2RS6A

Solution structure of the n-terminal dsrbd from rna helicase a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase A
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs6A01
3ADJA 2DMYA 2UXCE 4B3ME 4JI1E 4DUYE 4JI8E 4DKKA 1FJGE 4YY3E 1X48A 1ZBTA 5LMNE 4WFTA 2UXDE 3OTOE 4DR1E 4AQYE 4WYQB 4M2ZA 4LF7E 4DR3E 1STUA 1GQEA 2JY9A 4JI3E 1XNRE 1YYOA 4OX9E 1UILA 2B7TA 4DV4E 1XMOE 1IBME 2L33A 1YYKA 2L3CA 1J26A 2E5LE 4DV1E 1UHZA 1RQ0A 4X66E 1IBKE 4JI0E 1N32E 4GKJE 4JI6E 2RSMA 4X8WA 2UUBE 4X64E 2UXBE 1YZ9A 4NXME 1HR0E 1HNWE 4DV2E 4DR5E 4DUZE 2VQEE 3VYYA 1DI2A 1N34E 4JI4E 3C4BA 5LMUE 4LFAE 1XNQE 1T4NA 1X49A 1X47A 1EKZA 4DV0E 4X65E 2RTXA 4LF6E 5IWAE 4LF8E 4JI2E 2LUPB 5CFFE 2DIXA 2LTRA 2L3JA 4LFBE 2N3HA 4JYAE 1WHNA 2MDRA 2UUCE 1I94E 1XMQE 4DR7E 3LLHA 3P1XA 2DB2A 2L2NA 4KHPE 3ADIA 2ZM6E 2B3TB 4OOGC 1N36E 3ADGA 4B3SE 4DV3E 1QU6A 2LBSB 4JV5E 3T1YE 4M30A 4LFCE 5BR8E 2LTSA 4LF5E 4K0KE 2JVAA 4DV6E 2N3GA 3ADLA 2LUQA 4DR4E 2HHHE 4DR2E 2RS7A 2YT4A 1IBLE 4JI7E 2EZ6A 4LF4E 1T4LB 2UUAE 2NUEA 4YHHE 1HNXE 4DV7E 4DV5E 2CPNA 1PKPA 2NUFA 3VYXA 4DR6E 2RS6A 1YYWA 1WHQA 4JI5E 2LJHA 3J7Yp 2VQFE 4NXNE 4X62E 2UU9E 2L2MA 2B7VA 2IHR1 2F4VE 4LF9E 1O0WA 2LRSA 2NUGA 4B3TE 1RC7A 2L2KB 3C4TA 1FKAE 3HTXA 4GKKE 1J5EE 1HNZE 1T4OA 4B3RE 1N33E 2KHXA 3T1HE 2NA2A
chains in the Genus database with same CATH superfamily
4MLVA 2UXCE 2V89A 1SR9A 4KWYA 4IJDA 2E1MA 1PDAA 4WFTA 5TSEA 2K7IA 4WYQB 1STUA 3KWRA 3EPLA 1Z1BA 4JI3E 2EOIA 1XNRE 1YYOA 2EMZA 1XMOE 2EMXA 2H36X 2EMWA 2E5LE 4DMIA 4ZYGA 2EL4A 3H09A 2FTXB 2LT7A 2LJUA 1YZ9A 2YRHA 4F9AB 4NXME 4DV2E 2EOHA 3FIGA 2M7QA 4TUGA 2EM8A 2YPNA 2L92A 3EPHA 3C4BA 3BGHA 1EH6A 1BB8A 2V83A 4LF6E 5IWAE 4O5GA 3J7AG 2B9DA 2JP9A 2BB8A 2YU8A 4JYAE 4WXDA 2CTDA 1XMQE 4DR7E 2EN3A 2V88A 2DRPA 3BBGA 2EM9A 2WBTA 1GZ6A 3VK6A 2EPAA 4L8NA 1LLMC 4B3SE 4DV3E 1PJSA 1QU6A 2LBSB 1BBGA 2EM7A 5AC5A 2MKDA 1L4SA 5BR8E 2V87A 1TF6A 2LUQA 2EM2A 3MSWA 4DR4E 4NHRA 5KL3A 2ELYA 2YT4A 1IQOA 2GLIA 2EPOA 1YPNA 2EPZA 4LF4E 3RMPA 2NUEA 2EPLX 2EM5A 3AUZA 4DV5E 1PKPA 2EL5A 1PJTA 2NUFA 1X3CA 2EPUA 2VQFE 5KL7A 4NXNE 2N8XA 1A1IA 4BHBA 2EOSA 