2RS6A

Solution structure of the n-terminal dsrbd from rna helicase a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase A
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 22
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs6A01
2UXCE 4LF6E 2B7TA 2NUFA 4DR1E 3ADJA 2N3HA 4DR2E 2B7VA 2UU9E 4LFCE 2MDRA 1UHZA 3VYXA 1N33E 4JI2E 1XNRE 2RS6A 1I94E 2UUAE 4X62E 1FJGE 2LTRA 4B3RE 4B3SE 4M30A 4LF7E 4WYQB 1HNWE 4DR5E 2L2KB 1T4LB 2LJHA 3C4BA 4LF8E 4DV5E 1XMOE 4B3ME 1RC7A 1N32E 4YHHE 4DV7E 4DR4E 2VQEE 2NA2A 4KHPE 4OX9E 1XNQE 4DR6E 3J7Yp 4X65E 1GQEA 4DUZE 2RS7A 4YY3E 2L3CA 2F4VE 3ADLA 1WHQA 2L2NA 4X66E 2DMYA 2JY9A 1X48A 2CPNA 1QU6A 4DV2E 2LTSA 4DV0E 2B3TB 1IBLE 4LF5E 4LFAE 4AQYE 5IWAE 2DIXA 3T1HE 1N36E 4K0KE 4JI1E 1XMQE 2IHR1 2UUBE 4JI7E 4X64E 3OTOE 2LUQA 4JI5E 1T4OA 2LRSA 4LF4E 1ZBTA 4JV5E 1EKZA 3P1XA 4DV1E 1N34E 2RSMA 3C4TA 4DV3E 4M2ZA 1RQ0A 3ADIA 1UILA 4NXNE 2UUCE 1HNXE 2LBSB 2VQFE 3T1YE 4JI3E 4JI0E 2UXDE 1YYKA 2N3GA 3LLHA 4JI4E 4DUYE 3HTXA 4DKKA 5BR8E 2L3JA 1HNZE 4JYAE 4WFTA 4GKKE 2ZM6E 5LMNE 3VYYA 1HR0E 4B3TE 4LF9E 2L33A 2E5LE 1X47A 4DR7E 4JI6E 1PKPA 2RTXA 1YZ9A 4NXME 2LUPB 2UXBE 4DV6E 2NUEA 1DI2A 2L2MA 4DR3E 4GKJE 1FKAE 1IBME 2HHHE 4DV4E 5CFFE 1J5EE 2KHXA 5LMUE 2EZ6A 1X49A 3ADGA 4JI8E 1WHNA 1YYWA 4LFBE 2YT4A 1IBKE 4X8WA 1T4NA 4OOGC 1STUA 1O0WA 1YYOA 1J26A 2JVAA 2NUGA 2DB2A
chains in the Genus database with same CATH superfamily
2EM3A 1YUIA 2VF1A 4R03A 3J81C 2E72A 2NUFA 4DR1E 2EMKA 1ZBQA 2B7VA 2EL4A 2UU9E 5A2QC 1RMDA 1SFEA 2EOYA 2M1SA 2MDRA 2EORA 2EPLX 4O5GA 4X62E 1FJGE 2ENAA 1JK2A 1F2IG 4M30A 4LF7E 4WYQB 1HNWE 5IT9C 4R2SA 2E1MA 2YPNA 4LF8E 1XMOE 1DQ3A 1GTKA 5LLQA 4O4KA 1WXRA 2R1FA 3HPZA 2M7QA 4KHPE 2LO3A 4OX9E 3H09A 4NHRA 4DR6E 2EWLA 5A69A 3JTZA 2F8BA 4DMIA 3RMPA 2RS7A 5ADZA 2F4VE 2ELZA 3ADLA 2EJ4A 1WHQA 1X5WA 1A1FA 2EMLA 2DMYA 2JY9A 3VHTB 2YTDA 4IJDA 1AH5A 2EOXA 2LTSA 2YTQA 3EQ1A 4HEIA 5IWAE 3F6HA 2LVHA 2WCC3 4JI1E 3HXLA 2LMZA 2V8QB 4X64E 1TF3A 3THNA 1L4SA 1G2FC 2RQLA 1QNTA 2YTNA 2EOZA 1UBDC 2ENHA 2JWOA 2EPKX 2WBTA 4DV3E 1TN9A 2V85A 2EL5A 1NCSA 4JI0E 4J8ZA 4GZNC 2N3GA 4JI4E 4NZVA 2EM0A 2YWQA 