4WSPA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
79
Chain Sequence
QSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 79
sequence length 83
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wspA01
2FGGA 4WPYA 4WSPA
chains in the Genus database with same CATH superfamily
2EP3A 1J5EE 3EQ1A 4I8OA 1A1IA 5A69A 2FTXB 5A6AA 2LTRA 4L5NC 4DV4E 1F2IG 2CPNA 4M0VA 2GLIA 2YRMA 1MEYC 4B3RE 2JOXA 1JK1A 4R2PA 2JWOA 2ZM6E 3C4BA 2GPIA 1IQOA 3BBGA 4DV5E 2L3JA 4BHBA 1IBKE 5LLQA 4IJDA 3THNA 1A1GA 2L2NA 2V89A 5F3WA 2YWQA 2CTDA 2V87A 1XMQE 4BBYA 1X48A 2EL4A 4KWYA 2EM3A 4DV1E 1X47A 4O5GA 2UUAE 4Q35B 1IBLE 2B3TB 4F9BB 4M30A 1KJKA 2VF1A 2YTPA 2YU8A 4DV2E 5AE1A 2LUPB 2YU5A 5ADZA 2EPXA 5A6BA 4F6MA 2RQLA 1DQ3A 2UXCE 2L8TA 2EMCA 2EMGA 2EM2A 1AH5A 2JR1A 5KL5A 2RTXA 2DB2A 4YHHE 1IQSA 4HTGA 3MHSC 2EORA 2I13A 3ADJA 4WSGA 4WX9A 5KL2A 4LF8E 2K4VA 5A6JA 1DI2A 4IS1C 4K0KE 2EMKA 4NXME 2LE2A 1N36E 3FIGA 4JI3E 1TF6A 2EPRA 4ZYDA 2EQ0A 2UXDE 3THOB 2E1MA 2EMWA 1UILA 4TUGA 1WJPA 3F6HA 1MGTA 2EM8A 3KWRA 2YZTA 4L8NA 2EMAA 2UUBE 2EMIA 1JK2A 3T1YE 4ZYHA 1TF3A 2FGGA 1QNTA 4DKKA 2MKDA 2EOZA 1YYOA 5BR8E 4NXNE 1ZBTA 1WRJA 4DR5E 4FK5C 3EPLA 3VYXA 2EL6A 2KONA 4DR6E 2V86A 2ENCA 1T4OA 5A6KA 4LF4E 2WBSA 1N3GA 2LBSB 4M9VC 2N3GA 4DV7E 2EWLA 2EPPA 2M7QA 1A1KA 2Q8UA 2EM6A 2EOOA 2JY9A 1BBGA 1PJQA 1FKAE 3DF6A 3T1HE 1X5WA 1RQ0A 2DIXA 2V8QB 2B7VA 4O43A 3HPZA 4R2CA 4BS9A 2ELZA 2EMZA 3J7AG 2DGCA 3IWDA 2EN6A 1HNXE 1RMDA 1GQEA 1GTKA 2MC5A 3BGHA 2WCC3 1UBDC 1WHQA 2V88A 1NEIA 1RC7A 4TUIA 3K6QA 2VQFE 2EOHA 5TSEA 2RS7A 2F4VE 2EPZA 4WFTA 2RPCA 2EOYA 1GZ6A 2MDRA 2EOJA 4DR2E 3M99B 4DR3E 4X65E 2YSOA 5AE3A 1YSAC 2MC6A 3ADGA 5A2QC 2EOQA 4R2SA 2R1FA 2HGHA 4F54A 4JI4E 3KZZA 2YTDA 1UN6B 2LT7A 2YRHA 4O24A 5IV8B 4B3TE 2ODRD 4WSPA 4WYQB 5LL6R 1TN9A 2EM7A 2FV4B 2EPLX 3BIDA 5FLXC 4GKKE 1X6EA 2EQ1A 2LTSA 1P47A 1G2FC 3C4TA 2YTOA 3JU0A 3ECRA 2JYAA 2E5LE 4JYAE 4JI8E 2EPMX 4GKJE 3VK6A 1X49A 1EKZA 2E72A 1X6FA 4R2AA 4OOGC 3KZYA 1B69A 2WZOA 1BBOA 1SR9A 3AV0A 1WXRA 1Z1BA 3MSWA 2EPOA 2EZ6A 