2L2MA 2YTEA 2R1FA 2IHR1 1ZBQA 2G7HA 2DLKA 2YRKA 3C4TA 5AE1A 1J5EE 3THNA 1A1JA 3T1HE 3J80C 4JI1E 1GTKA 3IWCA 1FJGE 4YY3E 1X48A 2YSPA 4F9BB 2MC6A 4P7DA 4DR1E 4ZYHA 3BIDA 2LMZA 4F54A 4LF7E 2GPIA 2JY9A 4HEIA 2EOMA 5KL4A 5A2QC 1UILA 2B7TA 2L6MA 3VHTB 2ELZA 1J26A 2CSHA 3HXLA 4DV1E 1UHZA 4JI0E 3F6HA 1N32E 5T6JA 2EMGA 2UXBE 2KOUA 1HR0E 1MGTA 2ODRD 4BS9A 5A6JA 2EPXA 4I8OA 2VQEE 1A1GA 2DLQA 3UK3C 4JI4E 2EMHA 5AE3A 4LFAE 5A6AA 2ODRC 1YSAC 1X47A 1EKZA 2YU5A 4R2SA 3C6KA 1G2FC 4JI2E 2EMFA 5A6BA 1DGCA 1ZAAC 1AAYA 5LL6R 1RMDA 2YTIA 2N3HA 5DNYA 2EN1A 2MDRA 2A25A 4M9VC 1X6EA 4KHPE 2EMBA 1G2DC 2V85A 2B3TB 3ADGA 2LV2A 1MEYC 4NZVA 4R2PA 3KZZA 4WXCA 3T1YE 3HQ1A 2LTSA 4LF5E 2JVAA 4DV6E 2N3GA 3ADLA 2RPCA 2HHHE 4DR2E 2RS7A 1A1HA 4Q28A 3AV0A 2EZ6A 3MHSC 4WX9A 5KL6A 2R76A 1YUJA 4M0VA 1HNXE 2VE7C 2EORA 2RS6A 1WHQA 2YTDA 1F2IG 2LO3A 4JI5E 3J7Yp 2MC5A 4X62E 3HPZA 2I9IA 2B7VA 2WBUA 4LF9E 4BBYA 2LRSA 2NUGA 2ENAA 2YTFA 4B3TE 2EM3A 2LE2A 1UBDC 1FKAE 4GKKE 4WSGA 5AASA 1N33E 5A6KA 2EE8A 2NA2A 1JK2A 2LVHA 4BC9A 4R8OA 4R2DA 2EPCA 5LMNE 1SFEA 1WRJA 2EJ4A 2UXDE 3OTOE 2EOQA 4WSPA 1GQEA 2MDGA 1EH7A 4P78A 4WPYA 5A69A 2E72A 4DV4E 2ENHA 2L33A 4F9CB 3C6MA 1B69A 3JU0A 1RQ0A 1IBKE 4GKJE 4R03A 2WCC3 2EL6A 4FK5C 4MLQA 4X8WA 1T38A 4X64E 1A1FA 2LCEA 2DSYA 1IMUA 1HNWE 4DR5E 4DUZE 1N34E 2JPAA 2MKNA 2EOEA 3JTZA 4BCAA 5LLQA 3QG5C 1ZR9A 2L8TA 4DV0E 1YFHA 4X65E 2ADRA 1N3GA 2I13A 5IT9C 4LF8E 2M9AA 1NEIA 2HJJA 3THOB 1X6FA 5CFFE 2FV4B 2Q8UA 2RSIA 2YTNA 1I94E 2M1SA 3LLHA 1IQSA 1ZU1A 3P1XA 2DB2A 2L2NA 4X9JA 4F6MA 2GHFA 3ADIA 1N36E 4GEQB 2EP3A 2RQLA 1WXRA 4JV5E 2HC5A 4LFCE 2EN8A 2EQ0A 5KL2A 2YTGA 4K0KE 3IWDA 4R2EA 2YTQA 4KZSA 2EOJA 2EQ3A 3JAMC 2WZOA 1X5WA 3EPKA 2UUAE 3KZYA 3MHHC 4YHHE 2JOXA 2YRMA 2EM4A 4R2AA 2EPPA 2EMYA 1UN6B 2EPMX 1DQ3A 2LJHA 2YTOA 5AE2A 2KONA 2UU9E 4BMJA 4BC7A 4ZYEA 2JOBA 4RHBB 2F4VE 4IS1C 5IV8B 2EN7A 2EPKX 2D9HA 2JYAA 5KL5A 1RC7A 3BF2A 2EQ1A 3HTXA 1AH5A 1EH8A 1T4OA 2EPRA 2VRDA 3ZOQB 3ADJA 1A1LA 2DMYA 2J7JA 1X6HA 4B3ME 1T39A 4DUYE 4JI8E 4DKKA 1TF3A 1ZBTA 4O24A 2F8BA 4AQYE 1P47A 4M2ZA 1WJPA 4DR3E 2EMIA 2WBSA 5AC4A 4OX9E 2K4VA 2YTPA 