4WSPA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
79
Chain Sequence
QSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
total genus 22
structure length 79
sequence length 83
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wspA01
2FGGA 4WSPA 4WPYA
chains in the Genus database with same CATH superfamily
2WZOA 2WBUA 3MSWA 5A69A 1X6HA 2MC6A 1EH6A 1JK1A 3J81C 4O5GA 2H36X 1T4LB 2LV2A 2ELYA 1ZU1A 2LE2A 2EQ3A 3KWRA 4R2RA 2EM9A 2FTXB 5AC4A 2EMLA 1X3CA 2HJJA 4M0VA 2PRTA 2EPZA 4O24A 2UUAE 2EPAA 5AE2A 2UXCE 2EN8A 1T38A 2YWQA 2VQFE 4B3RE 3JU0A 4RHBB 2RSMA 3MHHC 1XMQE 2EOEA 2EMYA 4YY3E 3T1HE 2B7VA 4WPYA 4BC9A 1IBLE 2RSIA 3ADLA 4NHRA 4JI0E 4F54A 2EMXA 4R2SA 2IHR1 2L92A 2GHFA 5BR8E 1BBOA 4F9BB 1EKZA 2YTDA 2KHXA 2LUPB 2EPPA 3DF6A 2YTGA 3ECRA 1HNWE 3ADJA 2LBSB 4ZYEA 4L5NC 2EMZA 2EMCA 1N33E 2DMYA 4BS9A 2M1SA 4GZNC 1B69A 4M9VC 4WFTA 2WBSA 4JI5E 4R03A 2NUGA 2YTIA 2M9AA 2EPOA 4X62E 4O43A 3LMLA 2ENHA 2EN6A 4KZSA 2RTXA 1PJQA 1SFEA 2L2KB 4IS1C 4TUGA 3C6MA 2JWOA 4JI8E 1IQSA 5KL5A 2EPKX 1A1LA 1PDAA 1XNQE 2J7JA 2CSHA 1T39A 4DR5E 5FLXC 2ELZA 4Q28A 4BMJA 2EM5A 4HEIA 2EOJA 1A1JA 4J8ZA 3C4BA 4DV4E 4LF4E 3BIDA 2MDGA 2ODRD 4BC7A 1I94E 5KL3A 4LU9A 1FJGE 2EOQA 1JK2A 2JP9A 2EN7A 5AE3A 2B3TB 3EPHA 5A6JA 2E5LE 1N3GA 1WRJA 1UILA 2EMIA 3VHTB 1YYWA 3K6QA 4JI4E 1HNXE 3TQMA 4ZYGA 4ZYHA 1RMDA 4LTYA 5IT9C 1YPNA 3ADGA 2DGCA 2EOMA 4DR4E 4BCAA 2G7HA 1DGCA 2UU9E 4LF7E 2V88A 2JR1A 2BBGA 2LVHA 2RS7A 2HC5A 4LFCE 2E72A 1GZ6A 1F2IG 1UBDC 2UXBE 3C6KA 2KONA 4JYAE 3C4TA 1RQ0A 2EM0A 4DMIA 1IBME 1G2FC 4DV7E 1UHZA 5A6KA 2R76A 3F6HA 2CT1A 5AE1A 2EL4A 2WBTA 2M4IA 1N36E 2B9DA 1WHNA 1X47A 2EPMX 3P1XA 2HGHA 2EMWA 1YYOA 4WYQB 4K0KE 5LL6R 4LFAE 2F8BA 2EM2A 4X64E 1TF6A 2YRMA 2MC5A 3L00A 5A6AA 4BHBA 1NCSA 4KHPE 2YTJA 4KWYA 4P78A 2EMGA 2EL5A 2EPUA 3HPSA 1ZBQA 2YTEA 2N3GA 2YTFA 3BBGA 5IXMB 2CPNA 2EZ6A 2L6MA 3HQ1A 5T6JA 4GEQB 3J7AG 1YFHA 4L8NA 2EM8A 2V86A 4JI6E 2EMAA 3IWDA 2ENCA 4B3SE 2M7QA 5KL7A 2YRHA 2RS6A 3M99B 2YTQA 2VE7C 3EPJA 4NXNE 3KZZA 2EOSA 4DV5E 2RPCA 5LMNE 2EM6A 