4WSPA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
79
Chain Sequence
QSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein DL-Rv1738
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 79
sequence length 83
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wspA01
4WPYA 2FGGA 4WSPA
chains in the Genus database with same CATH superfamily
2K4VA 2D9HA 5KL5A 2EMKA 4NXNE 4P7DA 1PKPA 2DMYA 4JI8E 1KYQA 1EH6A 2N3HA 2JWOA 4F6MA 3RMPA 4LTYA 4O24A 2JVAA 1RC7A 3HPZA 3ADIA 1SR9A 2JY9A 1BBOA 1T4NA 2NA2A 2B7TA 1PDAA 2HJJA 2EM4A 2M7QA 1J26A 1HR0E 1HNWE 2EN8A 2EPZA 1A1IA 2EM5A 2M9AA 4NZVA 1DI2A 1JK2A 4LFAE 1YPNA 3HPSA 4O4KA 2EZ6A 4DV1E 4DUYE 3EPLA 2V86A 3VYYA 1WJPA 2LCEA 4RH8A 1EKZA 3EPJA 5FLXC 2EN3A 5IWAE 1RQ0A 4DR1E 2LT7A 3P1XA 2YTOA 5KL7A 2EMFA 2KHXA 4MLVA 4WX9A 4X66E 4WFTA 2LBSB 1XNQE 2YTFA 5AE3A 1BB8A 1YYWA 2HGHA 2EPLX 5DNYA 1IQOA 2YZTA 2EM7A 4B3TE 2EOFA 3KWRA 4X8WA 2UUBE 5LLQA 4DV0E 2YRHA 2EQ3A 4BMJA 1HNZE 2YTEA 4TUIA 2EPAA 4JI7E 4JI6E 3K6QA 4Q35B 2EPMX 4R2SA 4WPYA 3ECRA 2EOJA 2EMHA 4J8ZA 2EMIA 1Z1BA 4JI1E 1UILA 2DLKA 2LUQA 4X9JA 4BCAA 3VYXA 2E72A 2RPCA 4JI4E 4KWYA 1N36E 1X6FA 1BBGA 2EL6A 3J7Yp 4OX9E 4LF7E 4LF4E 4F9AB 2EJ4A 2EM6A 4LF5E 2A25A 2L92A 1J5EE 3ZOQB 2WZOA 2DGCA 2FGGA 2V89A 1TN9A 4K0KE 4ZYHA 3T1HE 1ZBTA 1L4SA 2WBSA 2L6MA 4R8OA 4KHPE 2H36X 1A1GA 2LTSA 4MLQA 3THOB 2FV4B 1YYOA 1GTKA 1T39A 3L00A 2RTXA 4FK5C 2EORA 1AH5A 4BBYA 4Q28A 1IBKE 4R2CA 3VK6A 2RS7A 2ELZA 2EM2A 1ZBQA 4ZYGA 2EOXA 4BHCA 1G2FC 2WCC3 2YRMA 1XNRE 3MHHC 2B7VA 3J80C 3BGHA 2UU9E 1PJTA 2V85A 5A2QC 1PJSA 2JPAA 3IWDA 2CSHA 3C4TA 5AE2A 2Q8UA 2L2NA 1FJGE 3HXLA 2DSYA 3J7AG 2UXBE 2ODRD 4HTGA 4DV7E 3F6HA 2YU5A 3HTXA 3QG5C 4NHRA 2EPRA 2EMCA 2VE7C 2NABA 4ZYEA 2RQLA 2E5LE 2CT1A 4BHBA 1WXRA 4WYQB 2NUEA 1FKAE 4F9BB 2ENAA 1YUIA 1IQSA 4LF6E 5AE1A 1A1JA 1ZR9A 1WRJA 2V88A 4R2RA 3T1YE 2EM8A 3HQ1A 2RS6A 4HEIA 3LMLA 1X49A 4JI0E 3LLHA 2B9DA 4X65E 1KJKA 3C6KA 4DR3E 2HC5A 1N33E 1I94E 2EL4A 2EN4A 1YUJA 4JYAE 2EMBA 2EMGA 1XMQE 2V8QB 2ZM6E 1X47A 2EQ0A 2JR1A 4WSPA 2KOUA 5LL6R 