2EMLA 1IBME 1YYKA 2L3CA 4O4KA 3L00A 4TUIA 2EPNA 2EN2A 2EOZA 3OMLA 4X66E 4JI6E 2RSMA 2UUBE 5F3WA 5ADZA 2YSOA 1KYQA 3VYYA 2JWOA 1DI2A 3M99B 2PRTA 2YWQA 5LMUE 1XNQE 2EOYA 5A6BD 1T4NA 1X49A 2EMAA 2YZTA 1QNTA 2RTXA 3K6QA 2JXPA 2V86A 1BBOA 2LUPB 2EOOA 1JK1A 2HGHA 2DIXA 2LTRA 2L3JA 4LFBE 2V8QB 2EWLA 1A1KA 1WHNA 3J81C 2UUCE 4J8ZA 2EN4A 2FGGA 2YTJA 2ENCA 2DGCA 4ZYDA 3EPJA 4LTYA 4R2RA 1KJKA 4F2JC 2ZM6E 2EMCA 4L5NC 4OOGC 1PJQA 4GZNC 3TQMA 3F6GA 4M30A 3EQ1A 2EN6A 4N4RB 1IBLE 4JI7E 2DMIA 4RH8A 1T4LB 2VF1A 5FLXC 1TN9A 4DV7E 2CPNA 3VYXA 2M4IA 3DF6A 4LU9A 1YYWA 4DR6E 2EMKA 2CT1A 1NCSA 4BHCA 2JR1A 4HTGA 4Q35B 2BBGA 2EM6A 2NABA 3ECRA 1O0WA 3HPSA 2EOFA 3IWBA 2EM0A 3DJWA 4R2QA 2L2KB 1YUIA 5IXMB 4R2CA 3LMLA 1HNZE 4O43A 4B3RE 4F6NA 2KHXA 2EOXA
chains in the Genus database with same CATH topology
3ZOQB 3ADJA 2DMYA 2UXCE 3J80C 4B3ME 4JI1E 2V89A 1SR9A 4BC9A 4DUYE 3IWCA 4R8OA 4JI8E 4DKKA 4YY3E 1FJGE 1X48A 1ZBTA 2E1MA 2F8BA 4F9BB 5LMNE 4WFTA 2MC6A 4P7DA 2UXDE 3OTOE 4DR1E 4AQYE 4WYQB 4M2ZA 2LMZA 4F54A 1STUA 1GQEA 2JY9A 3KWRA 4P78A 4WSPA 4WPYA 4DR3E 4JI3E 1YYOA 2K4VA 5A2QC 4OX9E 1XNRE 1UILA 2B7TA 4DV4E 2H36X 1XMOE 2L6MA 1IBME 2L33A 1YYKA 4F9CB 2L3CA 1J26A 2E5LE 3HXLA 4DMIA 4TUIA 4DV1E 1UHZA 1RQ0A 3H09A 3JU0A 3F6HA 3OMLA 2FTXB 4R03A 2RSMA 4X66E 1IBKE 4JI0E 4JI6E 4X8WA 5T6JA 2UUBE 4X64E 5F3WA 5ADZA 2UXBE 1YZ9A 2DSYA 4F9AB 2KOUA 4NXME 1HR0E 2ODRD 4BS9A 4DV2E 1HNWE 4DR5E 4I8OA 4DUZE 3FIGA 2M7QA 2VQEE 3VYYA 4TUGA 2JWOA 1DI2A 1N34E 4JI4E 4GKJE 2L92A 5AE3A 3C4BA 3JTZA 4BCAA 5LMUE 4LFAE 1XNQE 2ODRC 1T4NA 1X49A 1X47A 2L8TA 2V83A 2YZTA 4DV0E 1EKZA 4X65E 2RTXA 4LF6E 5IWAE 5IT9C 3K6QA 4LF8E 2V86A 4JI2E 3J7AG 2B9DA 2LUPB 5CFFE 2DIXA 2FV4B 2LTRA 2L3JA 5LL6R 4LFBE 2N3HA 2V8QB 2EWLA 5DNYA 4JYAE 1WHNA 2MDRA 3J81C 2UUCE 4J8ZA 1I94E 2FGGA 1XMQE 4DR7E 2V88A 2M1SA 3LLHA 3P1XA 2DB2A 2L2NA 4LTYA 4KHPE 3ADIA 1GZ6A 2V85A 3VK6A 2ZM6E 4L5NC 2B3TB 4OOGC 1N36E 3ADGA 4L8NA 4B3SE 4GEQB 4DV3E 1QU6A 1WXRA 2LBSB 4JV5E 3F6GA 3T1YE 4M30A 4LFCE 3HQ1A 5BR8E 2LTSA 4LF5E 4K0KE 2V87A 2JVAA 3IWDA 4DV6E 2N3GA 3ADLA 2LUQA 4DR4E 3MSWA 2HHHE 4DR2E 2RS7A 4KZSA 2YT4A 