2EM6A

Solution structure of the c2h2 type zinc finger (region 199-231) of human zinc finger protein 224
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 199-231) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em6A01
1A1IA 2EJ4A 1G2FC 2YTEA 1A1JA 2YTQA 2BB8A 2WBUA 2EORA 4FK5C 1JK2A 2YRMA 4R2RA 2EQ0A 2NABA 1LLMC 2EP3A 2EN1A 2EQ3A 3VHTB 2GHFA 3EPHA 3M99B 2EL6A 2EMFA 2VRDA 2EN3A 2ELZA 2EPRA 2EM5A 1A1FA 2EN7A 1B69A 2CTDA 4WSGA 2MKNA 2E72A 2MDGA 1P47A 1X6FA 1JK1A 2J7JA 2EL4A 4R2CA 3MHSC 2EOQA 4R2EA 3EPJA 3EPKA 3EPLA 2R1FA 1KJKA 4R2QA 2EMXA 1ZU1A 4X9JA 2EM3A 4F6NA 2PRTA 2EMWA 2EM8A 2DMIA 2RSIA 2EMHA 1ZR9A 5KL6A 1X5WA 2LCEA 2RPCA 2EOOA 4R2SA 2EOIA 2EOSA 1X6HA 2MKDA 1YUIA 2EMZA 2ENAA 2LVHA 1NCSA 2EM9A 2EM0A 2EMBA 4GZNC 2I13A 3UK3C 2EPZA 2EMGA 2YTJA 2YTIA 2EL5A 2D9HA 4R2AA 2EMYA 4IJDA 1TF3A 2JP9A 2YSPA 2EMIA 2EOXA 4M9VC 5KL3A 4F6MA 2DRPA 1UN6B 2EN4A 2YRKA 2YTOA 5KL4A 1G2DC 2EM2A 1BB8A 2EE8A 1MEYC 1A1KA 2YTDA 2EPXA 1WJPA 2ENCA 5KL2A 1BBOA 2YTPA 2LT7A 1Z1BA 2CT1A 2ADRA 1F2IG 2CSHA 2EM7A 2EOJA 2EOEA 2EMCA 1RMDA 2EM6A 2EN8A 2ELYA 2WCC3 5KL5A 1ZAAC 2EOYA 4IS1C 2HGHA 2EPUA 2YU8A 2M9AA 2DLQA 1TN9A 2EM4A 2DLKA 2EMAA 1X3CA 2YRHA 1A1GA 2LV2A 1TF6A 2EOFA 2LO3A 2EOMA 1DGCA 2EMKA 4R2PA 2JPAA 2DGCA 2A25A 3MHHC 2EMLA 2EQ1A 2ENHA 2YTGA 2EPAA 2WBSA 2GLIA 2EPPA 2YTNA 1UBDC 2WBTA 2YTFA 2EOZA 1YUJA 2EN6A 4R2DA 2YSOA 2EOHA 2EPCA 1A1HA 4F2JC 1AAYA 1X6EA 2YU5A 5KL7A 1A1LA 2EN2A 1YSAC
chains in the Genus database with same CATH superfamily
4F9BB 1A1JA 2BB8A 4O24A 1XNQE 1X48A 4GKJE 4FK5C 2UUCE 1I94E 1L4SA 5IWAE 3IWCA 2EN1A 2EZ6A 2I9IA 4DV4E 2M7QA 4KWYA 2VRDA 2EPRA 1WXRA 2N3GA 1T4NA 1FKAE 2V87A 4MLQA 5A6BA 4BBYA 1WRJA 1UHZA 1YYOA 3C4TA 2EMWA 1PKPA 2DB2A 1PJSA 2RSIA 4BHCA 2JWOA 1AH5A 1X5WA 4RHBB 3J81C 3MSWA 1RC7A 1X6HA 5AC4A 1IBLE 1XMOE 2EMZA 2VE7C 1NCSA 4LF9E 2EMBA 4N4RB 4GZNC 4ZYDA 1FJGE 1ZBTA 1QNTA 3IWBA 2B7TA 2LMZA 4IJDA 3J80C 1J5EE 1TF3A 2EMIA 2EOXA 2CPNA 2DRPA 2EN4A 