4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
2EPPA 1ZU1A 2EM9A 2LVHA 2DMIA 1TF3A 1JK2A 1A1GA 5KL7A 2I13A 2EM8A 1RMDA 2EM6A 2EN7A 1X5WA 2RSIA 2MKNA 1X6EA 1DGCA 4R2EA 2EOHA 3MHHC 2YTIA 2ENCA 1A1IA 4R2SA 2EMYA 2LCEA 3UK3C 1TN9A 2EP3A 2ADRA 2EMWA 2YTEA 5KL2A 1ZAAC 2EPXA 2E72A 2EN6A 2EMIA 1KJKA 2JP9A 2EL5A 2YSPA 2DGCA 2EOQA 2R1FA 4GZNC 2EMFA 1A1KA 2A25A 2ENAA 2EOOA 1B69A 2YTJA 2WBSA 2ELZA 2ELYA 2CSHA 2YRKA 2YRMA 2EORA 2EN3A 1YUIA 2EM5A 2EOEA 3EPLA 4IS1C 2PRTA 2CTDA 2EMCA 2WCC3 2EJ4A 2YTGA 2GHFA 1BBOA 1YSAC 2EL6A 2YU5A 1YUJA 2EN4A 2EN8A 1UBDC 3MHSC 4F6MA 2EMHA 1MEYC 2EM4A 2WBUA 2ENHA 3EPJA 2EM0A 2M9AA 2EQ0A 2LO3A 2GLIA 2D9HA 2DLQA 4WSGA 2EL4A 1NCSA 1ZR9A 4R2RA 4R2CA 2EPRA 3VHTB 3EPHA 2J7JA 2EM3A 2EOFA 2EN2A 2LV2A 2YTNA 2YTOA 2EN1A 2EOJA 1G2DC 2YU8A 5KL3A 1JK1A 2EPUA 2EOXA 2EM2A 2RPCA 2EQ3A 4F2JC 1X6HA 2EOSA 2EMXA 4R2PA 2JPAA 2EMAA 2EOIA 2MDGA 1A1JA 2DLKA 1AAYA 1TF6A 2CT1A 1X3CA 2MKDA 2EMKA 1A1LA 4R2QA 2HGHA 5KL6A 2YTPA 5KL5A 2EMGA 1LLMC 4R2AA 1F2IG 1G2FC 2EM7A 1A1FA 2EPCA 4M9VC 2EOZA 3M99B 1P47A 1A1HA 2DRPA 3EPKA 4F6NA 2YRHA 2EOMA 2EPAA 1X6FA 2YTQA 4R2DA 1Z1BA 2BB8A 1WJPA 2YTDA 1BB8A 2LT7A 5KL4A 2YTFA 2EMZA 4IJDA 2EQ1A 2EMLA 2YSOA 2VRDA 2EE8A 2EPZA 4FK5C 1UN6B 2NABA 2EOYA 2WBTA 4X9JA 2EMBA
chains in the Genus database with same CATH superfamily
2DMIA 5A6AA 2I13A 4BHBA 2LJUA 2EM6A 2RSIA 3OTOE 2RTXA 1PJSA 1DGCA 3VYXA 1X49A 2ENCA 2L6MA 3ADGA 4DV1E 3IWDA 4L8NA 2VE7C 2L3JA 4BCAA 1QU6A 4JI4E 1XMOE 1X47A 3BGHA 2R1FA 4GZNC 4JI3E 2HHHE 2NUGA 4NXME 1GTKA 1YZ9A 4P78A 3F6HA 1STUA 2YTJA 3BF2A 2WBSA 2UU9E 2EPKX 2YRMA 2EN3A 1YUIA 2PRTA 1NEIA 1IQOA 1YYWA 2EWLA 4JI5E 3ADIA 2WCC3 5AC4A 2LE2A 3K6QA 2EL6A 2YU5A 1UBDC 3MHSC 2F4VE 2G7HA 2EMHA 1SFEA 4X66E 3EPJA 4NZVA 2V86A 1J26A 3EQ1A 4R03A 2EL4A 3BIDA 4M2ZA 4R2CA 3VHTB 1PDAA 4BBYA 1XNQE 4JI0E 2LV2A 1G2DC 4B3ME 1N3GA 1HNWE 2EOXA 4AQYE 4F2JC 5AE1A 4R2PA 4DR1E 3VK6A 1L4SA 5F3WA 4I8OA 4GKKE 3LMLA 