1HNWE 1HR0E 4DKKA 4JI4E 4DR4E 4LF5E 2NUGA 4X66E 2L2MA 1I94E 2KHXA 1FJGE 3OTOE 1IBLE 4JYAE 4M30A 4DUZE 4JI0E 3J7Yp 1DI2A 4AQYE 3C4BA
chains in the Genus database with same CATH superfamily
4GZNC 5LMUE 2EMZA 2BB8A 3VK6A 2EPRA 2N3GA 4B3RE 2JP9A 2L8TA 3K6QA 2JVAA 1UHZA 4F9AB 2J7JA 2RPCA 2EPUA 4JI2E 1YUJA 1FKAE 1X48A 2UUCE 4DR2E 2EN8A 4M0VA 2K4VA 3ADLA 4DV4E 1X49A 1IQSA 2RSMA 5A6JA 2V89A 2RQLA 2JY9A 3F6GA 4GEQB 4DV2E 2YTIA 3HXLA 1RC7A 1BBOA 3FIGA 4BS9A 5A2QC 1X6FA 2EMHA 2MC6A 1T4NA 1N33E 2I9IA 5TSEA 3HTXA 1JK2A 4LU9A 2EPOA 3J7AG 2EPLX 3JU0A 2EMGA 4KHPE 5T6JA 1EH8A 2EMFA 1ZAAC 2R76A 4M9VC 5IWAE 3BF2A 2UU9E 5A6KA 2EMBA 1A1KA 2EM3A 2UUBE 2NABA 2V85A 2L33A 2EOOA 5F3WA 1YYKA 2DMYA 3BBGA 4DR6E 4N4RB 2MC5A 2B7TA 4DV1E 2YTFA 1T4OA 1A1GA 2N3HA 1SR9A 3L00A 1STUA 1YPNA 4F6MA 2UXCE 1X47A 2VF1A 5DNYA 2ZM6E 1TN9A 2RTXA 3KZYA 4ZYHA 2D9HA 4WYQB 2A25A 2LUQA 3C6KA 1XMQE 1EH6A 2CT1A 4DV0E 4X64E 3ECRA 2E72A 1A1FA 4R03A 2LTRA 2YTDA 2LVHA 2LT7A 4L5NC 1WHNA 2Q8UA 2EPCA 2YU5A 1PDAA 2YSOA 4KZSA 3F6HA 2EPZA 5KL2A 5BR8E 2EQ0A 4BMJA 1HNWE 4DR4E 4F9CB 2V83A 2EM0A 2KHXA 4WSPA 2PRTA 4J8ZA 1IBLE 2EM2A 2EPNA 3J7Yp 2YPNA 4TUGA 2LTSA 2MDRA 4M2ZA 3J81C 4X62E 5CFFE 2WBUA 2KONA 2ELYA 2EPKX 1WJPA 4Q35B 1ZU1A 2JOBA 2YU8A 2EMWA 4B3ME 4JI6E 1WRJA 2EOYA 2WBTA 4B3SE 3T1HE 4LF6E 2GPIA 3BGHA 4WXDA 4F9BB 5AE1A 2EPAA 4Q28A 2NUFA 3H09A 4LF7E 2YWQA 3LMLA 1HNZE 4WXCA 3ADIA 1YYWA 1JK1A 4DV3E 2EP3A 2LJHA 2YRHA 2V88A 2DRPA 4HEIA 3DJWA 4TUIA 3RMPA 4DR3E 4DR7E 1A1IA 2V8QB 4KWYA 3UK3C 2NA2A 1YYOA 2EMKA 3EPKA 2EORA 4R2AA 2M7QA 2VQEE 4YHHE 1XMOE 1YZ9A 4BHBA 2WBSA 4L8NA 4ZYGA 1B69A 3AUZA 3THNA 4OOGC 4DV6E 1PJTA 4DR5E 1XNRE 1BB8A 1MEYC 4X9JA 2EOHA 1KYQA 1F2IG 3T1YE 2LBSB 2EZ6A 2HHHE 1HNXE 4NHRA 2DIXA 2JPAA 2EM6A 2EN3A 4IJDA 2EM7A 1ZBTA 2EM9A 2LCEA 2R1FA 2WZOA 3VYXA 3QG5C 4K0KE 2B3TB 2RS6A 5KL4A 4DV5E 5A6BD 2YTNA 5A6BA 1RMDA 4LF5E 1SFEA 1G2DC 2EOEA 2ODRC 2EOXA 2EPXA 3OTOE 2I13A 4JYAE 1YUIA 2EOSA 4FK5C 4JI0E 2EMAA 1IQOA 