1IBLE 4Q28A 4JI7E 3JAMC 2WZOA 3AV0A 2EZ6A 4LF4E 4LF7E 3RMPA 1T4LB 2UUAE 2NUEA 2VF1A 3AUZA 4M0VA 2JOXA 2VE7C 5FLXC 4YHHE 4DV7E 1HNXE 4DV5E 2CPNA 1PKPA 2NUFA 3VYXA 2M4IA 2RS6A 3DF6A 1WHQA 4LU9A 1YYWA 4DR6E 4JI5E 1DQ3A 2LJHA 3J7Yp 2MC5A 2VQFE 4NXNE 2JR1A 5AE2A 2KONA 3HPZA 4X62E 2UU9E 4BMJA 2L2MA 4BC7A 2B7VA 2JOBA 2IHR1 1ZBQA 2F4VE 4LF9E 4BBYA 1O0WA 2LRSA 3HPSA 2NUGA 3IWBA 4B3TE 1RC7A 3DJWA 2L2KB 2LE2A 1N32E 2G7HA 3C4TA 1FKAE 3HTXA 5AE1A 4GKKE 1J5EE 3LMLA 1HNZE 1T4OA 4B3RE 5AASA 1N33E 2KHXA 3T1HE 2NA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADJ A;  2DMY A;  2UXC E;  4B3M E;  4JI1 E;  4DUY E;  4JI8 E;  4DKK A;  1FJG E;  4YY3 E;  1X48 A;  1ZBT A;  5LMN E;  4WFT A;  2UXD E;  3OTO E;  4DR1 E;  4AQY E;  4WYQ B;  4M2Z A;  4LF7 E;  4DR3 E;  1STU A;  1GQE A;  2JY9 A;  4JI3 E;  1XNR E;  1YYO A;  4OX9 E;  1UIL A;  2B7T A;  4DV4 E;  1XMO E;  1IBM E;  2L33 A;  1YYK A;  2L3C A;  1J26 A;  2E5L E;  4DV1 E;  1UHZ A;  1RQ0 A;  4X66 E;  1IBK E;  4JI0 E;  1N32 E;  4GKJ E;  4JI6 E;  2RSM A;  4X8W A;  2UUB E;  4X64 E;  2UXB E;  1YZ9 A;  4NXM E;  1HR0 E;  1HNW E;  4DV2 E;  4DR5 E;  4DUZ E;  2VQE E;  3VYY A;  1DI2 A;  1N34 E;  4JI4 E;  3C4B A;  5LMU E;  4LFA E;  1XNQ E;  1T4N A;  1X49 A;  1X47 A;  1EKZ A;  4DV0 E;  4X65 E;  2RTX A;  4LF6 E;  5IWA E;  4LF8 E;  4JI2 E;  2LUP B;  5CFF E;  2DIX A;  2LTR A;  2L3J A;  4LFB E;  2N3H A;  4JYA E;  1WHN A;  2MDR A;  2UUC E;  1I94 E;  1XMQ E;  4DR7 E;  3LLH A;  3P1X A;  2DB2 A;  2L2N A;  4KHP E;  3ADI A;  2ZM6 E;  2B3T B;  4OOG C;  1N36 E;  3ADG A;  4B3S E;  4DV3 E;  1QU6 A;  2LBS B;  4JV5 E;  3T1Y E;  4M30 A;  4LFC E;  5BR8 E;  2LTS A;  4LF5 E;  4K0K E;  2JVA A;  4DV6 E;  2N3G A;  3ADL A;  2LUQ A;  4DR4 E;  2HHH E;  4DR2 E;  2RS7 A;  2YT4 A;  1IBL E;  4JI7 E;  2EZ6 A;  4LF4 E;  1T4L B;  2UUA E;  2NUE A;  4YHH E;  1HNX E;  4DV7 E;  4DV5 E;  2CPN A;  1PKP A;  2NUF A;  3VYX A;  4DR6 E;  2RS6 A;  1YYW A;  1WHQ A;  4JI5 E;  2LJH A;  3J7Y p;  2VQF E;  4NXN E;  4X62 E;  2UU9 E;  2L2M A;  2B7V A;  2IHR 1;  2F4V E;  4LF9 E;  1O0W A;  2LRS A;  2NUG A;  4B3T E;  1RC7 A;  2L2K B;  3C4T A;  1FKA E;  3HTX A;  4GKK E;  1J5E E;  1HNZ E;  1T4O A;  4B3R E;  1N33 E;  2KHX A;  3T1H E;  2NA2 A; 
