4WSPA

Racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
79
Chain Sequence
QSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A functional role of Rv1738 in Mycobacterium tuberculosis persistence suggested by racemic protein crystallography.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords protein DL-Rv1738
total genus 22
structure length 79
sequence length 83
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wspA01
2FGGA 4WSPA 4WPYA
chains in the Genus database with same CATH superfamily
4DV3E 3AUZA 2ZM6E 2N3HA 3H09A 1MEYC 4WPYA 1J5EE 1YSAC 1BBGA 4LF4E 4JI4E 1TF3A 2RSMA 2YU8A 3DF6A 2YZTA 1JK2A 5AE1A 1F2IG 4J8ZA 1SR9A 2JOBA 2EM6A 2YTIA 2DSYA 1O0WA 2UXDE 2WBTA 2VE7C 2DMYA 1YUIA 5FLXC 5LLQA 1T4NA 2L2NA 2LVHA 2EORA 4JI2E 5F3WA 1HR0E 2YU5A 2DLQA 1BB8A 1EH7A 2IHR1 2EQ1A 2EPMX 4IJDA 2UU9E 4RHBB 3IWCA 2MDRA 2EM4A 4DUZE 2EPAA 2EMBA 3C6MA 2YRHA 4LF9E 4L8NA 2NUGA 2EMHA 1UBDC 4ZYGA 4JYAE 1KYQA 2V86A 5IT9C 3BF2A 4DV4E 2L33A 4M30A 4AQYE 2DGCA 4R2QA 5AE3A 2YTOA 4DR4E 4R2DA 2RPCA 1G2FC 2VF1A 1X5WA 1PJQA 1PJTA 4WFTA 4X65E 4DV0E 2RS7A 1RC7A 4BBYA 1JK1A 2EQ3A 3KZZA 2EOSA 2LT7A 2LRSA 4Q28A 4R2EA 4IS1C 2B7TA 4WSPA 4WXDA 3BIDA 3KZYA 2NABA 4I8OA 2EE8A 4GZNC 3MHHC 3OMLA 4DKKA 1FJGE 2B3TB 5A2QC 2LUPB 2MDGA 2A25A 4DV5E 4X66E 2ELYA 2DRPA 5CFFE 3J80C 1XNRE 1EH8A 5BR8E 1GZ6A 2EN8A 2BBGA 4LFBE 2L8TA 3P1XA 4DR2E 3VK6A 2G7HA 3THNA 2JP9A 2LV2A 1XMQE 1IBKE 4WXCA 2EN1A 4KZSA 2CSHA 2L2KB 1MGTA 1B69A 2EM9A 4DV2E 1GQEA 2CPNA 2EMCA 2VRDA 4WX9A 2MC6A 3VHTB 4BS9A 3F6GA 3ZOQB 1X3CA 4R2CA 2M4IA 4JI6E 1T4LB 1NEIA 2ENHA 4M9VC 4GKKE 3F6HA 2J7JA 1X6FA 4O24A 1P47A 1UILA 2E72A 3LMLA 1ZU1A 2PRTA 1QU6A 4JI8E 2L2MA 2UUCE 1T39A 2GLIA 5IXMB 2E1MA 2EWLA 2EL4A 4NXNE 3J81C 2VQFE 2LE2A 1G2DC 5KL4A 4JI5E 2LJHA 4DUYE 2ENCA 4B3ME 3QG5C 2WZOA 2MKDA 1L4SA 2B9DA 2YTDA 1DI2A 5LMUE 2JY9A 2EOQA 2RSIA 1AH5A 1X47A 4O43A 4KWYA 3ADIA 4LU9A 4F6NA 2EOEA 2V83A 1X49A 5A69A 4JI7E 2DLKA 4FK5C 2EOHA 2NUEA 1WRJA 2EMGA 4KHPE 4JI1E 3EQ1A 1UN6B 4F9CB 2EMLA 3J7Yp 2EN4A 2EPOA 2EMWA 4RH8A 2LO3A 3ADGA 1YUJA 