4WSPA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
79
Chain Sequence
b'QSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 79
sequence length 83
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wspA01
4WPYA 4WSPA 2FGGA
chains in the Genus database with same CATH superfamily
4JI2E 2EQ1A 4DV3E 1LLMC 4F9AB 2UXCE 5A6BA 2CT1A 4RHBB 2EL5A 2LUPB 5IV8B 2VQFE 2RSMA 2LTSA 1X6FA 1YFHA 3HPSA 3ZOQB 5IT9C 4X8WA 3HPZA 2V86A 4NXME 4DR4E 2E5LE 2YTPA 2M4IA 2KOUA 2EL4A 4R2QA 3KZZA 2YTJA 1B69A 1STUA 3ADIA 1X3CA 2D9HA 2EQ0A 1UBDC 3F6GA 2EPCA 3QG5C 2VE7C 1X6HA 1T4LB 2DB2A 2UUCE 2HHHE 2EWLA 5KL6A 1NEIA 3VYXA 2L2MA 2VF1A 2L33A 1ZR9A 4LF9E 2B3TB 4R2DA 4DKKA 3ADJA 5LL6R 3EPJA 2ELYA 1EKZA 2EPKX 2B7VA 3ECRA 4RH8A 1L4SA 1GZ6A 4BCAA 1GTKA 2BB8A 1ZBTA 1WJPA 4NXNE 4LFAE 4B3TE 2H36X 2EM2A 1UILA 1YPNA 4Q28A 5A2QC 2CTDA 2EMIA 2YRMA 3H09A 1WRJA 2ODRD 2ENHA 2EMHA 2L6MA 1PDAA 4ZYHA 4KWYA 5LLQA 3BGHA 2EOFA 5TSEA 2RPCA 1GQEA 1XNQE 2KHXA 1A1LA 2YTFA 4WFTA 3EPLA 3IWBA 4HTGA 1IQSA 2EMGA 4F6NA 4LF7E 5AE2A 2KONA 3P1XA 1PJTA 5T6JA 1AH5A 2EPLX 4DR7E 2UXBE 2WBTA 2EN3A 5KL4A 2JOBA 3THOB 3MHSC 4KZSA 2FGGA 4GZNC 2EMBA 2F4VE 4DUYE 1IBME 4YHHE 4TUIA 3T1YE 4M9VC 4WXCA 1QNTA 4J8ZA 2PRTA 1TF3A 1IMUA 2F8BA 4ZYDA 2YTQA 1WHQA 1ZU1A 2MDRA 2DLQA 2L2NA 4IJDA 2YPNA 1N36E 4DR6E 2YTDA 1JK1A 4BHCA 1UN6B 1IQOA 3HQ1A 4DV7E 2L3CA 2EMKA 4X9JA 3BIDA 1N3GA 2YZTA 4WSPA 1QU6A 2EPRA 2E1MA 3JAMC 1J26A 2E72A 2RS6A 4LF4E 2YTNA 3BF2A 3LMLA 1FJGE 1G2DC 2DMYA 4DR1E 4O24A 2L2KB 4KHPE 3J80C 2EN4A 1RQ0A 2EOQA 2EZ6A 1J5EE 1YYOA 5IWAE 4R8OA 1BBOA 2YRHA 1EH6A 3J7Yp 1BB8A 3TQMA 5KL5A 2LT7A 5KL7A 1A1JA 1A1FA 1XMQE 3M99B 3KZYA 2FV4B 4MLVA 5F3WA 2HGHA 4NHRA 1SR9A 1DI2A 4R2AA 2EOOA 2EMYA 2EJ4A 1HR0E 4R2EA 1KJKA 4DV0E 4GKJE 4ZYEA 2N8XA 2YTGA 1YUIA 2EOZA 2EQ3A 2JR1A 2EPPA 1N33E 2V83A 2RS7A 4F2JC 2ODRC 1YZ9A 5AE1A 4WSGA 2EMZA 1G2FC 4DV6E 4LFCE 5ADZA 4M0VA 4B3ME 4BHBA 2DGCA 2YSPA 4WXDA 2A25A 3DJWA 4DV5E 2UUBE 3FIGA 4R2PA 4JI7E 2RSIA 1IBLE 3C6MA 1O0WA 2EPAA 4DMIA 2UXDE 2LE2A 2EORA 1MGTA 1N34E 