2FTXB 4B3RE 2L2MA 2N3GA 4HTGA 5KL6A 2YTPA 5KL5A 2EMGA 4M0VA 4R2AA 1F2IG 2K4VA 2EPCA 3M99B 2LTSA 4BMJA 4WSPA 1P47A 4F6NA 2DRPA 2V83A 3KWRA 4Q35B 4LFBE 3HXLA 3TQMA 4DR5E 3ADLA 1Z1BA 2LT7A 5IV8B 4MLQA 3RMPA 4F9BB 4DUZE 2YT4A 3LLHA 2JWOA 4K0KE 4GKJE 1UHZA 2EMLA 2VRDA 4DV3E 1EH8A 3C4TA 2RQLA 5AASA 3J81C 2EMBA 2EPPA 2EM9A 4J8ZA 1A1GA 4BC9A 1TF3A 5A2QC 1JK2A 5KL7A 2EM8A 2ODRD 3BBGA 1YYKA 1X5WA 3JU0A 4TUIA 3IWCA 4R2EA 2LUPB 1A1IA 2IHR1 4LF8E 2EMYA 4ZYGA 2GPIA 4ZYEA 5ADZA 4YY3E 2EL5A 5LMUE 2EPMX 1IBKE 4JI6E 2N8XA 2JYAA 4F9AB 2DB2A 2YRKA 2EORA 4YHHE 2EOEA 4IS1C 3C6KA 2L92A 2EJ4A 1WHQA 1PJQA 2EN4A 2EN8A 2L8TA 1YPNA 3F6GA 4MLVA 2WBUA 3HQ1A 2EM0A 4WPYA 2K7IA 5BR8E 2GLIA 2HC5A 2DLQA 4JI8E 4WSGA 4BS9A 2DIXA 4KHPE 1N33E 2YTOA 2M4IA 2EN1A 2EOJA 4GEQB 5KL3A 1JK1A 2JOXA 3JTZA 2EOSA 2EMXA 2EMAA 2H36X 5LLQA 2MDGA 1TF6A 2LMZA 3DF6A 2CT1A 4BHCA 1X3CA 2MKDA 2B7TA 4R2QA 4F54A 2YZTA 2DMYA 2EM7A 4WFTA 2UUAE 4WYQB 2V85A 1PKPA 2VQFE 4L5NC 4DR7E 4JV5E 2YTQA 2EZ6A 4F9CB 2BB8A 2YTDA 4LU9A 2I9IA 4O5GA 1IQSA 3FIGA 2YTFA 2V88A 2RS7A 4DV0E 5LL6R 1DI2A 4O43A 2EQ1A 2LRSA 2EPOA 4DV4E 1N36E 3THNA 2EPZA 4FK5C 2JOBA 1UN6B 2LUQA 2NABA 2ODRC 1MGTA 3THOB 4X9JA 3J80C 4WX9A 4WXCA 5A6BD 1XNRE 1RMDA 1T4LB 1X6EA 1T4OA 5A6BA 4LF7E 5TSEA 1QNTA 3KZZA 2LCEA 2MC5A 3HPSA 2E1MA 3UK3C 1TN9A 1HR0E 3MSWA 2ADRA 2EMWA 3DJWA 2E72A 3KZYA 1ZBQA 2YSPA 1EKZA 2DGCA 1IMUA 4LTYA 5AC5A 5AE2A 2ENAA 3IWBA 1B69A 1EH7A 3P1XA 3QG5C 1FKAE 2B7VA 3AV0A 2CSHA 4X64E 4ZYDA 2EM5A 2NUFA 2UXBE 5LMNE 1N34E 4DR4E 2B9DA 2EMCA 2UXDE 2YTGA 4X62E 1IBME 2GHFA 4DMIA 1BBOA 1O0WA 4Q28A 1YSAC 5DNYA 2V8QB 2ENHA 3L00A 2LJHA 1NCSA 1ZR9A 4X8WA 4R2RA 3OMLA 2E5LE 1XMQE 2FGGA 5IWAE 3EPHA 2J7JA 1SR9A 2EM3A 4LF6E 2EN2A 4RHBB 4DV7E 2YTNA 4DKKA 2DSYA 1X48A 2N3HA 2EPUA 4TUGA 4DV6E 2EM2A 2RPCA 2EQ3A 2KONA 4LFCE 2JPAA 4LFAE 4X65E 1GZ6A 3ZOQB 4DR3E 1N32E 2HGHA 2YWQA 5A6KA 1PJTA 3HPZA 4KWYA 1G2FC 2L2NA 2YPNA 4WXDA 4LF4E 2VF1A 4DV5E 