#chains in the Genus database with same CATH topology
 4MLV A;  2UXC E;  2V89 A;  1SR9 A;  4KWY A;  4IJD A;  2E1M A;  1PDA A;  4WFT A;  5TSE A;  2K7I A;  4WYQ B;  1STU A;  3KWR A;  3EPL A;  1Z1B A;  4JI3 E;  2EOI A;  1XNR E;  1YYO A;  2EMZ A;  1XMO E;  2EMX A;  2H36 X;  2EMW A;  2E5L E;  4DMI A;  4ZYG A;  2EL4 A;  3H09 A;  2FTX B;  2LT7 A;  2LJU A;  1YZ9 A;  2YRH A;  4F9A B;  4NXM E;  4DV2 E;  2EOH A;  3FIG A;  2M7Q A;  4TUG A;  2EM8 A;  2YPN A;  2L92 A;  3EPH A;  3C4B A;  3BGH A;  1EH6 A;  1BB8 A;  2V83 A;  4LF6 E;  5IWA E;  4O5G A;  3J7A G;  2B9D A;  2JP9 A;  2BB8 A;  2YU8 A;  4JYA E;  4WXD A;  2CTD A;  1XMQ E;  4DR7 E;  2EN3 A;  2V88 A;  2DRP A;  3BBG A;  2EM9 A;  2WBT A;  1GZ6 A;  3VK6 A;  2EPA A;  4L8N A;  1LLM C;  4B3S E;  4DV3 E;  1PJS A;  1QU6 A;  2LBS B;  1BBG A;  2EM7 A;  5AC5 A;  2MKD A;  1L4S A;  5BR8 E;  2V87 A;  1TF6 A;  2LUQ A;  2EM2 A;  3MSW A;  4DR4 E;  4NHR A;  5KL3 A;  2ELY A;  2YT4 A;  1IQO A;  2GLI A;  2EPO A;  1YPN A;  2EPZ A;  4LF4 E;  3RMP A;  2NUE A;  2EPL X;  2EM5 A;  3AUZ A;  4DV5 E;  1PKP A;  2EL5 A;  1PJT A;  2NUF A;  1X3C A;  2EPU A;  2VQF E;  5KL7 A;  4NXN E;  2N8X A;  1A1I A;  4BHB A;  2EOS A;  2L2M A;  2YTE A;  2R1F A;  2IHR 1;  1ZBQ A;  2G7H A;  2DLK A;  2YRK A;  3C4T A;  5AE1 A;  1J5E E;  3THN A;  1A1J A;  3T1H E;  3J80 C;  4JI1 E;  1GTK A;  3IWC A;  1FJG E;  4YY3 E;  1X48 A;  2YSP A;  4F9B B;  2MC6 A;  4P7D A;  4DR1 E;  4ZYH A;  3BID A;  2LMZ A;  4F54 A;  4LF7 E;  2GPI A;  2JY9 A;  4HEI A;  2EOM A;  5KL4 A;  5A2Q C;  1UIL A;  2B7T A;  2L6M A;  3VHT B;  2ELZ A;  1J26 A;  2CSH A;  3HXL A;  4DV1 E;  1UHZ A;  4JI0 E;  3F6H A;  1N32 E;  5T6J A;  2EMG A;  2UXB E;  2KOU A;  1HR0 E;  1MGT A;  2ODR D;  4BS9 A;  5A6J A;  2EPX A;  4I8O A;  2VQE E;  1A1G A;  2DLQ A;  3UK3 C;  4JI4 E;  2EMH A;  5AE3 A;  4LFA E;  5A6A A;  2ODR C;  1YSA C;  1X47 A;  1EKZ A;  2YU5 A;  4R2S A;  3C6K A;  1G2F C;  4JI2 E;  2EMF A;  5A6B A;  1DGC A;  1ZAA C;  1AAY A;  5LL6 R;  1RMD