2EM4A 4BC9A 3EPHA 3MHHC 2EOMA 2EOJA 2JP9A 4JI6E 2EPXA 1FKAE 2EMWA 4JI4E 1ZBQA 2V8QB 2EOIA 4O5GA 4BMJA 2MDGA 1YUJA 2Q8UA 2L8TA 1A1KA 1PKPA 5LMNE 2K7IA 1I94E 2N3GA 4R2RA 2CSHA 5A69A 4LF8E 1YSAC 2M9AA 2MC6A 2YRKA 2HJJA 2EOSA 5A6KA 2NA2A 3C4TA 4X65E 2I13A 2EOXA 3K6QA 2WZOA 1F2IG 4DR5E 1TN9A 2EM6A 4F9CB 3AV0A 4BBYA 3DF6A 3LLHA 2WBUA 2LMZA 1UHZA 2JXPA 1T39A 2EM9A 2LV2A 4DV2E 3T1HE 2NUFA 2JOXA 2YWQA 3EQ1A 3EPKA 3C4BA 3JU0A 4JYAE 2N3HA 2LBSB 3THNA 4BC7A 2GLIA 4L8NA 2K4VA 5AC4A 4OOGC 3OTOE 4JI0E 2RTXA 4IS1C 1Z1BA 1X48A 3L00A 2G7HA 2M7QA 1T4NA 2VQEE 5AE3A 1KYQA 4N4RB 4R2SA 2JWOA 2YTEA 5CFFE 1DGCA 5DNYA 2LJHA 4X66E 4M30A 1X6EA 2J7JA 3ADGA 1WHNA 2ENAA 4DR3E 3RMPA 2B7TA 4JI5E 1EH8A 1WXRA 2DRPA 2EMCA 5BR8E 2JYAA 2V89A 2HC5A 1YYWA 4ZYGA 4LFBE 5A6AA 3VHTB 4X64E 2R1FA 2NABA 3AUZA 5A6BD 2CPNA 1AAYA 4LF6E 2L3JA 2L92A 1HNWE 2EM3A 2EM7A 2B9DA 2EM8A 2R76A 2YU5A 5AC5A 3F6HA 2WCC3 2M1SA 2EPOA 2IHR1 4LTYA 1JK2A 2EN6A 1BBGA 4R2CA 1TF6A 2YU8A 2MKDA 2EMLA 2WBSA 3J7AG 2YSOA 2ELZA 3ADLA 4B3RE 1P47A 2LRSA 3IWCA 3VK6A 4DR2E 1IBKE 2ADRA 2LUQA 2GPIA 2YTIA 4M2ZA 3HTXA 1PJSA 1A1GA 1N32E 2YTOA 2EPUA 2UUAE 4DV4E 4FK5C 1MEYC 4X62E 2EE8A 2DLKA 3J81C 4JI1E 3HXLA 4O43A 4P78A 4JI3E 4F6MA 5IXMB 2EPMX 2EOHA 4F54A 4JV5E 4DV1E 2EPNA 1A1HA 5AASA 4YY3E 2LVHA 1ZAAC 5A6JA 3C6KA 1T4OA 1DQ3A 2JVAA 4WPYA 4BS9A 3VYYA 5KL2A 1NCSA 5LMUE 1T38A 2FTXB 3JTZA 2UU9E 2MC5A 2JPAA 2EMFA 1X5WA 1SFEA 2DMIA 2EOEA 4K0KE 1X47A 2EN2A 3MSWA 2EM5A 2YT4A 2EN1A 2V87A 2ZM6E 2EL6A 1EH7A 4B3SE 2DIXA 4I8OA 4HEIA 2LTRA 2NUEA 1PJQA 2BBGA 2EOYA 4NZVA 2EP3A 4WX9A 1X49A 2EMXA 2GHFA 2VRDA 3BBGA 4GEQB 5FLXC 4JI8E 3UK3C 2LO3A 4WYQB 2EMAA 4F9BB 2LCEA 4TUGA 2NUGA 2EPZA 4GKKE 1RC7A 3KWRA 4LU9A 4DUZE 5KL3A 4LF5E 2ENCA 1YYKA 4OX9E 2I9IA 2EN7A 2DSYA 4MLQA 4Q35B 3IWDA 1HNXE 4P7DA 1XMOE 2EN8A 1XNRE 2MKNA 3OMLA 4R03A 1RMDA 1A1IA 4AQYE 2V88A 4O4KA 2JY9A 2EM0A 2V85A 2RQLA 1HNZE 4L5NC 2LJUA
chains in the Genus database with same CATH topology
