4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
1A1LA 2WBTA 2YTOA 2EPUA 1KJKA 1TN9A 4R2CA 2D9HA 2CTDA 2LCEA 5KL3A 2ELZA 2EOXA 1A1HA 2EMAA 5KL7A 1TF6A 2JP9A 1LLMC 5KL2A 2EN8A 2EPAA 2VRDA 2EQ3A 2EL6A 1B69A 2GLIA 2EMKA 3VHTB 1UN6B 1BBOA 2EOOA 1P47A 2BB8A 2E72A 2RSIA 2EPCA 4WSGA 4R2PA 2YU8A 1A1GA 2EPPA 1X5WA 2EM2A 4R2RA 1BB8A 3MHHC 2EMLA 2EM3A 2EOHA 2NABA 2JPAA 1WJPA 1ZR9A 2EN3A 2EMIA 2R1FA 2EM8A 2EM4A 2YTEA 2EQ0A 3M99B 2EN2A 4IJDA 1A1IA 3MHSC 2HGHA 2EOQA 2ELYA 2DRPA 2EMYA 5KL6A 2EPXA 2YSPA 1JK1A 2YSOA 5KL5A 2EM7A 2DMIA 5KL4A 1YUJA 2GHFA 2ENHA 2EPZA 2LVHA 2J7JA 2MDGA 2MKDA 2EMGA 2YTPA 4F6NA 4R2AA 4R2DA 4M9VC 2WCC3 2YTQA 1AAYA 1G2DC 2YTDA 2EN1A 4IS1C 1X6EA 2EN6A 2YTFA 2YRHA 2EM6A 2YTNA 1NCSA 2EN7A 2YTIA 1A1FA 1UBDC 2ENCA 2EM9A 2EOIA 1X6HA 1YUIA 4R2EA 2M9AA 2EOJA 2EP3A 1X6FA 2YTJA 1ZU1A 1JK2A 2WBSA 1X3CA 4GZNC 2LO3A 2EQ1A 2EOMA 3EPKA 1G2FC 3EPHA 2EOSA 2EMBA 4R2QA 2EMZA 2EN4A 2EOEA 4R2SA 3EPJA 2A25A 2YRKA 1YSAC 2YTGA 2CT1A 4FK5C 2EL5A 2EMCA 1A1KA 1F2IG 2YRMA 1Z1BA 2WBUA 2RPCA 2EOZA 1RMDA 1MEYC 2DGCA 2EOFA 2ENAA 2EOYA 2EMXA 2EORA 3EPLA 2CSHA 2EMFA 2EMHA 2DLKA 4X9JA 2EMWA 2MKNA 2YU5A 1DGCA 2EJ4A 2EM5A 1TF3A 2EE8A 1A1JA 2I13A 2EPRA 2DLQA 2PRTA 4F2JC 1ZAAC 4F6MA 3UK3C 2ADRA 2EM0A 2EL4A 2LT7A 2LV2A
chains in the Genus database with same CATH superfamily
3VYYA 2WBTA 2EPUA 2Q8UA 2DMYA 5TSEA 2EWLA 4JI6E 2ODRC 2LJUA 4DV2E 2DIXA 2CTDA 2FGGA 5KL3A 2EOXA 2EMAA 5KL7A 4DV4E 2H36X 5A2QC 5KL2A 2VRDA 2EL6A 1X48A 2L6MA 1HNXE 4KWYA 1HNZE 2EOOA 3DF6A 2UUBE 2BB8A 2RSIA 4DUZE 4WSGA 5A6JA 1IQSA 1GTKA 2YU8A 4X62E 2NUGA 1X5WA 4DR5E 2JPAA 2VQEE 1ZR9A 2V83A 2EMIA 1EH6A 2B9DA 2R1FA 2RS6A 4NHRA 3ZOQB 2KOUA 2L2MA 1SR9A 2NA2A 4WX9A 4LTYA 4DR2E 4DR7E 2ELYA 3T1YE 3J7AG 2EMYA 5KL6A 2YSOA 2BBGA 1DQ3A 1YUJA 1T4OA 3DJWA 2F8BA 2EPZA 3BGHA 3FIGA 3EQ1A 4F6NA 4RHBB 5LLQA 4R8OA 3THOB 4M9VC 2WCC3 2YTQA 4JI8E 4IS1C 1XMOE 2ODRD 1RC7A 4MLQA 5LMUE 2E5LE 2EN7A 1IBME 2RQLA 