3C4BA 3BIDA 2JOXA 1WXRA 4BCAA 4R2RA 3VHTB 1X6EA 2MKDA 4X65E 2N8XA 4DMIA 1A1HA 2F4VE 2L2NA 4NZVA 1GQEA 4YY3E 4JV5E 2LRSA 4DUYE 2EMXA 1A1LA 4JI8E 4O24A 2L3JA 4HTGA 2YTEA 1LLMC 1MGTA 2YRMA 2M9AA 2EL6A 1QNTA 2YT4A 4F2JC 1IBKE 4JI1E 2EMIA 2NUEA 1YFHA 1PJQA 3VYYA 4P78A 2YRKA 1AAYA 2LV2A 5FLXC 3EPJA 5IXMB 4ZYDA 2CPNA 4X8WA 3HQ1A 2L6MA 1PJSA 1NCSA 4NXME 1RQ0A 1PKPA 2UUAE 4R2EA 1J26A 2CTDA 2EOZA 4WFTA 2JR1A 5A6AA 2KOUA 2IHR1 2EMLA 4JI5E 2WCC3 2EL5A 2DGCA 4B3TE 2H36X 1O0WA 2EQ1A 1A1JA 2DB2A 2EM4A 2K7IA 4WPYA 2GHFA 4DR1E 1IBME 2ELZA 2FV4B 3TQMA 4O4KA 4LF9E 3DF6A 4R2SA 1X5WA 4OX9E 3HPZA 1TF6A 1Z1BA 2MDGA 3C6MA 2L2KB 1L4SA 2EN6A 4LF4E 2HJJA 2EPPA 1J5EE 1IMUA 3KZZA 2ODRD 3ZOQB 3MHHC 4RH8A 5A69A 2EMCA 5LL6R 2ENAA 2LUPB 2EM5A 4F6NA 5KL6A 2LMZA 4WSGA 1QU6A 2EOQA 3P1XA 5KL5A 4IS1C 3EQ1A 2DMIA 2EL4A 4DKKA 4ZYEA 2LJUA 2EOMA 1KJKA 4O5GA 4X66E 2L2MA 2EN1A 2F8BA 1FJGE 1ZR9A 1X3CA 2FGGA 4BBYA 1GZ6A 5AE3A 2JYAA 1DI2A 4MLVA 2UXBE 3HPSA 2LO3A 4LTYA 3JAMC 1UBDC 2B9DA 2YTOA 1N34E 2EOIA 4MLQA 5KL7A 2JXPA 3IWCA 4P7DA 2B7VA 4R2DA 1YSAC 4R2PA 4RHBB 2LE2A 1X6HA 2EM8A 1T39A 5IV8B 3M99B 4GKKE 4I8OA 3C4TA 2ENHA 5ADZA 2EWLA 2E5LE 4LFCE 3IWBA 3EPLA 3KWRA 4DV7E 4R8OA 3ADJA 3MSWA 1DQ3A 3AV0A 1BBGA 2L3CA 4LF8E 1XNQE 2ADRA 2HGHA 1UILA 1N36E 2DLQA 1EKZA 3OMLA 3IWDA 1T38A 1G2FC 1AH5A 4JI7E 1T4LB 1GTKA 2VRDA 2YTQA 2BBGA 2YTGA 5KL3A 4R2QA 5IT9C 1ZBQA 5LMNE 4O43A 1EH7A 1N32E 2UXDE 3EPHA 1N3GA 2VQFE 1DGCA 5LLQA 2RS7A 2EE8A 2EPMX 2FTXB 3LLHA 2EQ3A 4LFAE 3J80C 4BHCA 4JI3E 4F54A 2VE7C 3ADGA 2RSIA 2YZTA 5AASA 2ENCA 4WX9A 2EMYA 2EOFA 3JTZA 4NXNE 2EN2A 2V86A 4BC9A 1UN6B 1P47A 1WHQA 2DSYA 2EOJA 2M4IA 1NEIA 4BC7A 2MKNA 2EJ4A 2GLIA 2E1MA 2EN7A 4LFBE 2YSPA 3THOB 5AC4A 2L92A 4GKJE 2CSHA 1TF3A 2YTPA 1HR0E 4JI4E 2HC5A 2V87A 2NUGA 3MHSC 2M1SA 2YTJA 1I94E 2G7HA 2JWOA 2DLKA 5AC5A 4DUZE 2EN4A 5AE2A 4R2CA 4AQYE 4M30A
chains in the Genus database with same CATH topology