2DSYA 2LVHA 3ZOQB 3LMLA 2YTEA 2DMIA 2KHXA 1ZAAC 5AC4A 1XMOE 2A25A 2EM9A 2V83A 4RH8A 2WBUA 1IBME 1A1LA 1BB8A 1A1FA 1ZBQA 4LF6E 4X9JA 1HR0E 5KL6A 4DUYE 2EJ4A 2R76A 1HNZE 4DR1E 4X66E 3HTXA 1PDAA 5KL4A 1YUJA 2YTJA 1T38A 4RHBB 1ZR9A 3L00A 4LFAE 2RS6A 3IWCA 4P78A 4LFCE 2UU9E 1N33E 4F9AB 3ADIA 4Q28A 1PJSA 4NZVA 2VE7C 2EN3A 2I9IA 3J7Yp 4MLVA 5CFFE 2M1SA 2LUQA 2EM0A 4LF7E 1NCSA 2EMFA 2LJHA 3C6MA 2KOUA 2EL5A 5IWAE 2JOBA 4JI7E 3QG5C 3HXLA 4LFBE 3HQ1A 2YPNA 4MLQA 2LMZA 2LCEA 2M9AA 4P7DA 2YTNA 2EN1A 1X3CA 5IXMB 3J81C 4LTYA 4R2EA 4BCAA 1I94E 2EOEA 3EPHA 3DJWA 3EPJA 2B9DA 5LMUE 3BF2A 2L6MA 1A1HA 2H36X 1EH7A 1X6HA 4HEIA 1O0WA 4DR7E 5DNYA 1J26A 1A1JA 2N3HA 5LMNE 2D9HA 2L2KB 4JI6E 3JAMC 3LLHA 2F8BA 2HC5A 1N34E 4DMIA 5KL7A 3P1XA 4F2JC 4GZNC 1PJTA 2PRTA 2JPAA 2K7IA 1YYKA 3VYYA 2EMLA 2EM4A 4N4RB 2EMBA 3C6KA 2DLKA 4X62E 4B3SE 5IT9C 2ODRC 3MHHC 2EOMA 5AASA 2EPAA 2MDGA 4WXDA 2EN8A 4R2DA 4J8ZA 4BMJA 2ENAA 1QU6A 4R2RA 2VQEE 1L4SA 4O4KA 2G7HA 3TQMA 1G2DC 4DV3E 4R8OA 4WPYA 1ZU1A 3OTOE 2EPKX 3J80C 3VHTB 2ELYA 2EMXA 2EN2A 2YT4A 4BC9A 4AQYE 4ZYGA 1SFEA 2EE8A 5AE2A 2YSPA 5AC5A 2HHHE 2NUFA 2YTQA 4OX9E 2B7TA 3ADLA 4DV6E 1YUIA 4JI5E 4GEQB 2EM5A 2YTGA 4X8WA 4JI2E 2EMYA 2J7JA 1UHZA 4WXCA 2JP9A 1HNWE 4DR4E 3HPSA 2EPNA 1AAYA 1YPNA 2V85A 2BBGA 2ADRA 4KHPE 4BHCA 2L33A 4F9CB 1T39A 2EPCA 2YTFA 5T6JA 4LF5E 1YZ9A 1STUA 1KYQA 3JTZA 2LRSA 1N32E 2DLQA 2WBTA 4JI0E 2N8XA 2NUGA 2GHFA 2HJJA 2M4IA 2EOIA 4DV0E 2JXPA 5KL3A 3UK3C 4JV5E 2IHR1 2YRKA 4R03A 4LF9E 4M2ZA 2CT1A 1YFHA 1PKPA 1EH6A 5A6BD 2L3CA 2EN7A 3F6GA 4R2QA 1FJGE 4F6NA 1YYWA 3H09A 2EOXA 4X64E 2EOSA 2RSIA 1XNRE 2JVAA 2LV2A 4ZYEA 1DGCA 2LO3A 3EPKA 3RMPA 3IWBA 2UUCE 3AUZA 2L92A 2BB8A 2EN4A 2LJUA 4YY3E 4DUZE 1IMUA 2VRDA 2EOFA 2YTIA 2RSMA 4BC7A 2UXBE 2EQ3A 1XNQE 2ENHA 4NHRA 2L2MA 4LU9A 1T4LB 2CSHA 2NABA 2NA2A 1LLMC 2DRPA 2EPUA 1T4NA 4B3ME 4JI1E 2EMHA 1WHNA 4KZSA 2DMYA 1EH8A 2MKNA 3OMLA 2NUEA
chains in the Genus database with same CATH topology