3HPZA 4I8OA 1X6EA 4R2CA 3OTOE 2EP3A 2EN1A 5LMUE 2EOIA 2EORA 4WSPA 2JOBA 2EE8A 1QNTA 4R2AA 3JTZA 5KL4A 4GKKE 4RH8A 2V8QB 4R2PA 2NUEA 4JV5E 1DQ3A 2LJUA 2VRDA 2WCC3 4FK5C 2EPLX 4JI1E 4P7DA 4F6NA 4B3TE 3BF2A 3J80C 2ENAA 3LLHA 4GKJE 3J7Yp 1G2DC 4N4RB 2I13A 2EJ4A 1MGTA 4NZVA 5A6BA 4DKKA 1N32E 2GLIA 4F6MA 2YSPA 3VYYA 1O0WA 2V85A 1TF3A 3HTXA 2MKNA 2KOUA 2EOYA 1HNZE 2YU5A 1BB8A 5IV8B 1IBKE 4LF8E 2MKDA 2EOHA 1WHQA 2LMZA 2LTSA 1YYKA 1ZR9A 2V83A 4WSGA 1BBGA 2UUCE 2K4VA 5KL6A 1LLMC 2EQ1A 2N3HA 3HXLA 3EPKA 2YZTA 2N8XA 2EOZA 2EOOA 2JY9A 2DLQA 2YSOA 4DR2E 4AQYE 4F2JC 2F4VE 2EPXA 3EQ1A 2EN4A 5A6BD 1AH5A 5DNYA 2DLKA 4BHCA 2L33A 1X49A 4WX9A 3AUZA 1TN9A 4DV3E 1GQEA 4LF5E 5AASA 4X9JA 2FGGA 1L4SA 2VF1A 3IWBA 1XMOE 1P47A 5ADZA 1YUIA 3MHSC 1YSAC 4DR7E 2EMKA 3IWCA 1X48A 1WXRA 5TSEA 1KYQA 4DV1E 3F6GA 4MLVA 2HHHE 2L3JA 1FKAE 2LT7A 2EPNA 5IWAE 1A1IA 2EM3A 1PJTA 1STUA 4R2QA 2YTPA 2NABA 1T4OA 2R1FA 1QU6A 1A1KA 1IQOA 2JOXA 4R2EA 2DIXA 2EOFA 4LF6E 1IMUA 1UN6B 5AC5A 2EMHA 1RC7A 2JPAA 1NEIA 4DR3E 2B7TA 3KZYA 1HR0E 1PJSA 2JVAA 4MLQA 4OOGC 4JI7E 4DV2E 4F9AB 4M30A 2YRKA 1SR9A 4WXDA 4LFBE 4NXME 2EPRA 4OX9E 2Q8UA 4F9CB 3H09A 2EL6A 2ADRA 4BBYA 4X66E 2LCEA 3JAMC 4DR1E 3THOB 4ZYDA 2CTDA 1YUJA 4O4KA 4TUIA 2BB8A 5CFFE 4HTGA 2L3CA 1A1GA 2LTRA 2V87A 1X6FA 1T4NA 5KL2A 1A1HA 1MEYC 3EPLA 3VK6A 3THNA 4LF9E 2L8TA 1J5EE 4DUZE 2EMBA 2EPCA 3DJWA 2DMIA 2YU8A 2NUFA 2UUBE 2L2MA 1YZ9A 4B3ME 4WXCA 4R8OA 4X8WA 2E1MA 4IJDA 5LLQA 1DI2A 3VYXA 2EN2A 2EQ0A 1AAYA 2LJHA 1PKPA 2LO3A 4DR6E 3FIGA 1X5WA 5A2QC 2YTNA 1N34E 1GTKA 4R2DA 4DV0E 2GPIA 2DB2A 3T1YE 2EM4A 3QG5C 2VQEE 4DUYE 2RQLA 4JI3E 1EH8A 2EMFA 2FV4B 2I9IA 2K7IA 1XNRE 2EN3A 3UK3C 1ZBTA 2A25A 4DV6E 2DSYA 2V89A 2L2NA 1EH7A 2JYAA 5F3WA 2YTOA 3ZOQB 2YT4A 1WJPA 2NA2A 4JI2E 2EOXA 3OMLA 3ADIA 1KJKA 2ZM6E 2UXDE 4YHHE 1Z1BA 3AV0A 2EM7A 1J26A 2DRPA 3RMPA 4X65E 1ZAAC 2EWLA 2LRSA 2MDRA 4M2ZA 3BGHA 1A1FA 2D9HA 2ODRC 2JXPA 2YPNA 2LUQA 4Q35B
chains in the Genus database with same CATH topology