2EPXA 2JR1A 4R2AA 1N36E 2EOOA 4LF7E 4X64E 2JYAA 4MLQA 1J26A 4TUGA 1YFHA 1TN9A 4GKJE 2EPRA 4O5GA 4LF8E 2KHXA 5KL3A 1YYOA 5A6AA 2EP3A 1XMOE 4ZYDA 2NUFA 4N4RB 1A1GA 1XNQE 4DR1E 1WHQA 2GPIA 5AC5A 2YTFA 2V8QB 2I13A 5A6BD 2RS6A 2RTXA 2YTJA 2DIXA 3MSWA 2EL6A 2LTRA 2EOJA 1PKPA 4M0VA 2FTXB 2HC5A 2EN7A 5IWAE 1X6EA 1FKAE 2EOIA 2EM2A 2EPPA 3HXLA 4LFAE 2L6MA 4R2RA 1HNXE 3EPHA 4B3RE 2RQLA 4BMJA 4BC7A 2MC5A 4R2SA 3EPLA 3JTZA 2MKNA 2L92A 2YRKA 3LLHA 5KL2A 4B3SE 3FIGA 2EMKA 1YYWA 1AAYA 3ECRA 4WYQB 1IBME 4GEQB 2BB8A 2ELZA 2V85A 2B7VA 4Q35B 2V89A 2UXBE 2H36X 5TSEA 2EPZA 3HQ1A 2EL5A 1T38A 2UXCE 2UUAE 2HJJA 2EM3A 2YSOA 1HNZE 2DMIA 2WBUA 1IQSA 1UHZA 2EM5A 4LTYA 1DGCA 2LBSB 4ZYEA 5A6BA 2Q8UA 2LTSA 1BBOA 5LL6R 2E5LE 2R76A 1KJKA 3TQMA 3MHSC 4DV6E 2EM8A 4M2ZA 4F54A 4NHRA 2EZ6A 4P78A 5ADZA 2EOYA 1STUA 4BHBA 1ZBQA 1GTKA 5A6KA 4NZVA 2JOXA 4L5NC 3M99B 2N3GA 4DR7E 1X48A 3HPZA 1YPNA 4X62E 1LLMC 1Z1BA 1WXRA 4P7DA 2EMFA 4ZYHA 1WJPA 4B3TE 2L3CA 3KWRA 2ODRD 3DJWA 3IWDA 2EN2A 2K7IA 1N3GA 1N32E 4R03A 4NXME 1T4OA 5LMNE 2CT1A 4DMIA 1A1FA 4X9JA 3JU0A 1WHNA 4JV5E 2YPNA 2EPUA 2EPCA 1HNWE 5AASA 5AC4A 1QNTA 4LF6E 5KL7A 1N33E 2ODRC 2D9HA 5KL5A 2EOXA 2JPAA 1EH6A 2WBSA 2EPKX 2EQ0A 5AE2A 2YTEA 5KL6A 3T1HE 2EMXA 5DNYA 4BC9A 1TF6A 2KONA 1RQ0A 1YYKA 1IMUA 3HTXA 4HTGA 4R2PA 1ZBTA 3AV0A 3HPSA 5IV8B 2LUQA 4MLVA 2JXPA 2M1SA 2EOZA 3JAMC 2YSPA 3C4TA 2M7QA 2YTGA 2ADRA 1YZ9A 1RMDA 4LF5E 4DV1E 2M9AA 2YRMA 2CTDA 2EPLX 1A1IA 2EPNA 2L3JA 4LFCE 1PJSA 4DR6E 1IBLE 2VQEE 4JI3E 1A1JA 4TUIA 1A1KA 1NCSA 1A1LA 3BBGA 2LMZA 1ZR9A 3J7AG 3ADLA 1PDAA 2YWQA 3K6QA 3EPKA 2V88A 3ADJA 2JVAA 3IWBA 4YHHE 2EMAA 4OX9E 3VYXA 4WSGA 2EMZA 3EPJA 2EM7A 3THOB 1IQOA 4OOGC 2NA2A 1N34E 4JI0E 3VYYA 2V87A 2LJUA 4R8OA 3RMPA 1DQ3A 2YTNA 4YY3E 4DR5E 2ENAA 4BCAA 3UK3C 2EN6A 4DV7E 2F8BA 1I94E 2EM0A 2LCEA 5T6JA 2FGGA 4F9BB 4F2JC 4F6MA 1A1HA 2EMYA 2EN3A 2R1FA 3C4BA 5A6JA 3C6KA 2YT4A 4F9AB 1SFEA 2UUBE 2EOMA 4BHCA 2F4VE 2YTPA 2DB2A 2EOFA 2YTQA 2JWOA 2KOUA 4HEIA 2N8XA 1X6HA 4X8WA 2HHHE 1ZAAC 2I9IA 3OTOE 4DR3E 2FV4B 3T1YE 2GHFA 2EMIA 2EJ4A 2HGHA 4O4KA 4K0KE 2WCC3 3L00A 2K4VA 3BGHA 1EKZA