1PKPA 1WHQA 3ADLA 4JI2E 4B3RE 2MDRA 2LRSA 5LMNE 2L2NA 4DV3E 3IWCA 3VK6A 4DR2E 4F9AB 1IBKE 1N36E 1I94E 4DR6E 2UXCE 2LUPB 2LUQA 2VQFE 2RSMA 2LTSA 3HQ1A 4DV7E 2N3GA 2L3CA 4M2ZA 3HPSA 3ZOQB 3HTXA 2YZTA 4WSPA 1QU6A 5IT9C 4X8WA 1N32E 3HPZA 2V86A 2UUAE 4NXME 4DV4E 2E1MA 3JAMC 2E5LE 4DR4E 1J26A 4LF8E 2M4IA 2KOUA 1IBME 2MC6A 4X62E 2RS6A 4LF4E 3J81C 3LMLA 1STUA 3HXLA 4JI1E 1FJGE 3ADIA 2DMYA 4P78A 4DR1E 4JI3E 2L2KB 2NA2A 3C4TA 4X65E 4KHPE 3F6GA 3K6QA 2WZOA 4F54A 3J80C 4DV1E 4JV5E 1RQ0A 4DR5E 2VE7C 5AASA 4YY3E 1YYOA 1J5EE 2EZ6A 5IWAE 4R8OA 1T4LB 2DB2A 2UUCE 2HHHE 2EWLA 4F9CB 3AV0A 1T4OA 4BBYA 3DF6A 3LLHA 3J7Yp 3VYXA 2LMZA 2L2MA 1UHZA 1DQ3A 2L33A 2VF1A 2JVAA 4LF9E 2B3TB 4WPYA 4DV2E 4DKKA 3T1HE 4BS9A 3VYYA 2NUFA 2JOXA 3ADJA 5LL6R 5LMUE 3C4BA 2FTXB 3JU0A 3JTZA 1XMQE 1EKZA 2UU9E 4JYAE 2MC5A 2B7VA 2N3HA 2FV4B 2LBSB 4BC7A 5F3WA 1SR9A 1GZ6A 4BCAA 4L8NA 4K0KE 2K4VA 1DI2A 1X47A 3MSWA 4OOGC 1ZBTA 3OTOE 4JI0E 4NXNE 2YT4A 4LFAE 2RTXA 2V87A 4B3TE 2ZM6E 1HR0E 1X48A 2H36X 1UILA 4B3SE 2G7HA 2M7QA 4DV0E 4GKJE 1T4NA 4Q28A 2VQEE 5AE3A 2DIXA 4I8OA 5A2QC 2JWOA 5CFFE 3H09A 2LTRA 2JR1A 5DNYA 2ODRD 2LJHA 4X66E 2NUEA 1N33E 4M30A 2RS7A 2V83A 2L6MA 3ADGA 1WHNA 2ODRC 1YZ9A 5AE1A 4DR3E 1X49A 5FLXC 4GEQB 3RMPA 2B7TA 4JI5E 4DV6E 1GQEA 4LFCE 1XNQE 4JI8E 5ADZA 2KHXA 4M0VA 4WFTA 4WYQB 1WXRA 4F9BB 4B3ME 3IWBA 5BR8E 4TUGA 2V89A 4LF7E 5AE2A 2NUGA 2KONA 4GKKE 1RC7A 1YYWA 3KWRA 3DJWA 3P1XA 4DV5E 2UUBE 4LU9A 4DUZE 3FIGA 4LFBE 4JI7E 1IBLE 4LF5E 1O0WA 5T6JA 4DR7E 2UXBE 4X64E 4DMIA 1YYKA 2UXDE 2LE2A 4OX9E 3AUZA 2JOBA 1N34E 2CPNA 4BC9A 2DSYA 4LF6E 2L3JA 3IWDA 2L92A 1HNWE 1HNXE 4JI6E 4P7DA 1FKAE 2B9DA 4KZSA 2FGGA 1XMOE 2F4VE 4JI4E 1ZBQA 4DUYE 2V8QB 3F6HA 1XNRE 4BMJA 2M1SA 3OMLA 2IHR1 4LTYA 4R03A 4YHHE 4TUIA 2V88A 4AQYE 3T1YE 4J8ZA 2JY9A 2F8BA 2V85A 1HNZE 2L8TA 3J7AG 4L5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPY A;  4WSP A;  2FGG A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  2EQ1 A;  4DV3 E;  1LLM C;  4F9A B;  2UXC E;  5A6B A;  2CT1 A;  4RHB B;  2EL5 A;  2LUP B;  5IV8 B;  2VQF E;  2RSM A;  2LTS A;  1X6F A;  1YFH A;  