2EM6A

Solution structure of the c2h2 type zinc finger (region 199-231) of human zinc finger protein 224
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 199-231) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em6A01
2WCC3 1YUJA 2YTDA 4X9JA 1G2DC 1NCSA 2ELYA 2EMFA 2EN7A 2R1FA 3EPHA 2EL5A 2EMHA 2EM7A 2EOXA 2EOQA 2EOFA 2DMIA 2EMLA 2EPCA 4F6MA 2LCEA 2EQ3A 1ZU1A 1A1FA 2EOYA 5KL2A 2WBTA 2DLQA 2CTDA 1WJPA 1MEYC 2EPPA 2CSHA 2EMKA 1A1KA 2EMYA 2VRDA 2YTIA 4R2PA 1UBDC 1X6FA 1ZAAC 1P47A 4GZNC 2GLIA 2ENCA 1TF3A 2EOSA 2RSIA 3UK3C 4M9VC 4IJDA 2YTGA 2EM3A 2EM4A 2EOOA 2D9HA 3M99B 2DLKA 2EM6A 4R2AA 3EPKA 2EQ0A 2YU5A 5KL4A 2M9AA 4IS1C 1A1LA 1TN9A 2EN1A 2ELZA 4R2RA 2LT7A 2EMIA 2JPAA 1X5WA 2EPAA 2YTEA 2EOJA 1G2FC 1X6HA 1YUIA 1F2IG 3EPLA 1TF6A 2EN3A 2YTNA 2DRPA 1KJKA 1BB8A 2EOEA 3MHSC 2HGHA 4R2DA 2YU8A 2NABA 2EQ1A 3MHHC 2EPRA 1A1JA 2MKDA 2DGCA 2YTOA 2EMXA 1DGCA 2MDGA 1B69A 2EPZA 1ZR9A 2EMCA 3EPJA 2EMGA 2ENAA 2EPXA 2LV2A 4R2CA 1X6EA 2EOHA 4R2QA 4FK5C 2EE8A 2EP3A 2JP9A 5KL6A 2WBSA 2EN2A 1A1IA 2YTQA 1LLMC 2EJ4A 2CT1A 2EOIA 2YSOA 1JK1A 2YRMA 1YSAC 2EOZA 2E72A 5KL5A 1A1GA 2EL6A 2LO3A 2EM9A 2EM8A 2EN4A 4F6NA 2EMAA 1RMDA 2YTJA 2EOMA 1BBOA 2EM2A 2EM5A 2EMZA 5KL3A 2EMWA 2MKNA 2BB8A 4R2EA 2ENHA 2YSPA 2PRTA 1Z1BA 2ADRA 2A25A 2EPUA 2YTFA 3VHTB 2WBUA 1UN6B 2EL4A 2YRHA 2YTPA 4WSGA 2I13A 2RPCA 1X3CA 2EN8A 4R2SA 4F2JC 2EMBA 5KL7A 2EM0A 2LVHA 2EN6A 2EORA 2J7JA 1A1HA 1AAYA 2GHFA 1JK2A 2YRKA
chains in the Genus database with same CATH superfamily
2DMYA 5FLXC 3VYXA 2JOBA 1T39A 3JU0A 4ZYDA 4Q28A 2EL5A 1WRJA 4O43A 2EOFA 2V89A 2EMLA 3MSWA 2NUEA 1HNWE 4HEIA 2UU9E 2EOYA 2L3JA 4DUZE 2L2KB 1WJPA 3JAMC 4DR4E 2CSHA 2EMKA 2EMYA 3ADJA 4R2PA 1YYOA 1X6FA 1P47A 2B9DA 1TF3A 1L4SA 2EOSA 2FV4B 2JY9A 1WHQA 2JOXA 4M9VC 2I9IA 2G7HA 2YTGA 4AQYE 1YYWA 1DQ3A 2NA2A 1IMUA 1GQEA 5AE1A 4JI8E 1X48A 2YT4A 4JI3E 2GPIA 2M7QA 2JPAA 4LFBE 4DV0E 4WYQB 3EPLA 2DRPA 1KJKA 4OX9E 3IWBA 3HXLA 2EOEA 4DR7E 4R2DA 2YU8A 