2YTOA 3K6QA 1G2DC 4DV0E 2EE8A 4DUZE 1WJPA 4DV7E 1BBOA 4ZYEA 2YTPA 2JR1A 1UILA 2CSHA 2EOJA 2LTRA 5FLXC 2EPLX 2EM6A 2EN8A 2WCC3 4WXDA 1YYKA 4P7DA 3ADJA 2RS6A 4DR1E 3T1YE 2HGHA 4K0KE 5BR8E 4DR6E 2EM4A 4HEIA 3KZYA 2DSYA 4JI7E 4J8ZA 2EMKA 4JI8E 1EH8A 3MHHC 2EMLA 2EQ1A 2YTGA 2GLIA 3KZZA 3F6GA 1RQ0A 2FGGA 2LRSA 4X62E 2EN6A 4R2DA 2YSOA 3C4BA 2EPCA 2MC5A 3ZOQB 2KHXA 2B9DA 4YHHE 2EN2A 2N3HA 2EJ4A 2YTEA 2EORA 4L8NA 1PDAA 1EH6A 2YRMA 5IT9C 3BIDA 2L2NA 1XMQE 1N3GA 2EL6A 4M2ZA 2EMFA 1IMUA 2EN3A 4R8OA 4X64E 1N32E 4BC7A 2NUEA 2YZTA 3LMLA 1A1FA 3HTXA 1B69A 4B3SE 4WSGA 3LLHA 4RH8A 1JK1A 1DI2A 2EL4A 4R2CA 4R2EA 4LFCE 4I8OA 3EPLA 1KJKA 4DV3E 2V86A 2EMXA 4X9JA 2HHHE 2UUBE 2KONA 2LCEA 3AUZA 4O5GA 3HPSA 4R2SA 2L3CA 2LJUA 4WYQB 4DMIA 4ZYGA 2BBGA 2EOSA 1YUIA 2JOXA 2LE2A 4WSPA 1ZBQA 4DKKA 2EM9A 2EM0A 5AE3A 3UK3C 2V83A 2EMGA 2YTIA 2D9HA 2UUAE 5LL6R 2VF1A 2L33A 2JP9A 4JI2E 4AQYE 2NUFA 4F6MA 4M9VC 2L2MA 2JYAA 5KL4A 1BB8A 2YTDA 2EPXA 1T4OA 2ENCA 3THOB 5KL2A 4JI0E 2LT7A 4X8WA 4DR5E 2CT1A 2ADRA 2JY9A 1T39A 2L92A 3VYYA 1HNWE 2EPOA 1GQEA 1YFHA 2EOEA 4KZSA 2ELYA 5KL5A 2EOYA 2M9AA 2L2KB 1TN9A 2DLKA 5AASA 5A2QC 4X66E 5AE2A 2JOBA 1EH7A 4O43A 2A25A 2V89A 3JAMC 3THNA 2ENHA 2EPAA 2WBSA 2K4VA 4NHRA 4DV2E 2YTNA 3F6HA 4HTGA 1N36E 5A6AA 1X49A 4P78A 1YUJA 2EOHA 4F2JC 2UXBE 1YZ9A 2DMYA 2VQEE 1X6EA 1A1LA 1PJTA 1EKZA 1YSAC 4BC9A 2EWLA 2JVAA 2YTQA 1KYQA 3OTOE 1JK2A 2IHR1 2N8XA 5A69A 1IBME 3AV0A 5CFFE 2NABA 1LLMC 2EP3A 2GHFA 3HPZA 4DV1E 3C6KA 2V85A 4KHPE 3J7AG 4JI4E 2ELZA 4F54A 2JXPA 2Q8UA 5IV8B 2EM5A 3RMPA 4BMJA 2EN7A 4JI1E 4DR3E 2MDGA 3BGHA 4NXME 2ODRC 4DV5E 2J7JA 4DV6E 4B3ME 2L3JA 4O4KA 2EPMX 4LFAE 3P1XA 4R03A 2YPNA 2MDRA 4F6NA 4F9AB 2V88A 2EM8A 2EMHA 4WFTA 2EOIA 1WHNA 1J26A 4TUGA 4JI5E 2MKDA 4LF4E 3KWRA 4OX9E 4GEQB 2F4VE 3ADIA 2EL5A 3DJWA 4R2AA 2EMYA 2YSPA 2NA2A 2LBSB 5KL3A 1UN6B 2L8TA 2DIXA 2YRKA 3BBGA 1DQ3A 1A1KA 3VYXA 2UXDE 1SFEA 3ADGA 1Z1BA 3C6MA 1GTKA 4LU9A 3T1HE 1YYWA 1NEIA 2WZOA 2EMCA 