4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
2MKNA 1BB8A 5KL7A 2EPXA 1YUIA 2YTQA 2PRTA 2EMLA 1AAYA 2YSOA 4GZNC 2EMBA 4FK5C 2EMXA 2WCC3 2EOZA 1YUJA 1ZR9A 4R2CA 3EPJA 3MHHC 2EQ3A 4X9JA 4F6MA 2RSIA 2EOJA 2YTFA 1UBDC 2HGHA 2YSPA 4R2DA 3UK3C 4R2RA 1F2IG 2EL6A 2EL5A 2MKDA 2DMIA 1A1JA 2EMIA 2EOYA 2EE8A 4R2AA 2GHFA 1A1GA 2EM6A 2EMCA 2EM8A 2LO3A 2A25A 2EPAA 1KJKA 2CSHA 2EMAA 2M9AA 1UN6B 2EMFA 2EOMA 2EN8A 1TN9A 2JPAA 3MHSC 2ENCA 1Z1BA 5KL6A 2EOOA 1JK2A 2YU5A 2YTPA 1ZU1A 1LLMC 4M9VC 2EPPA 4IS1C 2EPUA 2VRDA 1YSAC 2LT7A 1X3CA 2DLQA 2EMZA 2EN4A 2YU8A 2EQ1A 2EOHA 2LV2A 2EOSA 5KL5A 2JP9A 2BB8A 2ELYA 1BBOA 2EM0A 2EOFA 2NABA 2D9HA 4WSGA 2EOEA 2EPRA 2YRMA 4R2SA 1B69A 1X5WA 2EMWA 1X6EA 2GLIA 2EP3A 4R2EA 1DGCA 3EPKA 2EN3A 4IJDA 2EOQA 2EPZA 2LCEA 2WBSA 3EPHA 2EPCA 2EM5A 2EQ0A 2YRHA 1ZAAC 2CTDA 4F2JC 2EMKA 1NCSA 2YTJA 2EN7A 2ADRA 2YRKA 2EM3A 1MEYC 2EM2A 2WBUA 2YTIA 2ELZA 2EN1A 5KL2A 2EMGA 2YTOA 2EM4A 2CT1A 1G2DC 2RPCA 1X6FA 1A1KA 1WJPA 4R2PA 4F6NA 2YTDA 5KL3A 3EPLA 1JK1A 1X6HA 2YTGA 3VHTB 2EJ4A 2EM7A 2WBTA 1TF6A 2MDGA 2EORA 2DRPA 2EMYA 2LVHA 3M99B 1G2FC 2EMHA 4R2QA 2YTEA 2YTNA 2J7JA 2EN2A 5KL4A 2ENHA 2DLKA 2E72A 2EL4A 1A1LA 2I13A 2EOXA 1A1HA 1TF3A 1RMDA 2R1FA 2DGCA 2ENAA 1P47A 1A1IA 2EOIA 2EM9A 2EN6A 1A1FA
chains in the Genus database with same CATH superfamily
2EPXA 1AAYA 2KHXA 4X8WA 4LF4E 5IT9C 5TSEA 4DV6E 3KWRA 3C6MA 3MHHC 2EQ3A 4X9JA 4NXNE 1PJSA 2EOJA 5IWAE 1UBDC 2HGHA 2YSPA 3UK3C 4JI5E 1A1JA 2EMIA 2B7TA 4R2AA 5LL6R 2A25A 1KJKA 2M9AA 2UXDE 2EMFA 5AE3A 2LBSB 1GQEA 2DB2A 5KL6A 3HTXA 5LLQA 4M9VC 2EPPA 5AE2A 1DI2A 2VRDA 1IMUA 3JU0A 2EN4A 2L33A 2K7IA 2LV2A 2VF1A 5KL5A 1N36E 2EOFA 2M1SA 1N32E 4WSGA 2N3HA 1B69A 1YYOA 2EMWA 1X6EA 2LJUA 3KZZA 5A6KA 3VYXA 1XNRE 3ADJA 3IWBA 2UXBE 4DUYE 2EOQA 4M0VA 1HNXE 2N3GA 2EPCA 3AV0A 1PDAA 2LMZA 2EQ0A 1ZAAC 4BC9A 4LFCE 2CTDA 4F2JC 1EH8A 2EMKA 4BMJA 2JR1A 4B3TE 1EH7A 2VE7C 4LFAE 5A6BD 1EKZA 1KYQA 1QU6A 2EM3A 