3JAMC 2EOIA 1YUIA 3HTXA 2EP3A 1X6FA 2N8XA 4BMJA 2RTXA 2L3JA 3EPKA 2UUCE 3EPHA 2EOSA 2EMBA 3BF2A 3OTOE 3EPJA 4DR1E 3HQ1A 5BR8E 4BHCA 4FK5C 4M0VA 4JI4E 1F2IG 2WBUA 2RPCA 4LF7E 3HXLA 4ZYEA 1J5EE 1WRJA 5IT9C 1YZ9A 2M7QA 2EMFA 4N4RB 2DLKA 4F9AB 4M30A 2MKNA 2YU5A 2EJ4A 2EM5A 2I13A 2EE8A 4F54A 2DLQA 2PRTA 1ZAAC 3UK3C 2JR1A 2EL4A 2R76A 2YTOA 4LF4E 1A1HA 1TF6A 2ELZA 2EN8A 4JI1E 1STUA 4BC7A 1HR0E 4JI7E 3VHTB 4LF6E 5FLXC 1BBOA 5A6BA 1GZ6A 4ZYDA 1IMUA 5DNYA 1N32E 2UU9E 4R2RA 1BB8A 4B3ME 3IWDA 4F9CB 2UUAE 2LTRA 2EMLA 2EM3A 4R03A 2NABA 1I94E 2CPNA 2HHHE 2EN3A 2YTEA 3LLHA 2EQ0A 3VYXA 4O24A 1HNWE 4IJDA 2NUEA 3MHSC 4LU9A 3P1XA 2EPLX 2EPKX 5A6AA 2EM7A 2DMIA 1EH7A 3C6KA 1IBLE 4LFBE 2ENHA 1PDAA 3OMLA 4J8ZA 2LVHA 2J7JA 1YPNA 2WZOA 2JOBA 2V85A 3ADIA 1AAYA 2YTDA 2L3CA 1X6EA 2EN6A 1KYQA 2YTFA 5LMNE 5IXMB 1PJSA 3C4TA 1X6HA 1XNRE 4R2EA 2EOJA 4BBYA 2YTJA 3KZZA 2N3HA 1JK2A 4DR3E 1IQOA 1EH8A 5F3WA 2EOMA 1G2FC 4ZYHA 3ADLA 3BBGA 2EOEA 4R2SA 4JI0E 2LJHA 2CT1A 2EL5A 4I8OA 5LL6R 1A1KA 3T1HE 4WYQB 1Z1BA 2DGCA 2EOFA 5T6JA 2EOYA 2EORA 2UXCE 2VE7C 3TQMA 4DV1E 2EZ6A 4X9JA 2EMWA 1DGCA 1UILA 1TF3A 4DV5E 1A1JA 2JWOA 3LMLA 4O5GA 4Q35B 4BHBA 2MC5A 1A1LA 4JYAE 1UHZA 3MSWA 4ZYGA 1N36E 4BCAA 3J7Yp 2YPNA 2V87A 2D9HA 5AC5A 2LCEA 4P7DA 4LF8E 1LLMC 1O0WA 2L33A 2GLIA 2F4VE 2B7VA 5A6KA 3F6HA 1UN6B 2K7IA 1YYOA 3ADGA 2L2NA 4F9BB 5ADZA 4DV6E 4GKKE 4P78A 2DB2A 2DSYA 2EPCA 2EPOA 2JYAA 4O4KA 2JY9A 1T4NA 4L8NA 1A1GA 3ADJA 2EPPA 4NXME 3MHHC 2N3GA 3KZYA 1XMQE 4X66E 4GEQB 2EM4A 3JU0A 4WFTA 5AE2A 3AV0A 2EN2A 2HGHA 2FTXB 2V88A 1MGTA 3THNA 2KHXA 2LUPB 4TUGA 1JK1A 2YSPA 2LUQA 2MDRA 5AASA 5KL5A 2G7HA 2RSMA 5KL4A 4DUYE 3IWBA 1YFHA 3IWCA 5IWAE 2YTPA 2ZM6E 1DI2A 5AE1A 4R2DA 1PKPA 1BBGA 3ECRA 3BIDA 4DKKA 2EN1A 4DV0E 1T4LB 4DR4E 1A1FA 1UBDC 2ENCA 2HC5A 2LTSA 4L5NC 2YT4A 3C6MA 3HPSA 1ZU1A 2JOXA 2VQFE 2WBSA 2EPMX 1X3CA 2L92A 2EQ1A 5A6BD 4B3TE 2EMZA 2EN4A 1WHQA 4Q28A 2B3TB 1AH5A 2FV4B 2A25A 4KZSA 2YRKA 