2JOBA 1TF3A 2V83A 4KZSA 2EL5A 1A1HA 2EOSA 1QU6A 4P78A 1IBME 5A6BA 2L3CA 2YTNA 2YT4A 1O0WA 1MGTA 2PRTA 4DR4E 2LRSA 3H09A 4R2PA 4R2AA 5IXMB 2RSIA 4DV2E 2YPNA 5A69A 2VQEE 2ENHA 2GLIA 2LJUA 4WXCA 2E1MA 4YHHE 3ADJA 4X64E 4L8NA 2EM3A 3KZYA 1AAYA 3JAMC 1N3GA 2M1SA 1HNXE 2EN7A 2DB2A 2EOZA 5A6JA 1IBLE 4YY3E 4GKKE 1T4OA 2CTDA 2MKDA 3EQ1A 4OOGC 3TQMA 5KL4A 4DR7E 2HHHE 2EWLA 4DV4E 2ODRC 1GQEA 2EN6A 2MC6A 4B3RE 4F9CB 3ADLA 2EN2A 2I9IA 3DJWA 2L2KB 4N4RB 2L2MA 1EH8A 1X48A 2EPNA 2R76A 3EPKA 1NCSA 4RHBB 4R2DA 2JOXA 5IT9C 2YTJA 2EOQA 2EM9A 1JK1A 2EMWA 2YU8A 2EQ1A 2G7HA 3AUZA 1TF6A 5A6KA 2EPXA 1EH7A 1NEIA 1XMOE 4LFCE 1X5WA 3JTZA 2EPCA 2MC5A 4F54A 2YRKA 4LF9E 2DRPA 2YTIA 2EMXA 2YWQA 2ADRA 2EN1A 3UK3C 2F8BA 2B3TB 3OMLA 4JI2E 3EPHA 5T6JA 2EPUA 5CFFE 4F2JC 2UXDE 2EPPA 5LMNE 2R1FA 3MSWA 1ZU1A 1IMUA 2VQFE 4IS1C 4AQYE 2EOMA 2K7IA 2WBUA 2JXPA 3DF6A 1N34E 4JI5E 1YFHA 2I13A 5LMUE 5KL6A 2FTXB 1LLMC 2LJHA 4M30A 4B3ME 5A6AA 3KZZA 1WHQA 2EMLA 5ADZA 2GPIA 4M0VA 5AC5A 2N3GA 4X62E 3F6GA 4WXDA 2LO3A 2NUFA 3J81C 1ZAAC 2L8TA 2M4IA 1A1LA 2EMZA 2L3JA 3VHTB 2EPKX 2KONA 4NXME 2CPNA 1STUA 1X6EA 1X6HA 2JYAA 3JU0A 4GEQB 3FIGA 4O5GA 1UN6B 3M99B 2V87A 1QNTA 2UXCE 1YSAC 5A6BD 2LVHA 1T38A 1A1KA 2EMAA 2EP3A 5BR8E 2EOOA 2DIXA 2YTPA 1N32E 2GHFA 2J7JA 2RSMA 4DUZE 3IWCA 3THNA 3C4BA 2WBTA 1DGCA 2EMYA 1G2DC 2ELYA 4F6NA 4GKJE 4LU9A 2EOHA 2UUCE 2VF1A 4DKKA 4DR5E 2NUGA 2MKNA 2EOYA 2L33A 2YTDA 1RMDA 5KL3A 4BC9A 4BC7A 3BBGA 2EM0A 4LFBE 4WSGA 2LTRA 4DV3E 2DMIA 1UHZA 3BIDA 3IWBA 4M9VC 4DV6E 2EOEA 4ZYDA 1A1FA 2LMZA 4TUGA 4IJDA 1UBDC 4JV5E 2DLQA 2ENCA 2EPOA 4DV5E 3AV0A 4DMIA 1WHNA 2VRDA 2YSOA 4I8OA 5TSEA 4DR6E 1PJQA 1T4LB 2LV2A 2YTQA 2IHR1 4JI3E 2EOIA 2LE2A 3MHSC 5AASA 5IV8B 4M2ZA 2EE8A 2N8XA 3C6MA 2UUAE 1YZ9A 4LF8E 5AC4A 4R2EA 4O43A 2YTGA 1F2IG 4B3SE 3BF2A 3OTOE 3ADGA 1SFEA 1MEYC 2BB8A 2YSPA 4R2QA 2BBGA 1GZ6A 1YYKA 4GZNC 2JP9A 5F3WA 1B69A 2F4VE 4L5NC 5KL2A 4BS9A 2MDRA 4R03A 4DR2E 1X3CA 2LUPB 2MDGA 1DQ3A 1P47A
chains in the Genus database with same CATH topology