2LTSA 2UXBE 3HPSA 2JOXA 1WXRA 3VK6A 5LMUE 2MDRA 2N3GA 4LTYA 4M2ZA 4B3RE 4BCAA 2L8TA 3JAMC 3J81C 3K6QA 2JVAA 2B9DA 1N34E 1UHZA 4F9AB 5CFFE 4X62E 2KONA 4X65E 4JI2E 4DMIA 1FKAE 1X48A 3IWCA 4P7DA 2B7VA 2L2NA 4M0VA 1GQEA 4YY3E 4DR2E 2F4VE 2JOBA 4JV5E 2LRSA 4DUYE 4B3ME 4JI6E 2K4VA 4B3SE 2LE2A 4LF6E 3T1HE 3ADLA 4DV4E 1X49A 4JI8E 2L3JA 2RSMA 4F9BB 2V89A 3F6GA 2JY9A 4GEQB 5AE1A 4GKKE 4DV2E 4I8OA 3C4TA 3HXLA 5ADZA 1RC7A 2UUCE 4Q28A 2YT4A 2NUFA 3FIGA 4BS9A 3H09A 5A2QC 4LF7E 2EWLA 1IBKE 4JI1E 3LMLA 1HNZE 2NUEA 2MC6A 3VYYA 4P78A 3ADIA 2E5LE 4LFCE 3IWBA 5FLXC 1T4NA 3KWRA 1YYWA 1N33E 4DV3E 4DV7E 3HTXA 2LJHA 2CPNA 4X8WA 4LU9A 3HQ1A 3J7AG 3ADJA 3JU0A 2V88A 1DQ3A 2L6MA 3AV0A 3MSWA 4R8OA 5T6JA 3DJWA 2L3CA 4LF8E 4KHPE 4TUIA 1XNQE 3RMPA 4NXME 1RQ0A 1UILA 5IWAE 1PKPA 1N36E 4DR3E 2UU9E 4DR7E 2V8QB 2UUAE 1EKZA 2NA2A 3OMLA 3IWDA 1YYOA 1T4LB 4JI7E 2UUBE 2V85A 2L33A 5F3WA 2M7QA 1YYKA 2DMYA 2VQEE 1J26A 4YHHE 1ZBQA 5LMNE 5IT9C 1XMOE 4WFTA 1YZ9A 2MC5A 2JR1A 2B7TA 4DV1E 4DR6E 1T4OA 2KOUA 2IHR1 4JI5E 2N3HA 1SR9A 1N32E 4L8NA 1STUA 4B3TE 2UXDE 2H36X 1O0WA 3AUZA 4OOGC 2VQFE 4DV6E 2DB2A 4DR5E 2RS7A 4WPYA 2FTXB 1XNRE 3LLHA 2UXCE 4DR1E 4LFAE 1X47A 3J80C 4JI3E 2VF1A 4F54A 2VE7C 5DNYA 3ADGA 2FV4B 2YZTA 5AASA 2ZM6E 1IBME 4LF9E 3JTZA 4NXNE 2RTXA 2V86A 3T1YE 3DF6A 4BC9A 2LBSB 2EZ6A 2HHHE 1HNXE 4OX9E 4WYQB 2LUQA 3HPZA 1XMQE 2DIXA 2L2KB 4LF4E 4DV0E 4X64E 1WHQA 1J5EE 2DSYA 2ODRD 4R03A 2LTRA 2M4IA 3ZOQB 4BC7A 4L5NC 2E1MA 1WHNA 1ZBTA 5LL6R 4LFBE 2WZOA 2LUPB 3VYXA 4GKJE 2L92A 2LMZA 2B3TB 4K0KE 4KZSA 3F6HA 1QU6A 3P1XA 2RS6A 4DV5E 5BR8E 4BMJA 1HNWE 1HR0E 4DKKA 4JI4E 4DR4E 2V87A 4F9CB 2V83A 4LF5E 2NUGA 2M1SA 2L2MA 4X66E 1I94E 2KHXA 2F8BA 2G7HA 2JWOA 2ODRC 4WSPA 4J8ZA 3OTOE 1IBLE 2FGGA 4BBYA 1FJGE 4JYAE 1GZ6A 5AE3A 4M30A 4DUZE 4JI0E 3J7Yp 5AE2A 1DI2A 4AQYE 3C4BA 4TUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  2UXB E;  4B3R E;  5LMU E;  2MDR A;  2N3G A;  4M2Z A;  2JVA A;  1N34 E;  1UHZ A;  4X62 E;  5CFF E;  4X65 E;  4JI2 E;  1FKA E;  1X48 A;  2UUC