4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
b'PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
2EMGA 2ELYA 5KL7A 1X6EA 4R2EA 2EN4A 2EOYA 2EMKA 5KL2A 1KJKA 2M9AA 2YSOA 2EMAA 2EOQA 4R2PA 2EPCA 4WSGA 2YRHA 5KL3A 4X9JA 1AAYA 2EOXA 2EM7A 1P47A 1A1IA 2JPAA 1TF6A 2YTEA 4R2DA 2EMZA 2EOEA 2EN7A 3EPKA 2YRMA 2MKDA 4F6MA 2WBSA 3EPHA 2YTNA 1X6FA 2EL4A 4F2JC 2EMYA 1YUJA 2ENAA 1B69A 2LCEA 2E72A 2CTDA 2EJ4A 2EM8A 1BB8A 1ZR9A 1G2DC 2MKNA 2YSPA 1WJPA 2YTPA 2EM9A 2ENCA 2EMBA 4F6NA 2DRPA 4GZNC 4R2AA 2CSHA 2EN3A 3UK3C 2BB8A 2EMIA 2EPZA 2HGHA 2LV2A 2EOSA 2DLKA 2RSIA 2EOHA 2EN2A 2EN8A 4R2QA 1A1HA 2EPXA 2EORA 1JK2A 2NABA 1LLMC 2LT7A 2EM4A 2YU8A 1JK1A 2YRKA 2ENHA 2YTQA 2CT1A 5KL4A 2YTIA 2EL5A 1X3CA 1UN6B 4R2RA 3EPLA 1F2IG 4M9VC 2YTOA 4IS1C 1ZAAC 2EPUA 2EQ1A 2EPPA 1Z1BA 4R2CA 2EN1A 4IJDA 1BBOA 2EOZA 2EL6A 2DGCA 2EM5A 1A1JA 2YTGA 2EOIA 2VRDA 1X5WA 2EOOA 1TF3A 2D9HA 2A25A 2YTDA 1X6HA 2EM3A 2EM0A 2EPAA 2WBUA 2YU5A 2LVHA 2EMCA 2WBTA 2I13A 1TN9A 2R1FA 2WCC3 2YTFA 1RMDA 2GLIA 1YSAC 2EOFA 3MHSC 1YUIA 5KL6A 2RPCA 1A1GA 2EP3A 3MHHC 1G2FC 2EMLA 1A1KA 3EPJA 1UBDC 2EM6A 1A1FA 2EMWA 2JP9A 2GHFA 2EM2A 1DGCA 2DMIA 2EMHA 2EOMA 2J7JA 3VHTB 2EMFA 1NCSA 2YTJA 2MDGA 2PRTA 2EQ3A 5KL5A 2DLQA 2LO3A 2EOJA 2EN6A 2EPRA 4FK5C 1ZU1A 1A1LA 2EE8A 2EQ0A 3M99B 1MEYC 2EMXA 4R2SA 2ADRA 2ELZA
chains in the Genus database with same CATH superfamily
4L8NA 2F4VE 1X6EA 1ZBQA 2EN4A 4X65E 4P7DA 2M9AA 4BHCA 2EOQA 4WSGA 3QG5C 2YRHA 5KL3A 4X9JA 4HEIA 2EM7A 5AE2A 3TQMA 2YTEA 4B3TE 3EPKA 5AE3A 2UXBE 2LJUA 2WBSA 3VYXA 1IQOA 3T1YE 1X6FA 2EL4A 4KZSA 1IMUA 4JYAE 5LL6R 3F6HA 4WYQB 1G2DC 3AUZA 5LLQA 2DRPA 2B7TA 2CSHA 3UK3C 1O0WA 3ECRA 1YZ9A 2DLKA 4DMIA 2EORA 3H09A 2LT7A 2Q8UA 1T39A 1RC7A 2L33A 2YU8A 5IWAE 1I94E 2I9IA 1GQEA 3P1XA 3HTXA 3EPLA 1KYQA 2LE2A 2B7VA 1HR0E 2YTOA 5CFFE 4IS1C 2E5LE 2RS6A 2EPPA 2L2MA 4R2CA 4IJDA 5ADZA 2EOZA 2HC5A 3OTOE 2EM5A 3IWDA 2NUGA 2YTDA 2K7IA 5LMUE 4BHBA 2K4VA 3KWRA 