2E1MA 2K4VA 4YHHE 4BBYA 3ADJA 4Q28A 4P7DA 1PKPA 2DMYA 4JI8E 4X64E 3VK6A 2RS7A 4L8NA 5BR8E 2DIXA 1N32E 2N3HA 2JWOA 3JAMC 2M1SA 1HNXE 2DB2A 3RMPA 1IBLE 1ZBQA 4LTYA 4YY3E 2JVAA 1RC7A 1T4OA 2RSMA 4DUZE 4DR7E 4OOGC 3IWCA 3HPZA 4GKKE 1XNRE 2HHHE 2EWLA 1SR9A 2JY9A 3C4BA 2ODRC 1T4NA 2NA2A 4DV4E 3ADIA 1GQEA 2B7TA 2B7VA 3J80C 2UU9E 2M7QA 2V85A 2MC6A 1J26A 4B3RE 4F9CB 5A2QC 1HR0E 3ADLA 1HNWE 3DJWA 2L2KB 4GKJE 4LU9A 2L2MA 1X48A 3IWDA 1DI2A 5IT9C 2UUCE 2JOXA 3C4TA 5AE2A 2VF1A 4LFAE 3HPSA 4DKKA 4DR5E 2L2NA 1FJGE 2EZ6A 3HXLA 2DSYA 4DV1E 4DUYE 2L33A 2NUGA 2ODRD 3J7AG 2V86A 2G7HA 3AUZA 3VYYA 3F6HA 4DV7E 1EKZA 4BC9A 5FLXC 4OX9E 5IWAE 3HTXA 1RQ0A 4BC7A 4DR1E 3P1XA 1XMOE 4LFCE 3JTZA 2KHXA 4LFBE 2VE7C 2MC5A 2LTRA 4F54A 4WFTA 4X66E 4DV3E 1UHZA 2LBSB 3IWBA 4LF9E 1XNQE 5AE3A 4DV6E 1YYWA 5DNYA 2YZTA 2E5LE 2LMZA 4B3TE 3KWRA 4TUGA 2F8BA 2B3TB 3OMLA 4X8WA 4WYQB 1WXRA 2UUBE 1FKAE 4JI2E 2NUEA 4F9BB 4JV5E 4DV5E 3AV0A 4DMIA 5T6JA 1WHNA 4LF6E 5CFFE 2UXDE 5AE1A 4DV0E 4I8OA 4DR6E 2V88A 1T4LB 4BMJA 1HNZE 2IHR1 4TUIA 4JI7E 4JI3E 3T1YE 4JI6E 5LMNE 2UXBE 3HQ1A 3MSWA 2RS6A 3K6QA 4WPYA 3LMLA 1X49A 4JI0E 2VQFE 2LE2A 4AQYE 3LLHA 4J8ZA 5AASA 2B9DA 4X65E 3DF6A 1N34E 4JI1E 4M2ZA 4JI5E 4DR3E 1UILA 5LMUE 2LUQA 2UUAE 2FTXB 1N33E 1YZ9A 2LJHA 4BCAA 4M30A 4LF8E 3VYXA 1I94E 4B3ME 4JI4E 4JYAE 1N36E 1WHQA 4B3SE 1XMQE 2V8QB 5ADZA 1X47A 2JR1A 4WSPA 2ZM6E 4M0VA 2KOUA 3J7Yp 1IBKE 4LF7E 2N3GA 5LL6R 4F9AB 2JOBA 4X62E 3OTOE 3ADGA 3F6GA 2V83A 4LF4E 4KZSA 2NUFA 3J81C 1QU6A 4P78A 4LF5E 2L8TA 2L92A 2M4IA 1IBME 1J5EE 4NXNE 2L3JA 2L3CA 1GZ6A 1YYKA 3ZOQB 2WZOA 2FGGA 2KONA 2V89A 4NXME 2YT4A 5F3WA 1O0WA 2CPNA 2F4VE 4K0KE 3T1HE 4DR4E 1ZBTA 1STUA 2LRSA 3H09A 4L5NC 2L6MA 3JU0A 4R8OA 2H36X 4KHPE 4GEQB 3FIGA 4BS9A 4DV2E 2MDRA 2LTSA 2FV4B 2V87A 4R03A 4DR2E 1YYOA 2UXCE 2LUPB 2VQEE 1DQ3A 2RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPY A;  2FGG A;  4WSP A; 
#chains in the Genus database with same CATH topology
