4M9VC

Zfp57 mutant (e182q) in complex with 5-carboxylcytosine dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
60
Chain Sequence
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
total genus 18
structure length 60
sequence length 62
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4m9vC00
2ELZA 1G2DC 2YTIA 2EL4A 2EN7A 1YSAC 2I13A 2WBSA 1A1GA 1ZR9A 2MDGA 1UBDC 2DLKA 2WCC3 1BBOA 2LO3A 2EN2A 2YTOA 1A1IA 1TF3A 2EOYA 1X6HA 2EOSA 2WBTA 2EOOA 2ELYA 2YTNA 2EMHA 2EN6A 1P47A 1G2FC 3MHSC 5KL3A 2EN8A 2DRPA 2EE8A 2EN1A 2J7JA 1TF6A 2EQ1A 2YTGA 4IS1C 1X5WA 2ENAA 2CSHA 2EOXA 2YTQA 2D9HA 2EP3A 2CT1A 2M9AA 4FK5C 2EOIA 2EPPA 3M99B 2EOFA 4IJDA 3EPJA 2EPUA 2YTEA 2YRHA 4F2JC 3EPHA 1X6EA 2EORA 4F6MA 2YTJA 1NCSA 2BB8A 1B69A 2EOMA 2HGHA 1UN6B 1X6FA 3UK3C 1YUIA 2EL6A 2WBUA 2VRDA 4R2SA 3MHHC 2R1FA 2EM5A 2EM2A 5KL7A 2LV2A 1LLMC 2YU8A 2GLIA 1WJPA 2EOQA 2EOEA 2EMBA 2EMLA 1JK2A 2EMYA 2EMCA 2EPZA 1ZAAC 5KL5A 1BB8A 2EMFA 2RSIA 1X3CA 3EPLA 2CTDA 5KL2A 2EM9A 4WSGA 4R2EA 5KL4A 2E72A 2EN4A 2YTDA 1TN9A 2YSPA 2DMIA 4R2QA 1RMDA 2RPCA 2A25A 2EMGA 2EM6A 4R2DA 2DLQA 2MKDA 3EPKA 1A1KA 2EMKA 2NABA 1KJKA 1AAYA 2EJ4A 2EM3A 2EPXA 2EM4A 2EMWA 4R2PA 4X9JA 2ENCA 1A1HA 1DGCA 4F6NA 1YUJA 2LCEA 2YRMA 2EPRA 2LVHA 2EMIA 2ADRA 1A1JA 2EQ0A 2EL5A 2PRTA 3VHTB 2EQ3A 2YSOA 2YU5A 2LT7A 2YTFA 5KL6A 2EM7A 1JK1A 2EMXA 4R2CA 1Z1BA 2MKNA 2YTPA 2GHFA 2EM8A 2ENHA 2EPAA 4R2AA 2EN3A 2EOZA 2DGCA 4M9VC 1MEYC 1A1LA 1A1FA 2EPCA 2YRKA 4GZNC 2EM0A 2EMAA 1ZU1A 2EMZA 2JP9A 4R2RA 2EOHA 2EOJA 2JPAA 1F2IG
chains in the Genus database with same CATH superfamily
4DV2E 2BBGA 2WBSA 1J26A 1UBDC 1WXRA 2DLKA 2N3GA 1MGTA 2LO3A 2YTOA 4DKKA 4DR1E 2N8XA 4X66E 4OX9E 2EN6A 3ADIA 2JXPA 1PJSA 1EH6A 5KL3A 2EPKX 2KHXA 3IWBA 2EQ1A 2EWLA 3BBGA 4HEIA 2CSHA 2DB2A 1IBME 4FK5C 2EOIA 2V85A 4IJDA 1SFEA 3C6MA 1UHZA 2EPUA 2JWOA 2G7HA 1X6EA 2ODRD 2YTJA 4WX9A 2WZOA 2N3HA 1B69A 2UXBE 2B9DA 5BR8E 5DNYA 1YUIA 4MLVA 1X49A 4DR2E 3KWRA 2EM2A 1YYKA 3P1XA 2EOQA 