3HPS A;  3ZOQ B;  5IT9 C;  4X8W A;  3HPZ A;  2V86 A;  4NXM E;  4DR4 E;  2E5L E;  2YTP A;  2M4I A;  2KOU A;  2EL4 A;  4R2Q A;  3KZZ A;  2YTJ A;  1B69 A;  1STU A;  3ADI A;  1X3C A;  2D9H A;  2EQ0 A;  1UBD C;  3F6G A;  2EPC A;  3QG5 C;  2VE7 C;  1X6H A;  1T4L B;  2DB2 A;  2UUC E;  2HHH E;  2EWL A;  5KL6 A;  1NEI A;  3VYX A;  2L2M A;  2VF1 A;  2L33 A;  1ZR9 A;  4LF9 E;  2B3T B;  4R2D A;  4DKK A;  3ADJ A;  5LL6 R;  3EPJ A;  2ELY A;  1EKZ A;  2EPK X;  2B7V A;  3ECR A;  4RH8 A;  1L4S A;  1GZ6 A;  4BCA A;  1GTK A;  2BB8 A;  1ZBT A;  1WJP A;  4NXN E;  4LFA E;  4B3T E;  2H36 X;  2EM2 A;  1UIL A;  1YPN A;  4Q28 A;  5A2Q C;  2CTD A;  2EMI A;  2YRM A;  3H09 A;  1WRJ A;  2ODR D;  2ENH A;  2EMH A;  2L6M A;  1PDA A;  4ZYH A;  4KWY A;  5LLQ A;  3BGH A;  2EOF A;  5TSE A;  2RPC A;  1GQE A;  1XNQ E;  2KHX A;  1A1L A;  2YTF A;  4WFT A;  3EPL A;  3IWB A;  4HTG A;  1IQS A;  2EMG A;  4F6N A;  4LF7 E;  5AE2 A;  2KON A;  3P1X A;  1PJT A;  5T6J A;  1AH5 A;  2EPL X;  4DR7 E;  2UXB E;  2WBT A;  2EN3 A;  5KL4 A;  2JOB A;  3THO B;  3MHS C;  4KZS A;  2FGG A;  4GZN C;  2EMB A;  2F4V E;  4DUY E;  1IBM E;  4YHH E;  4TUI A;  3T1Y E;  4M9V C;  4WXC A;  1QNT A;  4J8Z A;  2PRT A;  1TF3 A;  1IMU A;  2F8B A;  4ZYD A;  2YTQ A;  1WHQ A;  1ZU1 A;  2MDR A;  2DLQ A;  2L2N A;  4IJD A;  2YPN A;  1N36 E;  4DR6 E;  2YTD A;  1JK1 A;  4BHC A;  1UN6 B;  1IQO A;  3HQ1 A;  4DV7 E;  2L3C A;  2EMK A;  4X9J A;  3BID A;  1N3G A;  2YZT A;  4WSP A;  1QU6 A;  2EPR A;  2E1M A;  3JAM C;  1J26 A;  2E72 A;  2RS6 A;  4LF4 E;  2YTN A;  3BF2 A;  3LML A;  1FJG E;  1G2D C;  2DMY A;  4DR1 E;  4O24 A;  2L2K B;  4KHP E;  3J80 C;  2EN4 A;  1RQ0 A;  2EOQ A;  2EZ6 A;  1J5E E;  1YYO A;  5IWA E;  4R8O A;  1BBO A;  2YRH A;  1EH6 A;  3J7Y p;  1BB8 A;  3TQM A;  5KL5 A;  2LT7 A;  5KL7 A;  1A1J A;  1A1F A;  1XMQ E;  3M99 B;  3KZY A;  2FV4 B;  4MLV A;  5F3W A;  2HGH A;  4NHR A;  1SR9 A;  1DI2 A;  4R2A A;  2EOO A;  2EMY A;  2EJ4 A;  1HR0 E;  4R2E A;  1KJK A;  4DV0 E;  4GKJ E;  4ZYE A;  2N8X A;  2YTG