2EM6A

Solution structure of the c2h2 type zinc finger (region 199-231) of human zinc finger protein 224
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 199-231) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em6A01
1X3CA 2EOXA 2EOMA 2EE8A 2YTFA 2YSOA 1TN9A 2GLIA 3EPKA 2DLQA 2EMAA 2EN6A 1G2FC 2EMXA 2EN7A 2EOHA 2VRDA 1TF6A 2CT1A 2EQ3A 2RPCA 2EP3A 2EQ1A 2YTOA 3MHSC 1UBDC 2EOFA 2EM8A 2EPRA 2EMCA 1ZR9A 2EMYA 2ENCA 1DGCA 4M9VC 1X5WA 2EOEA 2YTIA 1YUIA 2EM2A 1ZU1A 1A1IA 2EPPA 1LLMC 4R2RA 2EM0A 1JK2A 1X6HA 2EOZA 1UN6B 4FK5C 2EPCA 2EOOA 2CSHA 4WSGA 2NABA 4GZNC 2EM7A 2EMFA 1AAYA 2LVHA 2PRTA 1G2DC 2YRHA 2DRPA 5KL5A 4R2EA 3EPJA 1A1GA 2EL4A 4IS1C 2DGCA 2YRMA 1TF3A 2MDGA 2EMZA 2EN8A 2EPUA 2EOSA 1WJPA 2CTDA 2ADRA 2EPZA 2YRKA 5KL4A 2EMLA 2JP9A 5KL3A 2D9HA 2EMKA 2M9AA 3EPHA 2EMGA 2A25A 2R1FA 2LV2A 4F2JC 4R2QA 1A1JA 2BB8A 1X6EA 2ELYA 2EMIA 2GHFA 2WBTA 2EMHA 2WCC3 3UK3C 2JPAA 2ELZA 4X9JA 2EM3A 1A1FA 2DMIA 2EJ4A 2LCEA 2LO3A 1YSAC 2I13A 2MKNA 5KL6A 3VHTB 2EM4A 2WBUA 1NCSA 2EOJA 2EL6A 2EOYA 2EMWA 2EN1A 4R2CA 2ENAA 2YTGA 2EM9A 3MHHC 1A1KA 1A1HA 2LT7A 1MEYC 2EORA 2YSPA 2YTNA 2YU8A 2EQ0A 2YTQA 2EL5A 2EOIA 2EN2A 2YU5A 4IJDA 2J7JA 1Z1BA 2EN3A 1A1LA 2MKDA 4R2AA 1X6FA 2RSIA 4R2PA 2DLKA 1BB8A 2E72A 2YTJA 2EM6A 2ENHA 2EPAA 4F6MA 5KL2A 1F2IG 1YUJA 5KL7A 2HGHA 1RMDA 1BBOA 2EN4A 4R2SA 2YTEA 2EOQA 4F6NA 1JK1A 4R2DA 2YTDA 2YTPA 1ZAAC 2EMBA 3M99B 3EPLA 1B69A 2EM5A 1P47A 2WBSA 1KJKA 2EPXA
chains in the Genus database with same CATH superfamily
2EOMA 3J7AG 4DMIA 4R8OA 3IWDA 4NZVA 4DR6E 2YWQA 1UILA 2YSOA 1TN9A 3VK6A 2DLQA 3DJWA 4F9BB 1WHNA 2EMAA 2EMXA 2EQ3A 2EQ1A 3MHSC 3EQ1A 4JI8E 4LF5E 2V83A 2EOFA 2UUCE 3LMLA 2EMYA 5AE3A 2ENCA 4M9VC 4RHBB 2EPNA 1YUIA 4N4RB 1PDAA 4LF4E 3VYXA 1PJQA 4R2RA 2EOZA 4LTYA 1UN6B 1EH6A 4FK5C 5AC5A 2EOOA 2CSHA 5IWAE 1AAYA 2DRPA 1PJSA 5KL5A 3OMLA 3EPJA 1A1GA 4DR7E 4IS1C 2YRMA 2EPKX 3P1XA 2EMZA 4B3RE 2EOSA 3RMPA 3AUZA 1N34E 2EPZA 2YPNA 4BC7A 4LFBE 1MGTA 