4JI4E 2WBUA 3HXLA 4KZSA 1XNQE 4O24A 2L8TA 2NUFA 3JTZA 3J81C 2L2NA 2LTSA 4WPYA 2CT1A 1G2DC 4GKKE 3H09A 1WJPA 1GZ6A 2YTDA 3ADLA 4ZYEA 4P78A 2VQFE 5A6BA 2L92A 1TF6A 4GKJE 1T4NA 2DRPA 4BHBA 2L2MA 4BCAA 2LTRA 4O5GA 4R2QA 1UHZA 4DR5E 2ODRD 4I8OA 2DLKA 5CFFE 1YZ9A 1T39A 2EL4A 2LE2A 2CPNA 4JI1E 2L3CA 2ODRC 3OTOE 5AC5A 2DGCA 4KWYA 4DR2E 1A1IA 2F8BA 2EN6A 1A1FA 1BBOA 2MKNA 4ZYGA 2HJJA 4DR1E 5IV8B 5A6JA 5A6AA 2EOZA 4NZVA 4YY3E 2UUBE 1EH6A 5A69A 3EPJA 2EPLX 2RSMA 4F6MA 4M2ZA 2YTFA 5BR8E 1XMOE 2RTXA 4R2RA 1F2IG 2EL6A 2EPMX 1T4LB 2MKDA 1AH5A 2EM8A 3BGHA 2EPAA 1YYKA 2CSHA 2V8QB 4BS9A 1UN6B 1TN9A 3MHSC 2M7QA 3DJWA 2YTPA 1ZU1A 1LLMC 2EPUA 2M4IA 2DLQA 2Q8UA 4HTGA 2LUPB 1BBGA 4LF5E 2EQ1A 2EOHA 3F6HA 2L3JA 1T38A 2NABA 4F54A 4ZYDA 2EOEA 2R76A 4R2SA 2ZM6E 1PKPA 2GLIA 2BBGA 5AE1A 1I94E 4L5NC 4NHRA 2B9DA 3ECRA 2YT4A 2E5LE 3AUZA 2WBSA 4JV5E 4K0KE 3ZOQB 2V89A 3J80C 1J26A 4R8OA 2V83A 4LF9E 4O4KA 2E1MA 2YTJA 1IQOA 2EZ6A 4LF6E 2YTIA 2EMGA 4DV4E 4RHBB 2RPCA 1X49A 2MC6A 1IBKE 4KHPE 3P1XA 1X6HA 4F9AB 3VHTB 2EJ4A 2EM7A 2DSYA 2EORA 2JWOA 3K6QA 4DV7E 2LVHA 3THNA 2RQLA 4OOGC 3BBGA 2J7JA 4O43A 4DV2E 4LTYA 2I9IA 4L8NA 3T1YE 2GPIA 5AC4A 4LF7E 4DR3E 4LF8E 1P47A 1SR9A 2EM9A 1FJGE 3OMLA 5KL7A 1GTKA 1YUIA 4JI3E 2EMLA 3MSWA 2YSOA 2UU9E 4GZNC 4NXME 2YZTA 4B3RE 1YYWA 1NEIA 4AQYE 2EPOA 1YUJA 1ZR9A 3HPSA 1J5EE 4R2CA 4HEIA 4R03A 1UILA 2B3TB 4TUIA 3THOB 2DIXA 2KONA 2UUAE 2EL5A 2V87A 2LRSA 3C6KA 2GHFA 1STUA 2EMCA 2LO3A 1HR0E 2EMAA 1SFEA 1YPNA 2FGGA 2EOOA 4Q35B 3VK6A 4IS1C 4JI2E 4DMIA 1YSAC 2LT7A 2EWLA 4DR6E 4B3SE 2EOSA 2JP9A 5FLXC 2EM0A 2JOXA 2EPRA 1YFHA 1O0WA 2EP3A 4R2EA 3F6GA 1WHNA 1DGCA 4YHHE 2F4VE 1IQSA 2EN3A 2UXCE 4IJDA 2EPZA 1PJQA 2EPKX 4WSPA 3EPHA 1MGTA 5AASA 1XMQE 4BHCA 4TUGA 4MLQA 1ZBQA 2HC5A 4JI0E 1NCSA 4JI6E 1WRJA 2EN7A 2JOBA 2YRKA 1IBLE 2FTXB 1L4SA 4LU9A 5KL2A 2YTOA 2L6MA 2EM4A 3J7Yp 4F9BB 3J7AG 1X6FA 1A1KA 1X48A 4R2PA 4F6NA 1JK1A 2KOUA 2YTGA 2H36X 1RC7A 2N8XA 