 2K4V A;  2D9H A;  5KL5 A;  2EMK A;  4NXN E;  4P7D A;  1PKP A;  2DMY A;  4JI8 E;  1KYQ A;  1EH6 A;  2N3H A;  2JWO A;  4F6M A;  3RMP A;  4LTY A;  4O24 A;  2JVA A;  1RC7 A;  3HPZ A;  3ADI A;  1SR9 A;  2JY9 A;  1BBO A;  1T4N A;  2NA2 A;  2B7T A;  1PDA A;  2HJJ A;  2EM4 A;  2M7Q A;  1J26 A;  1HR0 E;  1HNW E;  2EN8 A;  2EPZ A;  1A1I A;  2EM5 A;  2M9A A;  4NZV A;  1DI2 A;  1JK2 A;  4LFA E;  1YPN A;  3HPS A;  4O4K A;  2EZ6 A;  4DV1 E;  4DUY E;  3EPL A;  2V86 A;  3VYY A;  1WJP A;  2LCE A;  4RH8 A;  1EKZ A;  3EPJ A;  5FLX C;  2EN3 A;  5IWA E;  1RQ0 A;  4DR1 E;  2LT7 A;  3P1X A;  2YTO A;  5KL7 A;  2EMF A;  2KHX A;  4MLV A;  4WX9 A;  4X66 E;  4WFT A;  2LBS B;  1XNQ E;  2YTF A;  5AE3 A;  1BB8 A;  1YYW A;  2HGH A;  2EPL X;  5DNY A;  1IQO A;  2YZT A;  2EM7 A;  4B3T E;  2EOF A;  3KWR A;  4X8W A;  2UUB E;  5LLQ A;  4DV0 E;  2YRH A;  2EQ3 A;  4BMJ A;  1HNZ E;  2YTE A;  4TUI A;  2EPA A;  4JI7 E;  4JI6 E;  3K6Q A;  4Q35 B;  2EPM X;  4R2S A;  4WPY A;  3ECR A;  2EOJ A;  2EMH A;  4J8Z A;  2EMI A;  1Z1B A;  4JI1 E;  1UIL A;  2DLK A;  2LUQ A;  4X9J A;  4BCA A;  3VYX A;  2E72 A;  2RPC A;  4JI4 E;  4KWY A;  1N36 E;  1X6F A;  1BBG A;  2EL6 A;  3J7Y p;  4OX9 E;  4LF7 E;  4LF4 E;  4F9A B;  2EJ4 A;  2EM6 A;  4LF5 E;  2A25 A;  2L92 A;  1J5E E;  3ZOQ B;  2WZO A;  2DGC A;  2FGG A;  2V89 A;  1TN9 A;  4K0K E;  4ZYH A;  3T1H E;  1ZBT A;  1L4S A;  2WBS A;  2L6M A;  4R8O A;  4KHP E;  2H36 X;  1A1G A;  2LTS A;  4MLQ A;  3THO B;  2FV4 B;  1YYO A;  1GTK A;  1T39 A;  3L00 A;  2RTX A;  4FK5 C;  2EOR A;  1AH5 A;  4BBY A;  4Q28 A;  1IBK E;  4R2C A;  3VK6 A;  2RS7 A;  2ELZ A;  2EM2 A;  1ZBQ A;  4ZYG A;  2EOX A;  4BHC A;  1G2F C;  2WCC 3;  2YRM A;  1XNR E;  3MHH C;  2B7V A;  3J80 C;  3BGH A;  2UU9 E;  1PJT A;  2V85 A;  5A2Q C;  1PJS A;  2JPA A;  3IWD A;  2CSH A;  3C4T A;  5AE2 A;  2Q8U A;  2L2N A;  1FJG E;  3HXL A;  2DSY A;  3J7A G;  2UXB E;  2ODR D;  4HTG A;  4DV7 E;  3F6H A;  2YU5 A;  3HTX A;  3QG5 C;  4NHR A;  2EPR A;  2EMC A;  2VE7 C;  2NAB A;  4ZYE A;  2RQL A;  2E5L E;  2CT1 A;  4BHB A;  1WXR A;  4WYQ B;  2NUE A;  1FKA E;  4F9B B;  2ENA A;  1YUI A;  1IQS A;  4LF6 E;  5AE1 A;  