1A1HA 4O4KA 3JAMC 2EOMA 4N4RB 2M7QA 2EPAA 4R2DA 3C6MA 5A69A 1ZBTA 1HNZE 1T39A 1AH5A 2NA2A 2EMZA 2L2KB 4R8OA 4JYAE 2EOYA 2WBTA 2EPLX 1WHNA 2R76A 1ZU1A 5FLXC 2LVHA 4B3TE 4JI1E 2BBGA 2EN7A 2MC6A 1FJGE 2B3TB 2MKNA 1WXRA 3VYYA 2EOHA 2LTRA 3MHHC 2YTIA 4NXNE 2JXPA 2NUEA 1KYQA 4OX9E 3J7AG 4R2SA 3ADJA 1T4NA 2EP3A 2UUCE 2V87A 2YTEA 5KL2A 1ZAAC 2EPXA 2EN6A 2KHXA 4BC7A 2EMIA 1KJKA 1T38A 2JP9A 5A6JA 4RH8A 2EOQA 2EMFA 5T6JA 5IT9C 1A1KA 2A25A 2EOOA 2UUBE 2ELZA 4OOGC 1RC7A 2ELYA 2JVAA 4M30A 3T1HE 3EPLA 2CTDA 4DUYE 1YUJA 3T1YE 4F6MA 1MEYC 2EM4A 2L3CA 2JR1A 4JI7E 1I94E 2M9AA 4LF5E 1YYOA 1YFHA 2EQ0A 2LO3A 2V89A 1EH6A 2D9HA 2CPNA 2EPRA 2ZM6E 2LBSB 2F8BA 3AUZA 2EOFA 3HTXA 4DV2E 5AE3A 4NHRA 4JI2E 1UILA 2YU8A 4HEIA 4ZYHA 1WRJA 1X6HA 1HNXE 2EOIA 2HJJA 1A1JA 2DLKA 1BBGA 2M1SA 3C4BA 1AAYA 1RQ0A 4DR6E 2L33A 2RS6A 2UXCE 2EMKA 1A1LA 4LF9E 4KZSA 2WZOA 3J7Yp 1LLMC 4B3SE 1A1FA 4M9VC 5IXMB 2EOZA 2FV4B 3EPKA 2YRHA 1GQEA 4O24A 2VQEE 4P7DA 1X6FA 2JY9A 5CFFE 1WJPA 1BB8A 1J5EE 5KL4A 3H09A 4DR2E 1DQ3A 2MDRA 4IJDA 3ECRA 2KOUA 2Q8UA 2YSOA 2EE8A 2RSMA 1IBLE 2EPNA
chains in the Genus database with same CATH topology
2EPPA 1ZU1A 2EM9A 2LVHA 2DMIA 1TF3A 1JK2A 1A1GA 5KL7A 2I13A 2EM8A 1RMDA 2EM6A 2EN7A 1X5WA 2RSIA 2MKNA 1X6EA 1DGCA 4R2EA 2EOHA 3MHHC 2YTIA 2ENCA 1A1IA 4R2SA 2EMYA 2LCEA 3UK3C 1TN9A 2EP3A 2ADRA 2EMWA 2YTEA 5KL2A 1ZAAC 2EPXA 2E72A 2EN6A 2EMIA 1KJKA 2JP9A 2EL5A 2YSPA 2DGCA 2EOQA 2R1FA 4GZNC 2EMFA 1A1KA 2A25A 2ENAA 2EOOA 1B69A 2YTJA 2WBSA 2ELZA 2ELYA 2CSHA 2YRKA 2YRMA 2EORA 2EN3A 1YUIA 2EM5A 2EOEA 3EPLA 4IS1C 2PRTA 2CTDA 2EMCA 2WCC3 2EJ4A 2YTGA 2GHFA 1BBOA 1YSAC 2EL6A 2YU5A 1YUJA 2EN4A 2EN8A 1UBDC 3MHSC 4F6MA 2EMHA 1MEYC 2EM4A 2WBUA 2ENHA 3EPJA 2EM0A 2M9AA 2EQ0A 2LO3A 2GLIA 2D9HA 2DLQA 4WSGA 2EL4A 1NCSA 1ZR9A 4R2RA 4R2CA 2EPRA 3VHTB 3EPHA 2J7JA 2EM3A 2EOFA 2EN2A 2LV2A 2YTNA 2YTOA 2EN1A 2EOJA 1G2DC 2YU8A 5KL3A 1JK1A 2EPUA 2EOXA 2EM2A 2RPCA 2EQ3A 4F2JC 1X6HA 2EOSA 