1NEIA 2EPRA 4DR1E 4R8OA 3FIGA 2MDGA 2UUCE 1ZR9A 2EMCA 3EPJA 3ECRA 2L6MA 2KOUA 2JP9A 3P1XA 2YTQA 4WSPA 1LLMC 2CT1A 1JK1A 1YSAC 5T6JA 5DNYA 2LUQA 4DUYE 2ODRD 1XNQE 1EKZA 3THNA 2EN4A 2HC5A 1RMDA 2EM2A 2IHR1 4O5GA 1ZBTA 2EMWA 2FTXB 4R2EA 4DR5E 2PRTA 1Z1BA 4LF5E 2YTFA 3VHTB 1PKPA 2MC5A 1FJGE 4F9AB 4WSGA 4DMIA 2RS6A 1X3CA 2V87A 4LU9A 3HQ1A 3BBGA 5KL7A 2UUAE 1YYKA 4JYAE 2JR1A 2EN6A 3IWCA 1BBGA 1JK2A 4M30A 2YRKA 2Q8UA 2WCC3 2L2MA 1YUJA 5AC5A 2YTDA 4X9JA 2UXDE 4B3SE 2MC6A 2EN7A 2R1FA 2EM7A 4WFTA 4F6MA 2EPCA 2EQ3A 1YFHA 1A1FA 4WPYA 3F6HA 1QU6A 4LF9E 2V88A 3OTOE 2DLQA 4F54A 3C4TA 5IXMB 2JWOA 4ZYEA 2VRDA 5CFFE 1UBDC 1IBME 2EZ6A 4DV7E 1EH7A 3C6MA 2RSIA 2LE2A 2N3HA 1RQ0A 3H09A 3VYYA 2D9HA 2DLKA 4LFCE 2RQLA 3AUZA 5A2QC 3KWRA 2EPMX 4NXME 1I94E 2V8QB 2M9AA 3T1HE 4O4KA 1TN9A 4R2RA 4NXNE 3AV0A 2EPAA 1UHZA 1GTKA 3ADGA 1G2FC 1X6HA 4KZSA 1T38A 4Q35B 4DV2E 1TF6A 2EN3A 1PJSA 4P7DA 5A6BD 2EPOA 4M0VA 2HGHA 1DI2A 2EQ1A 4WXCA 2MKDA 2DGCA 4X65E 4ZYGA 5AASA 2UXBE 2M1SA 1HR0E 3DF6A 4KWYA 2EMGA 1IQSA 4R2CA 1X6EA 2EOHA 5AE2A 4R2QA 1YZ9A 4BMJA 2EP3A 4DV4E 2N3GA 4RHBB 3KZYA 2EJ4A 2YRMA 4DV5E 4DV3E 3C6KA 2B7VA 4JI0E 3OMLA 2EMAA 1BBOA 2EOMA 4JI2E 2EMZA 4YY3E 2MKNA 2E1MA 2BB8A 2ENHA 2YSPA 2ZM6E 2F8BA 2A25A 2EPUA 4HTGA 2WBUA 4BCAA 1UN6B 3L00A 2EL4A 2I13A 2RSMA 4JI1E 2RPCA 3LLHA 2L8TA 2EM0A 2EPLX 2EPKX 2VQEE 1UILA 2WZOA 1A1HA 2GHFA 2VQFE 4X8WA 4O24A 4X62E 3J7Yp 4M2ZA 2YPNA 4TUIA 2BBGA 2EMFA 4L5NC 3EPHA 2EMHA 2EOQA 4YHHE 2ODRC 5A6KA 2LCEA 2K7IA 3BF2A 2KONA 2YWQA 5A6BA 5A6AA 2DSYA 2WBTA 5KL2A 4X66E 4TUGA 2L33A 5IV8B 1N3GA 1EH8A 1A1KA 2E5LE 2LBSB 4JV5E 2YTIA 1WXRA 4WXDA 4GKKE 3THOB 3DJWA 3QG5C 3HTXA 1N36E 3UK3C 4IJDA 2EM3A 2EOOA 2UXCE 1X49A 2MDRA 2HJJA 3M99B 2NUGA 3C4BA 4R2AA 3EPKA 1O0WA 1T4LB 1N34E 4MLVA 2YU5A 5KL4A 1A1LA 4JI4E 4KHPE 2EN1A 2ELZA 4RH8A 4BHCA 1T4OA 1PJQA 1PDAA 1IBKE 2EMIA 2YTEA 2F4VE 1YUIA 1F2IG 2KHXA 2YTNA 1N33E 2RS7A 1BB8A 4BC9A 2LTSA 1IBLE 1HNZE 5IWAE 4ZYHA 2DIXA 5A69A 