1T4LB 4RHBB 2WBTA 4BCAA 1TN9A 4GKKE 2R1FA 1BBGA 1YSAC 4DV5E 1YUIA 2MDRA 2N8XA 2L6MA 1A1GA 2EP3A 3ADIA 4JI5E 2LUPB 2ODRD 2M7QA 2EMLA 3BIDA 5AASA 3EPJA 4JI4E 4KWYA 2B3TB 4O43A 2JOXA 2EOMA 2LMZA 3VHTB 2RS7A 4R03A 2L3JA 2MDGA 3VK6A 1N33E 4DV7E 4DR1E 1HNWE 2DLQA 2EN6A 5F3WA 2EE8A 4M2ZA 2KOUA 1T38A 2VE7C 5LMNE 4JI8E 3RMPA 2V89A 1UILA 2NA2A 4LFCE 2ELYA 4WFTA 2UUBE 2DIXA 2LTSA 2RTXA 2YSOA 2EMAA 2L8TA 3T1HE 2LTRA 5A69A 1YYWA 2UXDE 1N34E 1AAYA 2H36X 2EOXA 1P47A 1A1IA 2JPAA 1TF6A 3ADJA 2MKDA 4F6MA 4F2JC 1X48A 2EMYA 2ENAA 1B69A 2LCEA 2FV4B 3ADGA 3LLHA 2CTDA 3C4BA 2EM8A 2ZM6E 4B3SE 1ZR9A 3THNA 2MKNA 2YSPA 3ZOQB 1WJPA 1J26A 3C4TA 1SFEA 2KONA 4DV6E 3J7AG 2KHXA 4F6NA 1XNQE 4GZNC 4I8OA 2EPNA 4WXDA 1MGTA 4X62E 4X66E 2LUQA 2EOSA 4O5GA 2EOHA 1YFHA 4R2QA 1A1HA 3F6GA 4JI7E 2NABA 4DV1E 4LF9E 2RQLA 1JK1A 2F8BA 4DR3E 2CT1A 5KL4A 2YTIA 1UN6B 4JV5E 1ZAAC 2N3GA 1T4NA 4DR6E 2V85A 1HNZE 3IWCA 4P78A 2DSYA 1YYOA 4LF8E 3C6MA 2B9DA 4YHHE 1DI2A 3VYYA 4MLQA 4OOGC 2EOIA 3KZZA 3HXLA 2VQEE 2JY9A 2A25A 4LU9A 2BBGA 4LF6E 3HPZA 1X6HA 3HPSA 2YU5A 4DV4E 4F9CB 2V86A 5IT9C 1IBLE 1AH5A 2IHR1 2I13A 1N36E 2YTFA 1RMDA 4L5NC 4O24A 4BBYA 2RPCA 1WXRA 1EH8A 1G2FC 2NUFA 5T6JA 5AC4A 1A1KA 1GTKA 3FIGA 2YPNA 1UBDC 2JP9A 2GHFA 4LF4E 1DGCA 2EMHA 2J7JA 4MLVA 2EMFA 1NCSA 1T4OA 4O4KA 5KL5A 2EOJA 2EPRA 3J81C 4FK5C 5A6AA 1ZU1A 5IV8B 1IBKE 2EQ0A 3M99B 1MEYC 5A6JA 4ZYHA 1X47A 2ADRA 2ELZA 3L00A 4JI3E 1IQSA 5KL7A 4R2EA 2EOYA 2EMKA 1IBME 1KJKA 3JTZA 2V88A 4BC7A 4B3ME 4J8ZA 1J5EE 4R2DA 2EMZA 2EOEA 2EZ6A 2YRMA 3BF2A 3OMLA 4AQYE 1YUJA 5A6BA 2JXPA 2EJ4A 4ZYDA 3ADLA 2EPMX 2UU9E 2YTPA 4JI6E 4F9BB 2ENCA 2JOBA 3IWBA 4R2AA 2EN3A 5AE1A 2EMIA 2HGHA 2VF1A 1UHZA 2JWOA 2EN2A 1JK2A 2LRSA 1YPNA 3J7Yp 2UXCE 1QU6A 2JVAA 4BC9A 2ENHA 2YTQA 2EL5A 1X3CA 4JI1E 4R2RA 1N3GA 2EQ1A 1Z1BA 1N32E 2EN1A 2EL6A 2DGCA 4NZVA 3C6KA 2YTGA 2VRDA 1X5WA 5A2QC 1L4SA 2YWQA 1EH6A 1WRJA 1TF3A 5DNYA 4WSPA 2EM3A 2EM0A 2RSMA 4WX9A 2YZTA 2EMCA 4DV3E 