2B3TB 2LRSA 4BHCA 1BBGA 2FTXB 2M4IA 4YY3E 2V86A 2RSIA 4O24A 4KZSA 3C6KA 3DF6A 2CTDA 4LU9A 5KL2A 3HTXA 1HNXE 3JAMC 3BGHA 3ZOQB 2RPCA 2NUFA 1IMUA 4BC9A 2MKDA 4DV6E 3AV0A 2EMKA 4X62E 1N36E 1N33E 2LUPB 2M7QA 1AAYA 1IBLE 4M0VA 2EM3A 1HNZE 2EMWA 1DGCA 3EQ1A 4BHBA 4WYQB 5A6BA 5IWAE 2YRMA 2EMIA 2ADRA 4WPYA 1XMQE 2EQ0A 3ECRA 2PRTA 2JOXA 2ZM6E 1N34E 3VHTB 4B3ME 2UUAE 5LMNE 3VK6A 4RHBB 2LT7A 2YTFA 4LF7E 1JK1A 1PDAA 2EPOA 5A6AA 1YZ9A 4M9VC 2EOZA 4DR5E 1MEYC 2I9IA 3KZZA 4B3TE 2JP9A 2VF1A 1F2IG 1SR9A 5AASA 2EN7A 4LTYA 2EPMX 2VQFE 1T38A 1YFHA 1T4OA 3IWDA 3LLHA 2KOUA 1A1IA 4WFTA 2EOYA 4LF9E 4LFAE 3ADLA 2WBTA 3HPSA 4WSPA 5F3WA 2ELYA 2YTNA 2EMHA 1L4SA 4ZYEA 1YYWA 2EN8A 2EE8A 3BIDA 2VE7C 5AC5A 4JYAE 1UILA 2LJHA 1XMOE 1TF6A 1IQSA 2NA2A 2YTQA 2EP3A 4BMJA 2CT1A 3H09A 4F9CB 2YTEA 4R03A 1N32E 3RMPA 2H36X 2V87A 5AE3A 2EOMA 3IWCA 2HGHA 3J7Yp 3UK3C 1STUA 2DSYA 2MC5A 2WBUA 3T1HE 2UXDE 3MHHC 5IXMB 5KL7A 4B3RE 2YPNA 2YU8A 2EOEA 2EMLA 4JI5E 4JI4E 2EPZA 5KL5A 2V83A 2L8TA 4F9BB 3THNA 4DV3E 2EM9A 4WSGA 2V8QB 4DV0E 2YTDA 1TN9A 2E5LE 3HXLA 4J8ZA 4GKJE 3HPZA 4R2QA 4K0KE 4JI7E 2A25A 4R2DA 1A1KA 2ODRC 2NABA 3BF2A 2Q8UA 2B7TA 4DV7E 2EJ4A 2F8BA 2DMYA 2ENCA 4WXCA 3LMLA 1PJTA 1WHQA 4ZYHA 5T6JA 4BS9A 3T1YE 5A6JA 3J7AG 2NUEA 4LFBE 2LCEA 2EPRA 1A1JA 2UUCE 2EL5A 5AE1A 1EH8A 2LTRA 3MSWA 1T39A 2EQ3A 2L2NA 1N3GA 2DIXA 2YU5A 1RQ0A 4NXNE 4DR6E 1Z1BA 4JI6E 2HJJA 2K7IA 4GEQB 2ENHA 3ADJA 1NEIA 4F54A 2DGCA 1DI2A 3ADGA 2YRKA 4GZNC 3JU0A 3AUZA 2EPNA 4R2RA 2RQLA 4Q35B 1T4LB 2ELZA 2L3JA 2LJUA 2YTIA 4MLQA 5A6BD 5A6KA 2JYAA 1YSAC 2RTXA 2I13A 1A1GA 1ZR9A 2MDGA 5AE2A 2WCC3 4F9AB 3K6QA 2K4VA 2EOSA 4DV5E 1J5EE 3C4BA 1P47A 1G2FC 2YZTA 2V88A 2DRPA 2CPNA 3C4TA 2RSMA 3J81C 4I8OA 2YTGA 4IS1C 1X5WA 2ENAA 4ZYDA 2EOXA 2UXCE 2L92A 2M9AA 2EOFA 4NXME 1XNQE 2YRHA 1X48A 2EORA 4F6MA 4OOGC 1NCSA 1PJQA 1UN6B 1X6FA 1ZBQA 2EL6A 4O5GA 2VRDA 4R2SA 2R1FA 1XNRE 3OMLA 1WJPA 2JOBA 1X47A 2EMBA 2JY9A 1JK2A 2EMYA 2EPLX 3L00A 1I94E 4KWYA 1YPNA 2EMFA 