2EMXA 4R2PA 2JPAA 2EMAA 2EOIA 2MDGA 1A1JA 2DLKA 1AAYA 1TF6A 2CT1A 1X3CA 2MKDA 2EMKA 1A1LA 4R2QA 2HGHA 5KL6A 2YTPA 5KL5A 2EMGA 1LLMC 4R2AA 1F2IG 1G2FC 2EM7A 1A1FA 2EPCA 4M9VC 2EOZA 3M99B 1P47A 1A1HA 2DRPA 3EPKA 4F6NA 2YRHA 2EOMA 2EPAA 1X6FA 2YTQA 4R2DA 1Z1BA 2BB8A 1WJPA 2YTDA 1BB8A 2LT7A 5KL4A 2YTFA 2EMZA 4IJDA 2EQ1A 2EMLA 2YSOA 2VRDA 2EE8A 2EPZA 4FK5C 1UN6B 2NABA 2EOYA 2WBTA 4X9JA 2EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  1ZU1 A;  2EM9 A;  2LVH A;  2DMI A;  1TF3 A;  1JK2 A;  1A1G A;  5KL7 A;  2I13 A;  2EM8 A;  1RMD A;  2EM6 A;  2EN7 A;  1X5W A;  2RSI A;  2MKN A;  1X6E A;  1DGC A;  4R2E A;  2EOH A;  3MHH C;  2YTI A;  2ENC A;  1A1I A;  4R2S A;  2EMY A;  2LCE A;  3UK3 C;  1TN9 A;  2EP3 A;  2ADR A;  2EMW A;  2YTE A;  5KL2 A;  1ZAA C;  2EPX A;  2E72 A;  2EN6 A;  2EMI A;  1KJK A;  2JP9 A;  2EL5 A;  2YSP A;  2DGC A;  2EOQ A;  2R1F A;  4GZN C;  2EMF A;  1A1K A;  2A25 A;  2ENA A;  2EOO A;  1B69 A;  2YTJ A;  2WBS A;  2ELZ A;  2ELY A;  2CSH A;  2YRK A;  2YRM A;  2EOR A;  2EN3 A;  1YUI A;  2EM5 A;  2EOE A;  3EPL A;  4IS1 C;  2PRT A;  2CTD A;  2EMC A;  2WCC 3;  2EJ4 A;  2YTG A;  2GHF A;  1BBO A;  1YSA C;  2EL6 A;  2YU5 A;  1YUJ A;  2EN4 A;  2EN8 A;  1UBD C;  3MHS C;  4F6M A;  2EMH A;  1MEY C;  2EM4 A;  2WBU A;  2ENH A;  3EPJ A;  2EM0 A;  2M9A A;  2EQ0 A;  2LO3 A;  2GLI A;  2D9H A;  2DLQ A;  4WSG A;  2EL4 A;  1NCS A;  1ZR9 A;  4R2R A;  4R2C A;  2EPR A;  3VHT B;  3EPH A;  2J7J A;  2EM3 A;  2EOF A;  2EN2 A;  2LV2 A;  2YTN A;  2YTO A;  2EN1 A;  2EOJ A;  1G2D C;  2YU8 A;  5KL3 A;  1JK1 A;  2EPU A;  2EOX A;  2EM2 A;  2RPC A;  2EQ3 A;  4F2J C;  1X6H A;  2EOS A;  2EMX A;  4R2P A;  2JPA A;  2EMA A;  2EOI A;  2MDG A;  1A1J A;  2DLK A;  1AAY A;  1TF6 A;  2CT1 A;  1X3C A;  2MKD A;  2EMK A;  1A1L A;  4R2Q A;  2HGH A;  5KL6 A;  2YTP A;  5KL5 A;  2EMG A;  1LLM C;  4R2A A;  1F2I G;  1G2F C;  2EM7 A;  1A1F A;  2EPC A;  4M9V C;  2EOZ A;  3M99 