1T4OA 4LF4E 3OTOE 2LBSB 3J80C 1J5EE 1HR0E 4I8OA 2N3GA 4DUYE 4DV7E 1HNZE 2FTXB 2YT4A 4DR1E 2EWLA 4BC9A 2LTRA 4X66E 4AQYE 3HTXA 5AE2A 4L5NC 4DV4E 2M7QA 2CPNA 4M0VA 4LFAE 2HHHE 2RS6A 2NUFA 4B3RE 2JOXA 2JY9A 3IWCA 1FKAE 4P78A 4LFCE 2JWOA 2ZM6E 2UU9E 2B7TA 3C4BA 3DF6A 4F9AB 3T1HE 4Q28A 4OX9E 3ADIA 1N33E 4DV5E 2L3JA 1IBKE 1RQ0A 3ADLA 2DIXA 2V8QB 2VE7C 2B7VA 4DV6E 4JI5E 2L2NA 2V89A 3HPZA 4GEQB 4BS9A 3J7Yp 5F3WA 4X8WA 3J7AG 5CFFE 4JI2E 2M1SA 2V87A 1UHZA 3IWDA 1XMQE 1HNXE 2LUQA 4BBYA 1GQEA 2MC5A 1HNWE 4DR4E 1X48A 4LF7E 3HPSA 2LJHA 1WHQA 2V88A 2KOUA 1RC7A 2V85A 5IWAE 4TUIA 4DV1E 2JOBA 1X47A 4KHPE 4JI7E 2UUAE 3HXLA 4LFBE 3HQ1A 2L33A 3K6QA 2VQFE 4F9CB 2LMZA 1IBLE 4P7DA 5T6JA 2B3TB 4F9BB 4M30A 2RS7A 3J81C 4LF5E 4LTYA 2VF1A 2F4VE 4DV2E 1YZ9A 5AE1A 4WFTA 2LUPB 4BCAA 1STUA 5ADZA 3JTZA 1I94E 1GZ6A 2MDRA 4DR2E 2LRSA 1N32E 1DQ3A 2UXCE 2L8TA 4JI0E 4DR3E 4X65E 3DJWA 2NUGA 5AE3A 2JR1A 2MC6A 3ADGA 2B9DA 2M4IA 2RTXA 5A2QC 5LMUE 4DV0E 4JV5E 2DB2A 2IHR1 4F54A 4YHHE 4R03A 4JI4E 2L6MA 4LF9E 4M2ZA 2H36X 1PKPA 4B3TE 2ODRD 1O0WA 4DR7E 5DNYA 4WSPA 3ADJA 2L3CA 1J26A 2N3HA 3F6GA 4WYQB 5LL6R 5LMNE 2L2KB 1FJGE 4JI6E 3JAMC 4LF8E 3LLHA 2K4VA 1YYWA 2F8BA 3H09A 4X64E 2FV4B 5FLXC 1DI2A 1XNRE 2JVAA 4K0KE 4GKKE 2LTSA 4NXME 2LE2A 3RMPA 4DMIA 1N34E 3C4TA 3IWBA 3FIGA 3JU0A 1N36E 3AUZA 2UUCE 3P1XA 4JI3E 2L92A 2E5LE 4JYAE 2UXDE 1YYKA 3VYYA 4JI8E 4YY3E 4DUZE 2E1MA 4GKJE 3VK6A 1UILA 1X49A 4TUGA 1EKZA 4OOGC 4X62E 4B3SE 2RSMA 3F6HA 4BC7A 2WZOA 2ODRC 3KWRA 5IT9C 2YZTA 4L8NA 2UUBE 1XNQE 2UXBE 3T1YE 1SR9A 3AV0A 2L2MA 5AASA 1WXRA 3MSWA 4LU9A 2FGGA 2EZ6A 2DSYA 1T4LB 4J8ZA 4BMJA 3ZOQB 3LMLA 4DKKA 1QU6A 2NA2A 2KHXA 1YYOA 5BR8E 4NXNE 1ZBTA 1T4NA 4DR5E 4B3ME 2VQEE 4JI1E 1XMOE 3VYXA 4DR6E 2KONA 1WHNA 2V83A 2G7HA 2DMYA 2V86A 4KZSA 1IBME 4DV3E 4R8OA 3OMLA 4LF6E 1ZBQA 4WPYA 2NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WPY A;  4WSP A; 
#chains in the Genus database with same CATH topology