1A1JA 2L2NA 3RMPA 4F9CB 2DB2A 3J81C 1RC7A 2EPXA 4NHRA 2LV2A 4P78A 4R03A 5LLQA 5KL6A 4DR2E 2EN2A 5LL6R 5A6JA 2L3CA 2JVAA 2EOIA 2YSOA 2EOZA 2E72A 5KL5A 2LJUA 3F6GA 4DR3E 1A1GA 4WX9A 1T4NA 2LO3A 2EM9A 3EQ1A 4B3ME 2YTJA 4BS9A 1X47A 5IT9C 2V86A 2EM5A 5KL3A 4LFAE 1J26A 4JI7E 1N32E 2B7TA 2YRHA 2FGGA 3IWDA 2LUPB 3KZZA 2EN8A 4BC7A 4R2SA 4JI6E 4L8NA 2LJHA 4GEQB 2EMBA 3TQMA 2EORA 4LTYA 4I8OA 2J7JA 1AAYA 1HNXE 3K6QA 2EWLA 2VE7C 4BHBA 1G2DC 3J7AG 1NCSA 2ELYA 4F9BB 2EOXA 2DMIA 5LMUE 1ZU1A 4DR6E 2CTDA 1MEYC 3VK6A 2EPPA 2JYAA 1SFEA 5F3WA 1ZAAC 4GZNC 2GLIA 2ENCA 5BR8E 1IQOA 1J5EE 5ADZA 4DV1E 1PJTA 2UUBE 2EM4A 4BBYA 4MLQA 1AH5A 2EM6A 1STUA 4LF7E 2EQ0A 3ZOQB 4IS1C 2V85A 3JTZA 4DV6E 2LT7A 3LMLA 1QNTA 1X5WA 2CPNA 2L92A 2EOJA 5TSEA 4LF4E 3T1YE 4X64E 2N8XA 2NUFA 3MHSC 2B3TB 2NABA 4LF6E 4B3RE 2K4VA 3MHHC 2YZTA 4J8ZA 2YTOA 1EH6A 2LTRA 2EMXA 2JXPA 3HPSA 1DGCA 1B69A 2EPZA 4JI5E 3HPZA 2ENAA 1KYQA 4FK5C 2EE8A 1XNRE 2R76A 2WBSA 1A1IA 4B3TE 4LF8E 2VF1A 3J80C 4K0KE 3ADIA 2EL6A 1GZ6A 3ADLA 4DKKA 2EM8A 3BIDA 4F6NA 1XMQE 1ZBQA 1YPNA 2M4IA 2LRSA 1XMOE 3BGHA 2ADRA 5LMNE 5AE3A 4N4RB 2YTPA 2EPNA 1SR9A 2H36X 1MGTA 1FKAE 4NZVA 4F2JC 1WHNA 5AC4A 2LMZA 2LVHA 2HHHE 4OOGC 2V83A 4GKJE 2RTXA
chains in the Genus database with same CATH topology
2WCC3 1YUJA 2YTDA 4X9JA 1G2DC 1NCSA 2ELYA 2EMFA 2EN7A 2R1FA 3EPHA 2EL5A 2EMHA 2EM7A 2EOXA 2EOQA 2EOFA 2DMIA 2EMLA 2EPCA 4F6MA 2LCEA 2EQ3A 1ZU1A 1A1FA 2EOYA 5KL2A 2WBTA 2DLQA 2CTDA 1WJPA 1MEYC 2EPPA 2CSHA 2EMKA 1A1KA 2EMYA 2VRDA 2YTIA 4R2PA 1UBDC 1X6FA 1ZAAC 1P47A 4GZNC 2GLIA 2ENCA 1TF3A 2EOSA 2RSIA 3UK3C 4M9VC 4IJDA 2YTGA 2EM3A 2EM4A 2EOOA 2D9HA 3M99B 2DLKA 2EM6A 4R2AA 3EPKA 2EQ0A 2YU5A 5KL4A 2M9AA 4IS1C 1A1LA 1TN9A 2EN1A 2ELZA 4R2RA 2LT7A 2EMIA 2JPAA 1X5WA 2EPAA 2YTEA 2EOJA 1G2FC 1X6HA 1YUIA 1F2IG 3EPLA 1TF6A 2EN3A 2YTNA 2DRPA 1KJKA 1BB8A 2EOEA 3MHSC 2HGHA 4R2DA 2YU8A 2NABA 2EQ1A 3MHHC 2EPRA 1A1JA 2MKDA 2DGCA 2YTOA 2EMXA 1DGCA 2MDGA 1B69A 2EPZA 1ZR9A 