2WZOA 4OOGC 5LMUE 4JI7E 3MSWA 4DV2E 4WSPA 2MC6A 4F9AB 5AE3A 3J81C 2B3TB 4M30A 2JOBA 1SR9A 2E5LE 2H36X 1T4LB 1UILA 3JTZA 4LFBE 4GKKE 2LE2A 2V8QB 3KWRA 1YYWA 3K6QA 4JI4E 4NXME 4OX9E 4F9CB 2FTXB 3H09A 1HNXE 2NUEA 4BBYA 4JV5E 1DQ3A 4X66E 3JAMC 4DR1E 4LTYA 5IT9C 4TUIA 3ADGA 4M0VA 4JYAE 2UUAE 4BCAA 4DR4E 2G7HA 5AE2A 2UXCE 4JI1E 4P7DA 2VQFE 4B3TE 4B3RE 3JU0A 5CFFE 3J80C 3LLHA 2L3CA 2UU9E 2LTRA 2V87A 4GKJE 1T4NA 2RSMA 3J7Yp 4LF7E 2V88A 1XMQE 3VK6A 4DKKA 4YY3E 3T1HE 1N32E 4LF9E 2JR1A 2B7VA 2L8TA 4WPYA 3VYYA 1O0WA 2V85A 2RS7A 1J5EE 4BC9A 4DUZE 4LFCE 3DJWA 1IBLE 1GZ6A 3ADLA 3HTXA 4JI0E 2KOUA 4F54A 2UXBE 2NUFA 1HNZE 2UUBE 2KONA 1IBKE 2L2MA 1YZ9A 2IHR1 3C4TA 1RQ0A 4B3ME 4LF8E 2L92A 4R8OA 4DMIA 1WHQA 2E1MA 2LMZA 2LTSA 4X8WA 5BR8E 4F9BB 1EKZA 2V83A 1IBME 3VYXA 2KHXA 2LUPB 2UUCE 3DF6A 4DV7E 1UHZA 2K4VA 3F6HA 1DI2A 1HNWE 3ADJA 2N3HA 5AE1A 2LBSB 2LJHA 1PKPA 3HXLA 4L5NC 3FIGA 1N36E 2M4IA 2YZTA 5A2QC 4DR6E 2B9DA 1N33E 1WHNA 1X47A 3P1XA 2JY9A 1N34E 2DMYA 4BS9A 2M1SA 4AQYE 1YYOA 4WYQB 4DV0E 1YYKA 2F4VE 4K0KE 2DB2A 4WFTA 5LL6R 3T1YE 4LFAE 2F8BA 4R03A 2VQEE 4DUYE 4X64E 4JI5E 2NUGA 2MC5A 4JI3E 4KHPE 5DNYA 4P78A 2FV4B 1XNRE 2L33A 3HPSA 1X49A 3AUZA 4X62E 4DV3E 1GQEA 4LF5E 1ZBTA 1ZBQA 5AASA 2FGGA 4DV6E 2VF1A 3IWBA 4LF6E 3LMLA 2DSYA 2N3GA 2V89A 1XMOE 2CPNA 5ADZA 2L2NA 2EZ6A 4KZSA 2L6MA 2RTXA 3HQ1A 5T6JA 4DR7E 4GEQB 3J7AG 3IWCA 1X48A 1WXRA 5F3WA 3ZOQB 4L8NA 2YT4A 2L2KB 4TUGA 2V86A 3F6GA 4DV1E 2JWOA 2NA2A 2HHHE 4JI8E 2L3JA 4JI2E 1FKAE 3OMLA 4JI6E 3ADIA 5IWAE 2ZM6E 1XNQE 2UXDE 3IWDA 4B3SE 4YHHE 5FLXC 4DR5E 2M7QA 3AV0A 1STUA 4Q28A 1J26A 2RS6A 4NXNE 2VE7C 4BMJA 3RMPA 1T4OA 1QU6A 4X65E 2EWLA 2MDRA 2DIXA 2JOXA 2LRSA 4J8ZA 3C4BA 4DV4E 5LMNE 4DV5E 1RC7A 4LF4E 4M2ZA 3HPZA 4DR3E 2ODRD 4I8OA 4BC7A 1I94E 2B7TA 2ODRC 3OTOE 1HR0E 2JVAA 4LU9A 1FJGE 4DR2E 2LUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WSP A;  4WPY A; 
#chains in the Genus database with same CATH topology