3THOB 2L92A 4DUZE 2WCC3 2EOFA 3MHSC 2V87A 5KL6A 1PJSA 3MHHC 3K6QA 1WHNA 1A1FA 1YYKA 2EMWA 3BBGA 1EH7A 3DJWA 2EM2A 1SR9A 3AV0A 2DMIA 2YTJA 2PRTA 2EQ3A 1STUA 2JYAA 4M30A 2JR1A 3LMLA 1EKZA 4JI2E 2R76A 4Q35B 1A1LA 1WHQA 2UUCE 2EMXA 4R2SA 5A6KA 4LFBE 2EMGA 4KHPE 2L2KB 1PKPA 5KL2A 2MC6A 4JI0E 2UUAE 1XMOE 4R2PA 4ZYGA 2EPCA 4F9AB 5A6BD 2V8QB 4ZYEA 4N4RB 4Q28A 4HTGA 1GZ6A 2MC5A 4DR4E 4X64E 2DB2A 2LBSB 1X49A 2EN7A 3EQ1A 2V83A 1PDAA 5TSEA 1PJQA 3JAMC 3EPHA 2YTNA 1FJGE 4DV0E 2M1SA 4M0VA 4LF7E 4WXCA 2E72A 2LJHA 1BB8A 4OX9E 1DQ3A 2YT4A 2EM9A 2ODRC 4DR7E 4DR5E 2EMBA 2DMYA 4B3RE 2BB8A 4NHRA 2EPZA 4YY3E 2EPOA 5FLXC 2LV2A 1ZBTA 2RSIA 4RH8A 2EN8A 1RQ0A 2EPXA 1XNRE 1LLMC 4GKJE 2EM4A 2YRKA 4LF5E 1HNXE 1F2IG 4M9VC 3J80C 2EPUA 2E1MA 2WZOA 2HHHE 4DUYE 1BBOA 1A1JA 2L2NA 3KZYA 4K0KE 2EOOA 1XMQE 5BR8E 2D9HA 1QNTA 2EPAA 2WBUA 4TUGA 2HJJA 3JU0A 2LVHA 4F54A 2FGGA 2NUEA 3MSWA 1PJTA 4LTYA 2GLIA 2VQFE 4BMJA 1NEIA 1FKAE 5IXMB 2FTXB 4DV2E 3HQ1A 4GEQB 4NXNE 5AC5A 2N3HA 4WPYA 2EM6A 4LFAE 4TUIA 4DR2E 3DF6A 4DKKA 4NXME 4X8WA 3BGHA 2L3CA 2G7HA 2LO3A 2EPLX 2GPIA 4R8OA 2EPKX 2M4IA 4BS9A 2EWLA 2CPNA
chains in the Genus database with same CATH topology
2EMGA 2ELYA 5KL7A 1X6EA 4R2EA 2EN4A 2EOYA 2EMKA 5KL2A 1KJKA 2M9AA 2YSOA 2EMAA 2EOQA 4R2PA 2EPCA 4WSGA 2YRHA 5KL3A 4X9JA 1AAYA 2EOXA 2EM7A 1P47A 1A1IA 2JPAA 1TF6A 2YTEA 4R2DA 2EMZA 2EOEA 2EN7A 3EPKA 2YRMA 2MKDA 4F6MA 2WBSA 3EPHA 2YTNA 1X6FA 2EL4A 4F2JC 2EMYA 1YUJA 2ENAA 1B69A 2LCEA 2E72A 2CTDA 2EJ4A 2EM8A 1BB8A 1ZR9A 1G2DC 2MKNA 2YSPA 1WJPA 2YTPA 2EM9A 2ENCA 2EMBA 4F6NA 2DRPA 4GZNC 4R2AA 2CSHA 2EN3A 3UK3C 2BB8A 2EMIA 2EPZA 2HGHA 2LV2A 2EOSA 2DLKA 2RSIA 2EOHA 2EN2A 2EN8A 4R2QA 1A1HA 2EPXA 2EORA 1JK2A 2NABA 1LLMC 2LT7A 2EM4A 2YU8A 1JK1A 2YRKA 2ENHA 2YTQA 2CT1A 5KL4A 2YTIA 2EL5A 1X3CA 1UN6B 4R2RA 3EPLA 1F2IG 4M9VC 2YTOA 4IS1C 1ZAAC 2EPUA 2EQ1A 2EPPA 1Z1BA 4R2CA 2EN1A 4IJDA 1BBOA 2EOZA 2EL6A 2DGCA 2EM5A 1A1JA 2YTGA 2EOIA 2VRDA 1X5WA 