A;  1YUI A;  2EOZ A;  2EQ3 A;  2JR1 A;  2EPP A;  1N33 E;  2V83 A;  2RS7 A;  4F2J C;  2ODR C;  1YZ9 A;  5AE1 A;  4WSG A;  2EMZ A;  1G2F C;  4DV6 E;  4LFC E;  5ADZ A;  4M0V A;  4B3M E;  4BHB A;  2DGC A;  2YSP A;  4WXD A;  2A25 A;  3DJW A;  4DV5 E;  2UUB E;  3FIG A;  4R2P A;  4JI7 E;  2RSI A;  1IBL E;  3C6M A;  1O0W A;  2EPA A;  4DMI A;  2UXD E;  2LE2 A;  2EOR A;  1MGT A;  1N34 E;  2EM4 A;  4BC9 A;  3EPH A;  3MHH C;  2EOM A;  2EOJ A;  2JP9 A;  4JI6 E;  2EPX A;  1FKA E;  2EMW A;  4JI4 E;  1ZBQ A;  2V8Q B;  2EOI A;  4O5G A;  4BMJ A;  2MDG A;  1YUJ A;  2Q8U A;  2L8T A;  1A1K A;  1PKP A;  5LMN E;  2K7I A;  1I94 E;  2N3G A;  4R2R A;  2CSH A;  5A69 A;  4LF8 E;  1YSA C;  2M9A A;  2MC6 A;  2YRK A;  2HJJ A;  2EOS A;  5A6K A;  2NA2 A;  3C4T A;  4X65 E;  2I13 A;  2EOX A;  3K6Q A;  2WZO A;  1F2I G;  4DR5 E;  1TN9 A;  2EM6 A;  4F9C B;  3AV0 A;  4BBY A;  3DF6 A;  3LLH A;  2WBU A;  2LMZ A;  1UHZ A;  2JXP A;  1T39 A;  2EM9 A;  2LV2 A;  4DV2 E;  3T1H E;  2NUF A;  2JOX A;  2YWQ A;  3EQ1 A;  3EPK A;  3C4B A;  3JU0 A;  4JYA E;  2N3H A;  2LBS B;  3THN A;  4BC7 A;  2GLI A;  4L8N A;  2K4V A;  5AC4 A;  4OOG C;  3OTO E;  4JI0 E;  2RTX A;  4IS1 C;  1Z1B A;  1X48 A;  3L00 A;  2G7H A;  2M7Q A;  1T4N A;  2VQE E;  5AE3 A;  1KYQ A;  4N4R B;  4R2S A;  2JWO A;  2YTE A;  5CFF E;  1DGC A;  5DNY A;  2LJH A;  4X66 E;  4M30 A;  1X6E A;  2J7J A;  3ADG A;  1WHN A;  2ENA A;  4DR3 E;  3RMP A;  2B7T A;  4JI5 E;  1EH8 A;  1WXR A;  2DRP A;  2EMC A;  5BR8 E;  2JYA A;  2V89 A;  2HC5 A;  1YYW A;  4ZYG A;  4LFB E;  5A6A A;  3VHT B;  4X64 E;  2R1F A;  2NAB A;  3AUZ A;  5A6B D;  2CPN A;  1AAY A;  4LF6 E;  2L3J A;  2L92 A;  1HNW E;  2EM3 A;  2EM7 A;  2B9D A;  2EM8 A;  2R76 A;  2YU5 A;  5AC5 A;  3F6H A;  2WCC 3;  2M1S A;  2EPO A;  2IHR 1;  4LTY A;  1JK2 A;  2EN6 A;  1BBG A;  4R2C A;  1TF6 A;  2YU8 A;  2MKD A;  2EML A;  2WBS A;  3J7A G;  2YSO A;  2ELZ A;  3ADL A;  4B3R E;  1P47 A;  2LRS A;  3IWC A;  3VK6 A;  4DR2 E;  1IBK E;  2ADR A;  2LUQ A;  2GPI A;  2YTI A;  4M2Z A;  