2EMCA 3EPJA 2EMGA 2ENAA 2EPXA 2LV2A 4R2CA 1X6EA 2EOHA 4R2QA 4FK5C 2EE8A 2EP3A 2JP9A 5KL6A 2WBSA 2EN2A 1A1IA 2YTQA 1LLMC 2EJ4A 2CT1A 2EOIA 2YSOA 1JK1A 2YRMA 1YSAC 2EOZA 2E72A 5KL5A 1A1GA 2EL6A 2LO3A 2EM9A 2EM8A 2EN4A 4F6NA 2EMAA 1RMDA 2YTJA 2EOMA 1BBOA 2EM2A 2EM5A 2EMZA 5KL3A 2EMWA 2MKNA 2BB8A 4R2EA 2ENHA 2YSPA 2PRTA 1Z1BA 2ADRA 2A25A 2EPUA 2YTFA 3VHTB 2WBUA 1UN6B 2EL4A 2YRHA 2YTPA 4WSGA 2I13A 2RPCA 1X3CA 2EN8A 4R2SA 4F2JC 2EMBA 5KL7A 2EM0A 2LVHA 2EN6A 2EORA 2J7JA 1A1HA 1AAYA 2GHFA 1JK2A 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCC 3;  1YUJ A;  2YTD A;  4X9J A;  1G2D C;  1NCS A;  2ELY A;  2EMF A;  2EN7 A;  2R1F A;  3EPH A;  2EL5 A;  2EMH A;  2EM7 A;  2EOX A;  2EOQ A;  2EOF A;  2DMI A;  2EML A;  2EPC A;  4F6M A;  2LCE A;  2EQ3 A;  1ZU1 A;  1A1F A;  2EOY A;  5KL2 A;  2WBT A;  2DLQ A;  2CTD A;  1WJP A;  1MEY C;  2EPP A;  2CSH A;  2EMK A;  1A1K A;  2EMY A;  2VRD A;  2YTI A;  4R2P A;  1UBD C;  1X6F A;  1ZAA C;  1P47 A;  4GZN C;  2GLI A;  2ENC A;  1TF3 A;  2EOS A;  2RSI A;  3UK3 C;  4M9V C;  4IJD A;  2YTG A;  2EM3 A;  2EM4 A;  2EOO A;  2D9H A;  3M99 B;  2DLK A;  2EM6 A;  4R2A A;  3EPK A;  2EQ0 A;  2YU5 A;  5KL4 A;  2M9A A;  4IS1 C;  1A1L A;  1TN9 A;  2EN1 A;  2ELZ A;  4R2R A;  2LT7 A;  2EMI A;  2JPA A;  1X5W A;  2EPA A;  2YTE A;  2EOJ A;  1G2F C;  1X6H A;  1YUI A;  1F2I G;  3EPL A;  1TF6 A;  2EN3 A;  2YTN A;  2DRP A;  1KJK A;  1BB8 A;  2EOE A;  3MHS C;  2HGH A;  4R2D A;  2YU8 A;  2NAB A;  2EQ1 A;  3MHH C;  2EPR A;  1A1J A;  2MKD A;  2DGC A;  2YTO A;  2EMX A;  1DGC A;  2MDG A;  1B69 A;  2EPZ A;  1ZR9 A;  2EMC A;  3EPJ A;  2EMG A;  2ENA A;  2EPX A;  2LV2 A;  4R2C A;  1X6E A;  2EOH A;  4R2Q A;  4FK5 C;  2EE8 A;  2EP3 A;  2JP9 A;  5KL6 A;  2WBS A;  2EN2 A;  1A1I A;  2YTQ A;  1LLM C;  2EJ4 A;  2CT1 A;  2EOI A;  2YSO A;  1JK1 A;  2YRM A;  1YSA C;  2EOZ A;  2E72 A;  5KL5 A;  1A1G A;  2EL6 A;  2LO3 A;  2EM9 A;  2EM8 A;  2EN4 A;  4F6N A;  2EMA A;  1RMD