 2EP3 A;  1J5E E;  3EQ1 A;  4I8O A;  1A1I A;  5A69 A;  2FTX B;  5A6A A;  2LTR A;  4L5N C;  4DV4 E;  1F2I G;  2CPN A;  4M0V A;  2GLI A;  2YRM A;  1MEY C;  4B3R E;  2JOX A;  1JK1 A;  4R2P A;  2JWO A;  2ZM6 E;  3C4B A;  2GPI A;  1IQO A;  3BBG A;  4DV5 E;  2L3J A;  4BHB A;  1IBK E;  5LLQ A;  4IJD A;  3THN A;  1A1G A;  2L2N A;  2V89 A;  5F3W A;  2YWQ A;  2CTD A;  2V87 A;  1XMQ E;  4BBY A;  1X48 A;  2EL4 A;  4KWY A;  2EM3 A;  4DV1 E;  1X47 A;  4O5G A;  2UUA E;  4Q35 B;  1IBL E;  2B3T B;  4F9B B;  4M30 A;  1KJK A;  2VF1 A;  2YTP A;  2YU8 A;  4DV2 E;  5AE1 A;  2LUP B;  2YU5 A;  5ADZ A;  2EPX A;  5A6B A;  4F6M A;  2RQL A;  1DQ3 A;  2UXC E;  2L8T A;  2EMC A;  2EMG A;  2EM2 A;  1AH5 A;  2JR1 A;  5KL5 A;  2RTX A;  2DB2 A;  4YHH E;  1IQS A;  4HTG A;  3MHS C;  2EOR A;  2I13 A;  3ADJ A;  4WSG A;  4WX9 A;  5KL2 A;  4LF8 E;  2K4V A;  5A6J A;  1DI2 A;  4IS1 C;  4K0K E;  2EMK A;  4NXM E;  2LE2 A;  1N36 E;  3FIG A;  4JI3 E;  1TF6 A;  2EPR A;  4ZYD A;  2EQ0 A;  2UXD E;  3THO B;  2E1M A;  2EMW A;  1UIL A;  4TUG A;  1WJP A;  3F6H A;  1MGT A;  2EM8 A;  3KWR A;  2YZT A;  4L8N A;  2EMA A;  2UUB E;  2EMI A;  1JK2 A;  3T1Y E;  4ZYH A;  1TF3 A;  2FGG A;  1QNT A;  4DKK A;  2MKD A;  2EOZ A;  1YYO A;  5BR8 E;  4NXN E;  1ZBT A;  1WRJ A;  4DR5 E;  4FK5 C;  3EPL A;  3VYX A;  2EL6 A;  2KON A;  4DR6 E;  2V86 A;  2ENC A;  1T4O A;  5A6K A;  4LF4 E;  2WBS A;  1N3G A;  2LBS B;  4M9V C;  2N3G A;  4DV7 E;  2EWL A;  2EPP A;  2M7Q A;  1A1K A;  2Q8U A;  2EM6 A;  2EOO A;  2JY9 A;  1BBG A;  1PJQ A;  1FKA E;  3DF6 A;  3T1H E;  1X5W A;  1RQ0 A;  2DIX A;  2V8Q B;  2B7V A;  4O43 A;  3HPZ A;  4R2C A;  4BS9 A;  2ELZ A;  2EMZ A;  3J7A G;  2DGC A;  3IWD A;  2EN6 A;  1HNX E;  1RMD A;  1GQE A;  1GTK A;  2MC5 A;  3BGH A;  2WCC 3;  1UBD C;  1WHQ A;  2V88 A;  1NEI A;  1RC7 A;  4TUI A;  3K6Q A;  2VQF E;  2EOH A;  5TSE A;  2RS7 A;  2F4V E;  2EPZ A;  4WFT A;  2RPC A;  2EOY A;  1GZ6 A;  2MDR A;  2EOJ A;  4DR2 E;  3M99 B;  4DR3 E;  4X65 E;  2YSO A;  5AE3 A;  1YSA C;  2MC6 A;  3ADG A;  5A2Q C;  2EOQ A;  4R2S A;  2R1F A;  2HGH A;  4F54 A;  4JI4 E;  3KZZ A;  2YTD A;  1UN6 B;  2LT7 A;  2YRH A;  4O24 A;  5IV8 B;  4B3T E;  2ODR D;  4WSP