4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
2EMZA 1JK1A 2MDGA 2WCC3 5KL6A 4F6NA 1X6HA 2NABA 1YUIA 2EN6A 2DLKA 5KL5A 2EOIA 2EN3A 2EL5A 2YTQA 4R2EA 2EOZA 2EOHA 2EOEA 2EQ3A 1LLMC 2EMYA 2EM6A 2YU8A 3UK3C 2EJ4A 2YTIA 2EM9A 2ENCA 4R2QA 2EOOA 4X9JA 2DMIA 1A1HA 2EMCA 2EN7A 2EOYA 2LO3A 2EM2A 1X6EA 2EOQA 1ZU1A 2EORA 5KL7A 1P47A 1A1KA 1X6FA 2DRPA 2JP9A 3EPHA 2EM0A 1G2FC 2GHFA 2EMXA 3MHSC 2EOXA 4F2JC 2EMHA 2EPUA 2MKDA 2YTFA 4R2DA 2EN2A 2CSHA 2EM4A 5KL4A 4F6MA 1A1IA 2EOFA 1KJKA 2ELYA 2DLQA 2EQ0A 2YTGA 2ADRA 2EPRA 1NCSA 4FK5C 2YTNA 2LCEA 1UN6B 1TN9A 2YTEA 2EMFA 1DGCA 1X5WA 2PRTA 3EPLA 1A1JA 1UBDC 2EMLA 2YTJA 2WBSA 2EM7A 2YU5A 3EPKA 2RPCA 3EPJA 2EPPA 2EPZA 2EOJA 2YTPA 4WSGA 2EPCA 2YRMA 2EL4A 1ZAAC 2EP3A 4R2RA 2ENAA 2EE8A 4R2CA 1F2IG 2M9AA 2J7JA 2EMGA 1A1FA 2EMWA 2MKNA 4IJDA 1BBOA 2WBTA 1BB8A 2R1FA 4R2SA 1TF3A 2WBUA 2LV2A 2ELZA 1Z1BA 1MEYC 4IS1C 2YSOA 2YTOA 2BB8A 1WJPA 2LT7A 2EMAA 3VHTB 2EOSA 2EN4A 2CT1A 2DGCA 2VRDA 1YSAC 2EN1A 1AAYA 2I13A 2CTDA 2D9HA 2EMIA 2EOMA 1TF6A 2YRKA 2RSIA 2EL6A 3M99B 5KL2A 2YRHA 2LVHA 2EMBA 2EMKA 4M9VC 2EM5A 2A25A 2EN8A 2ENHA 1A1LA 4R2PA 2EPXA 2EQ1A 1ZR9A 2EPAA 1A1GA 4R2AA 2E72A 2JPAA 1X3CA 2YTDA 3MHHC 2EM3A 1JK2A 2GLIA 1G2DC 1RMDA 1B69A 5KL3A 1YUJA 4GZNC 2YSPA 2HGHA 2EM8A
chains in the Genus database with same CATH superfamily
2M4IA 4RHBB 1JK1A 2JR1A 2ODRD 1QU6A 5KL6A 3ADGA 2LTRA 1WHNA 2EPMX 2B7VA 2DLKA 5F3WA 4BBYA 5A69A 5BR8E 2EN3A 4M0VA 2EL5A 2B9DA 2EOEA 1LLMC 4JI6E 2EMYA 2EM6A 4B3RE 2YT4A 3UK3C 2HHHE 2ENCA 3BIDA 2LTSA 1T38A 2EOYA 2LO3A 4Q35B 1HR0E 1P47A 1BBGA 1ZU1A 3BBGA 1A1KA 2RS7A 3JTZA 2EM0A 3AV0A 2GHFA 3MHSC 5LMUE 4J8ZA 4LF4E 2MKDA 2F8BA 4DR3E 3LMLA 2KHXA 2DLQA 3C4BA 2L92A 2L33A 1RQ0A 3T1YE 4ZYHA 2L8TA 4F9CB 1N34E 4OX9E 2EMLA 4HTGA 2WBSA 2YU5A 3RMPA 3EPKA 5IXMB 2EPPA 2EOJA 4DR7E 2HC5A 2YTPA 4X66E 2MC5A 4WSGA 1ZBTA 2RQLA 4R2RA 1DI2A 3IWDA 1IBME 2UXBE 5AE2A 4DV5E 2MKNA 2L2MA 3F6HA 2N3GA 4DV0E 1PJTA 