2LJHA 2B7VA 1O0WA 2LTSA 1ZAAC 4JV5E 4BHBA 4IS1C 4DUYE 2EPUA 1WHQA 1X3CA 2YRHA 4M0VA 4Q35B 2GPIA 2LO3A 2EOMA 2EPNA 4R2PA 2JPAA 2RTXA 1PJQA 2DGCA 2KOUA 2RQLA 2NUGA 1IQOA 4WPYA 1UBDC 2UU9E 1X47A 2WBTA 2YTFA 3HXLA 2EPKX 1HR0E 2V8QB 1XNRE 1GZ6A 4R2RA 3L00A 1A1IA 1G2FC 2E1MA 2M1SA 2M4IA 1IBKE 2WBUA 1N34E 3H09A 4LF5E 2EQ0A 3VHTB 2EQ3A 4ZYHA 4LF8E 3EPHA 3M99B 5IXMB 5AC5A 3FIGA 1T38A 4LTYA 3ADLA 3JU0A 2ZM6E 2CTDA 2FTXB 3VK6A 2E72A 2MC6A 1P47A 2ODRD 1T4LB 4NZVA 4B3RE 1X6FA 4WXCA 1IQSA 2EOQA 3MHSC 3EPJA 3EPKA 2R1FA 5ADZA 4MLVA 4R2QA 5A6JA 1ZU1A 4DR7E 4X65E 2EM3A 4BS9A 2PRTA 2DMIA 1ZR9A 2FV4B 5KL6A 2RPCA 2EOOA 2F8BA 4YY3E 3J7Yp 4JI3E 4L5NC 2ENAA 2LVHA 4WX9A 2R76A 2I13A 2EPZA 5DNYA 1HNZE 5F3WA 2YTJA 3OMLA 5LMNE 4Q28A 1BBGA 2K7IA 2LUPB 2L6MA 2E5LE 5LLQA 2RSMA 1STUA 3TQMA 5TSEA 2EM2A 4BCAA 3JTZA 4NXNE 2HC5A 4LFBE 1MEYC 4LF7E 2YT4A 2G7HA 1F2IG 4OOGC 2YWQA 2EM7A 5A6KA 4DR2E 1RMDA 1QU6A 2B3TB 3ECRA 2HJJA 2YU8A 2DLQA 4JYAE 1MGTA 2EMAA 2H36X 1A1GA 3EQ1A 4TUIA 2LV2A 1TF6A 2EOFA 1YPNA 1DGCA 1N33E 3BF2A 3QG5C 1HNXE 4DR4E 5T6JA 4F9CB 2EPPA 3DF6A 5LMUE 5A6BD 4JI6E 4LF6E 4M30A 3HQ1A 2EOZA 4B3TE 1SR9A 1A1HA 1AAYA 4GKKE 2VQFE 2LUQA 2UXCE 5AE1A 2RS7A 2YU5A 3IWDA 5KL7A 2MKNA
chains in the Genus database with same CATH topology
1A1IA 2EJ4A 1G2FC 2YTEA 1A1JA 2YTQA 2BB8A 2WBUA 2EORA 4FK5C 1JK2A 2YRMA 4R2RA 2EQ0A 2NABA 1LLMC 2EP3A 2EN1A 2EQ3A 3VHTB 2GHFA 3EPHA 3M99B 2EL6A 2EMFA 2VRDA 2EN3A 2ELZA 2EPRA 2EM5A 1A1FA 2EN7A 1B69A 2CTDA 4WSGA 2MKNA 2E72A 2MDGA 1P47A 1X6FA 1JK1A 2J7JA 2EL4A 4R2CA 3MHSC 2EOQA 4R2EA 3EPJA 3EPKA 3EPLA 2R1FA 1KJKA 4R2QA 2EMXA 1ZU1A 4X9JA 2EM3A 4F6NA 2PRTA 2EMWA 2EM8A 2DMIA 2RSIA 2EMHA 1ZR9A 5KL6A 1X5WA 2LCEA 2RPCA 2EOOA 4R2SA 2EOIA 2EOSA 1X6HA 2MKDA 1YUIA 2EMZA 2ENAA 2LVHA 1NCSA 2EM9A 2EM0A 2EMBA 4GZNC 2I13A 3UK3C 2EPZA 2EMGA 2YTJA 2YTIA 2EL5A 2D9HA 4R2AA 2EMYA 4IJDA 1TF3A 2JP9A 2YSPA 2EMIA 2EOXA 4M9VC 5KL3A 4F6MA 2DRPA 1UN6B 2EN4A 2YRKA 2YTOA 5KL4A 1G2DC 2EM2A 