2YWQA 2MDGA 3IWCA 2HHHE 3L00A 2EMHA 3EQ1A 4M30A 2YTNA 2EN2A 2E72A 4J8ZA 2V85A 2NA2A 1A1LA 4LFBE 2EOXA 4JI8E 3TQMA 1TF3A 2V86A 2NUEA 3DF6A 1IBME 2EOIA 2JY9A 1BB8A 2YTQA 2PRTA 2EMBA 4FK5C 2EMXA 2WCC3 1X47A 4DV3E 2G7HA 4DR7E 4DV5E 2MC5A 5T6JA 2V88A 2RSIA 4R2DA 2EPNA 2IHR1 2DMIA 4JYAE 2EOYA 2EE8A 4Q28A 1A1GA 2EM6A 2MDRA 5IXMB 2NUGA 2EOMA 2EN8A 2JPAA 2ENCA 3LMLA 1Z1BA 2RS7A 5F3WA 2YU5A 1JK2A 1FKAE 3KZYA 4WFTA 3HPZA 3ADGA 5ADZA 2FV4B 1X3CA 1WHQA 2WZOA 2EMZA 3VYYA 1HNZE 3QG5C 2YU8A 1ZBTA 4BBYA 5LMUE 4P7DA 2BB8A 2ELYA 2UUCE 2D9HA 4WXDA 2YRMA 1X5WA 4F9CB 1T4OA 1HNWE 1N33E 2DMYA 4X64E 3EPKA 2YPNA 3JAMC 4WYQB 2JYAA 4X62E 3RMPA 5LMNE 2LCEA 5DNYA 5A2QC 3IWDA 4DV1E 3C4TA 2JXPA 2EM5A 3FIGA 2K4VA 2YRHA 2JVAA 1PJTA 3BF2A 1DQ3A 1WXRA 4B3ME 3BIDA 2ADRA 1MEYC 4X66E 2EM2A 2ELZA 2EN1A 4JI7E 1N34E 2LUQA 4OX9E 5KL3A 3EPLA 4N4RB 4WX9A 1N3GA 2WBTA 4DKKA 2LJHA 2RS6A 2EMYA 3C4BA 3M99B 2B7VA 1G2FC 4DR4E 3LLHA 3T1HE 2YTEA 3ADIA 4RH8A 5KL4A 2ENHA 1QNTA 4GEQB 4BC7A 4DUZE 2VQEE 4ZYHA 2I13A 4DV0E 1A1HA 1RQ0A 1RMDA 2L2KB 2R1FA 4X65E 2ENAA 3HQ1A 4MLVA 4WXCA
chains in the Genus database with same CATH topology
2MKNA 1BB8A 5KL7A 2EPXA 1YUIA 2YTQA 2PRTA 2EMLA 1AAYA 2YSOA 4GZNC 2EMBA 4FK5C 2EMXA 2WCC3 2EOZA 1YUJA 1ZR9A 4R2CA 3EPJA 3MHHC 2EQ3A 4X9JA 4F6MA 2RSIA 2EOJA 2YTFA 1UBDC 2HGHA 2YSPA 4R2DA 3UK3C 4R2RA 1F2IG 2EL6A 2EL5A 2MKDA 2DMIA 1A1JA 2EMIA 2EOYA 2EE8A 4R2AA 2GHFA 1A1GA 2EM6A 2EMCA 2EM8A 2LO3A 2A25A 2EPAA 1KJKA 2CSHA 2EMAA 2M9AA 1UN6B 2EMFA 2EOMA 2EN8A 1TN9A 2JPAA 3MHSC 2ENCA 1Z1BA 5KL6A 2EOOA 1JK2A 2YU5A 2YTPA 1ZU1A 1LLMC 4M9VC 2EPPA 4IS1C 2EPUA 2VRDA 1YSAC 2LT7A 1X3CA 2DLQA 2EMZA 2EN4A 2YU8A 2EQ1A 2EOHA 2LV2A 2EOSA 5KL5A 2JP9A 2BB8A 2ELYA 1BBOA 2EM0A 2EOFA 2NABA 2D9HA 4WSGA 2EOEA 2EPRA 2YRMA 4R2SA 1B69A 1X5WA 2EMWA 1X6EA 2GLIA 2EP3A 4R2EA 1DGCA 3EPKA 2EN3A 4IJDA 2EOQA 2EPZA 2LCEA 2WBSA 3EPHA 2EPCA 2EM5A 2EQ0A 2YRHA 1ZAAC 2CTDA 4F2JC 2EMKA 1NCSA 2YTJA 2EN7A 