3EPLA 2EMIA 4GEQB 2EOHA 4BS9A 1A1LA 3MHSC 5KL5A 4GKKE 1BBOA 4RH8A 2ZM6E 4MLVA 2V89A 4KZSA 2RTXA 4F6MA 4DV6E 2I13A 2ADRA 2EL6A 4P78A 2L92A 3AUZA 4FK5C 3C6KA 4HTGA 5AE1A 2EN4A 1IBKE 4M9VC 1LLMC 1EH8A 2DB2A 2DMIA 2UXCE 4LF6E 2LE2A 5A6BD 2B7TA 3ADJA 2EPOA 4DR2E 4R2DA 4WXCA 3IWBA 2YTFA 2GLIA 3J80C 4JI2E 2UUAE 1YFHA 4ZYDA 2EMYA 2JOXA 2LTRA 2EM9A 4O24A 1A1IA 2YTEA 3EPJA 1T4LB 2EN3A 1A1GA 1KYQA 3UK3C 2YSOA 2J7JA 3C6MA 1GZ6A 4YHHE 2ENCA 1DGCA 2EPRA 1YUJA 1P47A 3J7Yp 4X65E 1GQEA 2V88A 4YY3E 2L3CA 1PJQA 1AAYA 4R2EA 4X66E 2JP9A 2EOIA 2EQ3A 1WJPA 2DLKA 3HPSA 4DV2E 1JK1A 2B3TB 1IBLE 4F54A 3MHHC 4BHBA 4BCAA 4I8OA 3T1HE 4WSPA 1N36E 3K6QA 2UUBE 4BC7A 2G7HA 2CTDA 4ZYHA 2LUQA 2I9IA 2WZOA 4LU9A 1T4OA 4TUIA 1ZBTA 1EKZA 2EE8A 1IMUA 4M2ZA 2DLQA 3ADIA 1UILA 3DJWA 1A1HA 1HNXE 2EM6A 5A6AA 2YRHA 3HQ1A 2JYAA 1NEIA 1X6EA 1X6HA 4F9CB 3T1YE 3L00A 2MKNA 4WSGA 2WBUA 4M0VA 3THOB 2EM7A 4DUYE 2VRDA 4BMJA 4WPYA 2L3JA 3ZOQB 1HNZE 2M4IA 2L8TA 2Q8UA 1B69A 3VK6A 5A6JA 2BBGA 2EMBA 4BC9A 4LF9E 2L33A 2EN2A 1MEYC 2E5LE 5KL4A 2YTPA 2LV2A 4JI6E 4NXME 2UXBE 3QG5C 1BBGA 2YTJA 2L2MA 2N8XA 4GKJE 4R2PA 5CFFE 1J5EE 2EM4A 1T38A 2KHXA 5LMUE 2EZ6A 2EOQA 1MGTA 4TUGA 1EH7A 4JI8E 1WHNA 4X8WA 1STUA 1X3CA 2M9AA 2JVAA 1XNRE 5TSEA 4Q35B 2BB8A 3BBGA 2N3HA 5AASA 4LTYA 2L6MA 2LCEA 3KZYA 2MC5A 1EH6A 4B3RE 4WXDA 2EMAA 2DRPA 2PRTA 2EN1A 2EM2A 2EMCA 2LJHA 2YU8A 1ZR9A 3BGHA 1Z1BA 2MDGA 4P7DA 1RC7A 4BHCA 2EOOA 2HC5A 2EP3A 4F9BB 2KONA 3EPHA 2VQEE 1YPNA 1XNQE 2YSPA 4WX9A 2EPPA 1KJKA 2EM8A 3ECRA 1X48A 3BIDA 5IV8B 3TQMA 3BF2A 5LL6R 2V86A 3AV0A 2YTOA 2IHR1 2FGGA 4IS1C 2LRSA 4JV5E 2EMZA 2V87A 4BBYA 4KWYA 5DNYA 4NXNE 1UN6B 2VQFE 2UXDE 1YYKA 2YZTA 3M99B 2K7IA 2EPUA 4L5NC 3LLHA 2EOFA 5A6KA 3EPKA 5BR8E 1N3GA 2NABA 4JYAE 4WFTA 2EOEA 2ODRD 2FTXB 5KL3A 4R2QA 5LMNE 3VYYA 2LJUA 1PJSA 1X47A 4DR7E 1PJTA 1PKPA 2LUPB 2NUEA 3KWRA 4DR3E 1YSAC 2V83A 1FKAE 1IBME 2EPZA 4DV4E 3MSWA 1YYWA 2YT4A 1T4NA 1J26A 1O0WA 1YYOA 3F6GA 2EMHA 2GHFA 2RSIA 1T39A 2NUGA 3LMLA 1A1KA 2EN7A 2EOJA 3JAMC 5AC5A 4LFCE 1IQOA 5AE2A 1UHZA 3VYXA 2K4VA 1N33E 5KL2A 2EM5A 2RS6A 1I94E 5AE3A 2VE7C 4B3SE 2RPCA 2YRKA 4DR5E 2EQ0A 