A;  4WYQ B;  5LL6 R;  1TN9 A;  2EM7 A;  2FV4 B;  2EPL X;  3BID A;  5FLX C;  4GKK E;  1X6E A;  2EQ1 A;  2LTS A;  1P47 A;  1G2F C;  3C4T A;  2YTO A;  3JU0 A;  3ECR A;  2JYA A;  2E5L E;  4JYA E;  4JI8 E;  2EPM X;  4GKJ E;  3VK6 A;  1X49 A;  1EKZ A;  2E72 A;  1X6F A;  4R2A A;  4OOG C;  3KZY A;  1B69 A;  2WZO A;  1BBO A;  1SR9 A;  3AV0 A;  1WXR A;  1Z1B A;  3MSW A;  2EPO A;  2EZ6 A;  2DSY A;  2LVH A;  3ZOQ B;  3LML A;  2YTE A;  2DMI A;  2KHX A;  1ZAA C;  5AC4 A;  1XMO E;  2A25 A;  2EM9 A;  2V83 A;  4RH8 A;  2WBU A;  1IBM E;  1A1L A;  1BB8 A;  1A1F A;  1ZBQ A;  4LF6 E;  4X9J A;  1HR0 E;  5KL6 A;  4DUY E;  2EJ4 A;  2R76 A;  1HNZ E;  4DR1 E;  4X66 E;  3HTX A;  1PDA A;  5KL4 A;  1YUJ A;  2YTJ A;  1T38 A;  4RHB B;  1ZR9 A;  3L00 A;  4LFA E;  2RS6 A;  3IWC A;  4P78 A;  4LFC E;  2UU9 E;  1N33 E;  4F9A B;  3ADI A;  4Q28 A;  1PJS A;  4NZV A;  2VE7 C;  2EN3 A;  2I9I A;  3J7Y p;  4MLV A;  5CFF E;  2M1S A;  2LUQ A;  2EM0 A;  4LF7 E;  1NCS A;  2EMF A;  2LJH A;  3C6M A;  2KOU A;  2EL5 A;  5IWA E;  2JOB A;  4JI7 E;  3QG5 C;  3HXL A;  4LFB E;  3HQ1 A;  2YPN A;  4MLQ A;  2LMZ A;  2LCE A;  2M9A A;  4P7D A;  2YTN A;  2EN1 A;  1X3C A;  5IXM B;  3J81 C;  4LTY A;  4R2E A;  4BCA A;  1I94 E;  2EOE A;  3EPH A;  3DJW A;  3EPJ A;  2B9D A;  5LMU E;  3BF2 A;  2L6M A;  1A1H A;  2H36 X;  1EH7 A;  1X6H A;  4HEI A;  1O0W A;  4DR7 E;  5DNY A;  1J26 A;  1A1J A;  2N3H A;  5LMN E;  2D9H A;  2L2K B;  4JI6 E;  3JAM C;  3LLH A;  2F8B A;  2HC5 A;  1N34 E;  4DMI A;  5KL7 A;  3P1X A;  4F2J C;  4GZN C;  1PJT A;  2PRT A;  2JPA A;  2K7I A;  1YYK A;  3VYY A;  2EML A;  2EM4 A;  4N4R B;  2EMB A;  3C6K A;  2DLK A;  4X62 E;  4B3S E;  5IT9 C;  2ODR C;  3MHH C;  2EOM A;  5AAS A;  2EPA A;  2MDG A;  4WXD A;  2EN8 A;  4R2D A;  4J8Z A;  4BMJ A;  2ENA A;  1QU6 A;  4R2R A;  2VQE E;  1L4S A;  4O4K A;  2G7H A;  3TQM A;  1G2D C;  4DV3 E;  4R8O A;  4WPY A;  1ZU1 A;  3OTO E;  2EPK X;  3J80 C;  3VHT B;  2ELY A;  2EMX A;  2EN2 A;  2YT4 A;  4BC9 A;  4AQY E;  4ZYG A;  1SFE A;  2EE8 A;  