2ADRA 2YRKA 2EM3A 1MEYC 2EM2A 2WBUA 2YTIA 2ELZA 2EN1A 5KL2A 2EMGA 2YTOA 2EM4A 2CT1A 1G2DC 2RPCA 1X6FA 1A1KA 1WJPA 4R2PA 4F6NA 2YTDA 5KL3A 3EPLA 1JK1A 1X6HA 2YTGA 3VHTB 2EJ4A 2EM7A 2WBTA 1TF6A 2MDGA 2EORA 2DRPA 2EMYA 2LVHA 3M99B 1G2FC 2EMHA 4R2QA 2YTEA 2YTNA 2J7JA 2EN2A 5KL4A 2ENHA 2DLKA 2E72A 2EL4A 1A1LA 2I13A 2EOXA 1A1HA 1TF3A 1RMDA 2R1FA 2DGCA 2ENAA 1P47A 1A1IA 2EOIA 2EM9A 2EN6A 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKN A;  1BB8 A;  5KL7 A;  2EPX A;  1YUI A;  2YTQ A;  2PRT A;  2EML A;  1AAY A;  2YSO A;  4GZN C;  2EMB A;  4FK5 C;  2EMX A;  2WCC 3;  2EOZ A;  1YUJ A;  1ZR9 A;  4R2C A;  3EPJ A;  3MHH C;  2EQ3 A;  4X9J A;  4F6M A;  2RSI A;  2EOJ A;  2YTF A;  1UBD C;  2HGH A;  2YSP A;  4R2D A;  3UK3 C;  4R2R A;  1F2I G;  2EL6 A;  2EL5 A;  2MKD A;  2DMI A;  1A1J A;  2EMI A;  2EOY A;  2EE8 A;  4R2A A;  2GHF A;  1A1G A;  2EM6 A;  2EMC A;  2EM8 A;  2LO3 A;  2A25 A;  2EPA A;  1KJK A;  2CSH A;  2EMA A;  2M9A A;  1UN6 B;  2EMF A;  2EOM A;  2EN8 A;  1TN9 A;  2JPA A;  3MHS C;  2ENC A;  1Z1B A;  5KL6 A;  2EOO A;  1JK2 A;  2YU5 A;  2YTP A;  1ZU1 A;  1LLM C;  4M9V C;  2EPP A;  4IS1 C;  2EPU A;  2VRD A;  1YSA C;  2LT7 A;  1X3C A;  2DLQ A;  2EMZ A;  2EN4 A;  2YU8 A;  2EQ1 A;  2EOH A;  2LV2 A;  2EOS A;  5KL5 A;  2JP9 A;  2BB8 A;  2ELY A;  1BBO A;  2EM0 A;  2EOF A;  2NAB A;  2D9H A;  4WSG A;  2EOE A;  2EPR A;  2YRM A;  4R2S A;  1B69 A;  1X5W A;  2EMW A;  1X6E A;  2GLI A;  2EP3 A;  4R2E A;  1DGC A;  3EPK A;  2EN3 A;  4IJD A;  2EOQ A;  2EPZ A;  2LCE A;  2WBS A;  3EPH A;  2EPC A;  2EM5 A;  2EQ0 A;  2YRH A;  1ZAA C;  2CTD A;  4F2J C;  2EMK A;  1NCS A;  2YTJ A;  2EN7 A;  2ADR A;  2YRK A;  2EM3 A;  1MEY C;  2EM2 A;  2WBU A;  2YTI A;  2ELZ A;  2EN1 A;  5KL2 A;  2EMG A;  2YTO A;  2EM4 A;  2CT1 A;  1G2D C;  2RPC A;  1X6F A;  1A1K A;  1WJP A;  4R2P A;  4F6N A;  2YTD A;  5KL3 A;  3EPL A;  1JK1 A;  1X6H A;  2YTG A;  3VHT B;  2EJ4 A;  2EM7 A;  