4JI4E 3THNA 5A2QC 4IS1C 2YTOA 2BB8A 2LT7A 4GEQB 4P78A 2EOSA 2MDRA 2I13A 4KZSA 3OTOE 1UILA 4F9BB 2RSIA 1MGTA 4MLQA 2DB2A 2EMBA 2EMKA 4DR5E 4BC7A 1WXRA 2A25A 2FV4B 2ENHA 2DIXA 4R2PA 2EQ1A 5A6BA 1ZR9A 1X3CA 1KYQA 1WRJA 5ADZA 2H36X 5IWAE 2UU9E 2GLIA 1G2DC 1RMDA 2LJUA 4O5GA 4KHPE 1UHZA 2RS6A 2L2KB 1X6HA 4YY3E 3J80C 2VE7C 1YUIA 1J26A 3IWCA 4R03A 5KL5A 1YPNA 1EH7A 1GZ6A 5AC4A 3JU0A 2EZ6A 5TSEA 1PJSA 3OMLA 2EJ4A 3J81C 2N8XA 2EM9A 4R2QA 2EOOA 4X9JA 1A1HA 2EMCA 2EN7A 1X6EA 2EORA 3KZZA 5KL7A 2DRPA 2YPNA 3EPHA 2UXDE 2BBGA 5IT9C 5CFFE 5A6BD 2K4VA 1YZ9A 2UUBE 5KL4A 1FJGE 2EOFA 2ELYA 1YYKA 2V89A 2V88A 4BHBA 3HPSA 4FK5C 2LCEA 1UN6B 2NUFA 4DUZE 1TN9A 4JI3E 2EMFA 2UUCE 2DMYA 4KWYA 4DV2E 3F6GA 1EKZA 4RH8A 2YTJA 3H09A 3C4TA 4N4RB 4NZVA 5A6JA 4I8OA 4JI2E 1YYWA 4DV3E 3C6MA 2KOUA 3VYYA 2EL4A 1ZAAC 2EP3A 4OOGC 2ENAA 4R2CA 2IHR1 2EMGA 1STUA 1A1FA 2EMWA 4O43A 2B3TB 2NUGA 3J7Yp 2WBTA 4X62E 2B7TA 1TF3A 2LE2A 2WBUA 2HJJA 4LF5E 2M1SA 2LUPB 2EMAA 3BF2A 4JI7E 2CPNA 1X48A 5LL6R 3QG5C 2N3HA 4M30A 2EOMA 1TF6A 2ODRC 4GKKE 2YRKA 3BGHA 4O4KA 3ZOQB 2JOBA 2V8QB 4WPYA 1GTKA 4M2ZA 2YRHA 1IQOA 2Q8UA 4P7DA 2EPXA 4JV5E 2E5LE 4DR6E 2E72A 1EH6A 3KWRA 1XNRE 2R76A 2LJHA 2EM3A 4Q28A 2NUEA 1IBLE 4JYAE 4L8NA 5AC5A 2WZOA 5AASA 5KL3A 5A6KA 2YSPA 2HGHA 3K6QA 2F4VE 4DMIA 1YFHA 2VQFE 3HPZA 2VQEE 2MDGA 5AE3A 4DV1E 2RTXA 1QNTA 3JAMC 4NXNE 4R8OA 3ECRA 2UUAE 2EOIA 4BCAA 2YZTA 5LMNE 2EOHA 3ADIA 2YTIA 1ZBQA 2DMIA 4LF9E 3VK6A 2EM2A 2EOQA 3J7AG 1X6FA 4DR1E 4L5NC 2MC6A 1G2FC 1PJQA 2EMXA 5FLXC 4F2JC 4F54A 2EPUA 3P1XA 2YTFA 1N3GA 4R2DA 2EN2A 2CSHA 1A1IA 4F6MA 1KJKA 2EPKX 2V83A 3EQ1A 1HNXE 1HNWE 2YTGA 1SFEA 4LFCE 1NCSA 2YTNA 4JI1E 4JI5E 2YTEA 1DGCA 3EPLA 2LBSB 1UBDC 2LMZA 1AH5A 4X65E 2KONA 4TUIA 2M7QA 4O24A 2EM7A 2L3CA 1T4OA 3EPJA 1FKAE 2EPZA 4LF7E 5A6AA 2EPCA 2FTXB 1PDAA 2E1MA 2EE8A 1F2IG 4GKJE 2M9AA 2J7JA 4DR4E 4MLVA 2V85A 2FGGA 4IJDA 1IMUA 1T4NA 2R1FA 4BS9A 4JI8E 4ZYGA 1N36E 4F9AB 1Z1BA 5LLQA 