A;  2YTI A;  2N3H A;  5DNY A;  2EN1 A;  2MDR A;  2A25 A;  4M9V C;  1X6E A;  4KHP E;  2EMB A;  1G2D C;  2V85 A;  2B3T B;  3ADG A;  2LV2 A;  1MEY C;  4NZV A;  4R2P A;  3KZZ A;  4WXC A;  3T1Y E;  3HQ1 A;  2LTS A;  4LF5 E;  2JVA A;  4DV6 E;  2N3G A;  3ADL A;  2RPC A;  2HHH E;  4DR2 E;  2RS7 A;  1A1H A;  4Q28 A;  3AV0 A;  2EZ6 A;  3MHS C;  4WX9 A;  5KL6 A;  2R76 A;  1YUJ A;  4M0V A;  1HNX E;  2VE7 C;  2EOR A;  2RS6 A;  1WHQ A;  2YTD A;  1F2I G;  2LO3 A;  4JI5 E;  3J7Y p;  2MC5 A;  4X62 E;  3HPZ A;  2I9I A;  2B7V A;  2WBU A;  4LF9 E;  4BBY A;  2LRS A;  2NUG A;  2ENA A;  2YTF A;  4B3T E;  2EM3 A;  2LE2 A;  1UBD C;  1FKA E;  4GKK E;  4WSG A;  5AAS A;  1N33 E;  5A6K A;  2EE8 A;  2NA2 A;  1JK2 A;  2LVH A;  4BC9 A;  4R8O A;  4R2D A;  2EPC A;  5LMN E;  1SFE A;  1WRJ A;  2EJ4 A;  2UXD E;  3OTO E;  2EOQ A;  4WSP A;  1GQE A;  2MDG A;  1EH7 A;  4P78 A;  4WPY A;  5A69 A;  2E72 A;  4DV4 E;  2ENH A;  2L33 A;  4F9C B;  3C6M A;  1B69 A;  3JU0 A;  1RQ0 A;  1IBK E;  4GKJ E;  4R03 A;  2WCC 3;  2EL6 A;  4FK5 C;  4MLQ A;  4X8W A;  1T38 A;  4X64 E;  1A1F A;  2LCE A;  2DSY A;  1IMU A;  1HNW E;  4DR5 E;  4DUZ E;  1N34 E;  2JPA A;  2MKN A;  2EOE A;  3JTZ A;  4BCA A;  5LLQ A;  3QG5 C;  1ZR9 A;  2L8T A;  4DV0 E;  1YFH A;  4X65 E;  2ADR A;  1N3G A;  2I13 A;  5IT9 C;  4LF8 E;  2M9A A;  1NEI A;  2HJJ A;  3THO B;  1X6F A;  5CFF E;  2FV4 B;  2Q8U A;  2RSI A;  2YTN A;  1I94 E;  2M1S A;  3LLH A;  1IQS A;  1ZU1 A;  3P1X A;  2DB2 A;  2L2N A;  4X9J A;  4F6M A;  2GHF A;  3ADI A;  1N36 E;  4GEQ B;  2EP3 A;  2RQL A;  1WXR A;  4JV5 E;  2HC5 A;  4LFC E;  2EN8 A;  2EQ0 A;  5KL2 A;  2YTG A;  4K0K E;  3IWD A;  4R2E A;  2YTQ A;  4KZS A;  2EOJ A;  2EQ3 A;  3JAM C;  2WZO A;  1X5W A;  3EPK A;  2UUA E;  3KZY A;  3MHH C;  4YHH E;  2JOX A;  2YRM A;  2EM4 A;  4R2A A;  2EPP A;  2EMY A;  1UN6 B;  2EPM X;  1DQ3 A;  2LJH A;  2YTO A;  5AE2 A;  2KON A;  2UU9 E;  4BMJ A;  4BC7 A;  4ZYE A;  2JOB A;  4RHB B;  2F4V E;  4IS1 C;  5IV8 B;  2EN7 A;  2EPK X;  2D9H A;  2JYA A;  5KL5 A;  1RC7 A;  3BF2 A;  2EQ1 A;  3HTX A;  1AH5 A;  1EH8 A;  1T4O A;  2EPR A;  2VRD