A;  2YTJ A;  2EOM A;  1BBO A;  2EM2 A;  2EM5 A;  2EMZ A;  5KL3 A;  2EMW A;  2MKN A;  2BB8 A;  4R2E A;  2ENH A;  2YSP A;  2PRT A;  1Z1B A;  2ADR A;  2A25 A;  2EPU A;  2YTF A;  3VHT B;  2WBU A;  1UN6 B;  2EL4 A;  2YRH A;  2YTP A;  4WSG A;  2I13 A;  2RPC A;  1X3C A;  2EN8 A;  4R2S A;  4F2J C;  2EMB A;  5KL7 A;  2EM0 A;  2LVH A;  2EN6 A;  2EOR A;  2J7J A;  1A1H A;  1AAY A;  2GHF A;  1JK2 A;  2YRK A; 
#chains in the Genus database with same CATH topology
 2DMY A;  5FLX C;  3VYX A;  2JOB A;  1T39 A;  3JU0 A;  4ZYD A;  4Q28 A;  2EL5 A;  1WRJ A;  4O43 A;  2EOF A;  2V89 A;  2EML A;  3MSW A;  2NUE A;  1HNW E;  4HEI A;  2UU9 E;  2EOY A;  2L3J A;  4DUZ E;  2L2K B;  1WJP A;  3JAM C;  4DR4 E;  2CSH A;  2EMK A;  2EMY A;  3ADJ A;  4R2P A;  1YYO A;  1X6F A;  1P47 A;  2B9D A;  1TF3 A;  1L4S A;  2EOS A;  2FV4 B;  2JY9 A;  1WHQ A;  2JOX A;  4M9V C;  2I9I A;  2G7H A;  2YTG A;  4AQY E;  1YYW A;  1DQ3 A;  2NA2 A;  1IMU A;  1GQE A;  5AE1 A;  4JI8 E;  1X48 A;  2YT4 A;  4JI3 E;  2GPI A;  2M7Q A;  2JPA A;  4LFB E;  4DV0 E;  4WYQ B;  3EPL A;  2DRP A;  1KJK A;  4OX9 E;  3IWB A;  3HXL A;  2EOE A;  4DR7 E;  4R2D A;  2YU8 A;  1NEI A;  2EPR A;  4DR1 E;  4R8O A;  3FIG A;  2MDG A;  2UUC E;  1ZR9 A;  2EMC A;  3EPJ A;  3ECR A;  2L6M A;  2KOU A;  2JP9 A;  3P1X A;  2YTQ A;  4WSP A;  1LLM C;  2CT1 A;  1JK1 A;  1YSA C;  5T6J A;  5DNY A;  2LUQ A;  4DUY E;  2ODR D;  1XNQ E;  1EKZ A;  3THN A;  2EN4 A;  2HC5 A;  1RMD A;  2EM2 A;  2IHR 1;  4O5G A;  1ZBT A;  2EMW A;  2FTX B;  4R2E A;  4DR5 E;  2PRT A;  1Z1B A;  4LF5 E;  2YTF A;  3VHT B;  1PKP A;  2MC5 A;  1FJG E;  4F9A B;  4WSG A;  4DMI A;  2RS6 A;  1X3C A;  2V87 A;  4LU9 A;  3HQ1 A;  3BBG A;  5KL7 A;  2UUA E;  1YYK A;  4JYA E;  2JR1 A;  2EN6 A;  3IWC A;  1BBG A;  1JK2 A;  4M30 A;  2YRK A;  2Q8U A;  2WCC 3;  2L2M A;  1YUJ A;  5AC5 A;  2YTD A;  4X9J A;  2UXD E;  4B3S E;  2MC6 A;  2EN7 A;  2R1F A;  2EM7 A;  4WFT A;  4F6M A;  2EPC A;  2EQ3 A;  