2EOOA 1TF3A 2D9HA 2A25A 2YTDA 1X6HA 2EM3A 2EM0A 2EPAA 2WBUA 2YU5A 2LVHA 2EMCA 2WBTA 2I13A 1TN9A 2R1FA 2WCC3 2YTFA 1RMDA 2GLIA 1YSAC 2EOFA 3MHSC 1YUIA 5KL6A 2RPCA 1A1GA 2EP3A 3MHHC 1G2FC 2EMLA 1A1KA 3EPJA 1UBDC 2EM6A 1A1FA 2EMWA 2JP9A 2GHFA 2EM2A 1DGCA 2DMIA 2EMHA 2EOMA 2J7JA 3VHTB 2EMFA 1NCSA 2YTJA 2MDGA 2PRTA 2EQ3A 5KL5A 2DLQA 2LO3A 2EOJA 2EN6A 2EPRA 4FK5C 1ZU1A 1A1LA 2EE8A 2EQ0A 3M99B 1MEYC 2EMXA 4R2SA 2ADRA 2ELZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMG A;  2ELY A;  5KL7 A;  1X6E A;  4R2E A;  2EN4 A;  2EOY A;  2EMK A;  5KL2 A;  1KJK A;  2M9A A;  2YSO A;  2EMA A;  2EOQ A;  4R2P A;  2EPC A;  4WSG A;  2YRH A;  5KL3 A;  4X9J A;  1AAY A;  2EOX A;  2EM7 A;  1P47 A;  1A1I A;  2JPA A;  1TF6 A;  2YTE A;  4R2D A;  2EMZ A;  2EOE A;  2EN7 A;  3EPK A;  2YRM A;  2MKD A;  4F6M A;  2WBS A;  3EPH A;  2YTN A;  1X6F A;  2EL4 A;  4F2J C;  2EMY A;  1YUJ A;  2ENA A;  1B69 A;  2LCE A;  2E72 A;  2CTD A;  2EJ4 A;  2EM8 A;  1BB8 A;  1ZR9 A;  1G2D C;  2MKN A;  2YSP A;  1WJP A;  2YTP A;  2EM9 A;  2ENC A;  2EMB A;  4F6N A;  2DRP A;  4GZN C;  4R2A A;  2CSH A;  2EN3 A;  3UK3 C;  2BB8 A;  2EMI A;  2EPZ A;  2HGH A;  2LV2 A;  2EOS A;  2DLK A;  2RSI A;  2EOH A;  2EN2 A;  2EN8 A;  4R2Q A;  1A1H A;  2EPX A;  2EOR A;  1JK2 A;  2NAB A;  1LLM C;  2LT7 A;  2EM4 A;  2YU8 A;  1JK1 A;  2YRK A;  2ENH A;  2YTQ A;  2CT1 A;  5KL4 A;  2YTI A;  2EL5 A;  1X3C A;  1UN6 B;  4R2R A;  3EPL A;  1F2I G;  4M9V C;  2YTO A;  4IS1 C;  1ZAA C;  2EPU A;  2EQ1 A;  2EPP A;  1Z1B A;  4R2C A;  2EN1 A;  4IJD A;  1BBO A;  2EOZ A;  2EL6 A;  2DGC A;  2EM5 A;  1A1J A;  2YTG A;  2EOI A;  2VRD A;  1X5W A;  2EOO A;  1TF3 A;  2D9H A;  2A25 A;  2YTD A;  1X6H A;  2EM3 A;  2EM0 A;  2EPA A;  2WBU A;  2YU5 A;  2LVH A;  2EMC A;  2WBT A;  2I13 A;  1TN9 A;  2R1F A;  2WCC 3;  2YTF A;  1RMD A;  2GLI A;  1YSA C;  2EOF A;  3MHS C;  1YUI A;  5KL6 A;  2RPC A;  1A1G A;  2EP3 A;  3MHH C;  1G2F C;  2EML A;  