1YSAC 2V89A 2EMCA 4JI5E 3VK6A 4OX9E 2YRMA 2K4VA 1NEIA 2JVAA 3JTZA 4LF5E 3QG5C 3EPLA 4DR6E 2V86A 5IV8B 2CSHA 1FKAE 4LFAE 4X65E 1J26A 1WHNA 2EPRA 4F2JC 3J80C 1N3GA 2ADRA 2E1MA 3H09A 2EM0A 1IBKE 4DV7E 2EPNA 1KJKA 5AC4A 1TN9A 4JI3E 1N33E 4KHPE 1RQ0A 3J81C 4R2CA 4OOGC 4LF9E 2LBSB 4O43A 2JP9A 2UXBE 2EPAA 2EQ3A 1B69A 2LE2A 2EMKA 1N34E 1GQEA 1P47A 2E72A 4X64E 3AUZA 4R2PA 4HTGA 1ZBTA 2KONA 2UXDE 2EM2A 1X47A 2EOHA 1WJPA 1QNTA 1YYKA 3M99B 2EM8A 2M1SA 1PJQA 2VF1A 4K0KE 4TUIA 1ZBQA 1A1IA 4WXDA 1T38A 2EOQA 2L2KB 4B3RE 4BS9A 2DRPA 2EPXA 3L00A 4HEIA 2LRSA 1EKZA 1T39A 2GHFA 4YY3E 2YWQA 1X49A 4MLVA 2L8TA 2MDGA 2MKDA 2EMGA 4R2AA 1G2DC 1WXRA 2NUFA 1XNQE 2YRHA 1QU6A 2EM6A 2I9IA 2YTNA 4WPYA 1NCSA 1PJTA 2YTIA 2JXPA 2EM9A 4RH8A 2M9AA 2B7TA 4AQYE 2M4IA 4NXNE 4GZNC 1SFEA 2LO3A 4JI2E 2HJJA 1FJGE 2IHR1 4NZVA 4X8WA 5CFFE 4R2QA 4WSPA 5A69A 1L4SA 3KWRA 2MC6A 4LFCE 2YTGA 3RMPA 2LMZA 2RS7A 3F6GA 2YZTA 4YHHE 2EOZA 1RMDA 1MEYC 4M2ZA 4GKJE 2ENAA 4B3SE 2EMXA 3C4BA 4DV3E 4DMIA 2GPIA 2EMHA 1YYWA 2V8QB 3HPZA 5AE3A 4F6MA 4BC9A 3K6QA 4WXCA 4JV5E 2LT7A 2LV2A
chains in the Genus database with same CATH topology
1A1LA 2WBTA 2YTOA 2EPUA 1KJKA 1TN9A 4R2CA 2D9HA 2CTDA 2LCEA 5KL3A 2ELZA 2EOXA 1A1HA 2EMAA 5KL7A 1TF6A 2JP9A 1LLMC 5KL2A 2EN8A 2EPAA 2VRDA 2EQ3A 2EL6A 1B69A 2GLIA 2EMKA 3VHTB 1UN6B 1BBOA 2EOOA 1P47A 2BB8A 2E72A 2RSIA 2EPCA 4WSGA 4R2PA 2YU8A 1A1GA 2EPPA 1X5WA 2EM2A 4R2RA 1BB8A 3MHHC 2EMLA 2EM3A 2EOHA 2NABA 2JPAA 1WJPA 1ZR9A 2EN3A 2EMIA 2R1FA 2EM8A 2EM4A 2YTEA 2EQ0A 3M99B 2EN2A 4IJDA 1A1IA 3MHSC 2HGHA 2EOQA 2ELYA 2DRPA 2EMYA 5KL6A 2EPXA 2YSPA 1JK1A 2YSOA 5KL5A 2EM7A 2DMIA 5KL4A 1YUJA 2GHFA 2ENHA 2EPZA 2LVHA 2J7JA 2MDGA 2MKDA 2EMGA 2YTPA 4F6NA 4R2AA 4R2DA 4M9VC 2WCC3 2YTQA 1AAYA 1G2DC 2YTDA 2EN1A 4IS1C 1X6EA 2EN6A 2YTFA 2YRHA 2EM6A 2YTNA 1NCSA 2EN7A 2YTIA 1A1FA 1UBDC 2ENCA 2EM9A 2EOIA 1X6HA 1YUIA 4R2EA 2M9AA 2EOJA 2EP3A 1X6FA 2YTJA 1ZU1A 1JK2A 2WBSA 1X3CA 4GZNC 