1YFH A;  1A1F A;  4WPY A;  3F6H A;  1QU6 A;  4LF9 E;  2V88 A;  3OTO E;  2DLQ A;  4F54 A;  3C4T A;  5IXM B;  2JWO A;  4ZYE A;  2VRD A;  5CFF E;  1UBD C;  1IBM E;  2EZ6 A;  4DV7 E;  1EH7 A;  3C6M A;  2RSI A;  2LE2 A;  2N3H A;  1RQ0 A;  3H09 A;  3VYY A;  2D9H A;  2DLK A;  4LFC E;  2RQL A;  3AUZ A;  5A2Q C;  3KWR A;  2EPM X;  4NXM E;  1I94 E;  2V8Q B;  2M9A A;  3T1H E;  4O4K A;  1TN9 A;  4R2R A;  4NXN E;  3AV0 A;  2EPA A;  1UHZ A;  1GTK A;  3ADG A;  1G2F C;  1X6H A;  4KZS A;  1T38 A;  4Q35 B;  4DV2 E;  1TF6 A;  2EN3 A;  1PJS A;  4P7D A;  5A6B D;  2EPO A;  4M0V A;  2HGH A;  1DI2 A;  2EQ1 A;  4WXC A;  2MKD A;  2DGC A;  4X65 E;  4ZYG A;  5AAS A;  2UXB E;  2M1S A;  1HR0 E;  3DF6 A;  4KWY A;  2EMG A;  1IQS A;  4R2C A;  1X6E A;  2EOH A;  5AE2 A;  4R2Q A;  1YZ9 A;  4BMJ A;  2EP3 A;  4DV4 E;  2N3G A;  4RHB B;  3KZY A;  2EJ4 A;  2YRM A;  4DV5 E;  4DV3 E;  3C6K A;  2B7V A;  4JI0 E;  3OML A;  2EMA A;  1BBO A;  2EOM A;  4JI2 E;  2EMZ A;  4YY3 E;  2MKN A;  2E1M A;  2BB8 A;  2ENH A;  2YSP A;  2ZM6 E;  2F8B A;  2A25 A;  2EPU A;  4HTG A;  2WBU A;  4BCA A;  1UN6 B;  3L00 A;  2EL4 A;  2I13 A;  2RSM A;  4JI1 E;  2RPC A;  3LLH A;  2L8T A;  2EM0 A;  2EPL X;  2EPK X;  2VQE E;  1UIL A;  2WZO A;  1A1H A;  2GHF A;  2VQF E;  4X8W A;  4O24 A;  4X62 E;  3J7Y p;  4M2Z A;  2YPN A;  4TUI A;  2BBG A;  2EMF A;  4L5N C;  3EPH A;  2EMH A;  2EOQ A;  4YHH E;  2ODR C;  5A6K A;  2LCE A;  2K7I A;  3BF2 A;  2KON A;  2YWQ A;  5A6B A;  5A6A A;  2DSY A;  2WBT A;  5KL2 A;  4X66 E;  4TUG A;  2L33 A;  5IV8 B;  1N3G A;  1EH8 A;  1A1K A;  2E5L E;  2LBS B;  4JV5 E;  2YTI A;  1WXR A;  4WXD A;  4GKK E;  3THO B;  3DJW A;  3QG5 C;  3HTX A;  1N36 E;  3UK3 C;  4IJD A;  2EM3 A;  2EOO A;  2UXC E;  1X49 A;  2MDR A;  2HJJ A;  3M99 B;  2NUG A;  3C4B A;  4R2A A;  3EPK A;  1O0W A;  1T4L B;  1N34 E;  4MLV A;  2YU5 A;  5KL4 A;  1A1L A;  4JI4 E;  4KHP E;  2EN1 A;  2ELZ A;  4RH8 A;  4BHC A;  1T4O A;  1PJQ A;  1PDA