E;  4DR2 E;  2B7V A;  2L2N A;  4YY3 E;  1GQE A;  2F4V E;  4JV5 E;  2LRS A;  4DUY E;  4B3M E;  4JI6 E;  4B3S E;  4LF6 E;  3T1H E;  3ADL A;  4DV4 E;  1X49 A;  4JI8 E;  2L3J A;  2RSM A;  2JY9 A;  4GKK E;  4DV2 E;  3C4T A;  1RC7 A;  2YT4 A;  2NUF A;  4LF7 E;  1IBK E;  4JI1 E;  1HNZ E;  2NUE A;  3VYY A;  3ADI A;  2E5L E;  4LFC E;  1T4N A;  1YYW A;  1N33 E;  4DV3 E;  4DV7 E;  3HTX A;  2LJH A;  2CPN A;  4X8W A;  3ADJ A;  2L3C A;  4KHP E;  4LF8 E;  1XNQ E;  4NXM E;  1RQ0 A;  1UIL A;  5IWA E;  1PKP A;  1N36 E;  4DR3 E;  2UU9 E;  4DR7 E;  2UUA E;  1EKZ A;  2NA2 A;  1YYO A;  1T4L B;  4JI7 E;  2UUB E;  1J26 A;  2L33 A;  1YYK A;  2DMY A;  2VQE E;  4YHH E;  5LMN E;  1XMO E;  1YZ9 A;  4WFT A;  4DR6 E;  2B7T A;  4DV1 E;  1T4O A;  2IHR 1;  4JI5 E;  2N3H A;  1N32 E;  1STU A;  4B3T E;  2UXD E;  1O0W A;  4OOG C;  2VQF E;  4DV6 E;  2DB2 A;  4DR5 E;  2RS7 A;  1XNR E;  3LLH A;  2UXC E;  4DR1 E;  4LFA E;  1X47 A;  4JI3 E;  1IBM E;  2ZM6 E;  3ADG A;  4LF9 E;  4NXN E;  2RTX A;  3T1Y E;  2LBS B;  2EZ6 A;  2HHH E;  1HNX E;  4OX9 E;  4WYQ B;  2LUQ A;  1XMQ E;  2DIX A;  2L2K B;  4LF4 E;  4DV0 E;  4X64 E;  1WHQ A;  1J5E E;  2LTR A;  1WHN A;  1ZBT A;  4LFB E;  2LUP B;  3VYX A;  4GKJ E;  4K0K E;  2B3T B;  1QU6 A;  3P1X A;  2RS6 A;  4DV5 E;  5BR8 E;  1HNW E;  1HR0 E;  4DKK A;  4JI4 E;  4DR4 E;  4LF5 E;  2NUG A;  4X66 E;  2L2M A;  1I94 E;  2KHX A;  1FJG E;  3OTO E;  1IBL E;  4JYA E;  4M30 A;  4DUZ E;  4JI0 E;  3J7Y p;  1DI2 A;  4AQY E;  3C4B A; 
#chains in the Genus database with same CATH topology
 4GZN C;  5LMU E;  2EMZ A;  2BB8 A;  3VK6 A;  2EPR A;  2N3G A;  4B3R E;  2JP9 A;  2L8T A;  3K6Q A;  2JVA A;  1UHZ A;  4F9A B;  2J7J A;  2RPC A;  2EPU A;  4JI2 E;  1YUJ A;  1FKA E;  1X48 A;  2UUC E;  4DR2 E;  2EN8 A;  4M0V A;  2K4V A;  3ADL A;  4DV4 E;  1X49 A;  1IQS A;  2RSM A;  5A6J A;  2V89 A;  2RQL A;  2JY9 A;  3F6G A;  4GEQ B;  4DV2 E;  2YTI A;  3HXL A;  1RC7 A;  1BBO A;  3FIG A;  4BS9 A;  