4GEQB

Crystal structure of the spc24-spc25/cnn1 binding interface
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
58
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinetochore protein SPC25
publication title A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Cell cycle
total genus 15
structure length 58
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4geqB00
2FTXB 5T6JA 2FV4B 4GEQB
chains in the Genus database with same CATH superfamily
4DR2E 1TN9A 2JOBA 2EPRA 4JYAE 2MC6A 3LLHA 2L8TA 1YUIA 4BCAA 4R2PA 3M99B 1X5WA 5A6BD 1DGCA 4DR6E 4O4KA 4BC9A 1FKAE 1IMUA 4R2RA 1HR0E 1N33E 2V89A 1PKPA 4X8WA 4ZYGA 2DMYA 2JXPA 1YYOA 3QG5C 2E1MA 2LO3A 2VQEE 3MSWA 1Z1BA 4LF8E 4GZNC 2UUBE 2KHXA 1A1FA 2DLQA 4BHBA 2EORA 3OTOE 2DGCA 2EQ1A 4LTYA 4KWYA 2DB2A 4F6MA 2K4VA 4MLQA 1JK2A 4DUZE 1N32E 2M7QA 4M2ZA 5AE2A 2GLIA 4LF7E 4ZYDA 5LMNE 4WXDA 2EOSA 2N3GA 2YTGA 4DKKA 4LF4E 5A2QC 1PJSA 3BF2A 1WHNA 2RQLA 2E72A 5AC5A 1HNZE 4GKKE 2EN6A 2V83A 1ZU1A 2VF1A 4ZYHA 2J7JA 4YY3E 1YSAC 4R2DA 5LL6R 2DRPA 2NUFA 2JY9A 2EL6A 3THNA 4YHHE 2HHHE 2LTRA 2EMCA 2ENAA 2LUQA 4KHPE 4X65E 2EPCA 2ODRD 1EH7A 1YPNA 2KOUA 2ODRC 3AUZA 4AQYE 2RSIA 2I13A 4JI2E 4LF5E 2JR1A 4M9VC 1N34E 2CTDA 4KZSA 1ZBQA 2YTIA 4O43A 2RS6A 1P47A 1STUA 2B3TB 1N36E 2E5LE 2V8QB 4JI6E 3IWBA 4WYQB 1ZBTA 3JAMC 4HEIA 2LBSB 2EPXA 4MLVA 1TF6A 1ZR9A 2MC5A 2JVAA 3JU0A 4BC7A 4JI7E 2EM4A 2EPMX 4X9JA 1I94E 4WSPA 1GZ6A 2V88A 4Q35B 3ADGA 2RSMA 1G2DC 1WRJA 2YTEA 5T6JA 2WBSA 2DLKA 5AE1A 4F9BB 2EPOA 3HPSA 4NHRA 1A1IA 1KJKA 3ADIA 1PDAA 2L3CA 2EL4A 2VQFE 2FTXB 1AAYA 2WZOA 2B7VA 1RMDA 1A1KA 2YT4A 2HJJA 3DJWA 5KL5A 2L33A 1JK1A 5DNYA 2DMIA 2A25A 1L4SA 2ELYA 2EMXA 2EP3A 2M9AA 5F3WA 2FV4B 2EN7A 2EPZA 2LJHA 4R2QA 3EPJA 4BS9A 5KL7A 1IBLE 2EM0A 3J81C 4OOGC 1MEYC 3C4BA 1J5EE 4R2AA 2CSHA 2YTDA 3MHHC 2M4IA 4DV5E 2JYAA 2HGHA 2EMHA 2EPPA 1O0WA 2UXBE 2L92A 2WBTA 5AE3A 2MDRA 4P78A 4DV6E 1XNRE 2F4VE 2MKNA 3VYYA 1F2IG 4DR3E 4B3RE 4NZVA 2R76A 4J8ZA 4JV5E 1WXRA 4F6NA 4DV0E 4RHBB 2EOFA 2YTJA 3VHTB 1T4LB 2EZ6A 2L2MA 2EM9A 4B3ME 4HTGA 1UBDC 3IWCA 4Q28A 2JWOA 4R8OA 4DUYE 1WJPA 3UK3C 1WHQA 2LTSA 4F9CB 1LLMC 3VYXA 2D9HA 1A1LA 3T1HE 3P1XA 4M30A 2ADRA 1KYQA 2RS7A 1X49A 2EM7A 5A6BA 4DR1E 2LV2A 3BGHA 2MDGA 4LF6E 4DV7E 4F54A 3AV0A 2UU9E 5ADZA 4M0VA 1A1GA 5LLQA 3KWRA 4DV1E 2EM3A 1X6EA 1EH6A 2B9DA 2DIXA 4P7DA 1IQOA 4DR5E 3MHSC 1SFEA 4BBYA 3J7AG 3ECRA 4O24A 5AC4A 3BBGA 2NA2A 4TUGA 4DMIA 1X48A 3IWDA 1NCSA 4DV4E 1UHZA 1AH5A 4TUIA 4L5NC 4N4RB 1XMQE 1X6HA 1B69A 5KL2A 2YTOA 2R1FA 4O5GA 2EWLA 4WFTA 4JI8E 1T39A 2L6MA 1X6FA 2UXDE 4WSGA 2H36X 5LMUE 4WPYA 2EN1A 3TQMA 2EE8A 3K6QA 2LVHA 4RH8A 