2WBT A;  1TF6 A;  2MDG A;  2EOR A;  2DRP A;  2EMY A;  2LVH A;  3M99 B;  1G2F C;  2EMH A;  4R2Q A;  2YTE A;  2YTN A;  2J7J A;  2EN2 A;  5KL4 A;  2ENH A;  2DLK A;  2E72 A;  2EL4 A;  1A1L A;  2I13 A;  2EOX A;  1A1H A;  1TF3 A;  1RMD A;  2R1F A;  2DGC A;  2ENA A;  1P47 A;  1A1I A;  2EOI A;  2EM9 A;  2EN6 A;  1A1F A; 
#chains in the Genus database with same CATH topology
 2EPX A;  1AAY A;  2KHX A;  4X8W A;  4LF4 E;  5IT9 C;  5TSE A;  4DV6 E;  3KWR A;  3C6M A;  3MHH C;  2EQ3 A;  4X9J A;  4NXN E;  1PJS A;  2EOJ A;  5IWA E;  1UBD C;  2HGH A;  2YSP A;  3UK3 C;  4JI5 E;  1A1J A;  2EMI A;  2B7T A;  4R2A A;  5LL6 R;  2A25 A;  1KJK A;  2M9A A;  2UXD E;  2EMF A;  5AE3 A;  2LBS B;  1GQE A;  2DB2 A;  5KL6 A;  3HTX A;  5LLQ A;  4M9V C;  2EPP A;  5AE2 A;  1DI2 A;  2VRD A;  1IMU A;  3JU0 A;  2EN4 A;  2L33 A;  2K7I A;  2LV2 A;  2VF1 A;  5KL5 A;  1N36 E;  2EOF A;  2M1S A;  1N32 E;  4WSG A;  2N3H A;  1B69 A;  1YYO A;  2EMW A;  1X6E A;  2LJU A;  3KZZ A;  5A6K A;  3VYX A;  1XNR E;  3ADJ A;  3IWB A;  2UXB E;  4DUY E;  2EOQ A;  4M0V A;  1HNX E;  2N3G A;  2EPC A;  3AV0 A;  1PDA A;  2LMZ A;  2EQ0 A;  1ZAA C;  4BC9 A;  4LFC E;  2CTD A;  4F2J C;  1EH8 A;  2EMK A;  4BMJ A;  2JR1 A;  4B3T E;  1EH7 A;  2VE7 C;  4LFA E;  5A6B D;  1EKZ A;  1KYQ A;  1QU6 A;  2EM3 A;  4JI4 E;  2WBU A;  3HXL A;  4KZS A;  1XNQ E;  4O24 A;  2L8T A;  2NUF A;  3JTZ A;  3J81 C;  2L2N A;  2LTS A;  4WPY A;  2CT1 A;  1G2D C;  4GKK E;  3H09 A;  1WJP A;  1GZ6 A;  2YTD A;  3ADL A;  4ZYE A;  4P78 A;  2VQF E;  5A6B A;  2L92 A;  1TF6 A;  4GKJ E;  1T4N A;  2DRP A;  4BHB A;  2L2M A;  4BCA A;  2LTR A;  4O5G A;  4R2Q A;  1UHZ A;  4DR5 E;  2ODR D;  4I8O A;  2DLK A;  5CFF E;  1YZ9 A;  1T39 A;  2EL4 A;  2LE2 A;  2CPN A;  4JI1 E;  2L3C A;  2ODR C;  3OTO E;  5AC5 A;  2DGC A;  4KWY A;  4DR2 E;  1A1I A;  2F8B A;  2EN6 A;  1A1F A;  1BBO A;  2MKN A;  4ZYG A;  2HJJ A;  4DR1 E;  5IV8 B;  5A6J A;  5A6A A;  