2LO3A 2EQ1A 2EOMA 3EPKA 1G2FC 3EPHA 2EOSA 2EMBA 4R2QA 2EMZA 2EN4A 2EOEA 4R2SA 3EPJA 2A25A 2YRKA 1YSAC 2YTGA 2CT1A 4FK5C 2EL5A 2EMCA 1A1KA 1F2IG 2YRMA 1Z1BA 2WBUA 2RPCA 2EOZA 1RMDA 1MEYC 2DGCA 2EOFA 2ENAA 2EOYA 2EMXA 2EORA 3EPLA 2CSHA 2EMFA 2EMHA 2DLKA 4X9JA 2EMWA 2MKNA 2YU5A 1DGCA 2EJ4A 2EM5A 1TF3A 2EE8A 1A1JA 2I13A 2EPRA 2DLQA 2PRTA 4F2JC 1ZAAC 4F6MA 3UK3C 2ADRA 2EM0A 2EL4A 2LT7A 2LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1L A;  2WBT A;  2YTO A;  2EPU A;  1KJK A;  1TN9 A;  4R2C A;  2D9H A;  2CTD A;  2LCE A;  5KL3 A;  2ELZ A;  2EOX A;  1A1H A;  2EMA A;  5KL7 A;  1TF6 A;  2JP9 A;  1LLM C;  5KL2 A;  2EN8 A;  2EPA A;  2VRD A;  2EQ3 A;  2EL6 A;  1B69 A;  2GLI A;  2EMK A;  3VHT B;  1UN6 B;  1BBO A;  2EOO A;  1P47 A;  2BB8 A;  2E72 A;  2RSI A;  2EPC A;  4WSG A;  4R2P A;  2YU8 A;  1A1G A;  2EPP A;  1X5W A;  2EM2 A;  4R2R A;  1BB8 A;  3MHH C;  2EML A;  2EM3 A;  2EOH A;  2NAB A;  2JPA A;  1WJP A;  1ZR9 A;  2EN3 A;  2EMI A;  2R1F A;  2EM8 A;  2EM4 A;  2YTE A;  2EQ0 A;  3M99 B;  2EN2 A;  4IJD A;  1A1I A;  3MHS C;  2HGH A;  2EOQ A;  2ELY A;  2DRP A;  2EMY A;  5KL6 A;  2EPX A;  2YSP A;  1JK1 A;  2YSO A;  5KL5 A;  2EM7 A;  2DMI A;  5KL4 A;  1YUJ A;  2GHF A;  2ENH A;  2EPZ A;  2LVH A;  2J7J A;  2MDG A;  2MKD A;  2EMG A;  2YTP A;  4F6N A;  4R2A A;  4R2D A;  4M9V C;  2WCC 3;  2YTQ A;  1AAY A;  1G2D C;  2YTD A;  2EN1 A;  4IS1 C;  1X6E A;  2EN6 A;  2YTF A;  2YRH A;  2EM6 A;  2YTN A;  1NCS A;  2EN7 A;  2YTI A;  1A1F A;  1UBD C;  2ENC A;  2EM9 A;  2EOI A;  1X6H A;  1YUI A;  4R2E A;  2M9A A;  2EOJ A;  2EP3 A;  1X6F A;  2YTJ A;  1ZU1 A;  1JK2 A;  2WBS A;  1X3C A;  4GZN C;  2LO3 A;  2EQ1 A;  2EOM A;  3EPK A;  1G2F C;  3EPH A;  2EOS A;  2EMB A;  4R2Q A;  2EMZ A;  2EN4 A;  2EOE A;  4R2S A;  3EPJ A;  2A25 A;  2YRK A;  1YSA C;  2YTG A;  2CT1 A;  4FK5 C;  2EL5 A;  2EMC A;  1A1K A;  1F2I G;  2YRM A;  1Z1B A;  2WBU A;  2RPC A;  2EOZ A;  1RMD A;  