 2WZO A;  2WBU A;  3MSW A;  5A69 A;  1X6H A;  2MC6 A;  1EH6 A;  1JK1 A;  3J81 C;  4O5G A;  2H36 X;  1T4L B;  2LV2 A;  2ELY A;  1ZU1 A;  2LE2 A;  2EQ3 A;  3KWR A;  4R2R A;  2EM9 A;  2FTX B;  5AC4 A;  2EML A;  1X3C A;  2HJJ A;  4M0V A;  2PRT A;  2EPZ A;  4O24 A;  2UUA E;  2EPA A;  5AE2 A;  2UXC E;  2EN8 A;  1T38 A;  2YWQ A;  2VQF E;  4B3R E;  3JU0 A;  4RHB B;  2RSM A;  3MHH C;  1XMQ E;  2EOE A;  2EMY A;  4YY3 E;  3T1H E;  2B7V A;  4WPY A;  4BC9 A;  1IBL E;  2RSI A;  3ADL A;  4NHR A;  4JI0 E;  4F54 A;  2EMX A;  4R2S A;  2IHR 1;  2L92 A;  2GHF A;  5BR8 E;  1BBO A;  4F9B B;  1EKZ A;  2YTD A;  2KHX A;  2LUP B;  2EPP A;  3DF6 A;  2YTG A;  3ECR A;  1HNW E;  3ADJ A;  2LBS B;  4ZYE A;  4L5N C;  2EMZ A;  2EMC A;  1N33 E;  2DMY A;  4BS9 A;  2M1S A;  4GZN C;  1B69 A;  4M9V C;  4WFT A;  2WBS A;  4JI5 E;  4R03 A;  2NUG A;  2YTI A;  2M9A A;  2EPO A;  4X62 E;  4O43 A;  3LML A;  2ENH A;  2EN6 A;  4KZS A;  2RTX A;  1PJQ A;  1SFE A;  2L2K B;  4IS1 C;  4TUG A;  3C6M A;  2JWO A;  4JI8 E;  1IQS A;  5KL5 A;  2EPK X;  1A1L A;  1PDA A;  1XNQ E;  2J7J A;  2CSH A;  1T39 A;  4DR5 E;  5FLX C;  2ELZ A;  4Q28 A;  4BMJ A;  2EM5 A;  4HEI A;  2EOJ A;  1A1J A;  4J8Z A;  3C4B A;  4DV4 E;  4LF4 E;  3BID A;  2MDG A;  2ODR D;  4BC7 A;  1I94 E;  5KL3 A;  4LU9 A;  1FJG E;  2EOQ A;  1JK2 A;  2JP9 A;  2EN7 A;  5AE3 A;  2B3T B;  3EPH A;  5A6J A;  2E5L E;  1N3G A;  1WRJ A;  1UIL A;  2EMI A;  3VHT B;  1YYW A;  3K6Q A;  4JI4 E;  1HNX E;  3TQM A;  4ZYG A;  4ZYH A;  1RMD A;  4LTY A;  5IT9 C;  1YPN A;  3ADG A;  2DGC A;  2EOM A;  4DR4 E;  4BCA A;  2G7H A;  1DGC A;  2UU9 E;  4LF7 E;  2V88 A;  2JR1 A;  2BBG A;  2LVH A;  2RS7 A;  2HC5 A;  4LFC E;  2E72 A;  1GZ6 A;  1F2I G;  1UBD C;  2UXB E;  3C6K A;  2KON A;  4JYA E;  3C4T A;  1RQ0 A;  2EM0 A;  4DMI A;  1IBM E;  1G2F C;  4DV7 E;  1UHZ A;  5A6K A;  2R76 A;  3F6H A;  2CT1 A;  5AE1 A;  2EL4 A;  2WBT A;  2M4I A;  1N36 E;  2B9D A;  1WHN A;  1X47 A;  2EPM X;  3P1X A;  2HGH A;  2EMW A;  1YYO A;  4WYQ B;  4K0K E;  5LL6 R;  4LFA E;  2F8B A;  2EM2 A;  4X64 E;  1TF6 A;  2YRM A;  2MC5 A;  3L00 A;  5A6A A;  4BHB A;  1NCS A;  4KHP E;  2YTJ A;  4KWY A;  4P78 A;  2EMG A;  