2L2KB 5KL7A 2A25A 3C4BA 4DV5E 4B3ME 4F2JC 3IWDA 1X6FA 3JU0A 1N32E 4DV7E 4DR4E 2NA2A 2CSHA 2EMFA 2JOBA 4DUZE 3IWCA 1A1JA 2YTGA 4R2AA 2EOSA 3OMLA 2R76A 2EPNA 5FLXC 2L2NA 4MLQA 4RHBB 2B9DA 2CPNA 2ELYA 1QU6A 4DV0E 4LF5E 2EN6A 4LFAE 3FIGA 4AQYE 5AC4A 5KL6A 2JXPA 2DIXA 2EPAA 2HGHA 2EPXA 1TF6A 4K0KE 1XMQE 2LT7A 4F6NA 2FV4B 2MC6A 2EOMA 4JI7E 2D9HA 3OTOE 4R8OA 1ZAAC 4JI5E 4LF4E 5A6BA 4N4RB 3P1XA 4ZYGA 4DV1E 1N34E 2RSMA 3C4TA 4O43A 2JPAA 1RQ0A 2EMXA 2UUCE 2LBSB 5F3WA 3J7AG 4JI3E 5IXMB 5T6JA 1IQSA 2YU5A 2GPIA 2H36X 3KZZA 3HTXA 1BB8A 4DKKA 4ZYEA 4F9AB 1SR9A 2KOUA 2EPMX 4X9JA 2EMWA 2ODRC 4R2RA 4Q28A 4B3TE 3DF6A 1HR0E 2DGCA 2DSYA 2EMGA 1YZ9A 1DI2A 4L8NA 2EN8A 4R2CA 2WBSA 2HHHE 2MKDA 2YRMA 2JR1A 2EQ1A 2CT1A 1WRJA 1X49A 1G2DC 3ADGA 1PDAA 1ZU1A 4LFBE 2HJJA 4OOGC 2EPCA 2YTIA
chains in the Genus database with same CATH topology
2UXCE 2VF1A 4LF6E 4R03A 2LE2A 3J81C 2B7TA 2NUFA 4DR1E 3ADJA 2N3HA 1ZBQA 4DR2E 5AASA 2B7VA 3JAMC 3IWBA 5A2QC 2UU9E 2M1SA 2L6MA 4LTYA 4LFCE 2MDRA 5AE2A 1UHZA 3J80C 2K4VA 3VYXA 1N33E 4JI2E 1XNRE 2RS6A 1I94E 2UUAE 2MC5A 5AE3A 4X62E 1FJGE 2JOXA 2LTRA 2VE7C 4B3SE 4B3RE 4M30A 4LF7E 4WYQB 1HNWE 4DR5E 2L2KB 1T4LB 5IT9C 2LJHA 2E1MA 3C4BA 4LF8E 4DV5E 1XMOE 1DQ3A 4B3ME 3IWDA 4P7DA 1RC7A 3JU0A 1WXRA 3HPZA 2M7QA 4F9BB 1GZ6A 4YHHE 4DV7E 2KONA 1N32E 4DR4E 2VQEE 2NA2A 4KHPE 2JOBA 4OX9E 3H09A 1XNQE 4DR6E 2EWLA 3J7Yp 4X65E 1GQEA 2V88A 3JTZA 2F8BA 4DUZE 4DMIA 3RMPA 2RS7A 4YY3E 2L3CA 3IWCA 5ADZA 2F4VE 3ADLA 3OMLA 1WHQA 5FLXC 2L2NA 4X66E 2DMYA 2JY9A 2B9DA 1X48A 2CPNA 1QU6A 3HPSA 4DV2E 2LTSA 4DV0E 2B3TB 5LL6R 1IBLE 4LF5E 2V86A 3AV0A 4F54A 3FIGA 4AQYE 4LFAE 5IWAE 3F6HA 4BCAA 2DIXA 4I8OA 3T1HE 4WSPA 1N36E 4K0KE 4JI1E 1XMQE 2IHR1 3HXLA 2FV4B 2MC6A 3K6QA 2UUBE 2LMZA 4BC7A 2V8QB 4JI7E 4X64E 3OTOE 2G7HA 4R8OA 2LUQA 2FGGA 2WZOA 4JI5E 4LU9A 1T4OA 2LRSA 4LF4E 4TUIA 1ZBTA 4JV5E 4BBYA 2V87A 5DNYA 1EKZA 3P1XA 4DV1E 2JWOA 1N34E 2RSMA 3C4TA 4DV3E 4M2ZA 1RQ0A 2V85A 3ADIA 1UILA 3DJWA 2UUCE 1HNXE 2LBSB 4NXNE 3HQ1A 2VQFE 5F3WA 4F9CB 3T1YE 4JI3E 4JI0E 3J7AG 4J8ZA 2UXDE 5T6JA 1YYKA 2YZTA 4L5NC 2N3GA 3LLHA 4JI4E 4M0VA 2H36X 4DUYE 