1A1K A;  3EPJ A;  1UBD C;  2EM6 A;  1A1F A;  2EMW A;  2JP9 A;  2GHF A;  2EM2 A;  1DGC A;  2DMI A;  2EMH A;  2EOM A;  2J7J A;  3VHT B;  2EMF A;  1NCS A;  2YTJ A;  2MDG A;  2PRT A;  2EQ3 A;  5KL5 A;  2DLQ A;  2LO3 A;  2EOJ A;  2EN6 A;  2EPR A;  4FK5 C;  1ZU1 A;  1A1L A;  2EE8 A;  2EQ0 A;  3M99 B;  1MEY C;  2EMX A;  4R2S A;  2ADR A;  2ELZ A; 
#chains in the Genus database with same CATH topology
 4L8N A;  2F4V E;  1X6E A;  1ZBQ A;  2EN4 A;  4X65 E;  4P7D A;  2M9A A;  4BHC A;  2EOQ A;  4WSG A;  3QG5 C;  2YRH A;  5KL3 A;  4X9J A;  4HEI A;  2EM7 A;  5AE2 A;  3TQM A;  2YTE A;  4B3T E;  3EPK A;  5AE3 A;  2UXB E;  2LJU A;  2WBS A;  3VYX A;  1IQO A;  3T1Y E;  1X6F A;  2EL4 A;  4KZS A;  1IMU A;  4JYA E;  5LL6 R;  3F6H A;  4WYQ B;  1G2D C;  3AUZ A;  5LLQ A;  2DRP A;  2B7T A;  2CSH A;  3UK3 C;  1O0W A;  3ECR A;  1YZ9 A;  2DLK A;  4DMI A;  2EOR A;  3H09 A;  2LT7 A;  2Q8U A;  1T39 A;  1RC7 A;  2L33 A;  2YU8 A;  5IWA E;  1I94 E;  2I9I A;  1GQE A;  3P1X A;  3HTX A;  3EPL A;  1KYQ A;  2LE2 A;  2B7V A;  1HR0 E;  2YTO A;  5CFF E;  4IS1 C;  2E5L E;  2RS6 A;  2EPP A;  2L2M A;  4R2C A;  4IJD A;  5ADZ A;  2EOZ A;  2HC5 A;  3OTO E;  2EM5 A;  3IWD A;  2NUG A;  2YTD A;  2K7I A;  5LMU E;  4BHB A;  2K4V A;  3KWR A;  1T4L B;  4RHB B;  2WBT A;  4BCA A;  1TN9 A;  4GKK E;  2R1F A;  1BBG A;  1YSA C;  4DV5 E;  1YUI A;  2MDR A;  2N8X A;  2L6M A;  1A1G A;  2EP3 A;  3ADI A;  4JI5 E;  2LUP B;  2ODR D;  2M7Q A;  2EML A;  3BID A;  5AAS A;  3EPJ A;  4JI4 E;  4KWY A;  2B3T B;  4O43 A;  2JOX A;  2EOM A;  2LMZ A;  3VHT B;  2RS7 A;  4R03 A;  2L3J A;  2MDG A;  3VK6 A;  1N33 E;  4DV7 E;  4DR1 E;  1HNW E;  2DLQ A;  2EN6 A;  5F3W A;  2EE8 A;  4M2Z A;  2KOU A;  1T38 A;  2VE7 C;  5LMN E;  4JI8 E;  3RMP A;  2V89 A;  1UIL A;  2NA2 A;  4LFC E;  2ELY A;  4WFT A;  2UUB E;  2DIX A;  2LTS A;  2RTX A;  2YSO A;  2EMA A;  2L8T A;  3T1H E;  2LTR A;  5A69 A;  1YYW A;  2UXD E;  1N34 E;  1AAY A;  