2RS6A

Solution structure of the n-terminal dsrbd from rna helicase a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the double-stranded RNA-binding domains from RNA helicase A
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase A
total genus 22
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rs6A01
4LF8E 2UXCE 4DV4E 1IBME 3LLHA 4LFCE 4DUZE 1PKPA 1XNQE 3ADJA 2NUEA 4M30A 4YHHE 2RTXA 4LF6E 4WYQB 2UU9E 4X65E 3P1XA 2DIXA 1RQ0A 2LTRA 4DUYE 4DV6E 1X48A 4JI4E 2RS6A 2B7VA 2IHR1 4M2ZA 4DR3E 2L3CA 1J5EE 4X8WA 2NUFA 4GKJE 3J7Yp 2VQFE 2RSMA 1UILA 4LFAE 4X66E 4B3RE 2RS7A 2F4VE 4JI1E 1WHNA 1N32E 2L33A 2UUBE 4DR4E 2LUQA 2UXBE 3HTXA 5LMNE 1YYKA 4JYAE 2UXDE 4DKKA 1DI2A 3C4TA 3OTOE 4DR2E 2L2MA 3ADIA 4JI0E 2B7TA 3T1HE 4DR5E 4JI6E 2UUCE 1ZBTA 2CPNA 4X62E 2YT4A 2E5LE 1UHZA 1X49A 1T4LB 2NA2A 1IBKE 4JI2E 4LFBE 2DB2A 4DV0E 1IBLE 4OOGC 4DR6E 2N3GA 3T1YE 3ADGA 5CFFE 1HNXE 4DV1E 1FJGE 1J26A 2NUGA 1FKAE 1EKZA 2MDRA 5LMUE 4B3ME 1HNWE 1STUA 1YZ9A 4AQYE 2DMYA 2JY9A 2ZM6E 2N3HA 4DV2E 4DV3E 4KHPE 4LF7E 2L2NA 4LF4E 1N33E 3VYYA 1HR0E 5IWAE 4DV7E 4NXNE 2L3JA 4DV5E 1RC7A 1HNZE 1O0WA 3ADLA 2UUAE 4LF5E 4K0KE 1I94E 4NXME 4DR1E 1N36E 2L2KB 1X47A 2LJHA 1GQEA 4DR7E 4JI8E 4B3SE 2KHXA 2VQEE 1N34E 1YYOA 2LTSA 4JI5E 2JVAA 4JI3E 3C4BA 4JV5E 5BR8E 2EZ6A 3VYXA 1XNRE 1WHQA 1XMQE 4WFTA 1XMOE 2HHHE 1T4OA 4B3TE 1T4NA 1YYWA 1QU6A 4GKKE 2B3TB 4OX9E 2LRSA 4LF9E 2LBSB 4JI7E 4X64E 4YY3E 2LUPB
chains in the Genus database with same CATH superfamily
3EPJA 3F6HA 2NABA 1X6EA 2RQLA 3BF2A 4I8OA 5DNYA 1YPNA 1A1GA 1XNQE 4ZYGA 2CT1A 2CTDA 4LF6E 2H36X 3MSWA 2ENHA 1ZU1A 1BBOA 2LE2A 1RQ0A 2LTRA 4DUYE 2N8XA 2YRHA 4DV6E 1UBDC 5AC5A 3VHTB 4GKJE 4LFAE 1UILA 2E1MA 5AC4A 4X66E 2RSIA 2YTJA 2F4VE 4JI1E 2YZTA 3H09A 3THNA 2EPNA 4DR4E 2L8TA 4LU9A 2R1FA 2EN1A 2ENAA 2UXDE 2JWOA 5A6KA 1WJPA 2V8QB 3K6QA 1A1IA 2K4VA 1P47A 3T1HE 3KZZA 4DR5E 2ODRD 2FTXB 4O24A 4GZNC 1ZAAC 1GZ6A 1QNTA 2DRPA 2M7QA 1KYQA 1T4LB 2NA2A 4LFBE 4BHBA 4BC7A 2YTFA 3T1YE 4F54A 5CFFE 2EPPA 1J26A 2NUGA 2DMIA 4R2AA 2EM0A 3AV0A 4N4RB 2JXPA 2FGGA 4AQYE 2DMYA 2JY9A 2V86A 2ZM6E 2CSHA 4DV2E 4LF7E 1L4SA 1N33E 1LLMC 