1A1J A;  1ZR9 A;  1WRJ A;  2V88 A;  4R2R A;  3T1Y E;  2EM8 A;  3HQ1 A;  2RS6 A;  4HEI A;  3LML A;  1X49 A;  4JI0 E;  3LLH A;  2B9D A;  4X65 E;  1KJK A;  3C6K A;  4DR3 E;  2HC5 A;  1N33 E;  1I94 E;  2EL4 A;  2EN4 A;  1YUJ A;  4JYA E;  2EMB A;  2EMG A;  1XMQ E;  2V8Q B;  2ZM6 E;  1X47 A;  2EQ0 A;  2JR1 A;  4WSP A;  2KOU A;  5LL6 R;  2JOB A;  1TF3 A;  2V83 A;  4KZS A;  2EL5 A;  1A1H A;  2EOS A;  1QU6 A;  4P78 A;  1IBM E;  5A6B A;  2L3C A;  2YTN A;  2YT4 A;  1O0W A;  1MGT A;  2PRT A;  4DR4 E;  2LRS A;  3H09 A;  4R2P A;  4R2A A;  5IXM B;  2RSI A;  4DV2 E;  2YPN A;  5A69 A;  2VQE E;  2ENH A;  2GLI A;  2LJU A;  4WXC A;  2E1M A;  4YHH E;  3ADJ A;  4X64 E;  4L8N A;  2EM3 A;  3KZY A;  1AAY A;  3JAM C;  1N3G A;  2M1S A;  1HNX E;  2EN7 A;  2DB2 A;  2EOZ A;  5A6J A;  1IBL E;  4YY3 E;  4GKK E;  1T4O A;  2CTD A;  2MKD A;  3EQ1 A;  4OOG C;  3TQM A;  5KL4 A;  4DR7 E;  2HHH E;  2EWL A;  4DV4 E;  2ODR C;  1GQE A;  2EN6 A;  2MC6 A;  4B3R E;  4F9C B;  3ADL A;  2EN2 A;  2I9I A;  3DJW A;  2L2K B;  4N4R B;  2L2M A;  1EH8 A;  1X48 A;  2EPN A;  2R76 A;  3EPK A;  1NCS A;  4RHB B;  4R2D A;  2JOX A;  5IT9 C;  2YTJ A;  2EOQ A;  2EM9 A;  1JK1 A;  2EMW A;  2YU8 A;  2EQ1 A;  2G7H A;  3AUZ A;  1TF6 A;  5A6K A;  2EPX A;  1EH7 A;  1NEI A;  1XMO E;  4LFC E;  1X5W A;  3JTZ A;  2EPC A;  2MC5 A;  4F54 A;  2YRK A;  4LF9 E;  2DRP A;  2YTI A;  2EMX A;  2YWQ A;  2ADR A;  2EN1 A;  3UK3 C;  2F8B A;  2B3T B;  3OML A;  4JI2 E;  3EPH A;  5T6J A;  2EPU A;  5CFF E;  4F2J C;  2UXD E;  2EPP A;  5LMN E;  2R1F A;  3MSW A;  1ZU1 A;  1IMU A;  2VQF E;  4IS1 C;  4AQY E;  2EOM A;  2K7I A;  2WBU A;  2JXP A;  3DF6 A;  1N34 E;  4JI5 E;  1YFH A;  2I13 A;  5LMU E;  5KL6 A;  2FTX B;  1LLM C;  2LJH A;  4M30 A;  4B3M E;  5A6A A;  3KZZ A;  1WHQ A;  2EML A;  5ADZ A;  2GPI A;  4M0V A;  5AC5 A;  2N3G A;  4X62 E;  3F6G A;  4WXD A;  2LO3 A;  2NUF A;  3J81 C;  1ZAA C;  2L8T A;  2M4I A;  1A1L A;  2EMZ A;  2L3J A;  3VHT B;  2EPK X;  2KON A;  4NXM E;  2CPN A;  1STU A;  1X6E A;  1X6H A;  2JYA A;  3JU0 