1BB8A 2EE8A 1MEYC 1A1KA 2YTDA 2EPXA 1WJPA 2ENCA 5KL2A 1BBOA 2YTPA 2LT7A 1Z1BA 2CT1A 2ADRA 1F2IG 2CSHA 2EM7A 2EOJA 2EOEA 2EMCA 1RMDA 2EM6A 2EN8A 2ELYA 2WCC3 5KL5A 1ZAAC 2EOYA 4IS1C 2HGHA 2EPUA 2YU8A 2M9AA 2DLQA 1TN9A 2EM4A 2DLKA 2EMAA 1X3CA 2YRHA 1A1GA 2LV2A 1TF6A 2EOFA 2LO3A 2EOMA 1DGCA 2EMKA 4R2PA 2JPAA 2DGCA 2A25A 3MHHC 2EMLA 2EQ1A 2ENHA 2YTGA 2EPAA 2WBSA 2GLIA 2EPPA 2YTNA 1UBDC 2WBTA 2YTFA 2EOZA 1YUJA 2EN6A 4R2DA 2YSOA 2EOHA 2EPCA 1A1HA 4F2JC 1AAYA 1X6EA 2YU5A 5KL7A 1A1LA 2EN2A 1YSAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1I A;  2EJ4 A;  1G2F C;  2YTE A;  1A1J A;  2YTQ A;  2BB8 A;  2WBU A;  2EOR A;  4FK5 C;  1JK2 A;  2YRM A;  4R2R A;  2EQ0 A;  2NAB A;  1LLM C;  2EP3 A;  2EN1 A;  2EQ3 A;  3VHT B;  2GHF A;  3EPH A;  3M99 B;  2EL6 A;  2EMF A;  2VRD A;  2EN3 A;  2ELZ A;  2EPR A;  2EM5 A;  1A1F A;  2EN7 A;  1B69 A;  2CTD A;  4WSG A;  2MKN A;  2E72 A;  2MDG A;  1P47 A;  1X6F A;  1JK1 A;  2J7J A;  2EL4 A;  4R2C A;  3MHS C;  2EOQ A;  4R2E A;  3EPJ A;  3EPK A;  3EPL A;  2R1F A;  1KJK A;  4R2Q A;  2EMX A;  1ZU1 A;  4X9J A;  2EM3 A;  4F6N A;  2PRT A;  2EMW A;  2EM8 A;  2DMI A;  2RSI A;  2EMH A;  1ZR9 A;  5KL6 A;  1X5W A;  2LCE A;  2RPC A;  2EOO A;  4R2S A;  2EOI A;  2EOS A;  1X6H A;  2MKD A;  1YUI A;  2EMZ A;  2ENA A;  2LVH A;  1NCS A;  2EM9 A;  2EM0 A;  2EMB A;  4GZN C;  2I13 A;  3UK3 C;  2EPZ A;  2EMG A;  2YTJ A;  2YTI A;  2EL5 A;  2D9H A;  4R2A A;  2EMY A;  4IJD A;  1TF3 A;  2JP9 A;  2YSP A;  2EMI A;  2EOX A;  4M9V C;  5KL3 A;  4F6M A;  2DRP A;  1UN6 B;  2EN4 A;  2YRK A;  2YTO A;  5KL4 A;  1G2D C;  2EM2 A;  1BB8 A;  2EE8 A;  1MEY C;  1A1K A;  2YTD A;  2EPX A;  1WJP A;  2ENC A;  5KL2 A;  1BBO A;  2YTP A;  2LT7 A;  1Z1B A;  2CT1 A;  2ADR A;  1F2I G;  2CSH A;  2EM7 A;  2EOJ A;  2EOE A;  2EMC A;  1RMD A;  2EM6 A;  2EN8 A;  2ELY A;  2WCC 3;  5KL5 A;  1ZAA C;  2EOY A;  4IS1 C;  2HGH A;  2EPU A;  2YU8 A;  2M9A A;  2DLQ A;  1TN9 A;  2EM4 A;  2DLK