5AE2 A;  2YSP A;  5AC5 A;  2HHH E;  2NUF A;  2YTQ A;  4OX9 E;  2B7T A;  3ADL A;  4DV6 E;  1YUI A;  4JI5 E;  4GEQ B;  2EM5 A;  2YTG A;  4X8W A;  4JI2 E;  2EMY A;  2J7J A;  1UHZ A;  4WXC A;  2JP9 A;  1HNW E;  4DR4 E;  3HPS A;  2EPN A;  1AAY A;  1YPN A;  2V85 A;  2BBG A;  2ADR A;  4KHP E;  4BHC A;  2L33 A;  4F9C B;  1T39 A;  2EPC A;  2YTF A;  5T6J A;  4LF5 E;  1YZ9 A;  1STU A;  1KYQ A;  3JTZ A;  2LRS A;  1N32 E;  2DLQ A;  2WBT A;  4JI0 E;  2N8X A;  2NUG A;  2GHF A;  2HJJ A;  2M4I A;  2EOI A;  4DV0 E;  2JXP A;  5KL3 A;  3UK3 C;  4JV5 E;  2IHR 1;  2YRK A;  4R03 A;  4LF9 E;  4M2Z A;  2CT1 A;  1YFH A;  1PKP A;  1EH6 A;  5A6B D;  2L3C A;  2EN7 A;  3F6G A;  4R2Q A;  1FJG E;  4F6N A;  1YYW A;  3H09 A;  2EOX A;  4X64 E;  2EOS A;  2RSI A;  1XNR E;  2JVA A;  2LV2 A;  4ZYE A;  1DGC A;  2LO3 A;  3EPK A;  3RMP A;  3IWB A;  2UUC E;  3AUZ A;  2L92 A;  2BB8 A;  2EN4 A;  2LJU A;  4YY3 E;  4DUZ E;  1IMU A;  2VRD A;  2EOF A;  2YTI A;  2RSM A;  4BC7 A;  2UXB E;  2EQ3 A;  1XNQ E;  2ENH A;  4NHR A;  2L2M A;  4LU9 A;  1T4L B;  2CSH A;  2NAB A;  2NA2 A;  1LLM C;  2DRP A;  2EPU A;  1T4N A;  4B3M E;  4JI1 E;  2EMH A;  1WHN A;  4KZS A;  2DMY A;  1EH8 A;  2MKN A;  3OML A;  2NUE A; 
#chains in the Genus database with same CATH homology
 1T4O A;  4LF4 E;  3OTO E;  2LBS B;  3J80 C;  1J5E E;  1HR0 E;  4I8O A;  2N3G A;  4DUY E;  4DV7 E;  1HNZ E;  2FTX B;  2YT4 A;  4DR1 E;  2EWL A;  4BC9 A;  2LTR A;  4X66 E;  4AQY E;  3HTX A;  5AE2 A;  4L5N C;  4DV4 E;  2M7Q A;  2CPN A;  4M0V A;  4LFA E;  2HHH E;  2RS6 A;  2NUF A;  4B3R E;  2JOX A;  2JY9 A;  3IWC A;  1FKA E;  4P78 A;  4LFC E;  2JWO A;  2ZM6 E;  2UU9 E;  2B7T A;  3C4B A;  3DF6 A;  4F9A B;  3T1H E;  4Q28 A;  4OX9 E;  3ADI A;  1N33 E;  4DV5 E;  2L3J A;  1IBK E;  1RQ0 A;  3ADL A;  2DIX A;  2V8Q B;  2VE7 C;  2B7V A;  4DV6 E;  4JI5 E;  2L2N A;  2V89 A;  3HPZ A;  4GEQ B;  4BS9 A;  3J7Y p;  5F3W A;  4X8W A;  3J7A G;  5CFF E;  4JI2 E;  2M1S A;  2V87 A;  1UHZ A;  3IWD A;  1XMQ E;  1HNX E;  2LUQ A;  4BBY A;  