1X3CA 2MC6A 3EPLA 4AQYE 4R2EA 2YSPA 4X64E 3VYXA 4L8NA 4YHHE 2FGGA 4X8WA 1RMDA 4O4KA 2DLQA 3EPKA 1HR0E 3OTOE 2V89A 4P7DA 1EH7A 1FKAE 4LF8E 1WRJA 1A1HA 3J80C 4JV5E 4F6NA 2RS7A 3F6GA 5IV8B 4NZVA 4L5NC 1PKPA 2NUGA 2YSOA 2GPIA 4DR7E 4R2CA 5A2QC 3THOB 2EPAA 2VQEE 2E1MA 4LFCE 2L2MA 5A69A 1A1LA 2EPCA 2EMZA 1EKZA 3FIGA 2RS6A 2M1SA 2EOHA 2JPAA 5LLQA 3KZYA 1G2DC 4JI2E 1GQEA 5CFFE 2EL4A 1DQ3A 2YT4A 4LF6E 1BBOA 5LMUE 1HNWE 2EN2A 1QNTA 4JI1E 1TF3A 2HHHE 1KYQA 3HQ1A 1X6HA 2LUQA 2MDRA 4DR3E 2EOOA 3F6HA 2L2KB 4HTGA 3MHSC 4LF5E 4DUYE 1RC7A 4GKKE 2EN1A 2J7JA 1YYOA 4KHPE 4R8OA 2D9HA 1GTKA 2EPPA 3M99B 3EPJA 3EPHA 4F2JC 5TSEA 2BB8A 4WXDA 1IBKE 2JVAA 4BCAA 5ADZA 4LF4E 2HC5A 2LBSB 2LTSA 5FLXC 1O0WA 2YWQA 2EM5A 3JTZA 2LV2A 1LLMC 2GLIA 5LL6R 4B3SE 2EMCA 1ZAAC 1BB8A 2L33A 2LE2A 4JI0E 2LMZA 3VYYA 4JI8E 5KL4A 2E72A 2EN4A 1GZ6A 2L6MA 2F4VE 2R76A 5IT9C 2EZ6A 2DMIA 4N4RB 2EMGA 1ZBTA 2EM6A 5AC4A 1KJKA 2L3CA 2UU9E 4TUGA 4Q28A 2JR1A 2EPXA 2EM4A 4R2PA 4X9JA 1QU6A 4DV1E 3DJWA 1YUJA 4NHRA 1AH5A 2LVHA 4P78A 2KONA 4X65E 4DMIA 4JI3E 4M30A 4O43A 1FJGE 3TQMA 4BBYA 2EM7A 2FV4B 5KL6A 2EMXA 1WHNA 2B7VA 2MKNA 2YTPA 2UUBE 2GHFA 2EM8A 4RH8A 4M2ZA 3QG5C 2EN3A 4R2AA 4TUIA 4DR4E 4ZYGA 4DUZE 1A1FA 2IHR1 1T4NA 4DV4E 4BC7A 2EM0A 2EMAA 1ZU1A 1IQOA 2EOJA
chains in the Genus database with same CATH topology
2ELZA 1G2DC 2YTIA 2EL4A 2EN7A 1YSAC 2I13A 2WBSA 1A1GA 1ZR9A 2MDGA 1UBDC 2DLKA 2WCC3 1BBOA 2LO3A 2EN2A 2YTOA 1A1IA 1TF3A 2EOYA 1X6HA 2EOSA 2WBTA 2EOOA 2ELYA 2YTNA 2EMHA 2EN6A 1P47A 1G2FC 3MHSC 5KL3A 2EN8A 2DRPA 2EE8A 2EN1A 2J7JA 1TF6A 2EQ1A 2YTGA 4IS1C 1X5WA 2ENAA 2CSHA 2EOXA 2YTQA 2D9HA 2EP3A 2CT1A 2M9AA 4FK5C 2EOIA 2EPPA 3M99B 2EOFA 4IJDA 3EPJA 2EPUA 2YTEA 2YRHA 4F2JC 3EPHA 1X6EA 2EORA 4F6MA 2YTJA 1NCSA 2BB8A 1B69A 2EOMA 2HGHA 1UN6B 1X6FA 3UK3C 1YUIA 2EL6A 2WBUA 2VRDA 4R2SA 3MHHC 2R1FA 2EM5A 2EM2A 5KL7A 2LV2A 1LLMC 2YU8A 2GLIA 1WJPA 2EOQA 2EOEA 2EMBA 2EMLA 1JK2A 2EMYA 2EMCA 2EPZA 1ZAAC 5KL5A 1BB8A 2EMFA 2RSIA 