2YSOA 1WJPA 4LF6E 1N33E 4YHHE 2VRDA 1YSAC 1AAYA 2JXPA 2EMIA 1T4LB 4B3SE 4LFAE 4DR2E 3T1HE 2EL6A 4WXDA 1XMQE 4M9VC 2EM5A 1A1LA 5DNYA 2JPAA 4R2AA 2YTDA 3L00A 3MHHC 2ZM6E 5T6JA 1XNQE 2L2NA 1B69A 2V86A 1YUJA 4GZNC 2EM8A 4WSPA 3C6KA 2EMZA 3DJWA 4B3TE 4F6NA 1X47A 3HXLA 4X8WA 3HQ1A 2WCC3 2NABA 4LF8E 2EN6A 2I9IA 2JVAA 2EPLX 2YTQA 4R2EA 2YWQA 4X64E 2EOZA 2EQ3A 2YU8A 4ZYEA 2V87A 1GQEA 2LUQA 4DV7E 2JP9A 4DKKA 1NEIA 1YYOA 2EPOA 4TUGA 2EOXA 4K0KE 2JOXA 4AQYE 1XMOE 2EMHA 2K7IA 2EM4A 2JY9A 2EQ0A 2ADRA 2EPRA 4DV4E 2GPIA 1J5EE 1IBKE 4WX9A 1X5WA 2PRTA 1A1JA 3IWBA 4BHCA 4DUYE 4NXME 5AE1A 3ADLA 2RPCA 4WYQB 2NA2A 1X49A 4B3ME 2YRMA 2DSYA 3AUZA 4LTYA 1T39A 3TQMA 2JWOA 4ZYDA 2L3JA 4HEIA 3VYXA 4JI0E 3LLHA 3THOB 1BBOA 1BB8A 4R2SA 1IQSA 1SR9A 2L6MA 3KZYA 2LV2A 4LU9A 2ELZA 2EPNA 1MEYC 3HTXA 4DV6E 3VHTB 1EH8A 2EN4A 2CT1A 2DGCA 2EWLA 2LRSA 2EN1A 2VF1A 3FIGA 1N32E 1DQ3A 2CTDA 2D9HA 4BMJA 1HNZE 3DF6A 1L4SA 2RSMA 4BC9A 3M99B 5KL2A 2LVHA 4WFTA 1O0WA 1PKPA 2EN8A 4LFBE 2UXCE 2G7HA 1A1GA 2EPAA 1I94E 3MSWA 5IV8B 2JYAA 4NHRA 1JK2A 3ADJA 1WHQA 4WXCA 1RC7A
chains in the Genus database with same CATH topology
2EMZA 1JK1A 2MDGA 2WCC3 5KL6A 4F6NA 1X6HA 2NABA 1YUIA 2EN6A 2DLKA 5KL5A 2EOIA 2EN3A 2EL5A 2YTQA 4R2EA 2EOZA 2EOHA 2EOEA 2EQ3A 1LLMC 2EMYA 2EM6A 2YU8A 3UK3C 2EJ4A 2YTIA 2EM9A 2ENCA 4R2QA 2EOOA 4X9JA 2DMIA 1A1HA 2EMCA 2EN7A 2EOYA 2LO3A 2EM2A 1X6EA 2EOQA 1ZU1A 2EORA 5KL7A 1P47A 1A1KA 1X6FA 2DRPA 2JP9A 3EPHA 2EM0A 1G2FC 2GHFA 2EMXA 3MHSC 2EOXA 4F2JC 2EMHA 2EPUA 2MKDA 2YTFA 4R2DA 2EN2A 2CSHA 2EM4A 5KL4A 4F6MA 1A1IA 2EOFA 1KJKA 2ELYA 2DLQA 2EQ0A 2YTGA 2ADRA 2EPRA 1NCSA 4FK5C 2YTNA 2LCEA 1UN6B 1TN9A 2YTEA 2EMFA 1DGCA 1X5WA 2PRTA 3EPLA 1A1JA 1UBDC 2EMLA 2YTJA 2WBSA 2EM7A 2YU5A 3EPKA 2RPCA 3EPJA 2EPPA 2EPZA 2EOJA 2YTPA 4WSGA 2EPCA 2YRMA 2EL4A 1ZAAC 2EP3A 4R2RA 2ENAA 2EE8A 4R2CA 1F2IG 2M9AA 2J7JA 2EMGA 1A1FA 2EMWA 2MKNA 4IJDA 1BBOA 2WBTA 1BB8A 2R1FA 4R2SA 1TF3A 2WBUA 2LV2A 