1MEY C;  2DGC A;  2EOF A;  2ENA A;  2EOY A;  2EMX A;  2EOR A;  3EPL A;  2CSH A;  2EMF A;  2EMH A;  2DLK A;  4X9J A;  2EMW A;  2MKN A;  2YU5 A;  1DGC A;  2EJ4 A;  2EM5 A;  1TF3 A;  2EE8 A;  1A1J A;  2I13 A;  2EPR A;  2DLQ A;  2PRT A;  4F2J C;  1ZAA C;  4F6M A;  3UK3 C;  2ADR A;  2EM0 A;  2EL4 A;  2LT7 A;  2LV2 A; 
#chains in the Genus database with same CATH topology
 3VYY A;  2WBT A;  2EPU A;  2Q8U A;  2DMY A;  5TSE A;  2EWL A;  4JI6 E;  2ODR C;  2LJU A;  4DV2 E;  2DIX A;  2CTD A;  2FGG A;  5KL3 A;  2EOX A;  2EMA A;  5KL7 A;  4DV4 E;  2H36 X;  5A2Q C;  5KL2 A;  2VRD A;  2EL6 A;  1X48 A;  2L6M A;  1HNX E;  4KWY A;  1HNZ E;  2EOO A;  3DF6 A;  2UUB E;  2BB8 A;  2RSI A;  4DUZ E;  4WSG A;  5A6J A;  1IQS A;  1GTK A;  2YU8 A;  4X62 E;  2NUG A;  1X5W A;  4DR5 E;  2JPA A;  2VQE E;  1ZR9 A;  2V83 A;  2EMI A;  1EH6 A;  2B9D A;  2R1F A;  2RS6 A;  4NHR A;  3ZOQ B;  2KOU A;  2L2M A;  1SR9 A;  2NA2 A;  4WX9 A;  4LTY A;  4DR2 E;  4DR7 E;  2ELY A;  3T1Y E;  3J7A G;  2EMY A;  5KL6 A;  2YSO A;  2BBG A;  1DQ3 A;  1YUJ A;  1T4O A;  3DJW A;  2F8B A;  2EPZ A;  3BGH A;  3FIG A;  3EQ1 A;  4F6N A;  4RHB B;  5LLQ A;  4R8O A;  3THO B;  4M9V C;  2WCC 3;  2YTQ A;  4JI8 E;  4IS1 C;  1XMO E;  2ODR D;  1RC7 A;  4MLQ A;  5LMU E;  2E5L E;  2EN7 A;  1IBM E;  2RQL A;  3JAM C;  2EOI A;  1YUI A;  3HTX A;  2EP3 A;  1X6F A;  2N8X A;  4BMJ A;  2RTX A;  2L3J A;  3EPK A;  2UUC E;  3EPH A;  2EOS A;  2EMB A;  3BF2 A;  3OTO E;  3EPJ A;  4DR1 E;  3HQ1 A;  5BR8 E;  4BHC A;  4FK5 C;  4M0V A;  4JI4 E;  1F2I G;  2WBU A;  2RPC A;  4LF7 E;  3HXL A;  4ZYE A;  1J5E E;  1WRJ A;  5IT9 C;  1YZ9 A;  2M7Q A;  2EMF A;  4N4R B;  2DLK A;  4F9A B;  4M30 A;  2MKN A;  2YU5 A;  2EJ4 A;  2EM5 A;  2I13 A;  2EE8 A;  4F54 A;  2DLQ A;  2PRT A;  1ZAA C;  3UK3 C;  2JR1 A;  2EL4 A;  2R76 A;  2YTO A;  4LF4 E;  1A1H A;  1TF6 A;  2ELZ A;  2EN8 A;  4JI1 E;  1STU A;  4BC7 A;  1HR0 E;  4JI7 E;  3VHT B;  4LF6 