chains in the Genus database with same CATH topology
1GQEA 2CPNA 5IWAE 1FKAE 2MC6A 4DV3E 1ZBTA 3AUZA 2N3HA 4BS9A 3F6GA 3H09A 3ZOQB 2ZM6E 3AV0A 3HPSA 2LUQA 4WPYA 3HXLA 1J5EE 4LFAE 2L6MA 2M1SA 2M4IA 4JI6E 1T4LB 1HNXE 4LF4E 4JI4E 4GKKE 3F6HA 3JAMC 2RSMA 3C4TA 2M7QA 4B3RE 3DF6A 2YZTA 4BMJA 1UILA 3LMLA 4BC7A 1YZ9A 2MC5A 5AE1A 3JTZA 1QU6A 2L92A 4JI8E 4LF5E 4J8ZA 2L2MA 2UUCE 1SR9A 2JOBA 3LLHA 4DV1E 2DSYA 2E1MA 4B3SE 1O0WA 3FIGA 2UXDE 2EWLA 2L3JA 4LFCE 2VE7C 2DMYA 4NXNE 5FLXC 4WYQB 3J81C 2LE2A 4GEQB 2VQFE 2V85A 1IBLE 1T4NA 2B7VA 2L2NA 1IBME 4JI5E 2LJHA 2V89A 2VQEE 4DUYE 4JI3E 4B3ME 2H36X 2WZOA 4TUIA 5F3WA 1HR0E 3HQ1A 4JI2E 2UXBE 2B9DA 2UXCE 2UUAE 2IHR1 4DR6E 1DI2A 2LMZA 5LMUE 2JY9A 1HNZE 3ADLA 3J7AG 2UU9E 1UHZA 4LTYA 3IWCA 2MDRA 3K6QA 1X47A 4DUZE 2LBSB 3ADIA 2V88A 4LU9A 3ADJA 2JVAA 2LTSA 3IWBA 4YHHE 4LF9E 4L8NA 2NUGA 2V83A 5LL6R 1X49A 2E5LE 4OX9E 4JYAE 3VYXA 4DV6E 4JI7E 2V86A 5IT9C 2NUEA 4DV4E 2L33A 4M2ZA 4F54A 4M30A 4AQYE 4OOGC 2NA2A 1N34E 4JI0E 4P78A 5ADZA 5AE3A 2V87A 4R8OA 3VYYA 2EZ6A 4DR4E 3RMPA 4KHPE 1DQ3A 4JI1E 1STUA 2VF1A 4X65E 4DV0E 1ZBQA 4WFTA 4YY3E 4F9CB 4DR5E 4BCAA 3J7Yp 2RS7A 4DV7E 2F8BA 4BBYA 1RC7A 2JOXA 4L5NC 1I94E 3ADGA 2N3GA 4DR7E 1X48A 3HPZA 2LRSA 4Q28A 4X62E 2B7TA 2JR1A 1WXRA 4WSPA 1N36E 4P7DA 5T6JA 4LF7E 4X64E 2FGGA 4F9BB 4B3TE 4I8OA 2L3CA 3KWRA 3OMLA 2ODRD 3DJWA 3IWDA 1J26A 3C4BA 4TUGA 4DKKA 1N32E 4R03A 4NXME 1FJGE 2B3TB 1T4OA 5A2QC 5LMNE 4DV5E 2LUPB 4GKJE 4X66E 4DMIA 2YT4A 4F9AB 4LF8E 2KHXA 5CFFE 3JU0A 3J80C 1WHNA 2UUBE 1YYOA 2F4VE 4JV5E 1XNRE 2DB2A 1GZ6A 5BR8E 5AASA 1XMOE 2NUFA 4LFBE 1HNWE 1XNQE 2JWOA 2KOUA 4LF6E 4DR1E 1N33E 2ODRC 2L8TA 1WHQA 3P1XA 4X8WA 4DR2E 1YYWA 3VK6A 2HHHE 2G7HA 3OTOE 2V8QB 5AE2A 2FV4B 4DR3E 3T1YE 3T1HE 2RS6A 2RTXA 1XMQE 5DNYA 4BC9A 2DIXA 3MSWA 1IBKE 4KZSA 2KONA 2LTRA 1RQ0A 2L2KB 4K0KE 1PKPA 4M0VA 1YYKA 2K4VA 2FTXB 4DV2E 3HTXA 1EKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGG A;  4WSP A;  4WPY A; 
#chains in the Genus database with same CATH topology