2NA2A 2EMKA 1EH8A 4X64E 2HJJA 2VE7C 4F9AB 2LV2A 1A1JA 1XMQE 5TSEA 2ELYA 2WCC3 1J26A 4HEIA 3HTXA 2EM3A 2EJ4A 2L8TA 5IXMB 1J5EE 3C4TA 1SFEA 2LCEA 4LU9A 2K7IA 4JI1E 2FGGA 3VHTB 2LJUA 4DR3E 2WBUA 2EOJA 2EL6A 3K6QA 1YZ9A 2YTGA 4GKKE 1A1HA 4KZSA 1QU6A 2RSMA 3F6GA 2LT7A 2F4VE 3T1HE 2ZM6E 4DV3E 2YTQA 2EOIA 4IJDA 4NXME 3TQMA 3QG5C 1XNQE 2JWOA 4BS9A 1WRJA 2V85A 2EPLX 4K0KE 2L6MA 3KZZA 1BB8A 1T4OA 2ENHA 5AE1A 2VQFE 3ADIA 1BBOA 2KOUA 2IHR1 3BIDA 2MC5A 2I9IA 2LUQA 4DV0E 2FTXB 1ZAAC 3EPLA 4B3ME 1EKZA 3ZOQB 1L4SA 1QNTA 3MSWA 4I8OA 4JYAE 2EOXA 1T38A 5IV8B 5LMNE 3OTOE 1FKAE 3THOB 4DV4E 2LRSA 2EN7A 5A6BA 5ADZA 3VYYA 5LLQA 2EM8A 5A2QC 2KONA 4X66E 2MDRA 4M0VA 2G7HA 4OX9E 2EOEA 2YTIA 1N33E 1GQEA 1A1IA 1ZBTA 2EPPA 5IT9C 4KWYA 2EM0A 2UXDE 1KYQA 2EPCA 4DR1E 4DUYE 2EM7A 1X47A 2M1SA 2V89A 4WYQB 2EL4A 2E1MA 1DQ3A 2KHXA 2EWLA 4NXNE 3AV0A 1IBKE 2CTDA 4LFAE 4JI4E 2DMYA 2YT4A 5FLXC 2JYAA 2A25A 1X48A 4HTGA 2EMIA 1X6EA 4DV1E 2LE2A 2F8BA 5AE2A 2EPMX 3UK3C 3BGHA 1A1FA 2DMIA 1XMOE 2LJHA 2UU9E 2L92A 4YHHE 1X49A 1RC7A 2EM4A 4JV5E 4B3SE 3ECRA 1BBGA 2DB2A 2ENAA 2ODRC 3JAMC 3DF6A 4TUIA 3THNA 1MEYC 3HPZA 2YTNA 1HNXE 2EN2A 2J7JA 2FV4B 4BHCA 3L00A 3IWBA 3C6KA 2EZ6A 1X6FA 4R2PA 1T39A 1IQSA 3J80C 2MC6A 4WX9A 2E72A 2RQLA 1O0WA 2V8QB 4JI6E 4YY3E 2JOXA 2LBSB 2JR1A 4X8WA 1RMDA 2L2KB 4MLQA 4F6NA 3F6HA 2VF1A 2UXCE 1B69A 4LFCE 3BF2A 2LTSA 1KJKA 2EPXA 4O43A 2V86A 2EPOA 1YPNA 2YTFA 4Q28A 1IBLE 2GLIA 1WHQA 1N32E 3EPKA 2M4IA 1HR0E 2B3TB 2GPIA 4DR4E 3C6MA 1UBDC 2EPRA 2EMCA 2LUPB 4WPYA 3ADJA 4X65E 1X5WA 4DV5E 2L2NA 1PJTA 2EM2A 1ZU1A 1T4NA 2Q8UA 4DV6E 1X6HA 1RQ0A 5LL6R 1ZBQA 4WSGA 4GZNC 5A6KA 2UUBE 3BBGA 1G2DC 2YRHA 4Q35B 4JI5E 4R2EA 1IMUA 2DGCA 1TF3A 2B7VA 2EN8A 2EPUA 3JU0A 4LF8E 2HC5A 4DKKA 2JP9A 2D9HA 4ZYHA 2EMGA 4R2QA 3ADLA 2WBTA 2EMHA 2UXBE 5T6JA 4WFTA 3H09A 2LO3A 2L2MA 2MKNA 2JXPA 1HNWE 5A6JA 2EOYA 1IBME 2EMWA 2EM9A 2EORA 2NUGA 2YSPA 2YU8A 1XNRE 2EL5A 2YU5A 5DNYA 1Z1BA 4DV7E 1A1LA 2MKDA 4R2AA 1WXRA 