A;  1IBK E;  2EMI A;  2YTE A;  2F4V E;  1YUI A;  1F2I G;  2KHX A;  2YTN A;  1N33 E;  2RS7 A;  1BB8 A;  4BC9 A;  2LTS A;  1IBL E;  1HNZ E;  5IWA E;  4ZYH A;  2DIX A;  5A69 A;  1A1J A;  2L2N A;  3RMP A;  4F9C B;  2DB2 A;  3J81 C;  1RC7 A;  2EPX A;  4NHR A;  2LV2 A;  4P78 A;  4R03 A;  5LLQ A;  5KL6 A;  4DR2 E;  2EN2 A;  5LL6 R;  5A6J A;  2L3C A;  2JVA A;  2EOI A;  2YSO A;  2EOZ A;  2E72 A;  5KL5 A;  2LJU A;  3F6G A;  4DR3 E;  1A1G A;  4WX9 A;  1T4N A;  2LO3 A;  2EM9 A;  3EQ1 A;  4B3M E;  2YTJ A;  4BS9 A;  1X47 A;  5IT9 C;  2V86 A;  2EM5 A;  5KL3 A;  4LFA E;  1J26 A;  4JI7 E;  1N32 E;  2B7T A;  2YRH A;  2FGG A;  3IWD A;  2LUP B;  3KZZ A;  2EN8 A;  4BC7 A;  4R2S A;  4JI6 E;  4L8N A;  2LJH A;  4GEQ B;  2EMB A;  3TQM A;  2EOR A;  4LTY A;  4I8O A;  2J7J A;  1AAY A;  1HNX E;  3K6Q A;  2EWL A;  2VE7 C;  4BHB A;  1G2D C;  3J7A G;  1NCS A;  2ELY A;  4F9B B;  2EOX A;  2DMI A;  5LMU E;  1ZU1 A;  4DR6 E;  2CTD A;  1MEY C;  3VK6 A;  2EPP A;  2JYA A;  1SFE A;  5F3W A;  1ZAA C;  4GZN C;  2GLI A;  2ENC A;  5BR8 E;  1IQO A;  1J5E E;  5ADZ A;  4DV1 E;  1PJT A;  2UUB E;  2EM4 A;  4BBY A;  4MLQ A;  1AH5 A;  2EM6 A;  1STU A;  4LF7 E;  2EQ0 A;  3ZOQ B;  4IS1 C;  2V85 A;  3JTZ A;  4DV6 E;  2LT7 A;  3LML A;  1QNT A;  1X5W A;  2CPN A;  2L92 A;  2EOJ A;  5TSE A;  4LF4 E;  3T1Y E;  4X64 E;  2N8X A;  2NUF A;  3MHS C;  2B3T B;  2NAB A;  4LF6 E;  4B3R E;  2K4V A;  3MHH C;  2YZT A;  4J8Z A;  2YTO A;  1EH6 A;  2LTR A;  2EMX A;  2JXP A;  3HPS A;  1DGC A;  1B69 A;  2EPZ A;  4JI5 E;  3HPZ A;  2ENA A;  1KYQ A;  4FK5 C;  2EE8 A;  1XNR E;  2R76 A;  2WBS A;  1A1I A;  4B3T E;  4LF8 E;  2VF1 A;  3J80 C;  4K0K E;  3ADI A;  2EL6 A;  1GZ6 A;  3ADL A;  4DKK A;  2EM8 A;  3BID A;  4F6N A;  1XMQ E;  1ZBQ A;  1YPN A;  2M4I A;  2LRS A;  1XMO E;  3BGH A;  2ADR A;  5LMN E;  5AE3 A;  4N4R B;  2YTP A;  2EPN A;  1SR9 A;  2H36 X;  1MGT A;  1FKA E;  4NZV A;  4F2J C;  1WHN A;  5AC4 A;  2LMZ A;  2LVH A;  2HHH E;  4OOG C;  2V83 A;  4GKJ E;  2RTX A; 