A;  3ZOQ B;  3ADJ A;  1A1L A;  2DMY A;  2J7J A;  1X6H A;  4B3M E;  1T39 A;  4DUY E;  4JI8 E;  4DKK A;  1TF3 A;  1ZBT A;  4O24 A;  2F8B A;  4AQY E;  1P47 A;  4M2Z A;  1WJP A;  4DR3 E;  2EMI A;  2WBS A;  5AC4 A;  4OX9 E;  2K4V A;  2YTP A;  2EML A;  1IBM E;  1YYK A;  2L3C A;  4O4K A;  3L00 A;  4TUI A;  2EPN A;  2EN2 A;  2EOZ A;  3OML A;  4X66 E;  4JI6 E;  2RSM A;  2UUB E;  5F3W A;  5ADZ A;  2YSO A;  1KYQ A;  3VYY A;  2JWO A;  1DI2 A;  3M99 B;  2PRT A;  2YWQ A;  5LMU E;  1XNQ E;  2EOY A;  5A6B D;  1T4N A;  1X49 A;  2EMA A;  2YZT A;  1QNT A;  2RTX A;  3K6Q A;  2JXP A;  2V86 A;  1BBO A;  2LUP B;  2EOO A;  1JK1 A;  2HGH A;  2DIX A;  2LTR A;  2L3J A;  4LFB E;  2V8Q B;  2EWL A;  1A1K A;  1WHN A;  3J81 C;  2UUC E;  4J8Z A;  2EN4 A;  2FGG A;  2YTJ A;  2ENC A;  2DGC A;  4ZYD A;  3EPJ A;  4LTY A;  4R2R A;  1KJK A;  4F2J C;  2ZM6 E;  2EMC A;  4L5N C;  4OOG C;  1PJQ A;  4GZN C;  3TQM A;  3F6G A;  4M30 A;  3EQ1 A;  2EN6 A;  4N4R B;  1IBL E;  4JI7 E;  2DMI A;  4RH8 A;  1T4L B;  2VF1 A;  5FLX C;  1TN9 A;  4DV7 E;  2CPN A;  3VYX A;  2M4I A;  3DF6 A;  4LU9 A;  1YYW A;  4DR6 E;  2EMK A;  2CT1 A;  1NCS A;  4BHC A;  2JR1 A;  4HTG A;  4Q35 B;  2BBG A;  2EM6 A;  2NAB A;  3ECR A;  1O0W A;  3HPS A;  2EOF A;  3IWB A;  2EM0 A;  3DJW A;  4R2Q A;  2L2K B;  1YUI A;  5IXM B;  4R2C A;  3LML A;  1HNZ E;  4O43 A;  4B3R E;  4F6N A;  2KHX A;  2EOX A; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  3ADJ A;  2DMY A;  2UXC E;  3J80 C;  4B3M E;  4JI1 E;  2V89 A;  1SR9 A;  4BC9 A;  4DUY E;  3IWC A;  4R8O A;  4JI8 E;  4DKK A;  4YY3 E;  1FJG E;  1X48 A;  1ZBT A;  2E1M A;  2F8B A;  4F9B B;  5LMN E;  4WFT A;  2MC6 A;  4P7D A;  2UXD E;  3OTO E;  4DR1 E;  4AQY E;  4WYQ B;  4M2Z A;  2LMZ A;  4F54 A;  1STU A;  1GQE A;  2JY9 A;  3KWR A;  4P78 A;  4WSP A;  4WPY A;  4DR3 E;  4JI3 E;  1YYO A;  2K4V A;  5A2Q C;  4OX9 E;  1XNR E;  1UIL A;  2B7T A;  4DV4 E;  2H36 X;  1XMO E;  2L6M A;  1IBM E;  2L33 A;  1YYK A;  4F9C B;  2L3C A;  1J26 A;  2E5L E;  3HXL A;  4DMI A;  4TUI A;  4DV1 E;  1UHZ A;  1RQ0 A;  3H09 A;  3JU0 A;  3F6H A;  3OML A;  2FTX