3VYYA 4TUGA 4NXNE 1HNZE 2EMYA 1O0WA 4LF5E 4K0KE 4NHRA 5KL2A 1N36E 1YUIA 2GPIA 2YU5A 1A1FA 2EM8A 2EQ3A 2LMZA 4JI8E 1F2IG 2VQEE 2YTIA 1NCSA 2R76A 4JI5E 2JVAA 2KONA 2EZ6A 3DJWA 2Q8UA 2JYAA 5T6JA 2ODRC 1DQ3A 2RPCA 5A6JA 4JI7E 4FK5C 4B3RE 4LF8E 4P7DA 2UXCE 4F9AB 2YTEA 2ELZA 3JTZA 4DV4E 5AE3A 5KL7A 4BC9A 3LLHA 2EOJA 2ADRA 2MDGA 4DUZE 5IT9C 1UN6B 1A1LA 2EMWA 3KWRA 4YHHE 5AE2A 2YTNA 2MC6A 4R2RA 4KWYA 2DIXA 2E72A 2EPLX 4IS1C 2EL5A 5TSEA 2M1SA 2B7VA 2V89A 2G7HA 3C6MA 3RMPA 5KL5A 1MEYC 2EOIA 3J7Yp 2EMIA 4M9VC 1X6HA 1WHNA 1N32E 4R2DA 2LUQA 4ZYEA 4JYAE 4DKKA 1DI2A 3C4TA 1WXRA 3OTOE 2LUPB 1AH5A 4R03A 3JAMC 2EL6A 3MHSC 1EH7A 1TF6A 4JI6E 2CPNA 4RHBB 2HC5A 2E5LE 2BB8A 1X49A 1YSAC 1KJKA 1PJSA 4DV0E 4DR6E 1BBGA 2EN2A 5IXMB 4DV1E 2LCEA 4HEIA 2EN8A 2LJUA 2EMCA 3IWDA 4WPYA 1IQSA 1B69A 4WSGA 4F6MA 2N3HA 2GHFA 4R2CA 2YRKA 3M99B 2EM3A 4LF4E 5A2QC 4DMIA 4DV7E 2EM7A 3KZYA 1RC7A 2EOEA 4F9CB 2A25A 1JK2A 2YTGA 2K7IA 3BGHA 4GEQB 2EPUA 3DF6A 4WXDA 4NXME 2DLKA 2EOMA 2L2KB 2LJHA 2EQ0A 1GQEA 2MKDA 3EPKA 4DR7E 5A6BA 4B3SE 2EPOA 1YYOA 2V85A 2EPAA 1PDAA 4JI3E 3OMLA 1A1JA 3VYXA 1XNRE 2EM5A 2EORA 3EPHA 3TQMA 5IV8B 2EPRA 2B3TB 4F2JC 4OX9E 3HXLA 2EMFA 2LBSB 4X64E 2V87A 1EH8A 3EQ1A 3QG5C 2F8BA 2YTOA 2ELYA 5F3WA 3FIGA 2WZOA 4LFCE 2EPKX 2RTXA 2JOXA 2UU9E 5LLQA 2PRTA 1N3GA 2EMZA 4NZVA 4R2PA 1TF3A 2GLIA 2EOFA 4JI4E 4L5NC 3J81C 2RS6A 4M2ZA 4DR3E 2EM2A 4HTGA 2L3CA 1T39A 2NUFA 2EMKA 2LVHA 2L92A 5FLXC 2RSMA 2I9IA 4O4KA 2UUBE 3MHHC 2EPZA 2UXBE 5LMNE 1YYKA 1WRJA 4KZSA 4ZYDA 2L2MA 2YTDA 4JI0E 2B7TA 2EL4A 3HPZA 3HQ1A 5ADZA 2YRMA 2UUCE 5A6AA 1RMDA 1UHZA 1G2FC 4RH8A 4JI2E 4OOGC 3ECRA 5AE1A 5A6BD 2N3GA 2EQ1A 3ADGA 3LMLA 1MGTA 5KL3A 1FJGE 2EOZA 2EM6A 2VF1A 2YU8A 1HNWE 3HPSA 1DGCA 2LO3A 3IWCA 4BCAA 1IQOA 4KHPE 3ZOQB 2EWLA 4R2SA 1HR0E 1IMUA 2ENCA 2L3JA 2DLQA 2DGCA 2UUAE 1SR9A 2KOUA 4O5GA 4DR1E 3AUZA 2KHXA 2M9AA 1N34E 2M4IA 3C4BA 4JV5E 5BR8E 4Q28A 3BBGA 1XMOE 1T38A 1T4OA 3VK6A 4B3TE 4BMJA 1YFHA 1PJQA 5AASA 2LRSA 2EM9A 4YY3E 3HTXA 4WX9A 2EMAA 1ZBQA 3F6GA 1AAYA 1G2DC 4R2QA 3THOB 3UK3C 1IBME 2YSOA 1SFEA 2EPMX 2EPXA 4P78A 1PKPA 3ADJA 2EOYA 2EN7A 2NUEA 4M30A 2EMHA 2EMLA 3J7AG 