2H36 X;  2EOX A;  1P47 A;  1A1I A;  2JPA A;  1TF6 A;  3ADJ A;  2MKD A;  4F6M A;  4F2J C;  1X48 A;  2EMY A;  2ENA A;  1B69 A;  2LCE A;  2FV4 B;  3ADG A;  3LLH A;  2CTD A;  3C4B A;  2EM8 A;  2ZM6 E;  4B3S E;  1ZR9 A;  3THN A;  2MKN A;  2YSP A;  3ZOQ B;  1WJP A;  1J26 A;  3C4T A;  1SFE A;  2KON A;  4DV6 E;  3J7A G;  2KHX A;  4F6N A;  1XNQ E;  4GZN C;  4I8O A;  2EPN A;  4WXD A;  1MGT A;  4X62 E;  4X66 E;  2LUQ A;  2EOS A;  4O5G A;  2EOH A;  1YFH A;  4R2Q A;  1A1H A;  3F6G A;  4JI7 E;  2NAB A;  4DV1 E;  4LF9 E;  2RQL A;  1JK1 A;  2F8B A;  4DR3 E;  2CT1 A;  5KL4 A;  2YTI A;  1UN6 B;  4JV5 E;  1ZAA C;  2N3G A;  1T4N A;  4DR6 E;  2V85 A;  1HNZ E;  3IWC A;  4P78 A;  2DSY A;  1YYO A;  4LF8 E;  3C6M A;  2B9D A;  4YHH E;  1DI2 A;  3VYY A;  4MLQ A;  4OOG C;  2EOI A;  3KZZ A;  3HXL A;  2VQE E;  2JY9 A;  2A25 A;  4LU9 A;  2BBG A;  4LF6 E;  3HPZ A;  1X6H A;  3HPS A;  2YU5 A;  4DV4 E;  4F9C B;  2V86 A;  5IT9 C;  1IBL E;  1AH5 A;  2IHR 1;  2I13 A;  1N36 E;  2YTF A;  1RMD A;  4L5N C;  4O24 A;  4BBY A;  2RPC A;  1WXR A;  1EH8 A;  1G2F C;  2NUF A;  5T6J A;  5AC4 A;  1A1K A;  1GTK A;  3FIG A;  2YPN A;  1UBD C;  2JP9 A;  2GHF A;  4LF4 E;  1DGC A;  2EMH A;  2J7J A;  4MLV A;  2EMF A;  1NCS A;  1T4O A;  4O4K A;  5KL5 A;  2EOJ A;  2EPR A;  3J81 C;  4FK5 C;  5A6A A;  1ZU1 A;  5IV8 B;  1IBK E;  2EQ0 A;  3M99 B;  1MEY C;  5A6J A;  4ZYH A;  1X47 A;  2ADR A;  2ELZ A;  3L00 A;  4JI3 E;  1IQS A;  5KL7 A;  4R2E A;  2EOY A;  2EMK A;  1IBM E;  1KJK A;  3JTZ A;  2V88 A;  4BC7 A;  4B3M E;  4J8Z A;  1J5E E;  4R2D A;  2EMZ A;  2EOE A;  2EZ6 A;  2YRM A;  3BF2 A;  3OML A;  4AQY E;  1YUJ A;  5A6B A;  2JXP A;  2EJ4 A;  4ZYD A;  3ADL A;  2EPM X;  2UU9 E;  2YTP A;  4JI6 E;  4F9B B;  2ENC A;  2JOB A;  3IWB A;  4R2A A;  2EN3 A;  5AE1 A;  2EMI A;  2HGH A;  2VF1 A;  1UHZ A;  2JWO A;  2EN2 A;  1JK2 A;  2LRS A;  1YPN A;  3J7Y p;  2UXC E;  1QU6 A;  2JVA A;  4BC9 A;  2ENH A;  2YTQ A;  2EL5 