2EL5 A;  2EPU A;  3HPS A;  1ZBQ A;  2YTE A;  2N3G A;  2YTF A;  3BBG A;  5IXM B;  2CPN A;  2EZ6 A;  2L6M A;  3HQ1 A;  5T6J A;  4GEQ B;  3J7A G;  1YFH A;  4L8N A;  2EM8 A;  2V86 A;  4JI6 E;  2EMA A;  3IWD A;  2ENC A;  4B3S E;  2M7Q A;  5KL7 A;  2YRH A;  2RS6 A;  3M99 B;  2YTQ A;  2VE7 C;  3EPJ A;  4NXN E;  3KZZ A;  2EOS A;  4DV5 E;  2RPC A;  5LMN E;  2EM6 A;  3HPZ A;  4I8O A;  1X6E A;  4R2C A;  3OTO E;  2EP3 A;  2EN1 A;  5LMU E;  2EOI A;  2EOR A;  4WSP A;  2JOB A;  2EE8 A;  1QNT A;  4R2A A;  3JTZ A;  5KL4 A;  4GKK E;  4RH8 A;  2V8Q B;  4R2P A;  2NUE A;  4JV5 E;  1DQ3 A;  2LJU A;  2VRD A;  2WCC 3;  4FK5 C;  2EPL X;  4JI1 E;  4P7D A;  4F6N A;  4B3T E;  3BF2 A;  3J80 C;  2ENA A;  3LLH A;  4GKJ E;  3J7Y p;  1G2D C;  4N4R B;  2I13 A;  2EJ4 A;  1MGT A;  4NZV A;  5A6B A;  4DKK A;  1N32 E;  2GLI A;  4F6M A;  2YSP A;  3VYY A;  1O0W A;  2V85 A;  1TF3 A;  3HTX A;  2MKN A;  2KOU A;  2EOY A;  1HNZ E;  2YU5 A;  1BB8 A;  5IV8 B;  1IBK E;  4LF8 E;  2MKD A;  2EOH A;  1WHQ A;  2LMZ A;  2LTS A;  1YYK A;  1ZR9 A;  2V83 A;  4WSG A;  1BBG A;  2UUC E;  2K4V A;  5KL6 A;  1LLM C;  2EQ1 A;  2N3H A;  3HXL A;  3EPK A;  2YZT A;  2N8X A;  2EOZ A;  2EOO A;  2JY9 A;  2DLQ A;  2YSO A;  4DR2 E;  4AQY E;  4F2J C;  2F4V E;  2EPX A;  3EQ1 A;  2EN4 A;  5A6B D;  1AH5 A;  5DNY A;  2DLK A;  4BHC A;  2L33 A;  1X49 A;  4WX9 A;  3AUZ A;  1TN9 A;  4DV3 E;  1GQE A;  4LF5 E;  5AAS A;  4X9J A;  2FGG A;  1L4S A;  2VF1 A;  3IWB A;  1XMO E;  1P47 A;  5ADZ A;  1YUI A;  3MHS C;  1YSA C;  4DR7 E;  2EMK A;  3IWC A;  1X48 A;  1WXR A;  5TSE A;  1KYQ A;  4DV1 E;  3F6G A;  4MLV A;  2HHH E;  2L3J A;  1FKA E;  2LT7 A;  2EPN A;  5IWA E;  1A1I A;  2EM3 A;  1PJT A;  1STU A;  4R2Q A;  2YTP A;  2NAB A;  1T4O A;  2R1F A;  1QU6 A;  1A1K A;  1IQO A;  2JOX A;  4R2E A;  2DIX A;  2EOF A;  4LF6 E;  1IMU A;  1UN6 B;  5AC5 A;  2EMH A;  1RC7 A;  2JPA A;  1NEI A;  4DR3 E;  2B7T A;  3KZY A;  1HR0 E;  1PJS A;  2JVA A;  4MLQ A;  4OOG C;  4JI7 E;  4DV2 E;  4F9A B;  4M30 A;  2YRK A;  1SR9 A;  4WXD A;  