5A2Q C;  1X6F A;  2EMH A;  2MC6 A;  1T4N A;  1N33 E;  2I9I A;  5TSE A;  3HTX A;  1JK2 A;  4LU9 A;  2EPO A;  3J7A G;  2EPL X;  3JU0 A;  2EMG A;  4KHP E;  5T6J A;  1EH8 A;  2EMF A;  1ZAA C;  2R76 A;  4M9V C;  5IWA E;  3BF2 A;  2UU9 E;  5A6K A;  2EMB A;  1A1K A;  2EM3 A;  2UUB E;  2NAB A;  2V85 A;  2L33 A;  2EOO A;  5F3W A;  1YYK A;  2DMY A;  3BBG A;  4DR6 E;  4N4R B;  2MC5 A;  2B7T A;  4DV1 E;  2YTF A;  1T4O A;  1A1G A;  2N3H A;  1SR9 A;  3L00 A;  1STU A;  1YPN A;  4F6M A;  2UXC E;  1X47 A;  2VF1 A;  5DNY A;  2ZM6 E;  1TN9 A;  2RTX A;  3KZY A;  4ZYH A;  2D9H A;  4WYQ B;  2A25 A;  2LUQ A;  3C6K A;  1XMQ E;  1EH6 A;  2CT1 A;  4DV0 E;  4X64 E;  3ECR A;  2E72 A;  1A1F A;  4R03 A;  2LTR A;  2YTD A;  2LVH A;  2LT7 A;  4L5N C;  1WHN A;  2Q8U A;  2EPC A;  2YU5 A;  1PDA A;  2YSO A;  4KZS A;  3F6H A;  2EPZ A;  5KL2 A;  5BR8 E;  2EQ0 A;  4BMJ A;  1HNW E;  4DR4 E;  4F9C B;  2V83 A;  2EM0 A;  2KHX A;  4WSP A;  2PRT A;  4J8Z A;  1IBL E;  2EM2 A;  2EPN A;  3J7Y p;  2YPN A;  4TUG A;  2LTS A;  2MDR A;  4M2Z A;  3J81 C;  4X62 E;  5CFF E;  2WBU A;  2KON A;  2ELY A;  2EPK X;  1WJP A;  4Q35 B;  1ZU1 A;  2JOB A;  2YU8 A;  2EMW A;  4B3M E;  4JI6 E;  1WRJ A;  2EOY A;  2WBT A;  4B3S E;  3T1H E;  4LF6 E;  2GPI A;  3BGH A;  4WXD A;  4F9B B;  5AE1 A;  2EPA A;  4Q28 A;  2NUF A;  3H09 A;  4LF7 E;  2YWQ A;  3LML A;  1HNZ E;  4WXC A;  3ADI A;  1YYW A;  1JK1 A;  4DV3 E;  2EP3 A;  2LJH A;  2YRH A;  2V88 A;  2DRP A;  4HEI A;  3DJW A;  4TUI A;  3RMP A;  4DR3 E;  4DR7 E;  1A1I A;  2V8Q B;  4KWY A;  3UK3 C;  2NA2 A;  1YYO A;  2EMK A;  3EPK A;  2EOR A;  4R2A A;  2M7Q A;  2VQE E;  4YHH E;  1XMO E;  1YZ9 A;  4BHB A;  2WBS A;  4L8N A;  4ZYG A;  1B69 A;  3AUZ A;  3THN A;  4OOG C;  4DV6 E;  1PJT A;  4DR5 E;  1XNR E;  1BB8 A;  1MEY C;  4X9J A;  2EOH A;  1KYQ A;  1F2I G;  3T1Y E;  2LBS B;  2EZ6 A;  2HHH E;  1HNX E;  4NHR A;  2DIX A;  2JPA A;  2EM6 A;  2EN3 A;  4IJD A;  2EM7 A;  1ZBT A;  2EM9 A;  2LCE A;  