2DLKA 4X62E 2DSYA 4AQYE 4BCAA 3LLHA 2K4VA 4TUGA 4B3TE 1F2IG 5KL7A 4R2SA 4ZYGA 4RH8A 2EOQA 1DI2A 3JTZA 2YTPA 2EMBA 2E5LE 2WZOA 1YYWA 4F9CB 2RTXA 4P78A 4JI7E 2RS7A 2M7QA 1X3CA 1NEIA 1YFHA 2EE8A 3KZYA 4L8NA 2EN6A 3HXLA 4L5NC 2VRDA 2EOHA 1G2FC 1TF6A 2CT1A 2RPCA 2EP3A 2V87A 4DV2E 2YTOA 2YZTA 4MLVA 2DIXA 5A6BD 4J8ZA 1ZR9A 1N3GA 1DGCA 4O24A 4DR5E 1LLMC 2N3HA 2H36X 4BHBA 1STUA 4O5GA 1JK2A 2JOBA 2L33A 5A6AA 5F3WA 1HNZE 1T4LB 2NABA 3ADGA 2LMZA 4P7DA 4JI0E 2EMFA 2LVHA 2PRTA 1GZ6A 1PKPA 2LTRA 1N36E 4LF9E 1I94E 2B7TA 2MDGA 1IQOA 1YYOA 3IWCA 2BBGA 1WJPA 3KWRA 2HHHE 3J7Yp 4GKJE 5AASA 2ADRA 2YRKA 5KL4A 2EMLA 5KL3A 4R03A 2RS6A 4ZYDA 4M2ZA 3J81C 2M9AA 3EPHA 2CPNA 2R1FA 2R76A 4F2JC 1YYKA 2BB8A 4KHPE 2GHFA 4WSPA 4BMJA 2JY9A 2JPAA 2ELZA 4F54A 4X9JA 4DR2E 1AH5A 1YSAC 5BR8E 2NUFA 2I13A 5KL6A 4LF7E 4ZYEA 1NCSA 1UHZA 2EN1A 4R2CA 3HQ1A 1A1KA 3MHHC 4WXDA 4NHRA 3HPSA 2NUEA 2EQ0A 4JI3E 4GEQB 5AC4A 2EN3A 3FIGA 4JI2E 3T1YE 2N3GA 1EH7A 4WXCA 2RSIA 4BC9A 4LF6E 1GTKA 2YTJA 4O4KA 4BBYA 2EM6A 2V88A 1FJGE 2EPAA 4F6MA 5KL2A 2UUAE 2JVAA 1YUJA 2ODRD 4M30A 2HGHA 2L3CA 5LMUE 2EN4A 3C4BA 2YTEA 1JK1A 4R2DA 2VQEE 2YTDA 4DUZE 4OOGC 3M99B 2N8XA 5CFFE 2EM5A 1P47A 5A69A 2WBSA 2B9DA 2L3JA 1SR9A
chains in the Genus database with same CATH topology
1X3CA 2EOXA 2EOMA 2EE8A 2YTFA 2YSOA 1TN9A 2GLIA 3EPKA 2DLQA 2EMAA 2EN6A 1G2FC 2EMXA 2EN7A 2EOHA 2VRDA 1TF6A 2CT1A 2EQ3A 2RPCA 2EP3A 2EQ1A 2YTOA 3MHSC 1UBDC 2EOFA 2EM8A 2EPRA 2EMCA 1ZR9A 2EMYA 2ENCA 1DGCA 4M9VC 1X5WA 2EOEA 2YTIA 1YUIA 2EM2A 1ZU1A 1A1IA 2EPPA 1LLMC 4R2RA 2EM0A 1JK2A 1X6HA 2EOZA 1UN6B 4FK5C 2EPCA 2EOOA 2CSHA 4WSGA 2NABA 4GZNC 2EM7A 2EMFA 1AAYA 2LVHA 2PRTA 1G2DC 2YRHA 2DRPA 5KL5A 4R2EA 3EPJA 1A1GA 2EL4A 4IS1C 2DGCA 2YRMA 1TF3A 2MDGA 2EMZA 2EN8A 2EPUA 2EOSA 1WJPA 2CTDA 2ADRA 2EPZA 2YRKA 5KL4A 2EMLA 2JP9A 5KL3A 2D9HA 2EMKA 2M9AA 3EPHA 2EMGA 2A25A 2R1FA 2LV2A 4F2JC 4R2QA 1A1JA 2BB8A 1X6EA 2ELYA 2EMIA 2GHFA 2WBTA 2EMHA 2WCC3 3UK3C 2JPAA 2ELZA 