4LFB E;  4NXM E;  2EPR A;  4OX9 E;  2Q8U A;  4F9C B;  3H09 A;  2EL6 A;  2ADR A;  4BBY A;  4X66 E;  2LCE A;  3JAM C;  4DR1 E;  3THO B;  4ZYD A;  2CTD A;  1YUJ A;  4O4K A;  4TUI A;  2BB8 A;  5CFF E;  4HTG A;  2L3C A;  1A1G A;  2LTR A;  2V87 A;  1X6F A;  1T4N A;  5KL2 A;  1A1H A;  1MEY C;  3EPL A;  3VK6 A;  3THN A;  4LF9 E;  2L8T A;  1J5E E;  4DUZ E;  2EMB A;  2EPC A;  3DJW A;  2DMI A;  2YU8 A;  2NUF A;  2UUB E;  2L2M A;  1YZ9 A;  4B3M E;  4WXC A;  4R8O A;  4X8W A;  2E1M A;  4IJD A;  5LLQ A;  1DI2 A;  3VYX A;  2EN2 A;  2EQ0 A;  1AAY A;  2LJH A;  1PKP A;  2LO3 A;  4DR6 E;  3FIG A;  1X5W A;  5A2Q C;  2YTN A;  1N34 E;  1GTK A;  4R2D A;  4DV0 E;  2GPI A;  2DB2 A;  3T1Y E;  2EM4 A;  3QG5 C;  2VQE E;  4DUY E;  2RQL A;  4JI3 E;  1EH8 A;  2EMF A;  2FV4 B;  2I9I A;  2K7I A;  1XNR E;  2EN3 A;  3UK3 C;  1ZBT A;  2A25 A;  4DV6 E;  2DSY A;  2V89 A;  2L2N A;  1EH7 A;  2JYA A;  5F3W A;  2YTO A;  3ZOQ B;  2YT4 A;  1WJP A;  2NA2 A;  4JI2 E;  2EOX A;  3OML A;  3ADI A;  1KJK A;  2ZM6 E;  2UXD E;  4YHH E;  1Z1B A;  3AV0 A;  2EM7 A;  1J26 A;  2DRP A;  3RMP A;  4X65 E;  1ZAA C;  2EWL A;  2LRS A;  2MDR A;  4M2Z A;  3BGH A;  1A1F A;  2D9H A;  2ODR C;  2JXP A;  2YPN A;  2LUQ A;  4Q35 B; 
#chains in the Genus database with same CATH homology
 2WZO A;  4OOG C;  5LMU E;  4JI7 E;  3MSW A;  4DV2 E;  4WSP A;  2MC6 A;  4F9A B;  5AE3 A;  3J81 C;  2B3T B;  4M30 A;  2JOB A;  1SR9 A;  2E5L E;  2H36 X;  1T4L B;  1UIL A;  3JTZ A;  4LFB E;  4GKK E;  2LE2 A;  2V8Q B;  3KWR A;  1YYW A;  3K6Q A;  4JI4 E;  4NXM E;  4OX9 E;  4F9C B;  2FTX B;  3H09 A;  1HNX E;  2NUE A;  4BBY A;  4JV5 E;  1DQ3 A;  4X66 E;  3JAM C;  4DR1 E;  4LTY A;  5IT9 C;  4TUI A;  3ADG A;  4M0V A;  4JYA E;  2UUA E;  4BCA A;  4DR4 E;  2G7H A;  5AE2 A;  2UXC E;  4JI1 E;  4P7D A;  2VQF E;  4B3T E;  4B3R E;  3JU0 A;  5CFF E;  3J80 C;  3LLH A;  2L3C A;  2UU9 E;  2LTR A;  2V87 A;  4GKJ E;  1T4N A;  2RSM A;  3J7Y p;  4LF7 E;  2V88 A;  1XMQ E;  3VK6 A;  4DKK A;  4YY3 E;  3T1H E;  1N32 E;  4LF9 E;  2JR1 