4BMJA 3HTXA 4DKKA 4WPYA 5BR8E 4F9AB 1SR9A 2KOUA 2L3JA 3ZOQB 1HNZE 2M4IA 4JYAE 4WFTA 4GEQB 2L8TA 2ODRD 4BS9A 2ODRC 3VK6A 4Q28A 4GKKE 2FTXB 2ZM6E 5LMNE 3DF6A 4BC9A 3VYYA 2DSYA 1HR0E 2L33A 4B3TE 2V89A 4LF9E 4KZSA 2E5LE 1X47A 4DR7E 4JI6E 1PKPA 2RTXA 1YZ9A 4NXME 2LUPB 2UXBE 4DV6E 2NUEA 4L8NA 1DI2A 2L2MA 3KWRA 4DR3E 4P78A 4GKJE 2V83A 2L92A 1FKAE 1IBME 2HHHE 4DV4E 3AUZA 5CFFE 2JR1A 1J5EE 2KHXA 5AE1A 5LMUE 2EZ6A 3MSWA 1X49A 4TUGA 3ADGA 4JI8E 1WHNA 1YYWA 4LFBE 2YT4A 1IBKE 4X8WA 1T4NA 4OOGC 1STUA 1O0WA 1YYOA 3F6GA 1J26A 2JVAA 2NUGA 3LMLA 2DB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  4LF6 E;  2B7T A;  2NUF A;  4DR1 E;  3ADJ A;  2N3H A;  4DR2 E;  2B7V A;  2UU9 E;  4LFC E;  2MDR A;  1UHZ A;  3VYX A;  1N33 E;  4JI2 E;  1XNR E;  2RS6 A;  1I94 E;  2UUA E;  4X62 E;  1FJG E;  2LTR A;  4B3R E;  4B3S E;  4M30 A;  4LF7 E;  4WYQ B;  1HNW E;  4DR5 E;  2L2K B;  1T4L B;  2LJH A;  3C4B A;  4LF8 E;  4DV5 E;  1XMO E;  4B3M E;  1RC7 A;  1N32 E;  4YHH E;  4DV7 E;  4DR4 E;  2VQE E;  2NA2 A;  4KHP E;  4OX9 E;  1XNQ E;  4DR6 E;  3J7Y p;  4X65 E;  1GQE A;  4DUZ E;  2RS7 A;  4YY3 E;  2L3C A;  2F4V E;  3ADL A;  1WHQ A;  2L2N A;  4X66 E;  2DMY A;  2JY9 A;  1X48 A;  2CPN A;  1QU6 A;  4DV2 E;  2LTS A;  4DV0 E;  2B3T B;  1IBL E;  4LF5 E;  4LFA E;  4AQY E;  5IWA E;  2DIX A;  3T1H E;  1N36 E;  4K0K E;  4JI1 E;  1XMQ E;  2IHR 1;  2UUB E;  4JI7 E;  4X64 E;  3OTO E;  2LUQ A;  4JI5 E;  1T4O A;  2LRS A;  4LF4 E;  1ZBT A;  4JV5 E;  1EKZ A;  3P1X A;  4DV1 E;  1N34 E;  2RSM A;  3C4T A;  4DV3 E;  4M2Z A;  1RQ0 A;  3ADI A;  1UIL A;  4NXN E;  2UUC E;  1HNX E;  2LBS B;  2VQF E;  3T1Y E;  4JI3 E;  4JI0 E;  2UXD E;  1YYK A;  2N3G A;  3LLH A;  4JI4 E;  4DUY E;  3HTX A;  4DKK A;  5BR8 E;  2L3J A;  1HNZ E;  4JYA E;  4WFT A;  4GKK E;  2ZM6 E;  5LMN E;  3VYY A;  1HR0 E;  4B3T E;  4LF9 E;  2L33 A;  2E5L E;  1X47 A;  4DR7 E;  4JI6 E;  1PKP A;  2RTX A;  1YZ9 A;  4NXM E;  2LUP B;  2UXB E;  4DV6 E;  2NUE A;  1DI2 A;  2L2M A;  4DR3 E;  4GKJ E;  1FKA E;  1IBM E;  2HHH E;  4DV4 E;  5CFF E;  1J5E E;  2KHX A;  5LMU E;  2EZ6 A;  1X49 A;  3ADG A;  4JI8 E;  1WHN A;  1YYW A;  4LFB E;  2YT4 A;  1IBK E;  4X8W A;  1T4N A;  4OOG C;  1STU A;  1O0W A;  1YYO A;  1J26 A;  2JVA A;  2NUG A;  2DB2 A; 