A;  2EMA A;  1X3C A;  2YRH A;  1A1G A;  2LV2 A;  1TF6 A;  2EOF A;  2LO3 A;  2EOM A;  1DGC A;  2EMK A;  4R2P A;  2JPA A;  2DGC A;  2A25 A;  3MHH C;  2EML A;  2EQ1 A;  2ENH A;  2YTG A;  2EPA A;  2WBS A;  2GLI A;  2EPP A;  2YTN A;  1UBD C;  2WBT A;  2YTF A;  2EOZ A;  1YUJ A;  2EN6 A;  4R2D A;  2YSO A;  2EOH A;  2EPC A;  1A1H A;  4F2J C;  1AAY A;  1X6E A;  2YU5 A;  5KL7 A;  1A1L A;  2EN2 A;  1YSA C; 
#chains in the Genus database with same CATH topology
 4F9B B;  1A1J A;  2BB8 A;  4O24 A;  1XNQ E;  1X48 A;  4GKJ E;  4FK5 C;  2UUC E;  1I94 E;  1L4S A;  5IWA E;  3IWC A;  2EN1 A;  2EZ6 A;  2I9I A;  4DV4 E;  2M7Q A;  4KWY A;  2VRD A;  2EPR A;  1WXR A;  2N3G A;  1T4N A;  1FKA E;  2V87 A;  4MLQ A;  5A6B A;  4BBY A;  1WRJ A;  1UHZ A;  1YYO A;  3C4T A;  2EMW A;  1PKP A;  2DB2 A;  1PJS A;  2RSI A;  4BHC A;  2JWO A;  1AH5 A;  1X5W A;  4RHB B;  3J81 C;  3MSW A;  1RC7 A;  1X6H A;  5AC4 A;  1IBL E;  1XMO E;  2EMZ A;  2VE7 C;  1NCS A;  4LF9 E;  2EMB A;  4N4R B;  4GZN C;  4ZYD A;  1FJG E;  1ZBT A;  1QNT A;  3IWB A;  2B7T A;  2LMZ A;  4IJD A;  3J80 C;  1J5E E;  1TF3 A;  2EMI A;  2EOX A;  2CPN A;  2DRP A;  2EN4 A;  2YTO A;  3K6Q A;  1G2D C;  4DV0 E;  2EE8 A;  4DUZ E;  1WJP A;  4DV7 E;  1BBO A;  4ZYE A;  2YTP A;  2JR1 A;  1UIL A;  2CSH A;  2EOJ A;  2LTR A;  5FLX C;  2EPL X;  2EM6 A;  2EN8 A;  2WCC 3;  4WXD A;  1YYK A;  4P7D A;  3ADJ A;  2RS6 A;  4DR1 E;  3T1Y E;  2HGH A;  4K0K E;  5BR8 E;  4DR6 E;  2EM4 A;  4HEI A;  3KZY A;  2DSY A;  4JI7 E;  4J8Z A;  2EMK A;  4JI8 E;  1EH8 A;  3MHH C;  2EML A;  2EQ1 A;  2YTG A;  2GLI A;  3KZZ A;  3F6G A;  1RQ0 A;  2FGG A;  2LRS A;  4X62 E;  2EN6 A;  4R2D A;  2YSO A;  3C4B A;  2EPC A;  2MC5 A;  3ZOQ B;  2KHX A;  2B9D A;  4YHH E;  2EN2 A;  2N3H A;  2EJ4 A;  2YTE A;  2EOR A;  4L8N A;  1PDA A;  1EH6 A;  2YRM A;  5IT9 C;  3BID A;  2L2N A;  1XMQ E;  1N3G A;  2EL6 A;  4M2Z A;  2EMF A;  1IMU A;  2EN3 A;  4R8O A;  4X64 E;  1N32 E;  4BC7 A;  