4X9JA 2EM3A 1A1FA 2DMIA 2EJ4A 2LCEA 2LO3A 1YSAC 2I13A 2MKNA 5KL6A 3VHTB 2EM4A 2WBUA 1NCSA 2EOJA 2EL6A 2EOYA 2EMWA 2EN1A 4R2CA 2ENAA 2YTGA 2EM9A 3MHHC 1A1KA 1A1HA 2LT7A 1MEYC 2EORA 2YSPA 2YTNA 2YU8A 2EQ0A 2YTQA 2EL5A 2EOIA 2EN2A 2YU5A 4IJDA 2J7JA 1Z1BA 2EN3A 1A1LA 2MKDA 4R2AA 1X6FA 2RSIA 4R2PA 2DLKA 1BB8A 2E72A 2YTJA 2EM6A 2ENHA 2EPAA 4F6MA 5KL2A 1F2IG 1YUJA 5KL7A 2HGHA 1RMDA 1BBOA 2EN4A 4R2SA 2YTEA 2EOQA 4F6NA 1JK1A 4R2DA 2YTDA 2YTPA 1ZAAC 2EMBA 3M99B 3EPLA 1B69A 2EM5A 1P47A 2WBSA 1KJKA 2EPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  2EOX A;  2EOM A;  2EE8 A;  2YTF A;  2YSO A;  1TN9 A;  2GLI A;  3EPK A;  2DLQ A;  2EMA A;  2EN6 A;  1G2F C;  2EMX A;  2EN7 A;  2EOH A;  2VRD A;  1TF6 A;  2CT1 A;  2EQ3 A;  2RPC A;  2EP3 A;  2EQ1 A;  2YTO A;  3MHS C;  1UBD C;  2EOF A;  2EM8 A;  2EPR A;  2EMC A;  1ZR9 A;  2EMY A;  2ENC A;  1DGC A;  4M9V C;  1X5W A;  2EOE A;  2YTI A;  1YUI A;  2EM2 A;  1ZU1 A;  1A1I A;  2EPP A;  1LLM C;  4R2R A;  2EM0 A;  1JK2 A;  1X6H A;  2EOZ A;  1UN6 B;  4FK5 C;  2EPC A;  2EOO A;  2CSH A;  4WSG A;  2NAB A;  4GZN C;  2EM7 A;  2EMF A;  1AAY A;  2LVH A;  2PRT A;  1G2D C;  2YRH A;  2DRP A;  5KL5 A;  4R2E A;  3EPJ A;  1A1G A;  2EL4 A;  4IS1 C;  2DGC A;  2YRM A;  1TF3 A;  2MDG A;  2EMZ A;  2EN8 A;  2EPU A;  2EOS A;  1WJP A;  2CTD A;  2ADR A;  2EPZ A;  2YRK A;  5KL4 A;  2EML A;  2JP9 A;  5KL3 A;  2D9H A;  2EMK A;  2M9A A;  3EPH A;  2EMG A;  2A25 A;  2R1F A;  2LV2 A;  4F2J C;  4R2Q A;  1A1J A;  2BB8 A;  1X6E A;  2ELY A;  2EMI A;  2GHF A;  2WBT A;  2EMH A;  2WCC 3;  3UK3 C;  2JPA A;  2ELZ A;  4X9J A;  2EM3 A;  1A1F A;  2DMI A;  2EJ4 A;  2LCE A;  2LO3 A;  1YSA C;  2I13 A;  2MKN A;  5KL6 A;  3VHT B;  2EM4 A;  2WBU A;  1NCS A;  2EOJ A;  2EL6 A;  2EOY A;  2EMW A;  2EN1 A;  4R2C A;  2ENA A;  2YTG A;  2EM9 A;  3MHH C;  1A1K A;  1A1H A;  2LT7 A;  1MEY C;  2EOR A;  2YSP A;  2YTN A;  2YU8 A;  2EQ0 A;  2YTQ A;  2EL5 A;  2EOI A;  2EN2 A;  2YU5 A;  