2EOZ A;  4NZV A;  4YY3 E;  2UUB E;  1EH6 A;  5A69 A;  3EPJ A;  2EPL X;  2RSM A;  4F6M A;  4M2Z A;  2YTF A;  5BR8 E;  1XMO E;  2RTX A;  4R2R A;  1F2I G;  2EL6 A;  2EPM X;  1T4L B;  2MKD A;  1AH5 A;  2EM8 A;  3BGH A;  2EPA A;  1YYK A;  2CSH A;  2V8Q B;  4BS9 A;  1UN6 B;  1TN9 A;  3MHS C;  2M7Q A;  3DJW A;  2YTP A;  1ZU1 A;  1LLM C;  2EPU A;  2M4I A;  2DLQ A;  2Q8U A;  4HTG A;  2LUP B;  1BBG A;  4LF5 E;  2EQ1 A;  2EOH A;  3F6H A;  2L3J A;  1T38 A;  2NAB A;  4F54 A;  4ZYD A;  2EOE A;  2R76 A;  4R2S A;  2ZM6 E;  1PKP A;  2GLI A;  2BBG A;  5AE1 A;  1I94 E;  4L5N C;  4NHR A;  2B9D A;  3ECR A;  2YT4 A;  2E5L E;  3AUZ A;  2WBS A;  4JV5 E;  4K0K E;  3ZOQ B;  2V89 A;  3J80 C;  1J26 A;  4R8O A;  2V83 A;  4LF9 E;  4O4K A;  2E1M A;  2YTJ A;  1IQO A;  2EZ6 A;  4LF6 E;  2YTI A;  2EMG A;  4DV4 E;  4RHB B;  2RPC A;  1X49 A;  2MC6 A;  1IBK E;  4KHP E;  3P1X A;  1X6H A;  4F9A B;  3VHT B;  2EJ4 A;  2EM7 A;  2DSY A;  2EOR A;  2JWO A;  3K6Q A;  4DV7 E;  2LVH A;  3THN A;  2RQL A;  4OOG C;  3BBG A;  2J7J A;  4O43 A;  4DV2 E;  4LTY A;  2I9I A;  4L8N A;  3T1Y E;  2GPI A;  5AC4 A;  4LF7 E;  4DR3 E;  4LF8 E;  1P47 A;  1SR9 A;  2EM9 A;  1FJG E;  3OML A;  5KL7 A;  1GTK A;  1YUI A;  4JI3 E;  2EML A;  3MSW A;  2YSO A;  2UU9 E;  4GZN C;  4NXM E;  2YZT A;  4B3R E;  1YYW A;  1NEI A;  4AQY E;  2EPO A;  1YUJ A;  1ZR9 A;  3HPS A;  1J5E E;  4R2C A;  4HEI A;  4R03 A;  1UIL A;  2B3T B;  4TUI A;  3THO B;  2DIX A;  2KON A;  2UUA E;  2EL5 A;  2V87 A;  2LRS A;  3C6K A;  2GHF A;  1STU A;  2EMC A;  2LO3 A;  1HR0 E;  2EMA A;  1SFE A;  1YPN A;  2FGG A;  2EOO A;  4Q35 B;  3VK6 A;  4IS1 C;  4JI2 E;  4DMI A;  1YSA C;  2LT7 A;  2EWL A;  4DR6 E;  4B3S E;  2EOS A;  2JP9 A;  5FLX C;  2EM0 A;  2JOX A;  2EPR A;  1YFH A;  1O0W A;  2EP3 A;  4R2E A;  3F6G A;  1WHN A;  1DGC A;  4YHH E;  2F4V E;  1IQS A;  2EN3 A;  2UXC E;  4IJD A;  2EPZ A;  1PJQ A;  2EPK X;  4WSP A;  3EPH A;  1MGT A;  5AAS