2ELZA 1Z1BA 1MEYC 4IS1C 2YSOA 2YTOA 2BB8A 1WJPA 2LT7A 2EMAA 3VHTB 2EOSA 2EN4A 2CT1A 2DGCA 2VRDA 1YSAC 2EN1A 1AAYA 2I13A 2CTDA 2D9HA 2EMIA 2EOMA 1TF6A 2YRKA 2RSIA 2EL6A 3M99B 5KL2A 2YRHA 2LVHA 2EMBA 2EMKA 4M9VC 2EM5A 2A25A 2EN8A 2ENHA 1A1LA 4R2PA 2EPXA 2EQ1A 1ZR9A 2EPAA 1A1GA 4R2AA 2E72A 2JPAA 1X3CA 2YTDA 3MHHC 2EM3A 1JK2A 2GLIA 1G2DC 1RMDA 1B69A 5KL3A 1YUJA 4GZNC 2YSPA 2HGHA 2EM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMZ A;  1JK1 A;  2MDG A;  2WCC 3;  5KL6 A;  4F6N A;  1X6H A;  2NAB A;  1YUI A;  2EN6 A;  2DLK A;  5KL5 A;  2EOI A;  2EN3 A;  2EL5 A;  2YTQ A;  4R2E A;  2EOZ A;  2EOH A;  2EOE A;  2EQ3 A;  1LLM C;  2EMY A;  2EM6 A;  2YU8 A;  3UK3 C;  2EJ4 A;  2YTI A;  2EM9 A;  2ENC A;  4R2Q A;  2EOO A;  4X9J A;  2DMI A;  1A1H A;  2EMC A;  2EN7 A;  2EOY A;  2LO3 A;  2EM2 A;  1X6E A;  2EOQ A;  1ZU1 A;  2EOR A;  5KL7 A;  1P47 A;  1A1K A;  1X6F A;  2DRP A;  2JP9 A;  3EPH A;  2EM0 A;  1G2F C;  2GHF A;  2EMX A;  3MHS C;  2EOX A;  4F2J C;  2EMH A;  2EPU A;  2MKD A;  2YTF A;  4R2D A;  2EN2 A;  2CSH A;  2EM4 A;  5KL4 A;  4F6M A;  1A1I A;  2EOF A;  1KJK A;  2ELY A;  2DLQ A;  2EQ0 A;  2YTG A;  2ADR A;  2EPR A;  1NCS A;  4FK5 C;  2YTN A;  2LCE A;  1UN6 B;  1TN9 A;  2YTE A;  2EMF A;  1DGC A;  1X5W A;  2PRT A;  3EPL A;  1A1J A;  1UBD C;  2EML A;  2YTJ A;  2WBS A;  2EM7 A;  2YU5 A;  3EPK A;  2RPC A;  3EPJ A;  2EPP A;  2EPZ A;  2EOJ A;  2YTP A;  4WSG A;  2EPC A;  2YRM A;  2EL4 A;  1ZAA C;  2EP3 A;  4R2R A;  2ENA A;  2EE8 A;  4R2C A;  1F2I G;  2M9A A;  2J7J A;  2EMG A;  1A1F A;  2EMW A;  2MKN A;  4IJD A;  1BBO A;  2WBT A;  1BB8 A;  2R1F A;  4R2S A;  1TF3 A;  2WBU A;  2LV2 A;  2ELZ A;  1Z1B A;  1MEY C;  4IS1 C;  2YSO A;  2YTO A;  2BB8 A;  1WJP A;  2LT7 A;  2EMA A;  3VHT B;  2EOS A;  2EN4 A;  2CT1 A;  2DGC A;  2VRD A;  1YSA C;  2EN1 A;  1AAY A;  2I13 A;  2CTD A;  2D9H A;  2EMI A;  2EOM A;  1TF6 A;  2YRK A;  2RSI A;  2EL6 A;  3M99 B;  