1X3CA 3EPLA 2CTDA 5KL2A 2EM9A 4WSGA 4R2EA 5KL4A 2E72A 2EN4A 2YTDA 1TN9A 2YSPA 2DMIA 4R2QA 1RMDA 2RPCA 2A25A 2EMGA 2EM6A 4R2DA 2DLQA 2MKDA 3EPKA 1A1KA 2EMKA 2NABA 1KJKA 1AAYA 2EJ4A 2EM3A 2EPXA 2EM4A 2EMWA 4R2PA 4X9JA 2ENCA 1A1HA 1DGCA 4F6NA 1YUJA 2LCEA 2YRMA 2EPRA 2LVHA 2EMIA 2ADRA 1A1JA 2EQ0A 2EL5A 2PRTA 3VHTB 2EQ3A 2YSOA 2YU5A 2LT7A 2YTFA 5KL6A 2EM7A 1JK1A 2EMXA 4R2CA 1Z1BA 2MKNA 2YTPA 2GHFA 2EM8A 2ENHA 2EPAA 4R2AA 2EN3A 2EOZA 2DGCA 4M9VC 1MEYC 1A1LA 1A1FA 2EPCA 2YRKA 4GZNC 2EM0A 2EMAA 1ZU1A 2EMZA 2JP9A 4R2RA 2EOHA 2EOJA 2JPAA 1F2IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELZ A;  1G2D C;  2YTI A;  2EL4 A;  2EN7 A;  1YSA C;  2I13 A;  2WBS A;  1A1G A;  1ZR9 A;  2MDG A;  1UBD C;  2DLK A;  2WCC 3;  1BBO A;  2LO3 A;  2EN2 A;  2YTO A;  1A1I A;  1TF3 A;  2EOY A;  1X6H A;  2EOS A;  2WBT A;  2EOO A;  2ELY A;  2YTN A;  2EMH A;  2EN6 A;  1P47 A;  1G2F C;  3MHS C;  5KL3 A;  2EN8 A;  2DRP A;  2EE8 A;  2EN1 A;  2J7J A;  1TF6 A;  2EQ1 A;  2YTG A;  4IS1 C;  1X5W A;  2ENA A;  2CSH A;  2EOX A;  2YTQ A;  2D9H A;  2EP3 A;  2CT1 A;  2M9A A;  4FK5 C;  2EOI A;  2EPP A;  3M99 B;  2EOF A;  4IJD A;  3EPJ A;  2EPU A;  2YTE A;  2YRH A;  4F2J C;  3EPH A;  1X6E A;  2EOR A;  4F6M A;  2YTJ A;  1NCS A;  2BB8 A;  1B69 A;  2EOM A;  2HGH A;  1UN6 B;  1X6F A;  3UK3 C;  1YUI A;  2EL6 A;  2WBU A;  2VRD A;  4R2S A;  3MHH C;  2R1F A;  2EM5 A;  2EM2 A;  5KL7 A;  2LV2 A;  1LLM C;  2YU8 A;  2GLI A;  1WJP A;  2EOQ A;  2EOE A;  2EMB A;  2EML A;  1JK2 A;  2EMY A;  2EMC A;  2EPZ A;  1ZAA C;  5KL5 A;  1BB8 A;  2EMF A;  2RSI A;  1X3C A;  3EPL A;  2CTD A;  5KL2 A;  2EM9 A;  4WSG A;  4R2E A;  5KL4 A;  2E72 A;  2EN4 A;  2YTD A;  1TN9 A;  2YSP A;  2DMI A;  4R2Q A;  1RMD A;  2RPC A;  2A25 A;  2EMG A;  2EM6 A;  4R2D A;  2DLQ A;  2MKD A;  3EPK A;  1A1K A;  2EMK A;  2NAB A;  1KJK A;  1AAY A;  2EJ4 A;  2EM3 A;  2EPX A;  2EM4 A;  2EMW A;  4R2P A;  4X9J A;  2ENC A;  1A1H A;  1DGC A;  4F6N A;  1YUJ A;  