B;  1P47 A;  1A1H A;  2DRP A;  3EPK A;  4F6N A;  2YRH A;  2EOM A;  2EPA A;  1X6F A;  2YTQ A;  4R2D A;  1Z1B A;  2BB8 A;  1WJP A;  2YTD A;  1BB8 A;  2LT7 A;  5KL4 A;  2YTF A;  2EMZ A;  4IJD A;  2EQ1 A;  2EML A;  2YSO A;  2VRD A;  2EE8 A;  2EPZ A;  4FK5 C;  1UN6 B;  2NAB A;  2EOY A;  2WBT A;  4X9J A;  2EMB A; 
#chains in the Genus database with same CATH topology
 2DMI A;  5A6A A;  2I13 A;  4BHB A;  2LJU A;  2EM6 A;  2RSI A;  3OTO E;  2RTX A;  1PJS A;  1DGC A;  3VYX A;  1X49 A;  2ENC A;  2L6M A;  3ADG A;  4DV1 E;  3IWD A;  4L8N A;  2VE7 C;  2L3J A;  4BCA A;  1QU6 A;  4JI4 E;  1XMO E;  1X47 A;  3BGH A;  2R1F A;  4GZN C;  4JI3 E;  2HHH E;  2NUG A;  4NXM E;  1GTK A;  1YZ9 A;  4P78 A;  3F6H A;  1STU A;  2YTJ A;  3BF2 A;  2WBS A;  2UU9 E;  2EPK X;  2YRM A;  2EN3 A;  1YUI A;  2PRT A;  1NEI A;  1IQO A;  1YYW A;  2EWL A;  4JI5 E;  3ADI A;  2WCC 3;  5AC4 A;  2LE2 A;  3K6Q A;  2EL6 A;  2YU5 A;  1UBD C;  3MHS C;  2F4V E;  2G7H A;  2EMH A;  1SFE A;  4X66 E;  3EPJ A;  4NZV A;  2V86 A;  1J26 A;  3EQ1 A;  4R03 A;  2EL4 A;  3BID A;  4M2Z A;  4R2C A;  3VHT B;  1PDA A;  4BBY A;  1XNQ E;  4JI0 E;  2LV2 A;  1G2D C;  4B3M E;  1N3G A;  1HNW E;  2EOX A;  4AQY E;  4F2J C;  5AE1 A;  4R2P A;  4DR1 E;  3VK6 A;  1L4S A;  5F3W A;  4I8O A;  4GKK E;  3LML A;  2FTX B;  4B3R E;  2L2M A;  2N3G A;  4HTG A;  5KL6 A;  2YTP A;  5KL5 A;  2EMG A;  4M0V A;  4R2A A;  1F2I G;  2K4V A;  2EPC A;  3M99 B;  2LTS A;  4BMJ A;  4WSP A;  1P47 A;  4F6N A;  2DRP A;  2V83 A;  3KWR A;  4Q35 B;  4LFB E;  3HXL A;  3TQM A;  4DR5 E;  3ADL A;  1Z1B A;  2LT7 A;  5IV8 B;  4MLQ A;  3RMP A;  4F9B B;  4DUZ E;  2YT4 A;  3LLH A;  2JWO A;  4K0K E;  4GKJ E;  1UHZ A;  2EML A;  2VRD A;  4DV3 E;  1EH8 A;  3C4T A;  2RQL A;  5AAS A;  3J81 C;  2EMB A;  2EPP A;  2EM9 A;  4J8Z A;  1A1G A;  4BC9 A;  1TF3 A;  5A2Q C;  1JK2 A;  5KL7 A;  2EM8 A;  2ODR D;  3BBG A;  1YYK A;  1X5W A;  3JU0 A;  4TUI A;  3IWC