E;  5FLX C;  1BBO A;  5A6B A;  1GZ6 A;  4ZYD A;  1IMU A;  5DNY A;  1N32 E;  2UU9 E;  4R2R A;  1BB8 A;  4B3M E;  3IWD A;  4F9C B;  2UUA E;  2LTR A;  2EML A;  2EM3 A;  4R03 A;  2NAB A;  1I94 E;  2CPN A;  2HHH E;  2EN3 A;  2YTE A;  3LLH A;  2EQ0 A;  3VYX A;  4O24 A;  1HNW E;  4IJD A;  2NUE A;  3MHS C;  4LU9 A;  3P1X A;  2EPL X;  2EPK X;  5A6A A;  2EM7 A;  2DMI A;  1EH7 A;  3C6K A;  1IBL E;  4LFB E;  2ENH A;  1PDA A;  3OML A;  4J8Z A;  2LVH A;  2J7J A;  1YPN A;  2WZO A;  2JOB A;  2V85 A;  3ADI A;  1AAY A;  2YTD A;  2L3C A;  1X6E A;  2EN6 A;  1KYQ A;  2YTF A;  5LMN E;  5IXM B;  1PJS A;  3C4T A;  1X6H A;  1XNR E;  4R2E A;  2EOJ A;  4BBY A;  2YTJ A;  3KZZ A;  2N3H A;  1JK2 A;  4DR3 E;  1IQO A;  1EH8 A;  5F3W A;  2EOM A;  1G2F C;  4ZYH A;  3ADL A;  3BBG A;  2EOE A;  4R2S A;  4JI0 E;  2LJH A;  2CT1 A;  2EL5 A;  4I8O A;  5LL6 R;  1A1K A;  3T1H E;  4WYQ B;  1Z1B A;  2DGC A;  2EOF A;  5T6J A;  2EOY A;  2EOR A;  2UXC E;  2VE7 C;  3TQM A;  4DV1 E;  2EZ6 A;  4X9J A;  2EMW A;  1DGC A;  1UIL A;  1TF3 A;  4DV5 E;  1A1J A;  2JWO A;  3LML A;  4O5G A;  4Q35 B;  4BHB A;  2MC5 A;  1A1L A;  4JYA E;  1UHZ A;  3MSW A;  4ZYG A;  1N36 E;  4BCA A;  3J7Y p;  2YPN A;  2V87 A;  2D9H A;  5AC5 A;  2LCE A;  4P7D A;  4LF8 E;  1LLM C;  1O0W A;  2L33 A;  2GLI A;  2F4V E;  2B7V A;  5A6K A;  3F6H A;  1UN6 B;  2K7I A;  1YYO A;  3ADG A;  2L2N A;  4F9B B;  5ADZ A;  4DV6 E;  4GKK E;  4P78 A;  2DB2 A;  2DSY A;  2EPC A;  2EPO A;  2JYA A;  4O4K A;  2JY9 A;  1T4N A;  4L8N A;  1A1G A;  3ADJ A;  2EPP A;  4NXM E;  3MHH C;  2N3G A;  3KZY A;  1XMQ E;  4X66 E;  4GEQ B;  2EM4 A;  3JU0 A;  4WFT A;  5AE2 A;  3AV0 A;  2EN2 A;  2HGH A;  2FTX B;  2V88 A;  1MGT A;  3THN A;  2KHX A;  2LUP B;  4TUG A;  1JK1 A;  2YSP A;  2LUQ A;  2MDR A;  5AAS A;  5KL5 A;  2G7H A;  2RSM A;  5KL4 A;  4DUY E;  3IWB A;  1YFH A;  3IWC A;  5IWA E;  2YTP A;  2ZM6 E;  1DI2 A;  5AE1 A;  4R2D A;  1PKP A;  1BBG