4WYQB 2EMGA 4X65E 3P1XA 2LV2A 4F6NA 2D9HA 2EN4A 3J80C 1TN9A 4WSPA 2EOSA 1X48A 2YSPA 2YPNA 2EJ4A 2IHR1 2YTPA 2EN3A 5LL6R 1J5EE 4X8WA 5KL6A 2VQFE 2RS7A 4O43A 2JOBA 2V83A 1GTKA 2L33A 4MLVA 1A1KA 2JR1A 1NEIA 2WCC3 4DR2E 3ADIA 2JPAA 2HJJA 2EE8A 2J7JA 2EPCA 3EPLA 1PJTA 2B9DA 2BBGA 2EOHA 2WBTA 3BIDA 1ZBTA 4X62E 2EOOA 2YT4A 2MKNA 3C6KA 4X9JA 2LT7A 1IBKE 2DB2A 3L00A 1EH6A 1IBLE 2L6MA 4R2EA 4M0VA 4ZYHA 2VRDA 2HGHA 2YTQA 4Q35B 1HNXE 2EP3A 4BHCA 4L8NA 4BS9A 2EM4A 1X5WA 1FKAE 2EMBA 1EKZA 2MDRA 5LMUE 4B3ME 1STUA 1YZ9A 4TUIA 3IWBA 1JK1A 4DV3E 2EN6A 1ZR9A 2YWQA 2L2NA 1YUJA 5IWAE 4DV5E 3JU0A 4MLQA 4IJDA 3ADLA 2JP9A 2EOXA 1I94E 2I13A 1Z1BA 2DSYA 1X6FA 4LTYA 4BBYA 1X47A 4WXCA 4R8OA 2WBUA 2LTSA 5A69A 5KL4A 1BB8A 1WHQA 2FV4B 1XMQE 4WFTA 2HHHE 2EOQA 1X3CA 2V88A 2WBSA 1T4NA 1YYWA 1QU6A 4GKKE 2MC5A 4LF9E 4F9BB 2VE7C 2EMXA 4J8ZA 1A1HA
chains in the Genus database with same CATH topology
4LF8E 4P7DA 2UXCE 2F8BA 1ZBQA 4F9AB 3F6HA 3F6GA 5F3WA 3JTZA 3FIGA 4DV4E 4JI4E 5AE3A 4I8OA 5DNYA 2WZOA 4BC9A 3LLHA 1IBME 4LFCE 4P78A 4DUZE 1PKPA 5IT9C 3ADJA 1XNQE 2NUEA 3KWRA 4M30A 4YHHE 3J7AG 2RTXA 4LF6E 5AE2A 2JOXA 4WYQB 2H36X 2UU9E 2MC6A 3MSWA 4X65E 3P1XA 2DIXA 3J80C 2LE2A 4WSPA 1RQ0A 2LTRA 4DUYE 2M1SA 1X48A 4L5NC 3J81C 2RS6A 2B7VA 2V89A 2G7HA 2IHR1 3RMPA 4M2ZA 4DR3E 2L3CA 5LL6R 1J5EE 4X8WA 2NUFA 4GKJE 2L92A 3J7Yp 2VQFE 5FLXC 2RSMA 1UILA 4LFAE 2E1MA 4X66E 4B3RE 2RS7A 2F4VE 4JI1E 2YZTA 2JOBA 1WHNA 3H09A 1N32E 2V83A 2L33A 2UUBE 4DR4E 2L8TA 2LUQA 4LU9A 2UXBE 3HTXA 5LMNE 2JR1A 1YYKA 4JYAE 2UXDE 2JWOA 4DKKA 1DI2A 3C4TA 1WXRA 4KZSA 3OTOE 4DR2E 2LUPB 2L2MA 2V8QB 3K6QA 3ADIA 2K4VA 4JI0E 4R03A 3JAMC 2B7TA 3T1HE 3HPZA 4DR5E 3HQ1A 2ODRD 5ADZA 4DR6E 2FTXB 2B9DA 4JI6E 1GZ6A 2UUCE 1ZBTA 2CPNA 4X62E 2YT4A 2E5LE 2M7QA 1UHZA 1X49A 1T4LB 4DV6E 2NA2A 1IBKE 4JI2E 4LFBE 2DB2A 4DV0E 1IBLE 4OOGC 2L6MA 5AE1A 4M0VA 4BC7A 2N3GA 3T1YE 2EZ6A 3ADGA 3LMLA 4F54A 5CFFE 1HNXE 4DV1E 1FJGE 4L8NA 1J26A 2VF1A 4BS9A 2NUGA 1FKAE 3IWDA 1EKZA 2MDRA 4WPYA 5LMUE 4B3ME 3AV0A 1STUA 1HNWE 1YZ9A 2FGGA 4AQYE 2DMYA 3HPSA 2JY9A 3IWBA 2V86A 3IWCA 4BCAA 4TUIA 2N3HA 2ZM6E 4DV2E 3ZOQB 4DV3E 3VYXA 