 4DV3 E;  3AUZ A;  2ZM6 E;  2N3H A;  3H09 A;  1MEY C;  4WPY A;  1J5E E;  1YSA C;  1BBG A;  4LF4 E;  4JI4 E;  1TF3 A;  2RSM A;  2YU8 A;  3DF6 A;  2YZT A;  1JK2 A;  5AE1 A;  1F2I G;  4J8Z A;  1SR9 A;  2JOB A;  2EM6 A;  2YTI A;  2DSY A;  1O0W A;  2UXD E;  2WBT A;  2VE7 C;  2DMY A;  1YUI A;  5FLX C;  5LLQ A;  1T4N A;  2L2N A;  2LVH A;  2EOR A;  4JI2 E;  5F3W A;  1HR0 E;  2YU5 A;  2DLQ A;  1BB8 A;  1EH7 A;  2IHR 1;  2EQ1 A;  2EPM X;  4IJD A;  2UU9 E;  4RHB B;  3IWC A;  2MDR A;  2EM4 A;  4DUZ E;  2EPA A;  2EMB A;  3C6M A;  2YRH A;  4LF9 E;  4L8N A;  2NUG A;  2EMH A;  1UBD C;  4ZYG A;  4JYA E;  1KYQ A;  2V86 A;  5IT9 C;  3BF2 A;  4DV4 E;  2L33 A;  4M30 A;  4AQY E;  2DGC A;  4R2Q A;  5AE3 A;  2YTO A;  4DR4 E;  4R2D A;  2RPC A;  1G2F C;  2VF1 A;  1X5W A;  1PJQ A;  1PJT A;  4WFT A;  4X65 E;  4DV0 E;  2RS7 A;  1RC7 A;  4BBY A;  1JK1 A;  2EQ3 A;  3KZZ A;  2EOS A;  2LT7 A;  2LRS A;  4Q28 A;  4R2E A;  4IS1 C;  2B7T A;  4WSP A;  4WXD A;  3BID A;  3KZY A;  2NAB A;  4I8O A;  2EE8 A;  4GZN C;  3MHH C;  3OML A;  4DKK A;  1FJG E;  2B3T B;  5A2Q C;  2LUP B;  2MDG A;  2A25 A;  4DV5 E;  4X66 E;  2ELY A;  2DRP A;  5CFF E;  3J80 C;  1XNR E;  1EH8 A;  5BR8 E;  1GZ6 A;  2EN8 A;  2BBG A;  4LFB E;  2L8T A;  3P1X A;  4DR2 E;  3VK6 A;  2G7H A;  3THN A;  2JP9 A;  2LV2 A;  1XMQ E;  1IBK E;  4WXC A;  2EN1 A;  4KZS A;  2CSH A;  2L2K B;  1MGT A;  1B69 A;  2EM9 A;  4DV2 E;  1GQE A;  2CPN A;  2EMC A;  2VRD A;  4WX9 A;  2MC6 A;  3VHT B;  4BS9 A;  3F6G A;  3ZOQ B;  1X3C A;  4R2C A;  2M4I A;  4JI6 E;  1T4L B;  1NEI A;  2ENH A;  4M9V C;  4GKK E;  3F6H A;  2J7J A;  1X6F A;  4O24 A;  1P47 A;  1UIL A;  2E72 A;  3LML A;  1ZU1 A;  2PRT A;  1QU6 A;  4JI8 E;  2L2M A;  2UUC E;  1T39 A;  2GLI A;  5IXM B;  2E1M A;  2EWL A;  2EL4 A;  4NXN E;  3J81 C;  2VQF E;  2LE2 A;  1G2D C;  5KL4 A;  4JI5 E;  2LJH A;  4DUY E;  2ENC A;  4B3M E;  3QG5 C;  2WZO A;  2MKD A;  1L4S A;  2B9D A;  2YTD A;  1DI2 A;  5LMU E;  2JY9 A;  2EOQ A;  2RSI A;  1AH5 A;  1X47 A;  4O43 A;  4KWY A;  3ADI A;  4LU9 A;  4F6N A;  2EOE A;  2V83 A;  1X49 A;  