5KL2 A;  2YRH A;  2LVH A;  2EMB A;  2EMK A;  4M9V C;  2EM5 A;  2A25 A;  2EN8 A;  2ENH A;  1A1L A;  4R2P A;  2EPX A;  2EQ1 A;  1ZR9 A;  2EPA A;  1A1G A;  4R2A A;  2E72 A;  2JPA A;  1X3C A;  2YTD A;  3MHH C;  2EM3 A;  1JK2 A;  2GLI A;  1G2D C;  1RMD A;  1B69 A;  5KL3 A;  1YUJ A;  4GZN C;  2YSP A;  2HGH A;  2EM8 A; 
#chains in the Genus database with same CATH topology
 2M4I A;  4RHB B;  1JK1 A;  2JR1 A;  2ODR D;  1QU6 A;  5KL6 A;  3ADG A;  2LTR A;  1WHN A;  2EPM X;  2B7V A;  2DLK A;  5F3W A;  4BBY A;  5A69 A;  5BR8 E;  2EN3 A;  4M0V A;  2EL5 A;  2B9D A;  2EOE A;  1LLM C;  4JI6 E;  2EMY A;  2EM6 A;  4B3R E;  2YT4 A;  3UK3 C;  2HHH E;  2ENC A;  3BID A;  2LTS A;  1T38 A;  2EOY A;  2LO3 A;  4Q35 B;  1HR0 E;  1P47 A;  1BBG A;  1ZU1 A;  3BBG A;  1A1K A;  2RS7 A;  3JTZ A;  2EM0 A;  3AV0 A;  2GHF A;  3MHS C;  5LMU E;  4J8Z A;  4LF4 E;  2MKD A;  2F8B A;  4DR3 E;  3LML A;  2KHX A;  2DLQ A;  3C4B A;  2L92 A;  2L33 A;  1RQ0 A;  3T1Y E;  4ZYH A;  2L8T A;  4F9C B;  1N34 E;  4OX9 E;  2EML A;  4HTG A;  2WBS A;  2YU5 A;  3RMP A;  3EPK A;  5IXM B;  2EPP A;  2EOJ A;  4DR7 E;  2HC5 A;  2YTP A;  4X66 E;  2MC5 A;  4WSG A;  1ZBT A;  2RQL A;  4R2R A;  1DI2 A;  3IWD A;  1IBM E;  2UXB E;  5AE2 A;  4DV5 E;  2MKN A;  2L2M A;  3F6H A;  2N3G A;  4DV0 E;  1PJT A;  4JI4 E;  3THN A;  5A2Q C;  4IS1 C;  2YTO A;  2BB8 A;  2LT7 A;  4GEQ B;  4P78 A;  2EOS A;  2MDR A;  2I13 A;  4KZS A;  3OTO E;  1UIL A;  4F9B B;  2RSI A;  1MGT A;  4MLQ A;  2DB2 A;  2EMB A;  2EMK A;  4DR5 E;  4BC7 A;  1WXR A;  2A25 A;  2FV4 B;  2ENH A;  2DIX A;  4R2P A;  2EQ1 A;  5A6B A;  1ZR9 A;  1X3C A;  1KYQ A;  1WRJ A;  5ADZ A;  2H36 X;  5IWA E;  2UU9 E;  2GLI A;  1G2D C;  1RMD A;  2LJU A;  4O5G A;  4KHP E;  1UHZ A;  2RS6 A;  2L2K B;  1X6H A;  4YY3 E;  3J80 C;  2VE7 C;  1YUI A;  1J26 A;  3IWC A;  4R03 A;  5KL5 A;  1YPN A;  1EH7 A;  1GZ6 A;  5AC4 A;  3JU0 A;  2EZ6 A;  5TSE A;  1PJS A;  3OML A;  2EJ4 