4IJD A;  2J7J A;  1Z1B A;  2EN3 A;  1A1L A;  2MKD A;  4R2A A;  1X6F A;  2RSI A;  4R2P A;  2DLK A;  1BB8 A;  2E72 A;  2YTJ A;  2EM6 A;  2ENH A;  2EPA A;  4F6M A;  5KL2 A;  1F2I G;  1YUJ A;  5KL7 A;  2HGH A;  1RMD A;  1BBO A;  2EN4 A;  4R2S A;  2YTE A;  2EOQ A;  4F6N A;  1JK1 A;  4R2D A;  2YTD A;  2YTP A;  1ZAA C;  2EMB A;  3M99 B;  3EPL A;  1B69 A;  2EM5 A;  1P47 A;  2WBS A;  1KJK A;  2EPX A; 
#chains in the Genus database with same CATH topology
 2EOM A;  3J7A G;  4DMI A;  4R8O A;  3IWD A;  4NZV A;  4DR6 E;  2YWQ A;  1UIL A;  2YSO A;  1TN9 A;  3VK6 A;  2DLQ A;  3DJW A;  4F9B B;  1WHN A;  2EMA A;  2EMX A;  2EQ3 A;  2EQ1 A;  3MHS C;  3EQ1 A;  4JI8 E;  4LF5 E;  2V83 A;  2EOF A;  2UUC E;  3LML A;  2EMY A;  5AE3 A;  2ENC A;  4M9V C;  4RHB B;  2EPN A;  1YUI A;  4N4R B;  1PDA A;  4LF4 E;  3VYX A;  1PJQ A;  4R2R A;  2EOZ A;  4LTY A;  1UN6 B;  1EH6 A;  4FK5 C;  5AC5 A;  2EOO A;  2CSH A;  5IWA E;  1AAY A;  2DRP A;  1PJS A;  5KL5 A;  3OML A;  3EPJ A;  1A1G A;  4DR7 E;  4IS1 C;  2YRM A;  2EPK X;  3P1X A;  2EMZ A;  4B3R E;  2EOS A;  3RMP A;  3AUZ A;  1N34 E;  2EPZ A;  2YPN A;  4BC7 A;  4LFB E;  1MGT A;  2NA2 A;  2EMK A;  1EH8 A;  4X64 E;  2HJJ A;  2VE7 C;  4F9A B;  2LV2 A;  1A1J A;  1XMQ E;  5TSE A;  2ELY A;  2WCC 3;  1J26 A;  4HEI A;  3HTX A;  2EM3 A;  2EJ4 A;  2L8T A;  5IXM B;  1J5E E;  3C4T A;  1SFE A;  2LCE A;  4LU9 A;  2K7I A;  4JI1 E;  2FGG A;  3VHT B;  2LJU A;  4DR3 E;  2WBU A;  2EOJ A;  2EL6 A;  3K6Q A;  1YZ9 A;  2YTG A;  4GKK E;  1A1H A;  4KZS A;  1QU6 A;  2RSM A;  3F6G A;  2LT7 A;  2F4V E;  3T1H E;  2ZM6 E;  4DV3 E;  2YTQ A;  2EOI A;  4IJD A;  4NXM E;  3TQM A;  3QG5 C;  1XNQ E;  2JWO A;  4BS9 A;  1WRJ A;  2V85 A;  2EPL X;  4K0K E;  2L6M A;  3KZZ A;  1BB8 A;  1T4O A;  2ENH A;  5AE1 A;  2VQF E;  3ADI A;  1BBO A;  2KOU A;  2IHR 1;  3BID A;  2MC5 A;  2I9I A;  2LUQ A;  4DV0 E;  2FTX B;  1ZAA C;  3EPL A;  4B3M E;  1EKZ A;  3ZOQ B;  1L4S A;  1QNT A;  3MSW