2LCE A;  2YRM A;  2EPR A;  2LVH A;  2EMI A;  2ADR A;  1A1J A;  2EQ0 A;  2EL5 A;  2PRT A;  3VHT B;  2EQ3 A;  2YSO A;  2YU5 A;  2LT7 A;  2YTF A;  5KL6 A;  2EM7 A;  1JK1 A;  2EMX A;  4R2C A;  1Z1B A;  2MKN A;  2YTP A;  2GHF A;  2EM8 A;  2ENH A;  2EPA A;  4R2A A;  2EN3 A;  2EOZ A;  2DGC A;  4M9V C;  1MEY C;  1A1L A;  1A1F A;  2EPC A;  2YRK A;  4GZN C;  2EM0 A;  2EMA A;  1ZU1 A;  2EMZ A;  2JP9 A;  4R2R A;  2EOH A;  2EOJ A;  2JPA A;  1F2I G; 
#chains in the Genus database with same CATH topology
 4DV2 E;  2BBG A;  2WBS A;  1J26 A;  1UBD C;  1WXR A;  2DLK A;  2N3G A;  1MGT A;  2LO3 A;  2YTO A;  4DKK A;  4DR1 E;  2N8X A;  4X66 E;  4OX9 E;  2EN6 A;  3ADI A;  2JXP A;  1PJS A;  1EH6 A;  5KL3 A;  2EPK X;  2KHX A;  3IWB A;  2EQ1 A;  2EWL A;  3BBG A;  4HEI A;  2CSH A;  2DB2 A;  1IBM E;  4FK5 C;  2EOI A;  2V85 A;  4IJD A;  1SFE A;  3C6M A;  1UHZ A;  2EPU A;  2JWO A;  2G7H A;  1X6E A;  2ODR D;  2YTJ A;  4WX9 A;  2WZO A;  2N3H A;  1B69 A;  2UXB E;  2B9D A;  5BR8 E;  5DNY A;  1YUI A;  4MLV A;  1X49 A;  4DR2 E;  3KWR A;  2EM2 A;  1YYK A;  3P1X A;  2EOQ A;  2B3T B;  2LRS A;  4BHC A;  1BBG A;  2FTX B;  2M4I A;  4YY3 E;  2V86 A;  2RSI A;  4O24 A;  4KZS A;  3C6K A;  3DF6 A;  2CTD A;  4LU9 A;  5KL2 A;  3HTX A;  1HNX E;  3JAM C;  3BGH A;  3ZOQ B;  2RPC A;  2NUF A;  1IMU A;  4BC9 A;  2MKD A;  4DV6 E;  3AV0 A;  2EMK A;  4X62 E;  1N36 E;  1N33 E;  2LUP B;  2M7Q A;  1AAY A;  1IBL E;  4M0V A;  2EM3 A;  1HNZ E;  2EMW A;  1DGC A;  3EQ1 A;  4BHB A;  4WYQ B;  5A6B A;  5IWA E;  2YRM A;  2EMI A;  2ADR A;  4WPY A;  1XMQ E;  2EQ0 A;  3ECR A;  2PRT A;  2JOX A;  2ZM6 E;  1N34 E;  3VHT B;  4B3M E;  2UUA E;  5LMN E;  3VK6 A;  4RHB B;  2LT7 A;  2YTF A;  4LF7 E;  1JK1 A;  1PDA A;  2EPO A;  5A6A A;  1YZ9 A;  4M9V C;  2EOZ A;  4DR5 E;  1MEY C;  2I9I A;  3KZZ A;  4B3T E;  2JP9 A;  2VF1 A;  1F2I G;  1SR9 A;  5AAS A;  2EN7 A;  4LTY A;  2EPM X;  2VQF E;  1T38 A;  1YFH A;  1T4O A;  3IWD A;  3LLH A;  2KOU A;  