2R1F A;  2WZO A;  3VYX A;  3QG5 C;  4K0K E;  2B3T B;  2RS6 A;  5KL4 A;  4DV5 E;  5A6B D;  2YTN A;  5A6B A;  1RMD A;  4LF5 E;  1SFE A;  1G2D C;  2EOE A;  2ODR C;  2EOX A;  2EPX A;  3OTO E;  2I13 A;  4JYA E;  1YUI A;  2EOS A;  4FK5 C;  4JI0 E;  2EMA A;  1IQO A;  3C4B A;  3BID A;  2JOX A;  1WXR A;  4BCA A;  4R2R A;  3VHT B;  1X6E A;  2MKD A;  4X65 E;  2N8X A;  4DMI A;  1A1H A;  2F4V E;  2L2N A;  4NZV A;  1GQE A;  4YY3 E;  4JV5 E;  2LRS A;  4DUY E;  2EMX A;  1A1L A;  4JI8 E;  4O24 A;  2L3J A;  4HTG A;  2YTE A;  1LLM C;  1MGT A;  2YRM A;  2M9A A;  2EL6 A;  1QNT A;  2YT4 A;  4F2J C;  1IBK E;  4JI1 E;  2EMI A;  2NUE A;  1YFH A;  1PJQ A;  3VYY A;  4P78 A;  2YRK A;  1AAY A;  2LV2 A;  5FLX C;  3EPJ A;  5IXM B;  4ZYD A;  2CPN A;  4X8W A;  3HQ1 A;  2L6M A;  1PJS A;  1NCS A;  4NXM E;  1RQ0 A;  1PKP A;  2UUA E;  4R2E A;  1J26 A;  2CTD A;  2EOZ A;  4WFT A;  2JR1 A;  5A6A A;  2KOU A;  2IHR 1;  2EML A;  4JI5 E;  2WCC 3;  2EL5 A;  2DGC A;  4B3T E;  2H36 X;  1O0W A;  2EQ1 A;  1A1J A;  2DB2 A;  2EM4 A;  2K7I A;  4WPY A;  2GHF A;  4DR1 E;  1IBM E;  2ELZ A;  2FV4 B;  3TQM A;  4O4K A;  4LF9 E;  3DF6 A;  4R2S A;  1X5W A;  4OX9 E;  3HPZ A;  1TF6 A;  1Z1B A;  2MDG A;  3C6M A;  2L2K B;  1L4S A;  2EN6 A;  4LF4 E;  2HJJ A;  2EPP A;  1J5E E;  1IMU A;  3KZZ A;  2ODR D;  3ZOQ B;  3MHH C;  4RH8 A;  5A69 A;  2EMC A;  5LL6 R;  2ENA A;  2LUP B;  2EM5 A;  4F6N A;  5KL6 A;  2LMZ A;  4WSG A;  1QU6 A;  2EOQ A;  3P1X A;  5KL5 A;  4IS1 C;  3EQ1 A;  2DMI A;  2EL4 A;  4DKK A;  4ZYE A;  2LJU A;  2EOM A;  1KJK A;  4O5G A;  4X66 E;  2L2M A;  2EN1 A;  2F8B A;  1FJG E;  1ZR9 A;  1X3C A;  2FGG A;  4BBY A;  1GZ6 A;  5AE3 A;  2JYA A;  1DI2 A;  4MLV A;  2UXB E;  3HPS A;  2LO3 A;  4LTY A;  3JAM C;  1UBD C;  2B9D A;  2YTO A;  1N34 E;  2EOI A;  4MLQ A;  5KL7 A;  2JXP A;  3IWC A;  4P7D A;  2B7V A;  4R2D A;  1YSA C;  4R2P A;  4RHB B;  2LE2 A;  1X6H A;  2EM8 A;  1T39 A;  5IV8 B;  3M99 B;  4GKK E;  4I8O A;  3C4T