A;  4I8O A;  4JYA E;  2EOX A;  1T38 A;  5IV8 B;  5LMN E;  3OTO E;  1FKA E;  3THO B;  4DV4 E;  2LRS A;  2EN7 A;  5A6B A;  5ADZ A;  3VYY A;  5LLQ A;  2EM8 A;  5A2Q C;  2KON A;  4X66 E;  2MDR A;  4M0V A;  2G7H A;  4OX9 E;  2EOE A;  2YTI A;  1N33 E;  1GQE A;  1A1I A;  1ZBT A;  2EPP A;  5IT9 C;  4KWY A;  2EM0 A;  2UXD E;  1KYQ A;  2EPC A;  4DR1 E;  4DUY E;  2EM7 A;  1X47 A;  2M1S A;  2V89 A;  4WYQ B;  2EL4 A;  2E1M A;  1DQ3 A;  2KHX A;  2EWL A;  4NXN E;  3AV0 A;  1IBK E;  2CTD A;  4LFA E;  4JI4 E;  2DMY A;  2YT4 A;  5FLX C;  2JYA A;  2A25 A;  1X48 A;  4HTG A;  2EMI A;  1X6E A;  4DV1 E;  2LE2 A;  2F8B A;  5AE2 A;  2EPM X;  3UK3 C;  3BGH A;  1A1F A;  2DMI A;  1XMO E;  2LJH A;  2UU9 E;  2L92 A;  4YHH E;  1X49 A;  1RC7 A;  2EM4 A;  4JV5 E;  4B3S E;  3ECR A;  1BBG A;  2DB2 A;  2ENA A;  2ODR C;  3JAM C;  3DF6 A;  4TUI A;  3THN A;  1MEY C;  3HPZ A;  2YTN A;  1HNX E;  2EN2 A;  2J7J A;  2FV4 B;  4BHC A;  3L00 A;  3IWB A;  3C6K A;  2EZ6 A;  1X6F A;  4R2P A;  1T39 A;  1IQS A;  3J80 C;  2MC6 A;  4WX9 A;  2E72 A;  2RQL A;  1O0W A;  2V8Q B;  4JI6 E;  4YY3 E;  2JOX A;  2LBS B;  2JR1 A;  4X8W A;  1RMD A;  2L2K B;  4MLQ A;  4F6N A;  3F6H A;  2VF1 A;  2UXC E;  1B69 A;  4LFC E;  3BF2 A;  2LTS A;  1KJK A;  2EPX A;  4O43 A;  2V86 A;  2EPO A;  1YPN A;  2YTF A;  4Q28 A;  1IBL E;  2GLI A;  1WHQ A;  1N32 E;  3EPK A;  2M4I A;  1HR0 E;  2B3T B;  2GPI A;  4DR4 E;  3C6M A;  1UBD C;  2EPR A;  2EMC A;  2LUP B;  4WPY A;  3ADJ A;  4X65 E;  1X5W A;  4DV5 E;  2L2N A;  1PJT A;  2EM2 A;  1ZU1 A;  1T4N A;  2Q8U A;  4DV6 E;  1X6H A;  1RQ0 A;  5LL6 R;  1ZBQ A;  4WSG A;  4GZN C;  5A6K A;  2UUB E;  3BBG A;  1G2D C;  2YRH A;  4Q35 B;  4JI5 E;  4R2E A;  1IMU A;  2DGC A;  1TF3 A;  2B7V A;  2EN8 A;  2EPU A;  3JU0 A;  4LF8 E;  2HC5 A;  4DKK A;  2JP9 A;  2D9H A;  4ZYH A;  2EMG A;  4R2Q A;  3ADL A;  2WBT A;  2EMH A;  2UXB E;  5T6J A;  4WFT A;  3H09 A;  2LO3 A;  2L2M A;  2MKN A;  2JXP A;  1HNW E;  