A;  1X3C A;  4JI1 E;  4R2R A;  1N3G A;  2EQ1 A;  1Z1B A;  1N32 E;  2EN1 A;  2EL6 A;  2DGC A;  4NZV A;  3C6K A;  2YTG A;  2VRD A;  1X5W A;  5A2Q C;  1L4S A;  2YWQ A;  1EH6 A;  1WRJ A;  1TF3 A;  5DNY A;  4WSP A;  2EM3 A;  2EM0 A;  2RSM A;  4WX9 A;  2YZT A;  2EMC A;  4DV3 E;  3THO B;  2L92 A;  4DUZ E;  2WCC 3;  2EOF A;  3MHS C;  2V87 A;  5KL6 A;  1PJS A;  3MHH C;  3K6Q A;  1WHN A;  1A1F A;  1YYK A;  2EMW A;  3BBG A;  1EH7 A;  3DJW A;  2EM2 A;  1SR9 A;  3AV0 A;  2DMI A;  2YTJ A;  2PRT A;  2EQ3 A;  1STU A;  2JYA A;  4M30 A;  2JR1 A;  3LML A;  1EKZ A;  4JI2 E;  2R76 A;  4Q35 B;  1A1L A;  1WHQ A;  2UUC E;  2EMX A;  4R2S A;  5A6K A;  4LFB E;  2EMG A;  4KHP E;  2L2K B;  1PKP A;  5KL2 A;  2MC6 A;  4JI0 E;  2UUA E;  1XMO E;  4R2P A;  4ZYG A;  2EPC A;  4F9A B;  5A6B D;  2V8Q B;  4ZYE A;  4N4R B;  4Q28 A;  4HTG A;  1GZ6 A;  2MC5 A;  4DR4 E;  4X64 E;  2DB2 A;  2LBS B;  1X49 A;  2EN7 A;  3EQ1 A;  2V83 A;  1PDA A;  5TSE A;  1PJQ A;  3JAM C;  3EPH A;  2YTN A;  1FJG E;  4DV0 E;  2M1S A;  4M0V A;  4LF7 E;  4WXC A;  2E72 A;  2LJH A;  1BB8 A;  4OX9 E;  1DQ3 A;  2YT4 A;  2EM9 A;  2ODR C;  4DR7 E;  4DR5 E;  2EMB A;  2DMY A;  4B3R E;  2BB8 A;  4NHR A;  2EPZ A;  4YY3 E;  2EPO A;  5FLX C;  2LV2 A;  1ZBT A;  2RSI A;  4RH8 A;  2EN8 A;  1RQ0 A;  2EPX A;  1XNR E;  1LLM C;  4GKJ E;  2EM4 A;  2YRK A;  4LF5 E;  1HNX E;  1F2I G;  4M9V C;  3J80 C;  2EPU A;  2E1M A;  2WZO A;  2HHH E;  4DUY E;  1BBO A;  1A1J A;  2L2N A;  3KZY A;  4K0K E;  2EOO A;  1XMQ E;  5BR8 E;  2D9H A;  1QNT A;  2EPA A;  2WBU A;  4TUG A;  2HJJ A;  3JU0 A;  2LVH A;  4F54 A;  2FGG A;  2NUE A;  3MSW A;  1PJT A;  4LTY A;  2GLI A;  2VQF E;  4BMJ A;  1NEI A;  1FKA E;  5IXM B;  2FTX B;  4DV2 E;  3HQ1 A;  4GEQ B;  4NXN E;  5AC5 A;  2N3H A;  4WPY A;  2EM6 A;  4LFA E;  4TUI A;  4DR2 E;  3DF6 A;  4DKK A;  4NXM E;  4X8W A;  3BGH A;  2L3C A;  2G7H A;  2LO3 A;  2EPL X;  2GPI A;  4R8O A;  2EPK X;  2M4I A;  4BS9 A;  2EWL A;  2CPN A; 