A;  1XMQ E;  4BHC A;  4TUG A;  4MLQ A;  1ZBQ A;  2HC5 A;  4JI0 E;  1NCS A;  4JI6 E;  1WRJ A;  2EN7 A;  2JOB A;  2YRK A;  1IBL E;  2FTX B;  1L4S A;  4LU9 A;  5KL2 A;  2YTO A;  2L6M A;  2EM4 A;  3J7Y p;  4F9B B;  3J7A G;  1X6F A;  1A1K A;  1X48 A;  4R2P A;  4F6N A;  1JK1 A;  2KOU A;  2YTG A;  2H36 X;  1RC7 A;  2N8X A;  2YWQ A;  2MDG A;  3IWC A;  2HHH E;  3L00 A;  2EMH A;  3EQ1 A;  4M30 A;  2YTN A;  2EN2 A;  2E72 A;  4J8Z A;  2V85 A;  2NA2 A;  1A1L A;  4LFB E;  2EOX A;  4JI8 E;  3TQM A;  1TF3 A;  2V86 A;  2NUE A;  3DF6 A;  1IBM E;  2EOI A;  2JY9 A;  1BB8 A;  2YTQ A;  2PRT A;  2EMB A;  4FK5 C;  2EMX A;  2WCC 3;  1X47 A;  4DV3 E;  2G7H A;  4DR7 E;  4DV5 E;  2MC5 A;  5T6J A;  2V88 A;  2RSI A;  4R2D A;  2EPN A;  2IHR 1;  2DMI A;  4JYA E;  2EOY A;  2EE8 A;  4Q28 A;  1A1G A;  2EM6 A;  2MDR A;  5IXM B;  2NUG A;  2EOM A;  2EN8 A;  2JPA A;  2ENC A;  3LML A;  1Z1B A;  2RS7 A;  5F3W A;  2YU5 A;  1JK2 A;  1FKA E;  3KZY A;  4WFT A;  3HPZ A;  3ADG A;  5ADZ A;  2FV4 B;  1X3C A;  1WHQ A;  2WZO A;  2EMZ A;  3VYY A;  1HNZ E;  3QG5 C;  2YU8 A;  1ZBT A;  4BBY A;  5LMU E;  4P7D A;  2BB8 A;  2ELY A;  2UUC E;  2D9H A;  4WXD A;  2YRM A;  1X5W A;  4F9C B;  1T4O A;  1HNW E;  1N33 E;  2DMY A;  4X64 E;  3EPK A;  2YPN A;  3JAM C;  4WYQ B;  2JYA A;  4X62 E;  3RMP A;  5LMN E;  2LCE A;  5DNY A;  5A2Q C;  3IWD A;  4DV1 E;  3C4T A;  2JXP A;  2EM5 A;  3FIG A;  2K4V A;  2YRH A;  2JVA A;  1PJT A;  3BF2 A;  1DQ3 A;  1WXR A;  4B3M E;  3BID A;  2ADR A;  1MEY C;  4X66 E;  2EM2 A;  2ELZ A;  2EN1 A;  4JI7 E;  1N34 E;  2LUQ A;  4OX9 E;  5KL3 A;  3EPL A;  4N4R B;  4WX9 A;  1N3G A;  2WBT A;  4DKK A;  2LJH A;  2RS6 A;  2EMY A;  3C4B A;  3M99 B;  2B7V A;  1G2F C;  4DR4 E;  3LLH A;  3T1H E;  2YTE A;  3ADI A;  4RH8 A;  5KL4 A;  2ENH A;  1QNT A;  4GEQ B;  4BC7 A;  4DUZ E;  2VQE E;  4ZYH A;  2I13 A;  4DV0 E;  1A1H A;  1RQ0 A;  1RMD A;  2L2K B;  2R1F A;  4X65 E;  2ENA A;  3HQ1 A;  4MLV A;  4WXC A; 