5A6J A;  2EOY A;  1IBM E;  2EMW A;  2EM9 A;  2EOR A;  2NUG A;  2YSP A;  2YU8 A;  1XNR E;  2EL5 A;  2YU5 A;  5DNY A;  1Z1B A;  4DV7 E;  1A1L A;  2MKD A;  4R2A A;  1WXR A;  2DLK A;  4X62 E;  2DSY A;  4AQY E;  4BCA A;  3LLH A;  2K4V A;  4TUG A;  4B3T E;  1F2I G;  5KL7 A;  4R2S A;  4ZYG A;  4RH8 A;  2EOQ A;  1DI2 A;  3JTZ A;  2YTP A;  2EMB A;  2E5L E;  2WZO A;  1YYW A;  4F9C B;  2RTX A;  4P78 A;  4JI7 E;  2RS7 A;  2M7Q A;  1X3C A;  1NEI A;  1YFH A;  2EE8 A;  3KZY A;  4L8N A;  2EN6 A;  3HXL A;  4L5N C;  2VRD A;  2EOH A;  1G2F C;  1TF6 A;  2CT1 A;  2RPC A;  2EP3 A;  2V87 A;  4DV2 E;  2YTO A;  2YZT A;  4MLV A;  2DIX A;  5A6B D;  4J8Z A;  1ZR9 A;  1N3G A;  1DGC A;  4O24 A;  4DR5 E;  1LLM C;  2N3H A;  2H36 X;  4BHB A;  1STU A;  4O5G A;  1JK2 A;  2JOB A;  2L33 A;  5A6A A;  5F3W A;  1HNZ E;  1T4L B;  2NAB A;  3ADG A;  2LMZ A;  4P7D A;  4JI0 E;  2EMF A;  2LVH A;  2PRT A;  1GZ6 A;  1PKP A;  2LTR A;  1N36 E;  4LF9 E;  1I94 E;  2B7T A;  2MDG A;  1IQO A;  1YYO A;  3IWC A;  2BBG A;  1WJP A;  3KWR A;  2HHH E;  3J7Y p;  4GKJ E;  5AAS A;  2ADR A;  2YRK A;  5KL4 A;  2EML A;  5KL3 A;  4R03 A;  2RS6 A;  4ZYD A;  4M2Z A;  3J81 C;  2M9A A;  3EPH A;  2CPN A;  2R1F A;  2R76 A;  4F2J C;  1YYK A;  2BB8 A;  4KHP E;  2GHF A;  4WSP A;  4BMJ A;  2JY9 A;  2JPA A;  2ELZ A;  4F54 A;  4X9J A;  4DR2 E;  1AH5 A;  1YSA C;  5BR8 E;  2NUF A;  2I13 A;  5KL6 A;  4LF7 E;  4ZYE A;  1NCS A;  1UHZ A;  2EN1 A;  4R2C A;  3HQ1 A;  1A1K A;  3MHH C;  4WXD A;  4NHR A;  3HPS A;  2NUE A;  2EQ0 A;  4JI3 E;  4GEQ B;  5AC4 A;  2EN3 A;  3FIG A;  4JI2 E;  3T1Y E;  2N3G A;  1EH7 A;  4WXC A;  2RSI A;  4BC9 A;  4LF6 E;  1GTK A;  2YTJ A;  4O4K A;  4BBY A;  2EM6 A;  2V88 A;  1FJG E;  2EPA A;  4F6M A;  5KL2 A;  2UUA E;  2JVA A;  1YUJ A;  2ODR D;  4M30 A;  2HGH A;  2L3C A;  5LMU E;  2EN4 A;  3C4B A;  2YTE A;  1JK1 A;  4R2D A;  2VQE E;  2YTD A;  4DUZ E;  4OOG C;  3M99 B;  2N8X A;  5CFF E;  2EM5 A;  1P47 A;  5A69 A;  2WBS A;  2B9D A;  2L3J A;  1SR9 A; 