#chains in the Genus database with same CATH homology
 2EMG A;  2ELY A;  5KL7 A;  1X6E A;  4R2E A;  2EN4 A;  2EOY A;  2EMK A;  5KL2 A;  1KJK A;  2M9A A;  2YSO A;  2EMA A;  2EOQ A;  4R2P A;  2EPC A;  4WSG A;  2YRH A;  5KL3 A;  4X9J A;  1AAY A;  2EOX A;  2EM7 A;  1P47 A;  1A1I A;  2JPA A;  1TF6 A;  2YTE A;  4R2D A;  2EMZ A;  2EOE A;  2EN7 A;  3EPK A;  2YRM A;  2MKD A;  4F6M A;  2WBS A;  3EPH A;  2YTN A;  1X6F A;  2EL4 A;  4F2J C;  2EMY A;  1YUJ A;  2ENA A;  1B69 A;  2LCE A;  2E72 A;  2CTD A;  2EJ4 A;  2EM8 A;  1BB8 A;  1ZR9 A;  1G2D C;  2MKN A;  2YSP A;  1WJP A;  2YTP A;  2EM9 A;  2ENC A;  2EMB A;  4F6N A;  2DRP A;  4GZN C;  4R2A A;  2CSH A;  2EN3 A;  3UK3 C;  2BB8 A;  2EMI A;  2EPZ A;  2HGH A;  2LV2 A;  2EOS A;  2DLK A;  2RSI A;  2EOH A;  2EN2 A;  2EN8 A;  4R2Q A;  1A1H A;  2EPX A;  2EOR A;  1JK2 A;  2NAB A;  1LLM C;  2LT7 A;  2EM4 A;  2YU8 A;  1JK1 A;  2YRK A;  2ENH A;  2YTQ A;  2CT1 A;  5KL4 A;  2YTI A;  2EL5 A;  1X3C A;  1UN6 B;  4R2R A;  3EPL A;  1F2I G;  4M9V C;  2YTO A;  4IS1 C;  1ZAA C;  2EPU A;  2EQ1 A;  2EPP A;  1Z1B A;  4R2C A;  2EN1 A;  4IJD A;  1BBO A;  2EOZ A;  2EL6 A;  2DGC A;  2EM5 A;  1A1J A;  2YTG A;  2EOI A;  2VRD A;  1X5W A;  2EOO A;  1TF3 A;  2D9H A;  2A25 A;  2YTD A;  1X6H A;  2EM3 A;  2EM0 A;  2EPA A;  2WBU A;  2YU5 A;  2LVH A;  2EMC A;  2WBT A;  2I13 A;  1TN9 A;  2R1F A;  2WCC 3;  2YTF A;  1RMD A;  2GLI A;  1YSA C;  2EOF A;  3MHS C;  1YUI A;  5KL6 A;  2RPC A;  1A1G A;  2EP3 A;  3MHH C;  1G2F C;  2EML A;  1A1K A;  3EPJ A;  1UBD C;  2EM6 A;  1A1F A;  2EMW A;  2JP9 A;  2GHF A;  2EM2 A;  1DGC A;  2DMI A;  2EMH A;  2EOM A;  2J7J A;  3VHT B;  2EMF A;  1NCS A;  2YTJ A;  2MDG A;  2PRT A;  2EQ3 A;  5KL5 A;  2DLQ A;  2LO3 A;  2EOJ A;  2EN6 A;  2EPR A;  4FK5 C;  1ZU1 A;  1A1L A;  2EE8 A;  2EQ0 A;  3M99 B;  1MEY C;  2EMX A;  4R2S A;  2ADR A;  2ELZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...