2NUE A;  2YZT A;  3LML A;  1A1F A;  3HTX A;  1B69 A;  4B3S E;  4WSG A;  3LLH A;  4RH8 A;  1JK1 A;  1DI2 A;  2EL4 A;  4R2C A;  4R2E A;  4LFC E;  4I8O A;  3EPL A;  1KJK A;  4DV3 E;  2V86 A;  2EMX A;  4X9J A;  2HHH E;  2UUB E;  2KON A;  2LCE A;  3AUZ A;  4O5G A;  3HPS A;  4R2S A;  2L3C A;  2LJU A;  4WYQ B;  4DMI A;  4ZYG A;  2BBG A;  2EOS A;  1YUI A;  2JOX A;  2LE2 A;  4WSP A;  1ZBQ A;  4DKK A;  2EM9 A;  2EM0 A;  5AE3 A;  3UK3 C;  2V83 A;  2EMG A;  2YTI A;  2D9H A;  2UUA E;  5LL6 R;  2VF1 A;  2L33 A;  2JP9 A;  4JI2 E;  4AQY E;  2NUF A;  4F6M A;  4M9V C;  2L2M A;  2JYA A;  5KL4 A;  1BB8 A;  2YTD A;  2EPX A;  1T4O A;  2ENC A;  3THO B;  5KL2 A;  4JI0 E;  2LT7 A;  4X8W A;  4DR5 E;  2CT1 A;  2ADR A;  2JY9 A;  1T39 A;  2L92 A;  3VYY A;  1HNW E;  2EPO A;  1GQE A;  1YFH A;  2EOE A;  4KZS A;  2ELY A;  5KL5 A;  2EOY A;  2M9A A;  2L2K B;  1TN9 A;  2DLK A;  5AAS A;  5A2Q C;  4X66 E;  5AE2 A;  2JOB A;  1EH7 A;  4O43 A;  2A25 A;  2V89 A;  3JAM C;  3THN A;  2ENH A;  2EPA A;  2WBS A;  2K4V A;  4NHR A;  4DV2 E;  2YTN A;  3F6H A;  4HTG A;  1N36 E;  5A6A A;  1X49 A;  4P78 A;  1YUJ A;  2EOH A;  4F2J C;  2UXB E;  1YZ9 A;  2DMY A;  2VQE E;  1X6E A;  1A1L A;  1PJT A;  1EKZ A;  1YSA C;  4BC9 A;  2EWL A;  2JVA A;  2YTQ A;  1KYQ A;  3OTO E;  1JK2 A;  2IHR 1;  2N8X A;  5A69 A;  1IBM E;  3AV0 A;  5CFF E;  2NAB A;  1LLM C;  2EP3 A;  2GHF A;  3HPZ A;  4DV1 E;  3C6K A;  2V85 A;  4KHP E;  3J7A G;  4JI4 E;  2ELZ A;  4F54 A;  2JXP A;  2Q8U A;  5IV8 B;  2EM5 A;  3RMP A;  4BMJ A;  2EN7 A;  4JI1 E;  4DR3 E;  2MDG A;  3BGH A;  4NXM E;  2ODR C;  4DV5 E;  2J7J A;  4DV6 E;  4B3M E;  2L3J A;  4O4K A;  2EPM X;  4LFA E;  3P1X A;  4R03 A;  2YPN A;  2MDR A;  4F6N A;  4F9A B;  2V88 A;  2EM8 A;  2EMH A;  4WFT A;  2EOI A;  1WHN A;  1J26 A;  4TUG A;  4JI5 E;  2MKD A;  4LF4 E;  3KWR A;  4OX9 E;  4GEQ B;  2F4V E;  3ADI A;  2EL5 A;  3DJW A;  4R2A A;  2EMY A;  2YSP A;  2NA2 A;  2LBS B;  5KL3 A;  1UN6 B;  