4KHPE 2EWLA 4LF7E 2L2NA 4LF4E 5A2QC 1N33E 4DMIA 3VYYA 1HR0E 4TUGA 5IWAE 4DV7E 4NXNE 2L3JA 4DV5E 1RC7A 1HNZE 3JU0A 4F9CB 1O0WA 3ADLA 2UUAE 1SR9A 4LF5E 4K0KE 4GEQB 1I94E 3DF6A 4NXME 2KOUA 2DSYA 4DR1E 4LTYA 3AUZA 2L2KB 1N36E 4BBYA 1X47A 2LJHA 1GQEA 4DR7E 4JV5E 2LMZA 4JI8E 4B3SE 2KHXA 2VQEE 1N34E 4R8OA 1YYOA 2V85A 2LTSA 4JI5E 2JVAA 4JI3E 2M4IA 3C4BA 3OMLA 2KONA 5BR8E 4Q28A 1XNRE 1WHQA 2FV4B 1XMQE 3DJWA 4WFTA 1XMOE 2HHHE 2V88A 1T4OA 3VK6A 4B3TE 4BMJA 1T4NA 1YYWA 1QU6A 4GKKE 2B3TB 2MC5A 5T6JA 4OX9E 3HXLA 2LRSA 1DQ3A 2ODRC 5AASA 4F9BB 4LF9E 4J8ZA 2LBSB 4JI7E 2VE7C 4X64E 4YY3E 2V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 E;  2UXC E;  4DV4 E;  1IBM E;  3LLH A;  4LFC E;  4DUZ E;  1PKP A;  1XNQ E;  3ADJ A;  2NUE A;  4M30 A;  4YHH E;  2RTX A;  4LF6 E;  4WYQ B;  2UU9 E;  4X65 E;  3P1X A;  2DIX A;  1RQ0 A;  2LTR A;  4DUY E;  4DV6 E;  1X48 A;  4JI4 E;  2RS6 A;  2B7V A;  2IHR 1;  4M2Z A;  4DR3 E;  2L3C A;  1J5E E;  4X8W A;  2NUF A;  4GKJ E;  3J7Y p;  2VQF E;  2RSM A;  1UIL A;  4LFA E;  4X66 E;  4B3R E;  2RS7 A;  2F4V E;  4JI1 E;  1WHN A;  1N32 E;  2L33 A;  2UUB E;  4DR4 E;  2LUQ A;  2UXB E;  3HTX A;  5LMN E;  1YYK A;  4JYA E;  2UXD E;  4DKK A;  1DI2 A;  3C4T A;  3OTO E;  4DR2 E;  2L2M A;  3ADI A;  4JI0 E;  2B7T A;  3T1H E;  4DR5 E;  4JI6 E;  2UUC E;  1ZBT A;  2CPN A;  4X62 E;  2YT4 A;  2E5L E;  1UHZ A;  1X49 A;  1T4L B;  2NA2 A;  1IBK E;  4JI2 E;  4LFB E;  2DB2 A;  4DV0 E;  1IBL E;  4OOG C;  4DR6 E;  2N3G A;  3T1Y E;  3ADG A;  5CFF E;  1HNX E;  4DV1 E;  1FJG E;  1J26 A;  2NUG A;  1FKA E;  1EKZ A;  2MDR A;  5LMU E;  4B3M E;  1HNW E;  1STU A;  1YZ9 A;  4AQY E;  2DMY A;  2JY9 A;  2ZM6 E;  2N3H A;  4DV2 E;  4DV3 E;  4KHP E;  4LF7 E;  2L2N A;  4LF4 E;  1N33 E;  3VYY A;  1HR0 E;  5IWA E;  4DV7 E;  4NXN E;  2L3J A;  4DV5 E;  1RC7 A;  1HNZ E;  1O0W A;  3ADL A;  2UUA E;  4LF5 E;  4K0K E;  1I94 E;  4NXM E;  4DR1 E;  1N36 E;  2L2K B;  1X47 A;  2LJH A;  1GQE A;  4DR7 E;  4JI8 E;  4B3S E;  2KHX A;  2VQE E;  1N34 E;  1YYO A;  2LTS A;  4JI5 E;  2JVA A;  4JI3 E;  3C4B A;  4JV5 E;  5BR8 E;  2EZ6 A;  3VYX A;  1XNR E;  1WHQ A;  1XMQ E;  4WFT A;  1XMO E;  2HHH E;  1T4O A;  4B3T E;  1T4N A;  1YYW A;  1QU6 A;  4GKK E;  2B3T B;  4OX9 E;  2LRS A;  4LF9 E;  2LBS B;  4JI7 E;  4X64 E;  4YY3 E;  2LUP B; 