A;  3ECR A;  3BID A;  4DKK A;  2EN1 A;  4DV0 E;  1T4L B;  4DR4 E;  1A1F A;  1UBD C;  2ENC A;  2HC5 A;  2LTS A;  4L5N C;  2YT4 A;  3C6M A;  3HPS A;  1ZU1 A;  2JOX A;  2VQF E;  2WBS A;  2EPM X;  1X3C A;  2L92 A;  2EQ1 A;  5A6B D;  4B3T E;  2EMZ A;  2EN4 A;  1WHQ A;  4Q28 A;  2B3T B;  1AH5 A;  2FV4 B;  2A25 A;  4KZS A;  2YRK A;  1YSA C;  2V89 A;  2EMC A;  4JI5 E;  3VK6 A;  4OX9 E;  2YRM A;  2K4V A;  1NEI A;  2JVA A;  3JTZ A;  4LF5 E;  3QG5 C;  3EPL A;  4DR6 E;  2V86 A;  5IV8 B;  2CSH A;  1FKA E;  4LFA E;  4X65 E;  1J26 A;  1WHN A;  2EPR A;  4F2J C;  3J80 C;  1N3G A;  2ADR A;  2E1M A;  3H09 A;  2EM0 A;  1IBK E;  4DV7 E;  2EPN A;  1KJK A;  5AC4 A;  1TN9 A;  4JI3 E;  1N33 E;  4KHP E;  1RQ0 A;  3J81 C;  4R2C A;  4OOG C;  4LF9 E;  2LBS B;  4O43 A;  2JP9 A;  2UXB E;  2EPA A;  2EQ3 A;  1B69 A;  2LE2 A;  2EMK A;  1N34 E;  1GQE A;  1P47 A;  2E72 A;  4X64 E;  3AUZ A;  4R2P A;  4HTG A;  1ZBT A;  2KON A;  2UXD E;  2EM2 A;  1X47 A;  2EOH A;  1WJP A;  1QNT A;  1YYK A;  3M99 B;  2EM8 A;  2M1S A;  1PJQ A;  2VF1 A;  4K0K E;  4TUI A;  1ZBQ A;  1A1I A;  4WXD A;  1T38 A;  2EOQ A;  2L2K B;  4B3R E;  4BS9 A;  2DRP A;  2EPX A;  3L00 A;  4HEI A;  2LRS A;  1EKZ A;  1T39 A;  2GHF A;  4YY3 E;  2YWQ A;  1X49 A;  4MLV A;  2L8T A;  2MDG A;  2MKD A;  2EMG A;  4R2A A;  1G2D C;  1WXR A;  2NUF A;  1XNQ E;  2YRH A;  1QU6 A;  2EM6 A;  2I9I A;  2YTN A;  4WPY A;  1NCS A;  1PJT A;  2YTI A;  2JXP A;  2EM9 A;  4RH8 A;  2M9A A;  2B7T A;  4AQY E;  2M4I A;  4NXN E;  4GZN C;  1SFE A;  2LO3 A;  4JI2 E;  2HJJ A;  1FJG E;  2IHR 1;  4NZV A;  4X8W A;  5CFF E;  4R2Q A;  4WSP A;  5A69 A;  1L4S A;  3KWR A;  2MC6 A;  4LFC E;  2YTG A;  3RMP A;  2LMZ A;  2RS7 A;  3F6G A;  2YZT A;  4YHH E;  2EOZ A;  1RMD A;  1MEY C;  4M2Z A;  4GKJ E;  2ENA A;  4B3S E;  2EMX A;  3C4B A;  4DV3 E;  4DMI A;  2GPI A;  2EMH A;  1YYW A;  2V8Q B;  3HPZ A;  5AE3 A;  4F6M A;  4BC9 A;  3K6Q A;  4WXC A;  4JV5 E;  2LT7 A;  2LV2 A; 