#chains in the Genus database with same CATH homology
 2MKN A;  1BB8 A;  5KL7 A;  2EPX A;  1YUI A;  2YTQ A;  2PRT A;  2EML A;  1AAY A;  2YSO A;  4GZN C;  2EMB A;  4FK5 C;  2EMX A;  2WCC 3;  2EOZ A;  1YUJ A;  1ZR9 A;  4R2C A;  3EPJ A;  3MHH C;  2EQ3 A;  4X9J A;  4F6M A;  2RSI A;  2EOJ A;  2YTF A;  1UBD C;  2HGH A;  2YSP A;  4R2D A;  3UK3 C;  4R2R A;  1F2I G;  2EL6 A;  2EL5 A;  2MKD A;  2DMI A;  1A1J A;  2EMI A;  2EOY A;  2EE8 A;  4R2A A;  2GHF A;  1A1G A;  2EM6 A;  2EMC A;  2EM8 A;  2LO3 A;  2A25 A;  2EPA A;  1KJK A;  2CSH A;  2EMA A;  2M9A A;  1UN6 B;  2EMF A;  2EOM A;  2EN8 A;  1TN9 A;  2JPA A;  3MHS C;  2ENC A;  1Z1B A;  5KL6 A;  2EOO A;  1JK2 A;  2YU5 A;  2YTP A;  1ZU1 A;  1LLM C;  4M9V C;  2EPP A;  4IS1 C;  2EPU A;  2VRD A;  1YSA C;  2LT7 A;  1X3C A;  2DLQ A;  2EMZ A;  2EN4 A;  2YU8 A;  2EQ1 A;  2EOH A;  2LV2 A;  2EOS A;  5KL5 A;  2JP9 A;  2BB8 A;  2ELY A;  1BBO A;  2EM0 A;  2EOF A;  2NAB A;  2D9H A;  4WSG A;  2EOE A;  2EPR A;  2YRM A;  4R2S A;  1B69 A;  1X5W A;  2EMW A;  1X6E A;  2GLI A;  2EP3 A;  4R2E A;  1DGC A;  3EPK A;  2EN3 A;  4IJD A;  2EOQ A;  2EPZ A;  2LCE A;  2WBS A;  3EPH A;  2EPC A;  2EM5 A;  2EQ0 A;  2YRH A;  1ZAA C;  2CTD A;  4F2J C;  2EMK A;  1NCS A;  2YTJ A;  2EN7 A;  2ADR A;  2YRK A;  2EM3 A;  1MEY C;  2EM2 A;  2WBU A;  2YTI A;  2ELZ A;  2EN1 A;  5KL2 A;  2EMG A;  2YTO A;  2EM4 A;  2CT1 A;  1G2D C;  2RPC A;  1X6F A;  1A1K A;  1WJP A;  4R2P A;  4F6N A;  2YTD A;  5KL3 A;  3EPL A;  1JK1 A;  1X6H A;  2YTG A;  3VHT B;  2EJ4 A;  2EM7 A;  2WBT A;  1TF6 A;  2MDG A;  2EOR A;  2DRP A;  2EMY A;  2LVH A;  3M99 B;  1G2F C;  2EMH A;  4R2Q A;  2YTE A;  2YTN A;  2J7J A;  2EN2 A;  5KL4 A;  2ENH A;  2DLK A;  2E72 A;  2EL4 A;  1A1L A;  2I13 A;  2EOX A;  1A1H A;  1TF3 A;  1RMD A;  2R1F A;  2DGC A;  2ENA A;  1P47 A;  1A1I A;  2EOI A;  2EM9 A;  2EN6 A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...