#chains in the Genus database with same CATH topology
 3EPJ A;  3F6H A;  2NAB A;  1X6E A;  2RQL A;  3BF2 A;  4I8O A;  5DNY A;  1YPN A;  1A1G A;  1XNQ E;  4ZYG A;  2CT1 A;  2CTD A;  4LF6 E;  2H36 X;  3MSW A;  2ENH A;  1ZU1 A;  1BBO A;  2LE2 A;  1RQ0 A;  2LTR A;  4DUY E;  2N8X A;  2YRH A;  4DV6 E;  1UBD C;  5AC5 A;  3VHT B;  4GKJ E;  4LFA E;  1UIL A;  2E1M A;  5AC4 A;  4X66 E;  2RSI A;  2YTJ A;  2F4V E;  4JI1 E;  2YZT A;  3H09 A;  3THN A;  2EPN A;  4DR4 E;  2L8T A;  4LU9 A;  2R1F A;  2EN1 A;  2ENA A;  2UXD E;  2JWO A;  5A6K A;  1WJP A;  2V8Q B;  3K6Q A;  1A1I A;  2K4V A;  1P47 A;  3T1H E;  3KZZ A;  4DR5 E;  2ODR D;  2FTX B;  4O24 A;  4GZN C;  1ZAA C;  1GZ6 A;  1QNT A;  2DRP A;  2M7Q A;  1KYQ A;  1T4L B;  2NA2 A;  4LFB E;  4BHB A;  4BC7 A;  2YTF A;  3T1Y E;  4F54 A;  5CFF E;  2EPP A;  1J26 A;  2NUG A;  2DMI A;  4R2A A;  2EM0 A;  3AV0 A;  4N4R B;  2JXP A;  2FGG A;  4AQY E;  2DMY A;  2JY9 A;  2V86 A;  2ZM6 E;  2CSH A;  4DV2 E;  4LF7 E;  1L4S A;  1N33 E;  1LLM C;  3VYY A;  4TUG A;  4NXN E;  1HNZ E;  2EMY A;  1O0W A;  4LF5 E;  4K0K E;  4NHR A;  5KL2 A;  1N36 E;  1YUI A;  2GPI A;  2YU5 A;  1A1F A;  2EM8 A;  2EQ3 A;  2LMZ A;  4JI8 E;  1F2I G;  2VQE E;  2YTI A;  1NCS A;  2R76 A;  4JI5 E;  2JVA A;  2KON A;  2EZ6 A;  3DJW A;  2Q8U A;  2JYA A;  5T6J A;  2ODR C;  1DQ3 A;  2RPC A;  5A6J A;  4JI7 E;  4FK5 C;  4B3R E;  4LF8 E;  4P7D A;  2UXC E;  4F9A B;  2YTE A;  2ELZ A;  3JTZ A;  4DV4 E;  5AE3 A;  5KL7 A;  4BC9 A;  3LLH A;  2EOJ A;  2ADR A;  2MDG A;  4DUZ E;  5IT9 C;  1UN6 B;  1A1L A;  2EMW A;  3KWR A;  4YHH E;  5AE2 A;  2YTN A;  2MC6 A;  4R2R A;  4KWY A;  2DIX A;  2E72 A;  2EPL X;  4IS1 C;  2EL5 A;  5TSE A;  2M1S A;  2B7V A;  2V89 A;  2G7H A;  3C6M A;  3RMP A;  5KL5 A;  1MEY C;  2EOI A;  3J7Y p;  2EMI A;  4M9V C;  1X6H A;  1WHN A;  1N32 E;  4R2D A;  2LUQ A;  4ZYE A;  4JYA E;  4DKK A;  1DI2 A;  3C4T A;  1WXR A;  3OTO E;  2LUP B;  1AH5 A;  4R03 A;  3JAM C;  