1A1I A;  4WFT A;  2EOY A;  4LF9 E;  4LFA E;  3ADL A;  2WBT A;  3HPS A;  4WSP A;  5F3W A;  2ELY A;  2YTN A;  2EMH A;  1L4S A;  4ZYE A;  1YYW A;  2EN8 A;  2EE8 A;  3BID A;  2VE7 C;  5AC5 A;  4JYA E;  1UIL A;  2LJH A;  1XMO E;  1TF6 A;  1IQS A;  2NA2 A;  2YTQ A;  2EP3 A;  4BMJ A;  2CT1 A;  3H09 A;  4F9C B;  2YTE A;  4R03 A;  1N32 E;  3RMP A;  2H36 X;  2V87 A;  5AE3 A;  2EOM A;  3IWC A;  2HGH A;  3J7Y p;  3UK3 C;  1STU A;  2DSY A;  2MC5 A;  2WBU A;  3T1H E;  2UXD E;  3MHH C;  5IXM B;  5KL7 A;  4B3R E;  2YPN A;  2YU8 A;  2EOE A;  2EML A;  4JI5 E;  4JI4 E;  2EPZ A;  5KL5 A;  2V83 A;  2L8T A;  4F9B B;  3THN A;  4DV3 E;  2EM9 A;  4WSG A;  2V8Q B;  4DV0 E;  2YTD A;  1TN9 A;  2E5L E;  3HXL A;  4J8Z A;  4GKJ E;  3HPZ A;  4R2Q A;  4K0K E;  4JI7 E;  2A25 A;  4R2D A;  1A1K A;  2ODR C;  2NAB A;  3BF2 A;  2Q8U A;  2B7T A;  4DV7 E;  2EJ4 A;  2F8B A;  2DMY A;  2ENC A;  4WXC A;  3LML A;  1PJT A;  1WHQ A;  4ZYH A;  5T6J A;  4BS9 A;  3T1Y E;  5A6J A;  3J7A G;  2NUE A;  4LFB E;  2LCE A;  2EPR A;  1A1J A;  2UUC E;  2EL5 A;  5AE1 A;  1EH8 A;  2LTR A;  3MSW A;  1T39 A;  2EQ3 A;  2L2N A;  1N3G A;  2DIX A;  2YU5 A;  1RQ0 A;  4NXN E;  4DR6 E;  1Z1B A;  4JI6 E;  2HJJ A;  2K7I A;  4GEQ B;  2ENH A;  3ADJ A;  1NEI A;  4F54 A;  2DGC A;  1DI2 A;  3ADG A;  2YRK A;  4GZN C;  3JU0 A;  3AUZ A;  2EPN A;  4R2R A;  2RQL A;  4Q35 B;  1T4L B;  2ELZ A;  2L3J A;  2LJU A;  2YTI A;  4MLQ A;  5A6B D;  5A6K A;  2JYA A;  1YSA C;  2RTX A;  2I13 A;  1A1G A;  1ZR9 A;  2MDG A;  5AE2 A;  2WCC 3;  4F9A B;  3K6Q A;  2K4V A;  2EOS A;  4DV5 E;  1J5E E;  3C4B A;  1P47 A;  1G2F C;  2YZT A;  2V88 A;  2DRP A;  2CPN A;  3C4T A;  2RSM A;  3J81 C;  4I8O A;  2YTG A;  4IS1 C;  1X5W A;  2ENA A;  4ZYD A;  2EOX A;  2UXC E;  2L92 A;  2M9A A;  2EOF A;  4NXM E;  1XNQ E;  2YRH A;  1X48 A;  2EOR A;  4F6M A;  4OOG C;  1NCS A;  1PJQ A;  1UN6 B;  1X6F A;  1ZBQ A;  2EL6 A;  4O5G A;  2VRD A;  4R2S A;  2R1F A;  1XNR E;  3OML A;  1WJP A;  