5A69 A;  4JI7 E;  2DLK A;  4FK5 C;  2EOH A;  2NUE A;  1WRJ A;  2EMG A;  4KHP E;  4JI1 E;  3EQ1 A;  1UN6 B;  4F9C B;  2EML A;  3J7Y p;  2EN4 A;  2EPO A;  2EMW A;  4RH8 A;  2LO3 A;  3ADG A;  1YUJ A;  2EPX A;  2JR1 A;  4R2A A;  1N36 E;  2EOO A;  4LF7 E;  4X64 E;  2JYA A;  4MLQ A;  1J26 A;  4TUG A;  1YFH A;  1TN9 A;  4GKJ E;  2EPR A;  4O5G A;  4LF8 E;  2KHX A;  5KL3 A;  1YYO A;  5A6A A;  2EP3 A;  1XMO E;  4ZYD A;  2NUF A;  4N4R B;  1A1G A;  1XNQ E;  4DR1 E;  1WHQ A;  2GPI A;  5AC5 A;  2YTF A;  2V8Q B;  2I13 A;  5A6B D;  2RS6 A;  2RTX A;  2YTJ A;  2DIX A;  3MSW A;  2EL6 A;  2LTR A;  2EOJ A;  1PKP A;  4M0V A;  2FTX B;  2HC5 A;  2EN7 A;  5IWA E;  1X6E A;  1FKA E;  2EOI A;  2EM2 A;  2EPP A;  3HXL A;  4LFA E;  2L6M A;  4R2R A;  1HNX E;  3EPH A;  4B3R E;  2RQL A;  4BMJ A;  4BC7 A;  2MC5 A;  4R2S A;  3EPL A;  3JTZ A;  2MKN A;  2L92 A;  2YRK A;  3LLH A;  5KL2 A;  4B3S E;  3FIG A;  2EMK A;  1YYW A;  1AAY A;  3ECR A;  4WYQ B;  1IBM E;  4GEQ B;  2BB8 A;  2ELZ A;  2V85 A;  2B7V A;  4Q35 B;  2V89 A;  2UXB E;  2H36 X;  5TSE A;  2EPZ A;  3HQ1 A;  2EL5 A;  1T38 A;  2UXC E;  2UUA E;  2HJJ A;  2EM3 A;  2YSO A;  1HNZ E;  2DMI A;  2WBU A;  1IQS A;  1UHZ A;  2EM5 A;  4LTY A;  1DGC A;  2LBS B;  4ZYE A;  5A6B A;  2Q8U A;  2LTS A;  1BBO A;  5LL6 R;  2E5L E;  2R76 A;  1KJK A;  3TQM A;  3MHS C;  4DV6 E;  2EM8 A;  4M2Z A;  4F54 A;  4NHR A;  2EZ6 A;  4P78 A;  5ADZ A;  2EOY A;  1STU A;  4BHB A;  1ZBQ A;  1GTK A;  5A6K A;  4NZV A;  2JOX A;  4L5N C;  3M99 B;  2N3G A;  4DR7 E;  1X48 A;  3HPZ A;  1YPN A;  4X62 E;  1LLM C;  1Z1B A;  1WXR A;  4P7D A;  2EMF A;  4ZYH A;  1WJP A;  4B3T E;  2L3C A;  3KWR A;  2ODR D;  3DJW A;  3IWD A;  2EN2 A;  2K7I A;  1N3G A;  1N32 E;  4R03 A;  4NXM E;  1T4O A;  5LMN E;  2CT1 A;  4DMI A;  1A1F A;  4X9J A;  3JU0 A;  1WHN A;  4JV5 E;  2YPN A;  2EPU A;  2EPC A;  1HNW E;  5AAS A;  5AC4 A;  1QNT A;  4LF6 E;  5KL7 A;  1N33 E;  2ODR C;  2D9H A;  5KL5 A;  2EOX A;  2JPA A;  1EH6 A;  2WBS A;  2EPK X;  2EQ0 A;  5AE2 A;  2YTE A;  5KL6 A;  3T1H E;  2EMX A;  5DNY A;  4BC9 