2EL6 A;  3MHS C;  1EH7 A;  1TF6 A;  4JI6 E;  2CPN A;  4RHB B;  2HC5 A;  2E5L E;  2BB8 A;  1X49 A;  1YSA C;  1KJK A;  1PJS A;  4DV0 E;  4DR6 E;  1BBG A;  2EN2 A;  5IXM B;  4DV1 E;  2LCE A;  4HEI A;  2EN8 A;  2LJU A;  2EMC A;  3IWD A;  4WPY A;  1IQS A;  1B69 A;  4WSG A;  4F6M A;  2N3H A;  2GHF A;  4R2C A;  2YRK A;  3M99 B;  2EM3 A;  4LF4 E;  5A2Q C;  4DMI A;  4DV7 E;  2EM7 A;  3KZY A;  1RC7 A;  2EOE A;  4F9C B;  2A25 A;  1JK2 A;  2YTG A;  2K7I A;  3BGH A;  4GEQ B;  2EPU A;  3DF6 A;  4WXD A;  4NXM E;  2DLK A;  2EOM A;  2L2K B;  2LJH A;  2EQ0 A;  1GQE A;  2MKD A;  3EPK A;  4DR7 E;  5A6B A;  4B3S E;  2EPO A;  1YYO A;  2V85 A;  2EPA A;  1PDA A;  4JI3 E;  3OML A;  1A1J A;  3VYX A;  1XNR E;  2EM5 A;  2EOR A;  3EPH A;  3TQM A;  5IV8 B;  2EPR A;  2B3T B;  4F2J C;  4OX9 E;  3HXL A;  2EMF A;  2LBS B;  4X64 E;  2V87 A;  1EH8 A;  3EQ1 A;  3QG5 C;  2F8B A;  2YTO A;  2ELY A;  5F3W A;  3FIG A;  2WZO A;  4LFC E;  2EPK X;  2RTX A;  2JOX A;  2UU9 E;  5LLQ A;  2PRT A;  1N3G A;  2EMZ A;  4NZV A;  4R2P A;  1TF3 A;  2GLI A;  2EOF A;  4JI4 E;  4L5N C;  3J81 C;  2RS6 A;  4M2Z A;  4DR3 E;  2EM2 A;  4HTG A;  2L3C A;  1T39 A;  2NUF A;  2EMK A;  2LVH A;  2L92 A;  5FLX C;  2RSM A;  2I9I A;  4O4K A;  2UUB E;  3MHH C;  2EPZ A;  2UXB E;  5LMN E;  1YYK A;  1WRJ A;  4KZS A;  4ZYD A;  2L2M A;  2YTD A;  4JI0 E;  2B7T A;  2EL4 A;  3HPZ A;  3HQ1 A;  5ADZ A;  2YRM A;  2UUC E;  5A6A A;  1RMD A;  1UHZ A;  1G2F C;  4RH8 A;  4JI2 E;  4OOG C;  3ECR A;  5AE1 A;  5A6B D;  2N3G A;  2EQ1 A;  3ADG A;  3LML A;  1MGT A;  5KL3 A;  1FJG E;  2EOZ A;  2EM6 A;  2VF1 A;  2YU8 A;  1HNW E;  3HPS A;  1DGC A;  2LO3 A;  3IWC A;  4BCA A;  1IQO A;  4KHP E;  3ZOQ B;  2EWL A;  4R2S A;  1HR0 E;  1IMU A;  2ENC A;  2L3J A;  2DLQ A;  2DGC A;  2UUA E;  1SR9 A;  2KOU A;  4O5G A;  4DR1 E;  3AUZ A;  2KHX A;  2M9A A;  1N34 E;  2M4I A;  3C4B A;  4JV5 E;  5BR8 E;  4Q28 A;  3BBG A;  1XMO E;  1T38 A;  1T4O A;  3VK6 A;  4B3T E;  4BMJ A;  1YFH A;  1PJQ A;  5AAS A;  2LRS A;  2EM9 A;  4YY3 E;  3HTX A;  4WX9 A;  2EMA A;  1ZBQ A;  3F6G A;  1AAY A;  1G2D C;  4R2Q A;  3THO B;  3UK3 C;  1IBM E;  