2L8T A;  2DIX A;  2YRK A;  3BBG A;  1DQ3 A;  1A1K A;  3VYX A;  2UXD E;  1SFE A;  3ADG A;  1Z1B A;  3C6M A;  1GTK A;  4LU9 A;  3T1H E;  1YYW A;  1NEI A;  2WZO A;  2EMC A;  2LJH A;  2B7V A;  1O0W A;  2LTS A;  1ZAA C;  4JV5 E;  4BHB A;  4IS1 C;  4DUY E;  2EPU A;  1WHQ A;  1X3C A;  2YRH A;  4M0V A;  4Q35 B;  2GPI A;  2LO3 A;  2EOM A;  2EPN A;  4R2P A;  2JPA A;  2RTX A;  1PJQ A;  2DGC A;  2KOU A;  2RQL A;  2NUG A;  1IQO A;  4WPY A;  1UBD C;  2UU9 E;  1X47 A;  2WBT A;  2YTF A;  3HXL A;  2EPK X;  1HR0 E;  2V8Q B;  1XNR E;  1GZ6 A;  4R2R A;  3L00 A;  1A1I A;  1G2F C;  2E1M A;  2M1S A;  2M4I A;  1IBK E;  2WBU A;  1N34 E;  3H09 A;  4LF5 E;  2EQ0 A;  3VHT B;  2EQ3 A;  4ZYH A;  4LF8 E;  3EPH A;  3M99 B;  5IXM B;  5AC5 A;  3FIG A;  1T38 A;  4LTY A;  3ADL A;  3JU0 A;  2ZM6 E;  2CTD A;  2FTX B;  3VK6 A;  2E72 A;  2MC6 A;  1P47 A;  2ODR D;  1T4L B;  4NZV A;  4B3R E;  1X6F A;  4WXC A;  1IQS A;  2EOQ A;  3MHS C;  3EPJ A;  3EPK A;  2R1F A;  5ADZ A;  4MLV A;  4R2Q A;  5A6J A;  1ZU1 A;  4DR7 E;  4X65 E;  2EM3 A;  4BS9 A;  2PRT A;  2DMI A;  1ZR9 A;  2FV4 B;  5KL6 A;  2RPC A;  2EOO A;  2F8B A;  4YY3 E;  3J7Y p;  4JI3 E;  4L5N C;  2ENA A;  2LVH A;  4WX9 A;  2R76 A;  2I13 A;  2EPZ A;  5DNY A;  1HNZ E;  5F3W A;  2YTJ A;  3OML A;  5LMN E;  4Q28 A;  1BBG A;  2K7I A;  2LUP B;  2L6M A;  2E5L E;  5LLQ A;  2RSM A;  1STU A;  3TQM A;  5TSE A;  2EM2 A;  4BCA A;  3JTZ A;  4NXN E;  2HC5 A;  4LFB E;  1MEY C;  4LF7 E;  2YT4 A;  2G7H A;  1F2I G;  4OOG C;  2YWQ A;  2EM7 A;  5A6K A;  4DR2 E;  1RMD A;  1QU6 A;  2B3T B;  3ECR A;  2HJJ A;  2YU8 A;  2DLQ A;  4JYA E;  1MGT A;  2EMA A;  2H36 X;  1A1G A;  3EQ1 A;  4TUI A;  2LV2 A;  1TF6 A;  2EOF A;  1YPN A;  1DGC A;  1N33 E;  3BF2 A;  3QG5 C;  1HNX E;  4DR4 E;  5T6J A;  4F9C B;  2EPP A;  3DF6 A;  5LMU E;  5A6B D;  4JI6 E;  4LF6 E;  4M30 A;  3HQ1 A;  2EOZ A;  4B3T E;  1SR9 A;  1A1H A;  1AAY A;  4GKK E;  2VQF E;  2LUQ A;  2UXC E;  5AE1 A;  2RS7 A;  2YU5 A;  3IWD A;  5KL7 A;  2MKN A; 