A;  4R2E A;  2LUP B;  1A1I A;  2IHR 1;  4LF8 E;  2EMY A;  4ZYG A;  2GPI A;  4ZYE A;  5ADZ A;  4YY3 E;  2EL5 A;  5LMU E;  2EPM X;  1IBK E;  4JI6 E;  2N8X A;  2JYA A;  4F9A B;  2DB2 A;  2YRK A;  2EOR A;  4YHH E;  2EOE A;  4IS1 C;  3C6K A;  2L92 A;  2EJ4 A;  1WHQ A;  1PJQ A;  2EN4 A;  2EN8 A;  2L8T A;  1YPN A;  3F6G A;  4MLV A;  2WBU A;  3HQ1 A;  2EM0 A;  4WPY A;  2K7I A;  5BR8 E;  2GLI A;  2HC5 A;  2DLQ A;  4JI8 E;  4WSG A;  4BS9 A;  2DIX A;  4KHP E;  1N33 E;  2YTO A;  2M4I A;  2EN1 A;  2EOJ A;  4GEQ B;  5KL3 A;  1JK1 A;  2JOX A;  3JTZ A;  2EOS A;  2EMX A;  2EMA A;  2H36 X;  5LLQ A;  2MDG A;  1TF6 A;  2LMZ A;  3DF6 A;  2CT1 A;  4BHC A;  1X3C A;  2MKD A;  2B7T A;  4R2Q A;  4F54 A;  2YZT A;  2DMY A;  2EM7 A;  4WFT A;  2UUA E;  4WYQ B;  2V85 A;  1PKP A;  2VQF E;  4L5N C;  4DR7 E;  4JV5 E;  2YTQ A;  2EZ6 A;  4F9C B;  2BB8 A;  2YTD A;  4LU9 A;  2I9I A;  4O5G A;  1IQS A;  3FIG A;  2YTF A;  2V88 A;  2RS7 A;  4DV0 E;  5LL6 R;  1DI2 A;  4O43 A;  2EQ1 A;  2LRS A;  2EPO A;  4DV4 E;  1N36 E;  3THN A;  2EPZ A;  4FK5 C;  2JOB A;  1UN6 B;  2LUQ A;  2NAB A;  2ODR C;  1MGT A;  3THO B;  4X9J A;  3J80 C;  4WX9 A;  4WXC A;  5A6B D;  1XNR E;  1RMD A;  1T4L B;  1X6E A;  1T4O A;  5A6B A;  4LF7 E;  5TSE A;  1QNT A;  3KZZ A;  2LCE A;  2MC5 A;  3HPS A;  2E1M A;  3UK3 C;  1TN9 A;  1HR0 E;  3MSW A;  2ADR A;  2EMW A;  3DJW A;  2E72 A;  3KZY A;  1ZBQ A;  2YSP A;  1EKZ A;  2DGC A;  1IMU A;  4LTY A;  5AC5 A;  5AE2 A;  2ENA A;  3IWB A;  1B69 A;  1EH7 A;  3P1X A;  3QG5 C;  1FKA E;  2B7V A;  3AV0 A;  2CSH A;  4X64 E;  4ZYD A;  2EM5 A;  2NUF A;  2UXB E;  5LMN E;  1N34 E;  4DR4 E;  2B9D A;  2EMC A;  2UXD E;  2YTG A;  4X62 E;  1IBM E;  2GHF A;  4DMI A;  1BBO A;  1O0W A;  4Q28 A;  1YSA C;  5DNY A;  2V8Q B;  2ENH A;  3L00 A;  2LJH A;  1NCS A;  1ZR9 A;  4X8W A;  4R2R A;  3OML A;  2E5L E;  1XMQ E;  2FGG A;  5IWA E;  3EPH A;  2J7J A;  1SR9 A;  2EM3 A;  4LF6 E;  2EN2 A;  