A;  3J81 C;  2N8X A;  2EM9 A;  4R2Q A;  2EOO A;  4X9J A;  1A1H A;  2EMC A;  2EN7 A;  1X6E A;  2EOR A;  3KZZ A;  5KL7 A;  2DRP A;  2YPN A;  3EPH A;  2UXD E;  2BBG A;  5IT9 C;  5CFF E;  5A6B D;  2K4V A;  1YZ9 A;  2UUB E;  5KL4 A;  1FJG E;  2EOF A;  2ELY A;  1YYK A;  2V89 A;  2V88 A;  4BHB A;  3HPS A;  4FK5 C;  2LCE A;  1UN6 B;  2NUF A;  4DUZ E;  1TN9 A;  4JI3 E;  2EMF A;  2UUC E;  2DMY A;  4KWY A;  4DV2 E;  3F6G A;  1EKZ A;  4RH8 A;  2YTJ A;  3H09 A;  3C4T A;  4N4R B;  4NZV A;  5A6J A;  4I8O A;  4JI2 E;  1YYW A;  4DV3 E;  3C6M A;  2KOU A;  3VYY A;  2EL4 A;  1ZAA C;  2EP3 A;  4OOG C;  2ENA A;  4R2C A;  2IHR 1;  2EMG A;  1STU A;  1A1F A;  2EMW A;  4O43 A;  2B3T B;  2NUG A;  3J7Y p;  2WBT A;  4X62 E;  2B7T A;  1TF3 A;  2LE2 A;  2WBU A;  2HJJ A;  4LF5 E;  2M1S A;  2LUP B;  2EMA A;  3BF2 A;  4JI7 E;  2CPN A;  1X48 A;  5LL6 R;  3QG5 C;  2N3H A;  4M30 A;  2EOM A;  1TF6 A;  2ODR C;  4GKK E;  2YRK A;  3BGH A;  4O4K A;  3ZOQ B;  2JOB A;  2V8Q B;  4WPY A;  1GTK A;  4M2Z A;  2YRH A;  1IQO A;  2Q8U A;  4P7D A;  2EPX A;  4JV5 E;  2E5L E;  4DR6 E;  2E72 A;  1EH6 A;  3KWR A;  1XNR E;  2R76 A;  2LJH A;  2EM3 A;  4Q28 A;  2NUE A;  1IBL E;  4JYA E;  4L8N A;  5AC5 A;  2WZO A;  5AAS A;  5KL3 A;  5A6K A;  2YSP A;  2HGH A;  3K6Q A;  2F4V E;  4DMI A;  1YFH A;  2VQF E;  3HPZ A;  2VQE E;  2MDG A;  5AE3 A;  4DV1 E;  2RTX A;  1QNT A;  3JAM C;  4NXN E;  4R8O A;  3ECR A;  2UUA E;  2EOI A;  4BCA A;  2YZT A;  5LMN E;  2EOH A;  3ADI A;  2YTI A;  1ZBQ A;  2DMI A;  4LF9 E;  3VK6 A;  2EM2 A;  2EOQ A;  3J7A G;  1X6F A;  4DR1 E;  4L5N C;  2MC6 A;  1G2F C;  1PJQ A;  2EMX A;  5FLX C;  4F2J C;  4F54 A;  2EPU A;  3P1X A;  2YTF A;  1N3G A;  4R2D A;  2EN2 A;  2CSH A;  1A1I A;  4F6M A;  1KJK A;  2EPK X;  2V83 A;  3EQ1 A;  1HNX E;  1HNW E;  2YTG A;  1SFE A;  4LFC E;  1NCS A;  2YTN A;  4JI1 E;  4JI5 E;  2YTE A;  1DGC A;  3EPL A;  2LBS B;  1UBD C;  2LMZ A;  1AH5 A;  4X65 E;  