A;  2ENH A;  5ADZ A;  2EWL A;  2E5L E;  4LFC E;  3IWB A;  3EPL A;  3KWR A;  4DV7 E;  4R8O A;  3ADJ A;  3MSW A;  1DQ3 A;  3AV0 A;  1BBG A;  2L3C A;  4LF8 E;  1XNQ E;  2ADR A;  2HGH A;  1UIL A;  1N36 E;  2DLQ A;  1EKZ A;  3OML A;  3IWD A;  1T38 A;  1G2F C;  1AH5 A;  4JI7 E;  1T4L B;  1GTK A;  2VRD A;  2YTQ A;  2BBG A;  2YTG A;  5KL3 A;  4R2Q A;  5IT9 C;  1ZBQ A;  5LMN E;  4O43 A;  1EH7 A;  1N32 E;  2UXD E;  3EPH A;  1N3G A;  2VQF E;  1DGC A;  5LLQ A;  2RS7 A;  2EE8 A;  2EPM X;  2FTX B;  3LLH A;  2EQ3 A;  4LFA E;  3J80 C;  4BHC A;  4JI3 E;  4F54 A;  2VE7 C;  3ADG A;  2RSI A;  2YZT A;  5AAS A;  2ENC A;  4WX9 A;  2EMY A;  2EOF A;  3JTZ A;  4NXN E;  2EN2 A;  2V86 A;  4BC9 A;  1UN6 B;  1P47 A;  1WHQ A;  2DSY A;  2EOJ A;  2M4I A;  1NEI A;  4BC7 A;  2MKN A;  2EJ4 A;  2GLI A;  2E1M A;  2EN7 A;  4LFB E;  2YSP A;  3THO B;  5AC4 A;  2L92 A;  4GKJ E;  2CSH A;  1TF3 A;  2YTP A;  1HR0 E;  4JI4 E;  2HC5 A;  2V87 A;  2NUG A;  3MHS C;  2M1S A;  2YTJ A;  1I94 E;  2G7H A;  2JWO A;  2DLK A;  5AC5 A;  4DUZ E;  2EN4 A;  5AE2 A;  4R2C A;  4AQY E;  4M30 A; 
#chains in the Genus database with same CATH homology
 2LTS A;  2UXB E;  3HPS A;  2JOX A;  1WXR A;  3VK6 A;  5LMU E;  2MDR A;  2N3G A;  4LTY A;  4M2Z A;  4B3R E;  4BCA A;  2L8T A;  3JAM C;  3J81 C;  3K6Q A;  2JVA A;  2B9D A;  1N34 E;  1UHZ A;  4F9A B;  5CFF E;  4X62 E;  2KON A;  4X65 E;  4JI2 E;  4DMI A;  1FKA E;  1X48 A;  3IWC A;  4P7D A;  2B7V A;  2L2N A;  4M0V A;  1GQE A;  4YY3 E;  4DR2 E;  2F4V E;  2JOB A;  4JV5 E;  2LRS A;  4DUY E;  4B3M E;  4JI6 E;  2K4V A;  4B3S E;  2LE2 A;  4LF6 E;  3T1H E;  3ADL A;  4DV4 E;  1X49 A;  4JI8 E;  2L3J A;  2RSM A;  4F9B B;  2V89 A;  3F6G A;  2JY9 A;  4GEQ B;  5AE1 A;  4GKK E;  4DV2 E;  4I8O A;  3C4T A;  3HXL A;  5ADZ A;  1RC7 A;  2UUC E;  4Q28 A;  2YT4 A;  2NUF A;  3FIG A;  4BS9 A;  3H09 A;  5A2Q C;  4LF7 E;  2EWL A;  1IBK E;  4JI1 E;  3LML A;  1HNZ E;  2NUE A;  2MC6 A;  3VYY A;  4P78 A;  