A;  4GEQ B;  3FIG A;  4O5G A;  1UN6 B;  3M99 B;  2V87 A;  1QNT A;  2UXC E;  1YSA C;  5A6B D;  2LVH A;  1T38 A;  1A1K A;  2EMA A;  2EP3 A;  5BR8 E;  2EOO A;  2DIX A;  2YTP A;  1N32 E;  2GHF A;  2J7J A;  2RSM A;  4DUZ E;  3IWC A;  3THN A;  3C4B A;  2WBT A;  1DGC A;  2EMY A;  1G2D C;  2ELY A;  4F6N A;  4GKJ E;  4LU9 A;  2EOH A;  2UUC E;  2VF1 A;  4DKK A;  4DR5 E;  2NUG A;  2MKN A;  2EOY A;  2L33 A;  2YTD A;  1RMD A;  5KL3 A;  4BC9 A;  4BC7 A;  3BBG A;  2EM0 A;  4LFB E;  4WSG A;  2LTR A;  4DV3 E;  2DMI A;  1UHZ A;  3BID A;  3IWB A;  4M9V C;  4DV6 E;  2EOE A;  4ZYD A;  1A1F A;  2LMZ A;  4TUG A;  4IJD A;  1UBD C;  4JV5 E;  2DLQ A;  2ENC A;  2EPO A;  4DV5 E;  3AV0 A;  4DMI A;  1WHN A;  2VRD A;  2YSO A;  4I8O A;  5TSE A;  4DR6 E;  1PJQ A;  1T4L B;  2LV2 A;  2YTQ A;  2IHR 1;  4JI3 E;  2EOI A;  2LE2 A;  3MHS C;  5AAS A;  5IV8 B;  4M2Z A;  2EE8 A;  2N8X A;  3C6M A;  2UUA E;  1YZ9 A;  4LF8 E;  5AC4 A;  4R2E A;  4O43 A;  2YTG A;  1F2I G;  4B3S E;  3BF2 A;  3OTO E;  3ADG A;  1SFE A;  1MEY C;  2BB8 A;  2YSP A;  4R2Q A;  2BBG A;  1GZ6 A;  1YYK A;  4GZN C;  2JP9 A;  5F3W A;  1B69 A;  2F4V E;  4L5N C;  5KL2 A;  4BS9 A;  2MDR A;  4R03 A;  4DR2 E;  1X3C A;  2LUP B;  2MDG A;  1DQ3 A;  1P47 A; 
#chains in the Genus database with same CATH homology
 2E1M A;  2K4V A;  4YHH E;  4BBY A;  3ADJ A;  4Q28 A;  4P7D A;  1PKP A;  2DMY A;  4JI8 E;  4X64 E;  3VK6 A;  2RS7 A;  4L8N A;  5BR8 E;  2DIX A;  1N32 E;  2N3H A;  2JWO A;  3JAM C;  2M1S A;  1HNX E;  2DB2 A;  3RMP A;  1IBL E;  1ZBQ A;  4LTY A;  4YY3 E;  2JVA A;  1RC7 A;  1T4O A;  2RSM A;  4DUZ E;  4DR7 E;  4OOG C;  3IWC A;  3HPZ A;  4GKK E;  1XNR E;  2HHH E;  2EWL A;  1SR9 A;  2JY9 A;  3C4B A;  2ODR C;  1T4N A;  2NA2 A;  4DV4 E;  3ADI A;  1GQE A;  2B7T A;  2B7V A;  3J80 C;  2UU9 E;  2M7Q A;  2V85 A;  2MC6 A;  1J26 A;  4B3R E;  4F9C B;  5A2Q C;  1HR0 E;  3ADL A;  1HNW E;  3DJW A;  2L2K B;  4GKJ E;  4LU9 A;  2L2M A;  1X48 A;  3IWD A;  1DI2 A;  5IT9 C;  2UUC E;  2JOX A;  3C4T A;  5AE2 A;  2VF1 A;  4LFA E;  