2KON A;  4TUI A;  2M7Q A;  4O24 A;  2EM7 A;  2L3C A;  1T4O A;  3EPJ A;  1FKA E;  2EPZ A;  4LF7 E;  5A6A A;  2EPC A;  2FTX B;  1PDA A;  2E1M A;  2EE8 A;  1F2I G;  4GKJ E;  2M9A A;  2J7J A;  4DR4 E;  4MLV A;  2V85 A;  2FGG A;  4IJD A;  1IMU A;  1T4N A;  2R1F A;  4BS9 A;  4JI8 E;  4ZYG A;  1N36 E;  4F9A B;  1Z1B A;  5LLQ A;  2YSO A;  1WJP A;  4LF6 E;  1N33 E;  4YHH E;  2VRD A;  1YSA C;  1AAY A;  2JXP A;  2EMI A;  1T4L B;  4B3S E;  4LFA E;  4DR2 E;  3T1H E;  2EL6 A;  4WXD A;  1XMQ E;  4M9V C;  2EM5 A;  1A1L A;  5DNY A;  2JPA A;  4R2A A;  2YTD A;  3L00 A;  3MHH C;  2ZM6 E;  5T6J A;  1XNQ E;  2L2N A;  1B69 A;  2V86 A;  1YUJ A;  4GZN C;  2EM8 A;  4WSP A;  3C6K A;  2EMZ A;  3DJW A;  4B3T E;  4F6N A;  1X47 A;  3HXL A;  4X8W A;  3HQ1 A;  2WCC 3;  2NAB A;  4LF8 E;  2EN6 A;  2I9I A;  2JVA A;  2EPL X;  2YTQ A;  4R2E A;  2YWQ A;  4X64 E;  2EOZ A;  2EQ3 A;  2YU8 A;  4ZYE A;  2V87 A;  1GQE A;  2LUQ A;  4DV7 E;  2JP9 A;  4DKK A;  1NEI A;  1YYO A;  2EPO A;  4TUG A;  2EOX A;  4K0K E;  2JOX A;  4AQY E;  1XMO E;  2EMH A;  2K7I A;  2EM4 A;  2JY9 A;  2EQ0 A;  2ADR A;  2EPR A;  4DV4 E;  2GPI A;  1J5E E;  1IBK E;  4WX9 A;  1X5W A;  2PRT A;  1A1J A;  3IWB A;  4BHC A;  4DUY E;  4NXM E;  5AE1 A;  3ADL A;  2RPC A;  4WYQ B;  2NA2 A;  1X49 A;  4B3M E;  2YRM A;  2DSY A;  3AUZ A;  4LTY A;  1T39 A;  3TQM A;  2JWO A;  4ZYD A;  2L3J A;  4HEI A;  3VYX A;  4JI0 E;  3LLH A;  3THO B;  1BBO A;  1BB8 A;  4R2S A;  1IQS A;  1SR9 A;  2L6M A;  3KZY A;  2LV2 A;  4LU9 A;  2ELZ A;  2EPN A;  1MEY C;  3HTX A;  4DV6 E;  3VHT B;  1EH8 A;  2EN4 A;  2CT1 A;  2DGC A;  2EWL A;  2LRS A;  2EN1 A;  2VF1 A;  3FIG A;  1N32 E;  1DQ3 A;  2CTD A;  2D9H A;  4BMJ A;  1HNZ E;  3DF6 A;  1L4S A;  2RSM A;  4BC9 A;  3M99 B;  5KL2 A;  2LVH A;  4WFT A;  1O0W A;  1PKP A;  2EN8 A;  4LFB E;  2UXC E;  2G7H A;  1A1G A;  2EPA A;  1I94 E;  3MSW A;  5IV8 B;  2JYA A;  4NHR A;  1JK2 A;  3ADJ A;  1WHQ A;  4WXC A;  1RC7 A; 