#chains in the Genus database with same CATH topology
 2EM3 A;  1YUI A;  2VF1 A;  4R03 A;  3J81 C;  2E72 A;  2NUF A;  4DR1 E;  2EMK A;  1ZBQ A;  2B7V A;  2EL4 A;  2UU9 E;  5A2Q C;  1RMD A;  1SFE A;  2EOY A;  2M1S A;  2MDR A;  2EOR A;  2EPL X;  4O5G A;  4X62 E;  1FJG E;  2ENA A;  1JK2 A;  1F2I G;  4M30 A;  4LF7 E;  4WYQ B;  1HNW E;  5IT9 C;  4R2S A;  2E1M A;  2YPN A;  4LF8 E;  1XMO E;  1DQ3 A;  1GTK A;  5LLQ A;  4O4K A;  1WXR A;  2R1F A;  3HPZ A;  2M7Q A;  4KHP E;  2LO3 A;  4OX9 E;  3H09 A;  4NHR A;  4DR6 E;  2EWL A;  5A69 A;  3JTZ A;  2F8B A;  4DMI A;  3RMP A;  2RS7 A;  5ADZ A;  2F4V E;  2ELZ A;  3ADL A;  2EJ4 A;  1WHQ A;  1X5W A;  1A1F A;  2EML A;  2DMY A;  2JY9 A;  3VHT B;  2YTD A;  4IJD A;  1AH5 A;  2EOX A;  2LTS A;  2YTQ A;  3EQ1 A;  4HEI A;  5IWA E;  3F6H A;  2LVH A;  2WCC 3;  4JI1 E;  3HXL A;  2LMZ A;  2V8Q B;  4X64 E;  1TF3 A;  3THN A;  1L4S A;  1G2F C;  2RQL A;  1QNT A;  2YTN A;  2EOZ A;  1UBD C;  2ENH A;  2JWO A;  2EPK X;  2WBT A;  4DV3 E;  1TN9 A;  2V85 A;  2EL5 A;  1NCS A;  4JI0 E;  4J8Z A;  4GZN C;  2N3G A;  4JI4 E;  4NZV A;  2EM0 A;  2YWQ A;  3EPL A;  2EMI A;  4GEQ B;  2EOH A;  4BS9 A;  1A1L A;  3MHS C;  5KL5 A;  4GKK E;  1BBO A;  4RH8 A;  2ZM6 E;  4MLV A;  2V89 A;  4KZS A;  2RTX A;  4F6M A;  4DV6 E;  2I13 A;  2ADR A;  2EL6 A;  4P78 A;  2L92 A;  3AUZ A;  4FK5 C;  3C6K A;  4HTG A;  5AE1 A;  2EN4 A;  1IBK E;  4M9V C;  1LLM C;  1EH8 A;  2DB2 A;  2DMI A;  2UXC E;  4LF6 E;  2LE2 A;  5A6B D;  2B7T A;  3ADJ A;  2EPO A;  4DR2 E;  4R2D A;  4WXC A;  3IWB A;  2YTF A;  2GLI A;  3J80 C;  4JI2 E;  2UUA E;  1YFH A;  4ZYD A;  2EMY A;  2JOX A;  2LTR A;  2EM9 A;  4O24 A;  1A1I A;  2YTE A;  3EPJ A;  1T4L B;  2EN3 A;  1A1G A;  1KYQ A;  3UK3 C;  2YSO A;  2J7J A;  3C6M A;  1GZ6 A;  4YHH E;  2ENC A;  1DGC A;  2EPR A;  1YUJ A;  1P47 A;  3J7Y p;  4X65 E;  1GQE A;  2V88 A;  4YY3 E;  2L3C A;  1PJQ A;  1AAY A;  4R2E A;  4X66 E;  2JP9 A;  2EOI A;  2EQ3 A;  1WJP A;  2DLK A;  3HPS A;  