3HTX A;  1PJS A;  1A1G A;  1N32 E;  2YTO A;  2EPU A;  2UUA E;  4DV4 E;  4FK5 C;  1MEY C;  4X62 E;  2EE8 A;  2DLK A;  3J81 C;  4JI1 E;  3HXL A;  4O43 A;  4P78 A;  4JI3 E;  4F6M A;  5IXM B;  2EPM X;  2EOH A;  4F54 A;  4JV5 E;  4DV1 E;  2EPN A;  1A1H A;  5AAS A;  4YY3 E;  2LVH A;  1ZAA C;  5A6J A;  3C6K A;  1T4O A;  1DQ3 A;  2JVA A;  4WPY A;  4BS9 A;  3VYY A;  5KL2 A;  1NCS A;  5LMU E;  1T38 A;  2FTX B;  3JTZ A;  2UU9 E;  2MC5 A;  2JPA A;  2EMF A;  1X5W A;  1SFE A;  2DMI A;  2EOE A;  4K0K E;  1X47 A;  2EN2 A;  3MSW A;  2EM5 A;  2YT4 A;  2EN1 A;  2V87 A;  2ZM6 E;  2EL6 A;  1EH7 A;  4B3S E;  2DIX A;  4I8O A;  4HEI A;  2LTR A;  2NUE A;  1PJQ A;  2BBG A;  2EOY A;  4NZV A;  2EP3 A;  4WX9 A;  1X49 A;  2EMX A;  2GHF A;  2VRD A;  3BBG A;  4GEQ B;  5FLX C;  4JI8 E;  3UK3 C;  2LO3 A;  4WYQ B;  2EMA A;  4F9B B;  2LCE A;  4TUG A;  2NUG A;  2EPZ A;  4GKK E;  1RC7 A;  3KWR A;  4LU9 A;  4DUZ E;  5KL3 A;  4LF5 E;  2ENC A;  1YYK A;  4OX9 E;  2I9I A;  2EN7 A;  2DSY A;  4MLQ A;  4Q35 B;  3IWD A;  1HNX E;  4P7D A;  1XMO E;  2EN8 A;  1XNR E;  2MKN A;  3OML A;  4R03 A;  1RMD A;  1A1I A;  4AQY E;  2V88 A;  4O4K A;  2JY9 A;  2EM0 A;  2V85 A;  2RQL A;  1HNZ E;  4L5N C;  2LJU A; 
#chains in the Genus database with same CATH homology
 1PKP A;  1WHQ A;  3ADL A;  4JI2 E;  4B3R E;  2MDR A;  2LRS A;  5LMN E;  2L2N A;  4DV3 E;  3IWC A;  3VK6 A;  4DR2 E;  4F9A B;  1IBK E;  1N36 E;  1I94 E;  4DR6 E;  2UXC E;  2LUP B;  2LUQ A;  2VQF E;  2RSM A;  2LTS A;  3HQ1 A;  4DV7 E;  2N3G A;  2L3C A;  4M2Z A;  3HPS A;  3ZOQ B;  3HTX A;  2YZT A;  4WSP A;  1QU6 A;  5IT9 C;  4X8W A;  1N32 E;  3HPZ A;  2V86 A;  2UUA E;  4NXM E;  4DV4 E;  2E1M A;  3JAM C;  2E5L E;  4DR4 E;  1J26 A;  4LF8 E;  2M4I A;  2KOU A;  1IBM E;  2MC6 A;  4X62 E;  2RS6 A;  4LF4 E;  3J81 C;  3LML A;  1STU A;  3HXL A;  4JI1 E;  1FJG E;  3ADI A;  2DMY A;  4P78 A;  4DR1 E;  4JI3 E;  2L2K B;  2NA2 A;  3C4T A;  4X65 E;  4KHP E;  3F6G A;  3K6Q A;  2WZO A;  4F54 A;  3J80 C;  4DV1 E;  4JV5 E;  1RQ0 A;  