2YSO A;  1SFE A;  2EPM X;  2EPX A;  4P78 A;  1PKP A;  3ADJ A;  2EOY A;  2EN7 A;  2NUE A;  4M30 A;  2EMH A;  2EML A;  3J7A G;  4WYQ B;  2EMG A;  4X65 E;  3P1X A;  2LV2 A;  4F6N A;  2D9H A;  2EN4 A;  3J80 C;  1TN9 A;  4WSP A;  2EOS A;  1X48 A;  2YSP A;  2YPN A;  2EJ4 A;  2IHR 1;  2YTP A;  2EN3 A;  5LL6 R;  1J5E E;  4X8W A;  5KL6 A;  2VQF E;  2RS7 A;  4O43 A;  2JOB A;  2V83 A;  1GTK A;  2L33 A;  4MLV A;  1A1K A;  2JR1 A;  1NEI A;  2WCC 3;  4DR2 E;  3ADI A;  2JPA A;  2HJJ A;  2EE8 A;  2J7J A;  2EPC A;  3EPL A;  1PJT A;  2B9D A;  2BBG A;  2EOH A;  2WBT A;  3BID A;  1ZBT A;  4X62 E;  2EOO A;  2YT4 A;  2MKN A;  3C6K A;  4X9J A;  2LT7 A;  1IBK E;  2DB2 A;  3L00 A;  1EH6 A;  1IBL E;  2L6M A;  4R2E A;  4M0V A;  4ZYH A;  2VRD A;  2HGH A;  2YTQ A;  4Q35 B;  1HNX E;  2EP3 A;  4BHC A;  4L8N A;  4BS9 A;  2EM4 A;  1X5W A;  1FKA E;  2EMB A;  1EKZ A;  2MDR A;  5LMU E;  4B3M E;  1STU A;  1YZ9 A;  4TUI A;  3IWB A;  1JK1 A;  4DV3 E;  2EN6 A;  1ZR9 A;  2YWQ A;  2L2N A;  1YUJ A;  5IWA E;  4DV5 E;  3JU0 A;  4MLQ A;  4IJD A;  3ADL A;  2JP9 A;  2EOX A;  1I94 E;  2I13 A;  1Z1B A;  2DSY A;  1X6F A;  4LTY A;  4BBY A;  1X47 A;  4WXC A;  4R8O A;  2WBU A;  2LTS A;  5A69 A;  5KL4 A;  1BB8 A;  1WHQ A;  2FV4 B;  1XMQ E;  4WFT A;  2HHH E;  2EOQ A;  1X3C A;  2V88 A;  2WBS A;  1T4N A;  1YYW A;  1QU6 A;  4GKK E;  2MC5 A;  4LF9 E;  4F9B B;  2VE7 C;  2EMX A;  4J8Z A;  1A1H A; 
#chains in the Genus database with same CATH homology
 4LF8 E;  4P7D A;  2UXC E;  2F8B A;  1ZBQ A;  4F9A B;  3F6H A;  3F6G A;  5F3W A;  3JTZ A;  3FIG A;  4DV4 E;  4JI4 E;  5AE3 A;  4I8O A;  5DNY A;  2WZO A;  4BC9 A;  3LLH A;  1IBM E;  4LFC E;  4P78 A;  4DUZ E;  1PKP A;  5IT9 C;  3ADJ A;  1XNQ E;  2NUE A;  3KWR A;  4M30 A;  4YHH E;  3J7A G;  2RTX A;  4LF6 E;  5AE2 A;  2JOX A;  4WYQ B;  2H36 X;  2UU9 E;  2MC6 A;  3MSW A;  4X65 E;  3P1X A;  2DIX A;  3J80 C;  2LE2 A;  4WSP A;  1RQ0 A;  2LTR A;  4DUY E;  2M1S A;  1X48 A;  4L5N C;  3J81 C;  2RS6 A;  2B7V A;  2V89 A;  2G7H A;  2IHR 1;  3RMP A;  4M2Z A;  4DR3 E;  2L3C A;  5LL6 R;  1J5E E;  4X8W A;  2NUF A;  4GKJ E;  2L92 A;  3J7Y