4DV2 E;  1JK1 A;  2B3T B;  1IBL E;  4F54 A;  3MHH C;  4BHB A;  4BCA A;  4I8O A;  3T1H E;  4WSP A;  1N36 E;  3K6Q A;  2UUB E;  4BC7 A;  2G7H A;  2CTD A;  4ZYH A;  2LUQ A;  2I9I A;  2WZO A;  4LU9 A;  1T4O A;  4TUI A;  1ZBT A;  1EKZ A;  2EE8 A;  1IMU A;  4M2Z A;  2DLQ A;  3ADI A;  1UIL A;  3DJW A;  1A1H A;  1HNX E;  2EM6 A;  5A6A A;  2YRH A;  3HQ1 A;  2JYA A;  1NEI A;  1X6E A;  1X6H A;  4F9C B;  3T1Y E;  3L00 A;  2MKN A;  4WSG A;  2WBU A;  4M0V A;  3THO B;  2EM7 A;  4DUY E;  2VRD A;  4BMJ A;  4WPY A;  2L3J A;  3ZOQ B;  1HNZ E;  2M4I A;  2L8T A;  2Q8U A;  1B69 A;  3VK6 A;  5A6J A;  2BBG A;  2EMB A;  4BC9 A;  4LF9 E;  2L33 A;  2EN2 A;  1MEY C;  2E5L E;  5KL4 A;  2YTP A;  2LV2 A;  4JI6 E;  4NXM E;  2UXB E;  3QG5 C;  1BBG A;  2YTJ A;  2L2M A;  2N8X A;  4GKJ E;  4R2P A;  5CFF E;  1J5E E;  2EM4 A;  1T38 A;  2KHX A;  5LMU E;  2EZ6 A;  2EOQ A;  1MGT A;  4TUG A;  1EH7 A;  4JI8 E;  1WHN A;  4X8W A;  1STU A;  1X3C A;  2M9A A;  2JVA A;  1XNR E;  5TSE A;  4Q35 B;  2BB8 A;  3BBG A;  2N3H A;  5AAS A;  4LTY A;  2L6M A;  2LCE A;  3KZY A;  2MC5 A;  1EH6 A;  4B3R E;  4WXD A;  2EMA A;  2DRP A;  2PRT A;  2EN1 A;  2EM2 A;  2EMC A;  2LJH A;  2YU8 A;  1ZR9 A;  3BGH A;  1Z1B A;  2MDG A;  4P7D A;  1RC7 A;  4BHC A;  2EOO A;  2HC5 A;  2EP3 A;  4F9B B;  2KON A;  3EPH A;  2VQE E;  1YPN A;  1XNQ E;  2YSP A;  4WX9 A;  2EPP A;  1KJK A;  2EM8 A;  3ECR A;  1X48 A;  3BID A;  5IV8 B;  3TQM A;  3BF2 A;  5LL6 R;  2V86 A;  3AV0 A;  2YTO A;  2IHR 1;  2FGG A;  4IS1 C;  2LRS A;  4JV5 E;  2EMZ A;  2V87 A;  4BBY A;  4KWY A;  5DNY A;  4NXN E;  1UN6 B;  2VQF E;  2UXD E;  1YYK A;  2YZT A;  3M99 B;  2K7I A;  2EPU A;  4L5N C;  3LLH A;  2EOF A;  5A6K A;  3EPK A;  5BR8 E;  1N3G A;  2NAB A;  4JYA E;  4WFT A;  2EOE A;  2ODR D;  2FTX B;  5KL3 A;  4R2Q A;  5LMN E;  3VYY A;  2LJU A;  1PJS A;  1X47 A;  4DR7 E;  1PJT A;  1PKP A;  2LUP B;  2NUE A;  3KWR A;  4DR3 E;  1YSA C;  2V83 A;  1FKA E;  1IBM E;  2EPZ A;  4DV4 E;  3MSW A;  1YYW A;  2YT4 A;  1T4N A;  1J26 A;  1O0W A;  1YYO A;  3F6G A;  2EMH A;  2GHF A;  2RSI A;  1T39 A;  2NUG A;  3LML A;  1A1K A;  2EN7 A;  