A;  1TF6 A;  2KON A;  1RQ0 A;  1YYK A;  1IMU A;  3HTX A;  4HTG A;  4R2P A;  1ZBT A;  3AV0 A;  3HPS A;  5IV8 B;  2LUQ A;  4MLV A;  2JXP A;  2M1S A;  2EOZ A;  3JAM C;  2YSP A;  3C4T A;  2M7Q A;  2YTG A;  2ADR A;  1YZ9 A;  1RMD A;  4LF5 E;  4DV1 E;  2M9A A;  2YRM A;  2CTD A;  2EPL X;  1A1I A;  2EPN A;  2L3J A;  4LFC E;  1PJS A;  4DR6 E;  1IBL E;  2VQE E;  4JI3 E;  1A1J A;  4TUI A;  1A1K A;  1NCS A;  1A1L A;  3BBG A;  2LMZ A;  1ZR9 A;  3J7A G;  3ADL A;  1PDA A;  2YWQ A;  3K6Q A;  3EPK A;  2V88 A;  3ADJ A;  2JVA A;  3IWB A;  4YHH E;  2EMA A;  4OX9 E;  3VYX A;  4WSG A;  2EMZ A;  3EPJ A;  2EM7 A;  3THO B;  1IQO A;  4OOG C;  2NA2 A;  1N34 E;  4JI0 E;  3VYY A;  2V87 A;  2LJU A;  4R8O A;  3RMP A;  1DQ3 A;  2YTN A;  4YY3 E;  4DR5 E;  2ENA A;  4BCA A;  3UK3 C;  2EN6 A;  4DV7 E;  2F8B A;  1I94 E;  2EM0 A;  2LCE A;  5T6J A;  2FGG A;  4F9B B;  4F2J C;  4F6M A;  1A1H A;  2EMY A;  2EN3 A;  2R1F A;  3C4B A;  5A6J A;  3C6K A;  2YT4 A;  4F9A B;  1SFE A;  2UUB E;  2EOM A;  4BHC A;  2F4V E;  2YTP A;  2DB2 A;  2EOF A;  2YTQ A;  2JWO A;  2KOU A;  4HEI A;  2N8X A;  1X6H A;  4X8W A;  2HHH E;  1ZAA C;  2I9I A;  3OTO E;  4DR3 E;  2FV4 B;  3T1Y E;  2GHF A;  2EMI A;  2EJ4 A;  2HGH A;  4O4K A;  4K0K E;  2WCC 3;  3L00 A;  2K4V A;  3BGH A;  1EKZ A; 
#chains in the Genus database with same CATH homology
 1GQE A;  2CPN A;  5IWA E;  1FKA E;  2MC6 A;  4DV3 E;  1ZBT A;  3AUZ A;  2N3H A;  4BS9 A;  3F6G A;  3H09 A;  3ZOQ B;  2ZM6 E;  3AV0 A;  3HPS A;  2LUQ A;  4WPY A;  3HXL A;  1J5E E;  4LFA E;  2L6M A;  2M1S A;  2M4I A;  4JI6 E;  1T4L B;  1HNX E;  4LF4 E;  4JI4 E;  4GKK E;  3F6H A;  3JAM C;  2RSM A;  3C4T A;  2M7Q A;  4B3R E;  3DF6 A;  2YZT A;  4BMJ A;  1UIL A;  3LML A;  4BC7 A;  1YZ9 A;  2MC5 A;  5AE1 A;  3JTZ A;  1QU6 A;  2L92 A;  4JI8 E;  4LF5 E;  4J8Z A;  2L2M A;  2UUC E;  1SR9 A;  2JOB A;  3LLH A;  4DV1 E;  2DSY A;  2E1M A;  4B3S E;  1O0W A;  3FIG A;  2UXD E;  2EWL A;  2L3J A;  4LFC E;  2VE7 C;  2DMY A;  4NXN E;  5FLX C;  4WYQ B;  3J81 C;  2LE2 A;  4GEQ B;  2VQF E;  2V85 A;  1IBL