#chains in the Genus database with same CATH homology
 1A1L A;  2WBT A;  2YTO A;  2EPU A;  1KJK A;  1TN9 A;  4R2C A;  2D9H A;  2CTD A;  2LCE A;  5KL3 A;  2ELZ A;  2EOX A;  1A1H A;  2EMA A;  5KL7 A;  1TF6 A;  2JP9 A;  1LLM C;  5KL2 A;  2EN8 A;  2EPA A;  2VRD A;  2EQ3 A;  2EL6 A;  1B69 A;  2GLI A;  2EMK A;  3VHT B;  1UN6 B;  1BBO A;  2EOO A;  1P47 A;  2BB8 A;  2E72 A;  2RSI A;  2EPC A;  4WSG A;  4R2P A;  2YU8 A;  1A1G A;  2EPP A;  1X5W A;  2EM2 A;  4R2R A;  1BB8 A;  3MHH C;  2EML A;  2EM3 A;  2EOH A;  2NAB A;  2JPA A;  1WJP A;  1ZR9 A;  2EN3 A;  2EMI A;  2R1F A;  2EM8 A;  2EM4 A;  2YTE A;  2EQ0 A;  3M99 B;  2EN2 A;  4IJD A;  1A1I A;  3MHS C;  2HGH A;  2EOQ A;  2ELY A;  2DRP A;  2EMY A;  5KL6 A;  2EPX A;  2YSP A;  1JK1 A;  2YSO A;  5KL5 A;  2EM7 A;  2DMI A;  5KL4 A;  1YUJ A;  2GHF A;  2ENH A;  2EPZ A;  2LVH A;  2J7J A;  2MDG A;  2MKD A;  2EMG A;  2YTP A;  4F6N A;  4R2A A;  4R2D A;  4M9V C;  2WCC 3;  2YTQ A;  1AAY A;  1G2D C;  2YTD A;  2EN1 A;  4IS1 C;  1X6E A;  2EN6 A;  2YTF A;  2YRH A;  2EM6 A;  2YTN A;  1NCS A;  2EN7 A;  2YTI A;  1A1F A;  1UBD C;  2ENC A;  2EM9 A;  2EOI A;  1X6H A;  1YUI A;  4R2E A;  2M9A A;  2EOJ A;  2EP3 A;  1X6F A;  2YTJ A;  1ZU1 A;  1JK2 A;  2WBS A;  1X3C A;  4GZN C;  2LO3 A;  2EQ1 A;  2EOM A;  3EPK A;  1G2F C;  3EPH A;  2EOS A;  2EMB A;  4R2Q A;  2EMZ A;  2EN4 A;  2EOE A;  4R2S A;  3EPJ A;  2A25 A;  2YRK A;  1YSA C;  2YTG A;  2CT1 A;  4FK5 C;  2EL5 A;  2EMC A;  1A1K A;  1F2I G;  2YRM A;  1Z1B A;  2WBU A;  2RPC A;  2EOZ A;  1RMD A;  1MEY C;  2DGC A;  2EOF A;  2ENA A;  2EOY A;  2EMX A;  2EOR A;  3EPL A;  2CSH A;  2EMF A;  2EMH A;  2DLK A;  4X9J A;  2EMW A;  2MKN A;  2YU5 A;  1DGC A;  2EJ4 A;  2EM5 A;  1TF3 A;  2EE8 A;  1A1J A;  2I13 A;  2EPR A;  2DLQ A;  2PRT A;  4F2J C;  1ZAA C;  4F6M A;  3UK3 C;  2ADR A;  2EM0 A;  2EL4 A;  2LT7 A;  2LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...