2EOJ A;  3JAM C;  5AC5 A;  4LFC E;  1IQO A;  5AE2 A;  1UHZ A;  3VYX A;  2K4V A;  1N33 E;  5KL2 A;  2EM5 A;  2RS6 A;  1I94 E;  5AE3 A;  2VE7 C;  4B3S E;  2RPC A;  2YRK A;  4DR5 E;  2EQ0 A;  2L2K B;  5KL7 A;  2A25 A;  3C4B A;  4DV5 E;  4B3M E;  4F2J C;  3IWD A;  1X6F A;  3JU0 A;  1N32 E;  4DV7 E;  4DR4 E;  2NA2 A;  2CSH A;  2EMF A;  2JOB A;  4DUZ E;  3IWC A;  1A1J A;  2YTG A;  4R2A A;  2EOS A;  3OML A;  2R76 A;  2EPN A;  5FLX C;  2L2N A;  4MLQ A;  4RHB B;  2B9D A;  2CPN A;  2ELY A;  1QU6 A;  4DV0 E;  4LF5 E;  2EN6 A;  4LFA E;  3FIG A;  4AQY E;  5AC4 A;  5KL6 A;  2JXP A;  2DIX A;  2EPA A;  2HGH A;  2EPX A;  1TF6 A;  4K0K E;  1XMQ E;  2LT7 A;  4F6N A;  2FV4 B;  2MC6 A;  2EOM A;  4JI7 E;  2D9H A;  3OTO E;  4R8O A;  1ZAA C;  4JI5 E;  4LF4 E;  5A6B A;  4N4R B;  3P1X A;  4ZYG A;  4DV1 E;  1N34 E;  2RSM A;  3C4T A;  4O43 A;  2JPA A;  1RQ0 A;  2EMX A;  2UUC E;  2LBS B;  5F3W A;  3J7A G;  4JI3 E;  5IXM B;  5T6J A;  1IQS A;  2YU5 A;  2GPI A;  2H36 X;  3KZZ A;  3HTX A;  1BB8 A;  4DKK A;  4ZYE A;  4F9A B;  1SR9 A;  2KOU A;  2EPM X;  4X9J A;  2EMW A;  2ODR C;  4R2R A;  4Q28 A;  4B3T E;  3DF6 A;  1HR0 E;  2DGC A;  2DSY A;  2EMG A;  1YZ9 A;  1DI2 A;  4L8N A;  2EN8 A;  4R2C A;  2WBS A;  2HHH E;  2MKD A;  2YRM A;  2JR1 A;  2EQ1 A;  2CT1 A;  1WRJ A;  1X49 A;  1G2D C;  3ADG A;  1PDA A;  1ZU1 A;  4LFB E;  2HJJ A;  4OOG C;  2EPC A;  2YTI A; 
#chains in the Genus database with same CATH homology
 2UXC E;  2VF1 A;  4LF6 E;  4R03 A;  2LE2 A;  3J81 C;  2B7T A;  2NUF A;  4DR1 E;  3ADJ A;  2N3H A;  1ZBQ A;  4DR2 E;  5AAS A;  2B7V A;  3JAM C;  3IWB A;  5A2Q C;  2UU9 E;  2M1S A;  2L6M A;  4LTY A;  4LFC E;  2MDR A;  5AE2 A;  1UHZ A;  3J80 C;  2K4V A;  3VYX A;  1N33 E;  4JI2 E;  1XNR E;  2RS6 A;  1I94 E;  2UUA E;  2MC5 A;  5AE3 A;  4X62 E;  1FJG E;  2JOX A;  2LTR A;  2VE7 C;  4B3S E;  4B3R E;  4M30 A;  4LF7 E;  4WYQ B;  1HNW E;  4DR5 E;  2L2K B;  1T4L B;  5IT9 C;  2LJH A;  2E1M A;  3C4B A;  4LF8 E;  4DV5 E;  1XMO E;  1DQ3 A;  4B3M E;  3IWD A;  4P7D A;  1RC7 A;  3JU0 A;  1WXR A;  3HPZ A;  2M7Q A;  4F9B B;  1GZ6 A;  4YHH E;  4DV7 