A;  2B7V A;  2L8T A;  4WPY A;  3VYY A;  1O0W A;  2V85 A;  2RS7 A;  1J5E E;  4BC9 A;  4DUZ E;  4LFC E;  3DJW A;  1IBL E;  1GZ6 A;  3ADL A;  3HTX A;  4JI0 E;  2KOU A;  4F54 A;  2UXB E;  2NUF A;  1HNZ E;  2UUB E;  2KON A;  1IBK E;  2L2M A;  1YZ9 A;  2IHR 1;  3C4T A;  1RQ0 A;  4B3M E;  4LF8 E;  2L92 A;  4R8O A;  4DMI A;  1WHQ A;  2E1M A;  2LMZ A;  2LTS A;  4X8W A;  5BR8 E;  4F9B B;  1EKZ A;  2V83 A;  1IBM E;  3VYX A;  2KHX A;  2LUP B;  2UUC E;  3DF6 A;  4DV7 E;  1UHZ A;  2K4V A;  3F6H A;  1DI2 A;  1HNW E;  3ADJ A;  2N3H A;  5AE1 A;  2LBS B;  2LJH A;  1PKP A;  3HXL A;  4L5N C;  3FIG A;  1N36 E;  2M4I A;  2YZT A;  5A2Q C;  4DR6 E;  2B9D A;  1N33 E;  1WHN A;  1X47 A;  3P1X A;  2JY9 A;  1N34 E;  2DMY A;  4BS9 A;  2M1S A;  4AQY E;  1YYO A;  4WYQ B;  4DV0 E;  1YYK A;  2F4V E;  4K0K E;  2DB2 A;  4WFT A;  5LL6 R;  3T1Y E;  4LFA E;  2F8B A;  4R03 A;  2VQE E;  4DUY E;  4X64 E;  4JI5 E;  2NUG A;  2MC5 A;  4JI3 E;  4KHP E;  5DNY A;  4P78 A;  2FV4 B;  1XNR E;  2L33 A;  3HPS A;  1X49 A;  3AUZ A;  4X62 E;  4DV3 E;  1GQE A;  4LF5 E;  1ZBT A;  1ZBQ A;  5AAS A;  2FGG A;  4DV6 E;  2VF1 A;  3IWB A;  4LF6 E;  3LML A;  2DSY A;  2N3G A;  2V89 A;  1XMO E;  2CPN A;  5ADZ A;  2L2N A;  2EZ6 A;  4KZS A;  2L6M A;  2RTX A;  3HQ1 A;  5T6J A;  4DR7 E;  4GEQ B;  3J7A G;  3IWC A;  1X48 A;  1WXR A;  5F3W A;  3ZOQ B;  4L8N A;  2YT4 A;  2L2K B;  4TUG A;  2V86 A;  3F6G A;  4DV1 E;  2JWO A;  2NA2 A;  2HHH E;  4JI8 E;  2L3J A;  4JI2 E;  1FKA E;  3OML A;  4JI6 E;  3ADI A;  5IWA E;  2ZM6 E;  1XNQ E;  2UXD E;  3IWD A;  4B3S E;  4YHH E;  5FLX C;  4DR5 E;  2M7Q A;  3AV0 A;  1STU A;  4Q28 A;  1J26 A;  2RS6 A;  4NXN E;  2VE7 C;  4BMJ A;  3RMP A;  1T4O A;  1QU6 A;  4X65 E;  2EWL A;  2MDR A;  2DIX A;  2JOX A;  2LRS A;  4J8Z A;  3C4B A;  4DV4 E;  5LMN E;  4DV5 E;  1RC7 A;  4LF4 E;  4M2Z A;  3HPZ A;  4DR3 E;  2ODR D;  4I8O A;  4BC7 A;  1I94 E;  2B7T A;  2ODR C;  3OTO E;  1HR0 E;  2JVA A;  4LU9 A;  1FJG E;  4DR2 E;  2LUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...