#chains in the Genus database with same CATH homology
 1X3C A;  2EOX A;  2EOM A;  2EE8 A;  2YTF A;  2YSO A;  1TN9 A;  2GLI A;  3EPK A;  2DLQ A;  2EMA A;  2EN6 A;  1G2F C;  2EMX A;  2EN7 A;  2EOH A;  2VRD A;  1TF6 A;  2CT1 A;  2EQ3 A;  2RPC A;  2EP3 A;  2EQ1 A;  2YTO A;  3MHS C;  1UBD C;  2EOF A;  2EM8 A;  2EPR A;  2EMC A;  1ZR9 A;  2EMY A;  2ENC A;  1DGC A;  4M9V C;  1X5W A;  2EOE A;  2YTI A;  1YUI A;  2EM2 A;  1ZU1 A;  1A1I A;  2EPP A;  1LLM C;  4R2R A;  2EM0 A;  1JK2 A;  1X6H A;  2EOZ A;  1UN6 B;  4FK5 C;  2EPC A;  2EOO A;  2CSH A;  4WSG A;  2NAB A;  4GZN C;  2EM7 A;  2EMF A;  1AAY A;  2LVH A;  2PRT A;  1G2D C;  2YRH A;  2DRP A;  5KL5 A;  4R2E A;  3EPJ A;  1A1G A;  2EL4 A;  4IS1 C;  2DGC A;  2YRM A;  1TF3 A;  2MDG A;  2EMZ A;  2EN8 A;  2EPU A;  2EOS A;  1WJP A;  2CTD A;  2ADR A;  2EPZ A;  2YRK A;  5KL4 A;  2EML A;  2JP9 A;  5KL3 A;  2D9H A;  2EMK A;  2M9A A;  3EPH A;  2EMG A;  2A25 A;  2R1F A;  2LV2 A;  4F2J C;  4R2Q A;  1A1J A;  2BB8 A;  1X6E A;  2ELY A;  2EMI A;  2GHF A;  2WBT A;  2EMH A;  2WCC 3;  3UK3 C;  2JPA A;  2ELZ A;  4X9J A;  2EM3 A;  1A1F A;  2DMI A;  2EJ4 A;  2LCE A;  2LO3 A;  1YSA C;  2I13 A;  2MKN A;  5KL6 A;  3VHT B;  2EM4 A;  2WBU A;  1NCS A;  2EOJ A;  2EL6 A;  2EOY A;  2EMW A;  2EN1 A;  4R2C A;  2ENA A;  2YTG A;  2EM9 A;  3MHH C;  1A1K A;  1A1H A;  2LT7 A;  1MEY C;  2EOR A;  2YSP A;  2YTN A;  2YU8 A;  2EQ0 A;  2YTQ A;  2EL5 A;  2EOI A;  2EN2 A;  2YU5 A;  4IJD A;  2J7J A;  1Z1B A;  2EN3 A;  1A1L A;  2MKD A;  4R2A A;  1X6F A;  2RSI A;  4R2P A;  2DLK A;  1BB8 A;  2E72 A;  2YTJ A;  2EM6 A;  2ENH A;  2EPA A;  4F6M A;  5KL2 A;  1F2I G;  1YUJ A;  5KL7 A;  2HGH A;  1RMD A;  1BBO A;  2EN4 A;  4R2S A;  2YTE A;  2EOQ A;  4F6N A;  1JK1 A;  4R2D A;  2YTD A;  2YTP A;  1ZAA C;  2EMB A;  3M99 B;  3EPL A;  1B69 A;  2EM5 A;  1P47 A;  2WBS A;  1KJK A;  2EPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...