#chains in the Genus database with same CATH homology
 2WCC 3;  1YUJ A;  2YTD A;  4X9J A;  1G2D C;  1NCS A;  2ELY A;  2EMF A;  2EN7 A;  2R1F A;  3EPH A;  2EL5 A;  2EMH A;  2EM7 A;  2EOX A;  2EOQ A;  2EOF A;  2DMI A;  2EML A;  2EPC A;  4F6M A;  2LCE A;  2EQ3 A;  1ZU1 A;  1A1F A;  2EOY A;  5KL2 A;  2WBT A;  2DLQ A;  2CTD A;  1WJP A;  1MEY C;  2EPP A;  2CSH A;  2EMK A;  1A1K A;  2EMY A;  2VRD A;  2YTI A;  4R2P A;  1UBD C;  1X6F A;  1ZAA C;  1P47 A;  4GZN C;  2GLI A;  2ENC A;  1TF3 A;  2EOS A;  2RSI A;  3UK3 C;  4M9V C;  4IJD A;  2YTG A;  2EM3 A;  2EM4 A;  2EOO A;  2D9H A;  3M99 B;  2DLK A;  2EM6 A;  4R2A A;  3EPK A;  2EQ0 A;  2YU5 A;  5KL4 A;  2M9A A;  4IS1 C;  1A1L A;  1TN9 A;  2EN1 A;  2ELZ A;  4R2R A;  2LT7 A;  2EMI A;  2JPA A;  1X5W A;  2EPA A;  2YTE A;  2EOJ A;  1G2F C;  1X6H A;  1YUI A;  1F2I G;  3EPL A;  1TF6 A;  2EN3 A;  2YTN A;  2DRP A;  1KJK A;  1BB8 A;  2EOE A;  3MHS C;  2HGH A;  4R2D A;  2YU8 A;  2NAB A;  2EQ1 A;  3MHH C;  2EPR A;  1A1J A;  2MKD A;  2DGC A;  2YTO A;  2EMX A;  1DGC A;  2MDG A;  1B69 A;  2EPZ A;  1ZR9 A;  2EMC A;  3EPJ A;  2EMG A;  2ENA A;  2EPX A;  2LV2 A;  4R2C A;  1X6E A;  2EOH A;  4R2Q A;  4FK5 C;  2EE8 A;  2EP3 A;  2JP9 A;  5KL6 A;  2WBS A;  2EN2 A;  1A1I A;  2YTQ A;  1LLM C;  2EJ4 A;  2CT1 A;  2EOI A;  2YSO A;  1JK1 A;  2YRM A;  1YSA C;  2EOZ A;  2E72 A;  5KL5 A;  1A1G A;  2EL6 A;  2LO3 A;  2EM9 A;  2EM8 A;  2EN4 A;  4F6N A;  2EMA A;  1RMD A;  2YTJ A;  2EOM A;  1BBO A;  2EM2 A;  2EM5 A;  2EMZ A;  5KL3 A;  2EMW A;  2MKN A;  2BB8 A;  4R2E A;  2ENH A;  2YSP A;  2PRT A;  1Z1B A;  2ADR A;  2A25 A;  2EPU A;  2YTF A;  3VHT B;  2WBU A;  1UN6 B;  2EL4 A;  2YRH A;  2YTP A;  4WSG A;  2I13 A;  2RPC A;  1X3C A;  2EN8 A;  4R2S A;  4F2J C;  2EMB A;  5KL7 A;  2EM0 A;  2LVH A;  2EN6 A;  2EOR A;  2J7J A;  1A1H A;  1AAY A;  2GHF A;  1JK2 A;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...