2JOB A;  1X47 A;  2EMB A;  2JY9 A;  1JK2 A;  2EMY A;  2EPL X;  3L00 A;  1I94 E;  4KWY A;  1YPN A;  2EMF A;  1X3C A;  2MC6 A;  3EPL A;  4AQY E;  4R2E A;  2YSP A;  4X64 E;  3VYX A;  4L8N A;  4YHH E;  2FGG A;  4X8W A;  1RMD A;  4O4K A;  2DLQ A;  3EPK A;  1HR0 E;  3OTO E;  2V89 A;  4P7D A;  1EH7 A;  1FKA E;  4LF8 E;  1WRJ A;  1A1H A;  3J80 C;  4JV5 E;  4F6N A;  2RS7 A;  3F6G A;  5IV8 B;  4NZV A;  4L5N C;  1PKP A;  2NUG A;  2YSO A;  2GPI A;  4DR7 E;  4R2C A;  5A2Q C;  3THO B;  2EPA A;  2VQE E;  2E1M A;  4LFC E;  2L2M A;  5A69 A;  1A1L A;  2EPC A;  2EMZ A;  1EKZ A;  3FIG A;  2RS6 A;  2M1S A;  2EOH A;  2JPA A;  5LLQ A;  3KZY A;  1G2D C;  4JI2 E;  1GQE A;  5CFF E;  2EL4 A;  1DQ3 A;  2YT4 A;  4LF6 E;  1BBO A;  5LMU E;  1HNW E;  2EN2 A;  1QNT A;  4JI1 E;  1TF3 A;  2HHH E;  1KYQ A;  3HQ1 A;  1X6H A;  2LUQ A;  2MDR A;  4DR3 E;  2EOO A;  3F6H A;  2L2K B;  4HTG A;  3MHS C;  4LF5 E;  4DUY E;  1RC7 A;  4GKK E;  2EN1 A;  2J7J A;  1YYO A;  4KHP E;  4R8O A;  2D9H A;  1GTK A;  2EPP A;  3M99 B;  3EPJ A;  3EPH A;  4F2J C;  5TSE A;  2BB8 A;  4WXD A;  1IBK E;  2JVA A;  4BCA A;  5ADZ A;  4LF4 E;  2HC5 A;  2LBS B;  2LTS A;  5FLX C;  1O0W A;  2YWQ A;  2EM5 A;  3JTZ A;  2LV2 A;  1LLM C;  2GLI A;  5LL6 R;  4B3S E;  2EMC A;  1ZAA C;  1BB8 A;  2L33 A;  2LE2 A;  4JI0 E;  2LMZ A;  3VYY A;  4JI8 E;  5KL4 A;  2E72 A;  2EN4 A;  1GZ6 A;  2L6M A;  2F4V E;  2R76 A;  5IT9 C;  2EZ6 A;  2DMI A;  4N4R B;  2EMG A;  1ZBT A;  2EM6 A;  5AC4 A;  1KJK A;  2L3C A;  2UU9 E;  4TUG A;  4Q28 A;  2JR1 A;  2EPX A;  2EM4 A;  4R2P A;  4X9J A;  1QU6 A;  4DV1 E;  3DJW A;  1YUJ A;  4NHR A;  1AH5 A;  2LVH A;  4P78 A;  2KON A;  4X65 E;  4DMI A;  4JI3 E;  4M30 A;  4O43 A;  1FJG E;  3TQM A;  4BBY A;  2EM7 A;  2FV4 B;  5KL6 A;  2EMX A;  1WHN A;  2B7V A;  2MKN A;  2YTP A;  2UUB E;  2GHF A;  2EM8 A;  4RH8 A;  4M2Z A;  3QG5 C;  2EN3 A;  4R2A A;  4TUI A;  4DR4 E;  4ZYG A;  4DUZ E;  1A1F A;  2IHR 1;  1T4N A;  4DV4 E;  4BC7 A;  2EM0 A;  2EMA A;  1ZU1 A;  1IQO A;  2EOJ A; 