p;  2VQF E;  5FLX C;  2RSM A;  1UIL A;  4LFA E;  2E1M A;  4X66 E;  4B3R E;  2RS7 A;  2F4V E;  4JI1 E;  2YZT A;  2JOB A;  1WHN A;  3H09 A;  1N32 E;  2V83 A;  2L33 A;  2UUB E;  4DR4 E;  2L8T A;  2LUQ A;  4LU9 A;  2UXB E;  3HTX A;  5LMN E;  2JR1 A;  1YYK A;  4JYA E;  2UXD E;  2JWO A;  4DKK A;  1DI2 A;  3C4T A;  1WXR A;  4KZS A;  3OTO E;  4DR2 E;  2LUP B;  2L2M A;  2V8Q B;  3K6Q A;  3ADI A;  2K4V A;  4JI0 E;  4R03 A;  3JAM C;  2B7T A;  3T1H E;  3HPZ A;  4DR5 E;  3HQ1 A;  2ODR D;  5ADZ A;  4DR6 E;  2FTX B;  2B9D A;  4JI6 E;  1GZ6 A;  2UUC E;  1ZBT A;  2CPN A;  4X62 E;  2YT4 A;  2E5L E;  2M7Q A;  1UHZ A;  1X49 A;  1T4L B;  4DV6 E;  2NA2 A;  1IBK E;  4JI2 E;  4LFB E;  2DB2 A;  4DV0 E;  1IBL E;  4OOG C;  2L6M A;  5AE1 A;  4M0V A;  4BC7 A;  2N3G A;  3T1Y E;  2EZ6 A;  3ADG A;  3LML A;  4F54 A;  5CFF E;  1HNX E;  4DV1 E;  1FJG E;  4L8N A;  1J26 A;  2VF1 A;  4BS9 A;  2NUG A;  1FKA E;  3IWD A;  1EKZ A;  2MDR A;  4WPY A;  5LMU E;  4B3M E;  3AV0 A;  1STU A;  1HNW E;  1YZ9 A;  2FGG A;  4AQY E;  2DMY A;  3HPS A;  2JY9 A;  3IWB A;  2V86 A;  3IWC A;  4BCA A;  4TUI A;  2N3H A;  2ZM6 E;  4DV2 E;  3ZOQ B;  4DV3 E;  3VYX A;  4KHP E;  2EWL A;  4LF7 E;  2L2N A;  4LF4 E;  5A2Q C;  1N33 E;  4DMI A;  3VYY A;  1HR0 E;  4TUG A;  5IWA E;  4DV7 E;  4NXN E;  2L3J A;  4DV5 E;  1RC7 A;  1HNZ E;  3JU0 A;  4F9C B;  1O0W A;  3ADL A;  2UUA E;  1SR9 A;  4LF5 E;  4K0K E;  4GEQ B;  1I94 E;  3DF6 A;  4NXM E;  2KOU A;  2DSY A;  4DR1 E;  4LTY A;  3AUZ A;  2L2K B;  1N36 E;  4BBY A;  1X47 A;  2LJH A;  1GQE A;  4DR7 E;  4JV5 E;  2LMZ A;  4JI8 E;  4B3S E;  2KHX A;  2VQE E;  1N34 E;  4R8O A;  1YYO A;  2V85 A;  2LTS A;  4JI5 E;  2JVA A;  4JI3 E;  2M4I A;  3C4B A;  3OML A;  2KON A;  5BR8 E;  4Q28 A;  1XNR E;  1WHQ A;  2FV4 B;  1XMQ E;  3DJW A;  4WFT A;  1XMO E;  2HHH E;  2V88 A;  1T4O A;  3VK6 A;  4B3T E;  4BMJ A;  1T4N A;  1YYW A;  1QU6 A;  4GKK E;  2B3T B;  2MC5 A;  5T6J A;  4OX9 E;  3HXL A;  2LRS A;  1DQ3 A;  2ODR C;  5AAS A;  4F9B B;  4LF9 E;  4J8Z A;  2LBS B;  4JI7 E;  2VE7 C;  4X64 E;  4YY3 E;  2V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...