1GQE A;  2MC5 A;  1HNW E;  4DR4 E;  1X48 A;  4LF7 E;  3HPS A;  2LJH A;  1WHQ A;  2V88 A;  2KOU A;  1RC7 A;  2V85 A;  5IWA E;  4TUI A;  4DV1 E;  2JOB A;  1X47 A;  4KHP E;  4JI7 E;  2UUA E;  3HXL A;  4LFB E;  3HQ1 A;  2L33 A;  3K6Q A;  2VQF E;  4F9C B;  2LMZ A;  1IBL E;  4P7D A;  5T6J A;  2B3T B;  4F9B B;  4M30 A;  2RS7 A;  3J81 C;  4LF5 E;  4LTY A;  2VF1 A;  2F4V E;  4DV2 E;  1YZ9 A;  5AE1 A;  4WFT A;  2LUP B;  4BCA A;  1STU A;  5ADZ A;  3JTZ A;  1I94 E;  1GZ6 A;  2MDR A;  4DR2 E;  2LRS A;  1N32 E;  1DQ3 A;  2UXC E;  2L8T A;  4JI0 E;  4DR3 E;  4X65 E;  3DJW A;  2NUG A;  5AE3 A;  2JR1 A;  2MC6 A;  3ADG A;  2B9D A;  2M4I A;  2RTX A;  5A2Q C;  5LMU E;  4DV0 E;  4JV5 E;  2DB2 A;  2IHR 1;  4F54 A;  4YHH E;  4R03 A;  4JI4 E;  2L6M A;  4LF9 E;  4M2Z A;  2H36 X;  1PKP A;  4B3T E;  2ODR D;  1O0W A;  4DR7 E;  5DNY A;  4WSP A;  3ADJ A;  2L3C A;  1J26 A;  2N3H A;  3F6G A;  4WYQ B;  5LL6 R;  5LMN E;  2L2K B;  1FJG E;  4JI6 E;  3JAM C;  4LF8 E;  3LLH A;  2K4V A;  1YYW A;  2F8B A;  3H09 A;  4X64 E;  2FV4 B;  5FLX C;  1DI2 A;  1XNR E;  2JVA A;  4K0K E;  4GKK E;  2LTS A;  4NXM E;  2LE2 A;  3RMP A;  4DMI A;  1N34 E;  3C4T A;  3IWB A;  3FIG A;  3JU0 A;  1N36 E;  3AUZ A;  2UUC E;  3P1X A;  4JI3 E;  2L92 A;  2E5L E;  4JYA E;  2UXD E;  1YYK A;  3VYY A;  4JI8 E;  4YY3 E;  4DUZ E;  2E1M A;  4GKJ E;  3VK6 A;  1UIL A;  1X49 A;  4TUG A;  1EKZ A;  4OOG C;  4X62 E;  4B3S E;  2RSM A;  3F6H A;  4BC7 A;  2WZO A;  2ODR C;  3KWR A;  5IT9 C;  2YZT A;  4L8N A;  2UUB E;  1XNQ E;  2UXB E;  3T1Y E;  1SR9 A;  3AV0 A;  2L2M A;  5AAS A;  1WXR A;  3MSW A;  4LU9 A;  2FGG A;  2EZ6 A;  2DSY A;  1T4L B;  4J8Z A;  4BMJ A;  3ZOQ B;  3LML A;  4DKK A;  1QU6 A;  2NA2 A;  2KHX A;  1YYO A;  5BR8 E;  4NXN E;  1ZBT A;  1T4N A;  4DR5 E;  4B3M E;  2VQE E;  4JI1 E;  1XMO E;  3VYX A;  4DR6 E;  2KON A;  1WHN A;  2V83 A;  2G7H A;  2DMY A;  2V86 A;  4KZS A;  1IBM E;  4DV3 E;  4R8O A;  3OML A;  4LF6 E;  1ZBQ A;  4WPY A;  2NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...