4RHB B;  4DV7 E;  2YTN A;  4DKK A;  2DSY A;  1X48 A;  2N3H A;  2EPU A;  4TUG A;  4DV6 E;  2EM2 A;  2RPC A;  2EQ3 A;  2KON A;  4LFC E;  2JPA A;  4LFA E;  4X65 E;  1GZ6 A;  3ZOQ B;  4DR3 E;  1N32 E;  2HGH A;  2YWQ A;  5A6K A;  1PJT A;  3HPZ A;  4KWY A;  1G2F C;  2L2N A;  2YPN A;  4WXD A;  4LF4 E;  2VF1 A;  4DV5 E;  1A1H A;  4O4K A;  3JAM C;  2EOM A;  4N4R B;  2M7Q A;  2EPA A;  4R2D A;  3C6M A;  5A69 A;  1ZBT A;  1HNZ E;  1T39 A;  1AH5 A;  2NA2 A;  2EMZ A;  2L2K B;  4R8O A;  4JYA E;  2EOY A;  2WBT A;  2EPL X;  1WHN A;  2R76 A;  1ZU1 A;  5FLX C;  2LVH A;  4B3T E;  4JI1 E;  2BBG A;  2EN7 A;  2MC6 A;  1FJG E;  2B3T B;  2MKN A;  1WXR A;  3VYY A;  2EOH A;  2LTR A;  3MHH C;  2YTI A;  4NXN E;  2JXP A;  2NUE A;  1KYQ A;  4OX9 E;  3J7A G;  4R2S A;  3ADJ A;  1T4N A;  2EP3 A;  2UUC E;  2V87 A;  2YTE A;  5KL2 A;  1ZAA C;  2EPX A;  2EN6 A;  2KHX A;  4BC7 A;  2EMI A;  1KJK A;  1T38 A;  2JP9 A;  5A6J A;  4RH8 A;  2EOQ A;  2EMF A;  5T6J A;  5IT9 C;  1A1K A;  2A25 A;  2EOO A;  2UUB E;  2ELZ A;  4OOG C;  1RC7 A;  2ELY A;  2JVA A;  4M30 A;  3T1H E;  3EPL A;  2CTD A;  4DUY E;  1YUJ A;  3T1Y E;  4F6M A;  1MEY C;  2EM4 A;  2L3C A;  2JR1 A;  4JI7 E;  1I94 E;  2M9A A;  4LF5 E;  1YYO A;  1YFH A;  2EQ0 A;  2LO3 A;  2V89 A;  1EH6 A;  2D9H A;  2CPN A;  2EPR A;  2ZM6 E;  2LBS B;  2F8B A;  3AUZ A;  2EOF A;  3HTX A;  4DV2 E;  5AE3 A;  4NHR A;  4JI2 E;  1UIL A;  2YU8 A;  4HEI A;  4ZYH A;  1WRJ A;  1X6H A;  1HNX E;  2EOI A;  2HJJ A;  1A1J A;  2DLK A;  1BBG A;  2M1S A;  3C4B A;  1AAY A;  1RQ0 A;  4DR6 E;  2L33 A;  2RS6 A;  2UXC E;  2EMK A;  1A1L A;  4LF9 E;  4KZS A;  2WZO A;  3J7Y p;  1LLM C;  4B3S E;  1A1F A;  4M9V C;  5IXM B;  2EOZ A;  2FV4 B;  3EPK A;  2YRH A;  1GQE A;  4O24 A;  2VQE E;  4P7D A;  1X6F A;  2JY9 A;  5CFF E;  1WJP A;  1BB8 A;  1J5E E;  5KL4 A;  3H09 A;  4DR2 E;  1DQ3 A;  2MDR A;  4IJD A;  3ECR A;  2KOU A;  2Q8U A;  2YSO A;  2EE8 A;  2RSM A;  1IBL E;  2EPN A; 