#chains in the Genus database with same CATH homology
 2ELZ A;  1G2D C;  2YTI A;  2EL4 A;  2EN7 A;  1YSA C;  2I13 A;  2WBS A;  1A1G A;  1ZR9 A;  2MDG A;  1UBD C;  2DLK A;  2WCC 3;  1BBO A;  2LO3 A;  2EN2 A;  2YTO A;  1A1I A;  1TF3 A;  2EOY A;  1X6H A;  2EOS A;  2WBT A;  2EOO A;  2ELY A;  2YTN A;  2EMH A;  2EN6 A;  1P47 A;  1G2F C;  3MHS C;  5KL3 A;  2EN8 A;  2DRP A;  2EE8 A;  2EN1 A;  2J7J A;  1TF6 A;  2EQ1 A;  2YTG A;  4IS1 C;  1X5W A;  2ENA A;  2CSH A;  2EOX A;  2YTQ A;  2D9H A;  2EP3 A;  2CT1 A;  2M9A A;  4FK5 C;  2EOI A;  2EPP A;  3M99 B;  2EOF A;  4IJD A;  3EPJ A;  2EPU A;  2YTE A;  2YRH A;  4F2J C;  3EPH A;  1X6E A;  2EOR A;  4F6M A;  2YTJ A;  1NCS A;  2BB8 A;  1B69 A;  2EOM A;  2HGH A;  1UN6 B;  1X6F A;  3UK3 C;  1YUI A;  2EL6 A;  2WBU A;  2VRD A;  4R2S A;  3MHH C;  2R1F A;  2EM5 A;  2EM2 A;  5KL7 A;  2LV2 A;  1LLM C;  2YU8 A;  2GLI A;  1WJP A;  2EOQ A;  2EOE A;  2EMB A;  2EML A;  1JK2 A;  2EMY A;  2EMC A;  2EPZ A;  1ZAA C;  5KL5 A;  1BB8 A;  2EMF A;  2RSI A;  1X3C A;  3EPL A;  2CTD A;  5KL2 A;  2EM9 A;  4WSG A;  4R2E A;  5KL4 A;  2E72 A;  2EN4 A;  2YTD A;  1TN9 A;  2YSP A;  2DMI A;  4R2Q A;  1RMD A;  2RPC A;  2A25 A;  2EMG A;  2EM6 A;  4R2D A;  2DLQ A;  2MKD A;  3EPK A;  1A1K A;  2EMK A;  2NAB A;  1KJK A;  1AAY A;  2EJ4 A;  2EM3 A;  2EPX A;  2EM4 A;  2EMW A;  4R2P A;  4X9J A;  2ENC A;  1A1H A;  1DGC A;  4F6N A;  1YUJ A;  2LCE A;  2YRM A;  2EPR A;  2LVH A;  2EMI A;  2ADR A;  1A1J A;  2EQ0 A;  2EL5 A;  2PRT A;  3VHT B;  2EQ3 A;  2YSO A;  2YU5 A;  2LT7 A;  2YTF A;  5KL6 A;  2EM7 A;  1JK1 A;  2EMX A;  4R2C A;  1Z1B A;  2MKN A;  2YTP A;  2GHF A;  2EM8 A;  2ENH A;  2EPA A;  4R2A A;  2EN3 A;  2EOZ A;  2DGC A;  4M9V C;  1MEY C;  1A1L A;  1A1F A;  2EPC A;  2YRK A;  4GZN C;  2EM0 A;  2EMA A;  1ZU1 A;  2EMZ A;  2JP9 A;  4R2R A;  2EOH A;  2EOJ A;  2JPA A;  1F2I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...