3ADI A;  2E5L E;  4LFC E;  3IWB A;  5FLX C;  1T4N A;  3KWR A;  1YYW A;  1N33 E;  4DV3 E;  4DV7 E;  3HTX A;  2LJH A;  2CPN A;  4X8W A;  4LU9 A;  3HQ1 A;  3J7A G;  3ADJ A;  3JU0 A;  2V88 A;  1DQ3 A;  2L6M A;  3AV0 A;  3MSW A;  4R8O A;  5T6J A;  3DJW A;  2L3C A;  4LF8 E;  4KHP E;  4TUI A;  1XNQ E;  3RMP A;  4NXM E;  1RQ0 A;  1UIL A;  5IWA E;  1PKP A;  1N36 E;  4DR3 E;  2UU9 E;  4DR7 E;  2V8Q B;  2UUA E;  1EKZ A;  2NA2 A;  3OML A;  3IWD A;  1YYO A;  1T4L B;  4JI7 E;  2UUB E;  2V85 A;  2L33 A;  5F3W A;  2M7Q A;  1YYK A;  2DMY A;  2VQE E;  1J26 A;  4YHH E;  1ZBQ A;  5LMN E;  5IT9 C;  1XMO E;  4WFT A;  1YZ9 A;  2MC5 A;  2JR1 A;  2B7T A;  4DV1 E;  4DR6 E;  1T4O A;  2KOU A;  2IHR 1;  4JI5 E;  2N3H A;  1SR9 A;  1N32 E;  4L8N A;  1STU A;  4B3T E;  2UXD E;  2H36 X;  1O0W A;  3AUZ A;  4OOG C;  2VQF E;  4DV6 E;  2DB2 A;  4DR5 E;  2RS7 A;  4WPY A;  2FTX B;  1XNR E;  3LLH A;  2UXC E;  4DR1 E;  4LFA E;  1X47 A;  3J80 C;  4JI3 E;  2VF1 A;  4F54 A;  2VE7 C;  5DNY A;  3ADG A;  2FV4 B;  2YZT A;  5AAS A;  2ZM6 E;  1IBM E;  4LF9 E;  3JTZ A;  4NXN E;  2RTX A;  2V86 A;  3T1Y E;  3DF6 A;  4BC9 A;  2LBS B;  2EZ6 A;  2HHH E;  1HNX E;  4OX9 E;  4WYQ B;  2LUQ A;  3HPZ A;  1XMQ E;  2DIX A;  2L2K B;  4LF4 E;  4DV0 E;  4X64 E;  1WHQ A;  1J5E E;  2DSY A;  2ODR D;  4R03 A;  2LTR A;  2M4I A;  3ZOQ B;  4BC7 A;  4L5N C;  2E1M A;  1WHN A;  1ZBT A;  5LL6 R;  4LFB E;  2WZO A;  2LUP B;  3VYX A;  4GKJ E;  2L92 A;  2LMZ A;  2B3T B;  4K0K E;  4KZS A;  3F6H A;  1QU6 A;  3P1X A;  2RS6 A;  4DV5 E;  5BR8 E;  4BMJ A;  1HNW E;  1HR0 E;  4DKK A;  4JI4 E;  4DR4 E;  2V87 A;  4F9C B;  2V83 A;  4LF5 E;  2NUG A;  2M1S A;  2L2M A;  4X66 E;  1I94 E;  2KHX A;  2F8B A;  2G7H A;  2JWO A;  2ODR C;  4WSP A;  4J8Z A;  3OTO E;  1IBL E;  2FGG A;  4BBY A;  1FJG E;  4JYA E;  1GZ6 A;  5AE3 A;  4M30 A;  4DUZ E;  4JI0 E;  3J7Y p;  5AE2 A;  1DI2 A;  4AQY E;  3C4B A;  4TUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...