#chains in the Genus database with same CATH homology
 2EPP A;  1ZU1 A;  2EM9 A;  2LVH A;  2DMI A;  1TF3 A;  1JK2 A;  1A1G A;  5KL7 A;  2I13 A;  2EM8 A;  1RMD A;  2EM6 A;  2EN7 A;  1X5W A;  2RSI A;  2MKN A;  1X6E A;  1DGC A;  4R2E A;  2EOH A;  3MHH C;  2YTI A;  2ENC A;  1A1I A;  4R2S A;  2EMY A;  2LCE A;  3UK3 C;  1TN9 A;  2EP3 A;  2ADR A;  2EMW A;  2YTE A;  5KL2 A;  1ZAA C;  2EPX A;  2E72 A;  2EN6 A;  2EMI A;  1KJK A;  2JP9 A;  2EL5 A;  2YSP A;  2DGC A;  2EOQ A;  2R1F A;  4GZN C;  2EMF A;  1A1K A;  2A25 A;  2ENA A;  2EOO A;  1B69 A;  2YTJ A;  2WBS A;  2ELZ A;  2ELY A;  2CSH A;  2YRK A;  2YRM A;  2EOR A;  2EN3 A;  1YUI A;  2EM5 A;  2EOE A;  3EPL A;  4IS1 C;  2PRT A;  2CTD A;  2EMC A;  2WCC 3;  2EJ4 A;  2YTG A;  2GHF A;  1BBO A;  1YSA C;  2EL6 A;  2YU5 A;  1YUJ A;  2EN4 A;  2EN8 A;  1UBD C;  3MHS C;  4F6M A;  2EMH A;  1MEY C;  2EM4 A;  2WBU A;  2ENH A;  3EPJ A;  2EM0 A;  2M9A A;  2EQ0 A;  2LO3 A;  2GLI A;  2D9H A;  2DLQ A;  4WSG A;  2EL4 A;  1NCS A;  1ZR9 A;  4R2R A;  4R2C A;  2EPR A;  3VHT B;  3EPH A;  2J7J A;  2EM3 A;  2EOF A;  2EN2 A;  2LV2 A;  2YTN A;  2YTO A;  2EN1 A;  2EOJ A;  1G2D C;  2YU8 A;  5KL3 A;  1JK1 A;  2EPU A;  2EOX A;  2EM2 A;  2RPC A;  2EQ3 A;  4F2J C;  1X6H A;  2EOS A;  2EMX A;  4R2P A;  2JPA A;  2EMA A;  2EOI A;  2MDG A;  1A1J A;  2DLK A;  1AAY A;  1TF6 A;  2CT1 A;  1X3C A;  2MKD A;  2EMK A;  1A1L A;  4R2Q A;  2HGH A;  5KL6 A;  2YTP A;  5KL5 A;  2EMG A;  1LLM C;  4R2A A;  1F2I G;  1G2F C;  2EM7 A;  1A1F A;  2EPC A;  4M9V C;  2EOZ A;  3M99 B;  1P47 A;  1A1H A;  2DRP A;  3EPK A;  4F6N A;  2YRH A;  2EOM A;  2EPA A;  1X6F A;  2YTQ A;  4R2D A;  1Z1B A;  2BB8 A;  1WJP A;  2YTD A;  1BB8 A;  2LT7 A;  5KL4 A;  2YTF A;  2EMZ A;  4IJD A;  2EQ1 A;  2EML A;  2YSO A;  2VRD A;  2EE8 A;  2EPZ A;  4FK5 C;  1UN6 B;  2NAB A;  2EOY A;  2WBT A;  4X9J A;  2EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...