4DR5 E;  2VE7 C;  5AAS A;  4YY3 E;  1YYO A;  1J5E E;  2EZ6 A;  5IWA E;  4R8O A;  1T4L B;  2DB2 A;  2UUC E;  2HHH E;  2EWL A;  4F9C B;  3AV0 A;  1T4O A;  4BBY A;  3DF6 A;  3LLH A;  3J7Y p;  3VYX A;  2LMZ A;  2L2M A;  1UHZ A;  1DQ3 A;  2L33 A;  2VF1 A;  2JVA A;  4LF9 E;  2B3T B;  4WPY A;  4DV2 E;  4DKK A;  3T1H E;  4BS9 A;  3VYY A;  2NUF A;  2JOX A;  3ADJ A;  5LL6 R;  5LMU E;  3C4B A;  2FTX B;  3JU0 A;  3JTZ A;  1XMQ E;  1EKZ A;  2UU9 E;  4JYA E;  2MC5 A;  2B7V A;  2N3H A;  2FV4 B;  2LBS B;  4BC7 A;  5F3W A;  1SR9 A;  1GZ6 A;  4BCA A;  4L8N A;  4K0K E;  2K4V A;  1DI2 A;  1X47 A;  3MSW A;  4OOG C;  1ZBT A;  3OTO E;  4JI0 E;  4NXN E;  2YT4 A;  4LFA E;  2RTX A;  2V87 A;  4B3T E;  2ZM6 E;  1HR0 E;  1X48 A;  2H36 X;  1UIL A;  4B3S E;  2G7H A;  2M7Q A;  4DV0 E;  4GKJ E;  1T4N A;  4Q28 A;  2VQE E;  5AE3 A;  2DIX A;  4I8O A;  5A2Q C;  2JWO A;  5CFF E;  3H09 A;  2LTR A;  2JR1 A;  5DNY A;  2ODR D;  2LJH A;  4X66 E;  2NUE A;  1N33 E;  4M30 A;  2RS7 A;  2V83 A;  2L6M A;  3ADG A;  1WHN A;  2ODR C;  1YZ9 A;  5AE1 A;  4DR3 E;  1X49 A;  5FLX C;  4GEQ B;  3RMP A;  2B7T A;  4JI5 E;  4DV6 E;  1GQE A;  4LFC E;  1XNQ E;  4JI8 E;  5ADZ A;  2KHX A;  4M0V A;  4WFT A;  4WYQ B;  1WXR A;  4F9B B;  4B3M E;  3IWB A;  5BR8 E;  4TUG A;  2V89 A;  4LF7 E;  5AE2 A;  2NUG A;  2KON A;  4GKK E;  1RC7 A;  1YYW A;  3KWR A;  3DJW A;  3P1X A;  4DV5 E;  2UUB E;  4LU9 A;  4DUZ E;  3FIG A;  4LFB E;  4JI7 E;  1IBL E;  4LF5 E;  1O0W A;  5T6J A;  4DR7 E;  2UXB E;  4X64 E;  4DMI A;  1YYK A;  2UXD E;  2LE2 A;  4OX9 E;  3AUZ A;  2JOB A;  1N34 E;  2CPN A;  4BC9 A;  2DSY A;  4LF6 E;  2L3J A;  3IWD A;  2L92 A;  1HNW E;  1HNX E;  4JI6 E;  4P7D A;  1FKA E;  2B9D A;  4KZS A;  2FGG A;  1XMO E;  2F4V E;  4JI4 E;  1ZBQ A;  4DUY E;  2V8Q B;  3F6H A;  1XNR E;  4BMJ A;  2M1S A;  3OML A;  2IHR 1;  4LTY A;  4R03 A;  4YHH E;  4TUI A;  2V88 A;  4AQY E;  3T1Y E;  4J8Z A;  2JY9 A;  2F8B A;  2V85 A;  1HNZ E;  2L8T A;  3J7A G;  4L5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...