B;  4R03 A;  2RSM A;  4X66 E;  1IBK E;  4JI0 E;  4JI6 E;  4X8W A;  5T6J A;  2UUB E;  4X64 E;  5F3W A;  5ADZ A;  2UXB E;  1YZ9 A;  2DSY A;  4F9A B;  2KOU A;  4NXM E;  1HR0 E;  2ODR D;  4BS9 A;  4DV2 E;  1HNW E;  4DR5 E;  4I8O A;  4DUZ E;  3FIG A;  2M7Q A;  2VQE E;  3VYY A;  4TUG A;  2JWO A;  1DI2 A;  1N34 E;  4JI4 E;  4GKJ E;  2L92 A;  5AE3 A;  3C4B A;  3JTZ A;  4BCA A;  5LMU E;  4LFA E;  1XNQ E;  2ODR C;  1T4N A;  1X49 A;  1X47 A;  2L8T A;  2V83 A;  2YZT A;  4DV0 E;  1EKZ A;  4X65 E;  2RTX A;  4LF6 E;  5IWA E;  5IT9 C;  3K6Q A;  4LF8 E;  2V86 A;  4JI2 E;  3J7A G;  2B9D A;  2LUP B;  5CFF E;  2DIX A;  2FV4 B;  2LTR A;  2L3J A;  5LL6 R;  4LFB E;  2N3H A;  2V8Q B;  2EWL A;  5DNY A;  4JYA E;  1WHN A;  2MDR A;  3J81 C;  2UUC E;  4J8Z A;  1I94 E;  2FGG A;  1XMQ E;  4DR7 E;  2V88 A;  2M1S A;  3LLH A;  3P1X A;  2DB2 A;  2L2N A;  4LTY A;  4KHP E;  3ADI A;  1GZ6 A;  2V85 A;  3VK6 A;  2ZM6 E;  4L5N C;  2B3T B;  4OOG C;  1N36 E;  3ADG A;  4L8N A;  4B3S E;  4GEQ B;  4DV3 E;  1QU6 A;  1WXR A;  2LBS B;  4JV5 E;  3F6G A;  3T1Y E;  4M30 A;  4LFC E;  3HQ1 A;  5BR8 E;  2LTS A;  4LF5 E;  4K0K E;  2V87 A;  2JVA A;  3IWD A;  4DV6 E;  2N3G A;  3ADL A;  2LUQ A;  4DR4 E;  3MSW A;  2HHH E;  4DR2 E;  2RS7 A;  4KZS A;  2YT4 A;  1IBL E;  4Q28 A;  4JI7 E;  3JAM C;  2WZO A;  3AV0 A;  2EZ6 A;  4LF4 E;  4LF7 E;  3RMP A;  1T4L B;  2UUA E;  2NUE A;  2VF1 A;  3AUZ A;  4M0V A;  2JOX A;  2VE7 C;  5FLX C;  4YHH E;  4DV7 E;  1HNX E;  4DV5 E;  2CPN A;  1PKP A;  2NUF A;  3VYX A;  2M4I A;  2RS6 A;  3DF6 A;  1WHQ A;  4LU9 A;  1YYW A;  4DR6 E;  4JI5 E;  1DQ3 A;  2LJH A;  3J7Y p;  2MC5 A;  2VQF E;  4NXN E;  2JR1 A;  5AE2 A;  2KON A;  3HPZ A;  4X62 E;  2UU9 E;  4BMJ A;  2L2M A;  4BC7 A;  2B7V A;  2JOB A;  2IHR 1;  1ZBQ A;  2F4V E;  4LF9 E;  4BBY A;  1O0W A;  2LRS A;  3HPS A;  2NUG A;  3IWB A;  4B3T E;  1RC7 A;  3DJW A;  2L2K B;  2LE2 A;  1N32 E;  2G7H A;  3C4T A;  1FKA E;  3HTX A;  5AE1 A;  4GKK E;  1J5E E;  3LML A;  1HNZ E;  1T4O A;  4B3R E;  5AAS A;  1N33 E;  2KHX A;  3T1H E;  2NA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...