E;  1T4N A;  2B7V A;  2L2N A;  1IBM E;  4JI5 E;  2LJH A;  2V89 A;  2VQE E;  4DUY E;  4JI3 E;  4B3M E;  2H36 X;  2WZO A;  4TUI A;  5F3W A;  1HR0 E;  3HQ1 A;  4JI2 E;  2UXB E;  2B9D A;  2UXC E;  2UUA E;  2IHR 1;  4DR6 E;  1DI2 A;  2LMZ A;  5LMU E;  2JY9 A;  1HNZ E;  3ADL A;  3J7A G;  2UU9 E;  1UHZ A;  4LTY A;  3IWC A;  2MDR A;  3K6Q A;  1X47 A;  4DUZ E;  2LBS B;  3ADI A;  2V88 A;  4LU9 A;  3ADJ A;  2JVA A;  2LTS A;  3IWB A;  4YHH E;  4LF9 E;  4L8N A;  2NUG A;  2V83 A;  5LL6 R;  1X49 A;  2E5L E;  4OX9 E;  4JYA E;  3VYX A;  4DV6 E;  4JI7 E;  2V86 A;  5IT9 C;  2NUE A;  4DV4 E;  2L33 A;  4M2Z A;  4F54 A;  4M30 A;  4AQY E;  4OOG C;  2NA2 A;  1N34 E;  4JI0 E;  4P78 A;  5ADZ A;  5AE3 A;  2V87 A;  4R8O A;  3VYY A;  2EZ6 A;  4DR4 E;  3RMP A;  4KHP E;  1DQ3 A;  4JI1 E;  1STU A;  2VF1 A;  4X65 E;  4DV0 E;  1ZBQ A;  4WFT A;  4YY3 E;  4F9C B;  4DR5 E;  4BCA A;  3J7Y p;  2RS7 A;  4DV7 E;  2F8B A;  4BBY A;  1RC7 A;  2JOX A;  4L5N C;  1I94 E;  3ADG A;  2N3G A;  4DR7 E;  1X48 A;  3HPZ A;  2LRS A;  4Q28 A;  4X62 E;  2B7T A;  2JR1 A;  1WXR A;  4WSP A;  1N36 E;  4P7D A;  5T6J A;  4LF7 E;  4X64 E;  2FGG A;  4F9B B;  4B3T E;  4I8O A;  2L3C A;  3KWR A;  3OML A;  2ODR D;  3DJW A;  3IWD A;  1J26 A;  3C4B A;  4TUG A;  4DKK A;  1N32 E;  4R03 A;  4NXM E;  1FJG E;  2B3T B;  1T4O A;  5A2Q C;  5LMN E;  4DV5 E;  2LUP B;  4GKJ E;  4X66 E;  4DMI A;  2YT4 A;  4F9A B;  4LF8 E;  2KHX A;  5CFF E;  3JU0 A;  3J80 C;  1WHN A;  2UUB E;  1YYO A;  2F4V E;  4JV5 E;  1XNR E;  2DB2 A;  1GZ6 A;  5BR8 E;  5AAS A;  1XMO E;  2NUF A;  4LFB E;  1HNW E;  1XNQ E;  2JWO A;  2KOU A;  4LF6 E;  4DR1 E;  1N33 E;  2ODR C;  2L8T A;  1WHQ A;  3P1X A;  4X8W A;  4DR2 E;  1YYW A;  3VK6 A;  2HHH E;  2G7H A;  3OTO E;  2V8Q B;  5AE2 A;  2FV4 B;  4DR3 E;  3T1Y E;  3T1H E;  2RS6 A;  2RTX A;  1XMQ E;  5DNY A;  4BC9 A;  2DIX A;  3MSW A;  1IBK E;  4KZS A;  2KON A;  2LTR A;  1RQ0 A;  2L2K B;  4K0K E;  1PKP A;  4M0V A;  1YYK A;  2K4V A;  2FTX B;  4DV2 E;  3HTX A;  1EKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...