3HPS A;  4DKK A;  4DR5 E;  2L2N A;  1FJG E;  2EZ6 A;  3HXL A;  2DSY A;  4DV1 E;  4DUY E;  2L33 A;  2NUG A;  2ODR D;  3J7A G;  2V86 A;  2G7H A;  3AUZ A;  3VYY A;  3F6H A;  4DV7 E;  1EKZ A;  4BC9 A;  5FLX C;  4OX9 E;  5IWA E;  3HTX A;  1RQ0 A;  4BC7 A;  4DR1 E;  3P1X A;  1XMO E;  4LFC E;  3JTZ A;  2KHX A;  4LFB E;  2VE7 C;  2MC5 A;  2LTR A;  4F54 A;  4WFT A;  4X66 E;  4DV3 E;  1UHZ A;  2LBS B;  3IWB A;  4LF9 E;  1XNQ E;  5AE3 A;  4DV6 E;  1YYW A;  5DNY A;  2YZT A;  2E5L E;  2LMZ A;  4B3T E;  3KWR A;  4TUG A;  2F8B A;  2B3T B;  3OML A;  4X8W A;  4WYQ B;  1WXR A;  2UUB E;  1FKA E;  4JI2 E;  2NUE A;  4F9B B;  4JV5 E;  4DV5 E;  3AV0 A;  4DMI A;  5T6J A;  1WHN A;  4LF6 E;  5CFF E;  2UXD E;  5AE1 A;  4DV0 E;  4I8O A;  4DR6 E;  2V88 A;  1T4L B;  4BMJ A;  1HNZ E;  2IHR 1;  4TUI A;  4JI7 E;  4JI3 E;  3T1Y E;  4JI6 E;  5LMN E;  2UXB E;  3HQ1 A;  3MSW A;  2RS6 A;  3K6Q A;  4WPY A;  3LML A;  1X49 A;  4JI0 E;  2VQF E;  2LE2 A;  4AQY E;  3LLH A;  4J8Z A;  5AAS A;  2B9D A;  4X65 E;  3DF6 A;  1N34 E;  4JI1 E;  4M2Z A;  4JI5 E;  4DR3 E;  1UIL A;  5LMU E;  2LUQ A;  2UUA E;  2FTX B;  1N33 E;  1YZ9 A;  2LJH A;  4BCA A;  4M30 A;  4LF8 E;  3VYX A;  1I94 E;  4B3M E;  4JI4 E;  4JYA E;  1N36 E;  1WHQ A;  4B3S E;  1XMQ E;  2V8Q B;  5ADZ A;  1X47 A;  2JR1 A;  4WSP A;  2ZM6 E;  4M0V A;  2KOU A;  3J7Y p;  1IBK E;  4LF7 E;  2N3G A;  5LL6 R;  4F9A B;  2JOB A;  4X62 E;  3OTO E;  3ADG A;  3F6G A;  2V83 A;  4LF4 E;  4KZS A;  2NUF A;  3J81 C;  1QU6 A;  4P78 A;  4LF5 E;  2L8T A;  2L92 A;  2M4I A;  1IBM E;  1J5E E;  4NXN E;  2L3J A;  2L3C A;  1GZ6 A;  1YYK A;  3ZOQ B;  2WZO A;  2FGG A;  2KON A;  2V89 A;  4NXM E;  2YT4 A;  5F3W A;  1O0W A;  2CPN A;  2F4V E;  4K0K E;  3T1H E;  4DR4 E;  1ZBT A;  1STU A;  2LRS A;  3H09 A;  4L5N C;  2L6M A;  3JU0 A;  4R8O A;  2H36 X;  4KHP E;  4GEQ B;  3FIG A;  4BS9 A;  4DV2 E;  2MDR A;  2LTS A;  2FV4 B;  2V87 A;  4R03 A;  4DR2 E;  1YYO A;  2UXC E;  2LUP B;  2VQE E;  1DQ3 A;  2RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...