#chains in the Genus database with same CATH homology
 2EMZ A;  1JK1 A;  2MDG A;  2WCC 3;  5KL6 A;  4F6N A;  1X6H A;  2NAB A;  1YUI A;  2EN6 A;  2DLK A;  5KL5 A;  2EOI A;  2EN3 A;  2EL5 A;  2YTQ A;  4R2E A;  2EOZ A;  2EOH A;  2EOE A;  2EQ3 A;  1LLM C;  2EMY A;  2EM6 A;  2YU8 A;  3UK3 C;  2EJ4 A;  2YTI A;  2EM9 A;  2ENC A;  4R2Q A;  2EOO A;  4X9J A;  2DMI A;  1A1H A;  2EMC A;  2EN7 A;  2EOY A;  2LO3 A;  2EM2 A;  1X6E A;  2EOQ A;  1ZU1 A;  2EOR A;  5KL7 A;  1P47 A;  1A1K A;  1X6F A;  2DRP A;  2JP9 A;  3EPH A;  2EM0 A;  1G2F C;  2GHF A;  2EMX A;  3MHS C;  2EOX A;  4F2J C;  2EMH A;  2EPU A;  2MKD A;  2YTF A;  4R2D A;  2EN2 A;  2CSH A;  2EM4 A;  5KL4 A;  4F6M A;  1A1I A;  2EOF A;  1KJK A;  2ELY A;  2DLQ A;  2EQ0 A;  2YTG A;  2ADR A;  2EPR A;  1NCS A;  4FK5 C;  2YTN A;  2LCE A;  1UN6 B;  1TN9 A;  2YTE A;  2EMF A;  1DGC A;  1X5W A;  2PRT A;  3EPL A;  1A1J A;  1UBD C;  2EML A;  2YTJ A;  2WBS A;  2EM7 A;  2YU5 A;  3EPK A;  2RPC A;  3EPJ A;  2EPP A;  2EPZ A;  2EOJ A;  2YTP A;  4WSG A;  2EPC A;  2YRM A;  2EL4 A;  1ZAA C;  2EP3 A;  4R2R A;  2ENA A;  2EE8 A;  4R2C A;  1F2I G;  2M9A A;  2J7J A;  2EMG A;  1A1F A;  2EMW A;  2MKN A;  4IJD A;  1BBO A;  2WBT A;  1BB8 A;  2R1F A;  4R2S A;  1TF3 A;  2WBU A;  2LV2 A;  2ELZ A;  1Z1B A;  1MEY C;  4IS1 C;  2YSO A;  2YTO A;  2BB8 A;  1WJP A;  2LT7 A;  2EMA A;  3VHT B;  2EOS A;  2EN4 A;  2CT1 A;  2DGC A;  2VRD A;  1YSA C;  2EN1 A;  1AAY A;  2I13 A;  2CTD A;  2D9H A;  2EMI A;  2EOM A;  1TF6 A;  2YRK A;  2RSI A;  2EL6 A;  3M99 B;  5KL2 A;  2YRH A;  2LVH A;  2EMB A;  2EMK A;  4M9V C;  2EM5 A;  2A25 A;  2EN8 A;  2ENH A;  1A1L A;  4R2P A;  2EPX A;  2EQ1 A;  1ZR9 A;  2EPA A;  1A1G A;  4R2A A;  2E72 A;  2JPA A;  1X3C A;  2YTD A;  3MHH C;  2EM3 A;  1JK2 A;  2GLI A;  1G2D C;  1RMD A;  1B69 A;  5KL3 A;  1YUJ A;  4GZN C;  2YSP A;  2HGH A;  2EM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...