#chains in the Genus database with same CATH homology
 1A1I A;  2EJ4 A;  1G2F C;  2YTE A;  1A1J A;  2YTQ A;  2BB8 A;  2WBU A;  2EOR A;  4FK5 C;  1JK2 A;  2YRM A;  4R2R A;  2EQ0 A;  2NAB A;  1LLM C;  2EP3 A;  2EN1 A;  2EQ3 A;  3VHT B;  2GHF A;  3EPH A;  3M99 B;  2EL6 A;  2EMF A;  2VRD A;  2EN3 A;  2ELZ A;  2EPR A;  2EM5 A;  1A1F A;  2EN7 A;  1B69 A;  2CTD A;  4WSG A;  2MKN A;  2E72 A;  2MDG A;  1P47 A;  1X6F A;  1JK1 A;  2J7J A;  2EL4 A;  4R2C A;  3MHS C;  2EOQ A;  4R2E A;  3EPJ A;  3EPK A;  3EPL A;  2R1F A;  1KJK A;  4R2Q A;  2EMX A;  1ZU1 A;  4X9J A;  2EM3 A;  4F6N A;  2PRT A;  2EMW A;  2EM8 A;  2DMI A;  2RSI A;  2EMH A;  1ZR9 A;  5KL6 A;  1X5W A;  2LCE A;  2RPC A;  2EOO A;  4R2S A;  2EOI A;  2EOS A;  1X6H A;  2MKD A;  1YUI A;  2EMZ A;  2ENA A;  2LVH A;  1NCS A;  2EM9 A;  2EM0 A;  2EMB A;  4GZN C;  2I13 A;  3UK3 C;  2EPZ A;  2EMG A;  2YTJ A;  2YTI A;  2EL5 A;  2D9H A;  4R2A A;  2EMY A;  4IJD A;  1TF3 A;  2JP9 A;  2YSP A;  2EMI A;  2EOX A;  4M9V C;  5KL3 A;  4F6M A;  2DRP A;  1UN6 B;  2EN4 A;  2YRK A;  2YTO A;  5KL4 A;  1G2D C;  2EM2 A;  1BB8 A;  2EE8 A;  1MEY C;  1A1K A;  2YTD A;  2EPX A;  1WJP A;  2ENC A;  5KL2 A;  1BBO A;  2YTP A;  2LT7 A;  1Z1B A;  2CT1 A;  2ADR A;  1F2I G;  2CSH A;  2EM7 A;  2EOJ A;  2EOE A;  2EMC A;  1RMD A;  2EM6 A;  2EN8 A;  2ELY A;  2WCC 3;  5KL5 A;  1ZAA C;  2EOY A;  4IS1 C;  2HGH A;  2EPU A;  2YU8 A;  2M9A A;  2DLQ A;  1TN9 A;  2EM4 A;  2DLK A;  2EMA A;  1X3C A;  2YRH A;  1A1G A;  2LV2 A;  1TF6 A;  2EOF A;  2LO3 A;  2EOM A;  1DGC A;  2EMK A;  4R2P A;  2JPA A;  2DGC A;  2A25 A;  3MHH C;  2EML A;  2EQ1 A;  2ENH A;  2YTG A;  2EPA A;  2WBS A;  2GLI A;  2EPP A;  2YTN A;  1UBD C;  2WBT A;  2YTF A;  2EOZ A;  1YUJ A;  2EN6 A;  4R2D A;  2YSO A;  2EOH A;  2EPC A;  1A1H A;  4F2J C;  1AAY A;  1X6E A;  2YU5 A;  5KL7 A;  1A1L A;  2EN2 A;  1YSA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...