E;  2KON A;  1N32 E;  4DR4 E;  2VQE E;  2NA2 A;  4KHP E;  2JOB A;  4OX9 E;  3H09 A;  1XNQ E;  4DR6 E;  2EWL A;  3J7Y p;  4X65 E;  1GQE A;  2V88 A;  3JTZ A;  2F8B A;  4DUZ E;  4DMI A;  3RMP A;  2RS7 A;  4YY3 E;  2L3C A;  3IWC A;  5ADZ A;  2F4V E;  3ADL A;  3OML A;  1WHQ A;  5FLX C;  2L2N A;  4X66 E;  2DMY A;  2JY9 A;  2B9D A;  1X48 A;  2CPN A;  1QU6 A;  3HPS A;  4DV2 E;  2LTS A;  4DV0 E;  2B3T B;  5LL6 R;  1IBL E;  4LF5 E;  2V86 A;  3AV0 A;  4F54 A;  3FIG A;  4AQY E;  4LFA E;  5IWA E;  3F6H A;  4BCA A;  2DIX A;  4I8O A;  3T1H E;  4WSP A;  1N36 E;  4K0K E;  4JI1 E;  1XMQ E;  2IHR 1;  3HXL A;  2FV4 B;  2MC6 A;  3K6Q A;  2UUB E;  2LMZ A;  4BC7 A;  2V8Q B;  4JI7 E;  4X64 E;  3OTO E;  2G7H A;  4R8O A;  2LUQ A;  2FGG A;  2WZO A;  4JI5 E;  4LU9 A;  1T4O A;  2LRS A;  4LF4 E;  4TUI A;  1ZBT A;  4JV5 E;  4BBY A;  2V87 A;  5DNY A;  1EKZ A;  3P1X A;  4DV1 E;  2JWO A;  1N34 E;  2RSM A;  3C4T A;  4DV3 E;  4M2Z A;  1RQ0 A;  2V85 A;  3ADI A;  1UIL A;  3DJW A;  2UUC E;  1HNX E;  2LBS B;  4NXN E;  3HQ1 A;  2VQF E;  5F3W A;  4F9C B;  3T1Y E;  4JI3 E;  4JI0 E;  3J7A G;  4J8Z A;  2UXD E;  5T6J A;  1YYK A;  2YZT A;  4L5N C;  2N3G A;  3LLH A;  4JI4 E;  4M0V A;  2H36 X;  4DUY E;  4BMJ A;  3HTX A;  4DKK A;  4WPY A;  5BR8 E;  4F9A B;  1SR9 A;  2KOU A;  2L3J A;  3ZOQ B;  1HNZ E;  2M4I A;  4JYA E;  4WFT A;  4GEQ B;  2L8T A;  2ODR D;  4BS9 A;  2ODR C;  3VK6 A;  4Q28 A;  4GKK E;  2FTX B;  2ZM6 E;  5LMN E;  3DF6 A;  4BC9 A;  3VYY A;  2DSY A;  1HR0 E;  2L33 A;  4B3T E;  2V89 A;  4LF9 E;  4KZS A;  2E5L E;  1X47 A;  4DR7 E;  4JI6 E;  1PKP A;  2RTX A;  1YZ9 A;  4NXM E;  2LUP B;  2UXB E;  4DV6 E;  2NUE A;  4L8N A;  1DI2 A;  2L2M A;  3KWR A;  4DR3 E;  4P78 A;  4GKJ E;  2V83 A;  2L92 A;  1FKA E;  1IBM E;  2HHH E;  4DV4 E;  3AUZ A;  5CFF E;  2JR1 A;  1J5E E;  2KHX A;  5AE1 A;  5LMU E;  2EZ6 A;  3MSW A;  1X49 A;  4TUG A;  3ADG A;  4JI8 E;  1WHN A;  1YYW A;  4LFB E;  2YT4 A;  1IBK E;  4X8W A;  1T4N A;  4OOG C;  1STU A;  1O0W A;  1YYO A;  3F6G A;  1J26 A;  2JVA A;  2NUG A;  3LML A;  2DB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...