4FK5C 2BBGA 1RQ0A 3T1YE 2EMKA 1XMOE 2YPNA 4JI4E 1IBME 2L3JA 2EM6A 4I8OA 1ZAAC 2VRDA 2EQ3A 1QNTA 4R03A 2PRTA 1A1HA 4LFCE 1YYWA 2EMYA 1EH8A 2G7HA 4F9AB 1J26A 4OX9E 1T4NA 5A6JA 3THOB 1YZ9A 2EMWA 4R2EA 2YTQA 4LFBE 2EPLX 5A69A 2I9IA 4IJDA 1PJTA 1BBOA 2EOQA 3EPKA 4IS1C 1HNWE 3DF6A 4JI3E 2EOJA 3HQ1A 2JP9A 2EN8A 3C4TA 1HNXE 1UILA 1DQ3A 2LUPB 2K7IA 5A6KA 3KZYA 4L8NA 2EMBA 2ENHA 2YRMA 4R2SA 2EMGA 5IWAE 1XNQE 3HXLA 3HPZA 2V85A 1FJGE 3VK6A 2GPIA 2EOIA 4JI1E 2YTPA 4BHCA 2YTFA 2EMAA 2JPAA 2EPAA 5KL4A 2YRKA 2UXCE 2L2NA 2YWQA 5IV8B 1G2FC 3L00A 4NXME 2WCC3 1X47A 3C6KA 2EOMA 2EMIA 4X62E 2NUGA 3J80C 2CPNA 2EN2A 1N3GA 2FGGA 1YFHA 1RC7A 2EM8A 2YTNA 3C6MA 3F6HA 2EMFA 3OMLA 2EJ4A 3EQ1A 1BBGA 1YYKA 1TF3A 4F2JC 2KONA 3ADLA 1NEIA 2EPUA 2LE2A 2ELZA 4K0KE 2B7TA 2LCEA 2LMZA 2V87A 5BR8E 2EOEA 1T4OA 5IXMB 5KL3A 2LJUA 4GKJE 1PJQA 3BIDA 2LT7A 4WX9A 2WBUA 4LFAE 1DI2A 3H09A 4GEQB 2MKDA 1QU6A 2N3HA 3J7Yp 3JTZA 2LRSA 2GHFA 2Q8UA 3LMLA 4X64E 4DR7E 2EMZA 2EQ0A 2EOZA 2YU5A 2EM5A 2EN3A 2ZM6E 2NUEA 2DSYA 1X3CA 3HTXA 2V86A 2EPNA 2EOHA 3ZOQB 3RMPA 4JI5E 2YSOA 2M1SA 5A6AA 5AASA 2HC5A 2EOOA 2JOXA 4B3TE 2YSPA 2IHR1 3ADJA 4NXNE 4BMJA 2EM2A 1EKZA 2UUAE 2EN4A 2VE7C 5IT9C 2F8BA 5FLXC 4X66E 2EMLA 2CT1A 1UN6B 1IQSA 1GQEA 4LF9E 2RTXA 2YU8A 5KL6A 2L2KB 1GTKA 1MGTA 3FIGA 3EPHA 4R2CA 2RPCA 4B3SE 1YUJA 4LU9A 2YZTA 2YRHA 1IBKE 4DR4E 2NABA 5TSEA 2EOXA 4WXCA 1SR9A 2BB8A 2EPKX 1T38A 3KZZA 5CFFE 4DV3E 2EL5A 4JI0E 4ZYEA 3F6GA 4DV2E 2ENCA 2UUCE 3EPLA 1A1JA 1BB8A 2N8XA 2EOYA
chains in the Genus database with same CATH topology
4JI6E 4DR2E 4NXME 2JOBA 4JYAE 3IWBA 4WYQB 2MC6A 1ZBTA 3LLHA 2L8TA 3JAMC 2LBSB 1X47A 4NXNE 4DR1E 4BCAA 2MC5A 4LF6E 4DV7E 4DR6E 4X62E 2JVAA 3AV0A 3JU0A 4F54A 3J80C 2UU9E 5ADZA 4M0VA 2NUGA 2CPNA 2FGGA 4BC9A 1RC7A 4BC7A 3KWRA 4DV1E 4JI7E 1FKAE 1I94E 3F6HA 4WSPA 1GZ6A 2B9DA 2DIXA 4P7DA 3OMLA 2V88A 4DR5E 1HR0E 4BBYA 3J7AG 1N33E 2V89A 1PKPA 3ADGA 2NA2A 4TUGA 2RSMA 4X8WA 4DMIA 1X48A 3IWDA 1YYKA 4DV4E 2DMYA 1UHZA 2KONA 5T6JA 3ADLA 5AE1A 1YYOA 2LE2A 4F9BB 3HPSA 4L5NC 4TUIA 4K0KE 2E1MA 2VQEE 2B7TA 5BR8E 2LMZA 2V87A 2L3CA 1XMQE 1T4OA 3MSWA 3ADIA 4LF8E 2VQFE 4GKJE 2FTXB 2KHXA 2UUBE 2WZOA 1DI2A 2EWLA 4WFTA 2B7VA 3H09A 4JI8E 4LFAE 2YT4A 2L6MA 3OTOE 4GEQB 3DJWA 4LTYA 2L33A 1QU6A 2N3HA 2DB2A 2UXDE 5DNYA 2H36X 2K4VA 3J7Yp 3JTZA 2LRSA 4WPYA 5LMUE 3LMLA 4X64E 4DR7E 5F3WA 2FV4B 3K6QA 2LJHA 4DUZE 1N32E 2M7QA 4M2ZA 5AE2A 4BS9A 2ZM6E 4LF7E 1RQ0A 3T1YE 2NUEA 5LMNE 1XMOE 2DSYA 1IBLE 3HTXA 2V86A 4JI4E 1IBME 2L3JA 3ZOQB 3J81C 3RMPA 4OOGC 4I8OA 4JI5E 3C4BA 2N3GA 1J5EE 4LF4E 4DKKA 2M1SA 5A2QC 4R03A 4DV5E 2M4IA 4LFCE 1WHNA 1YYWA 2G7HA 5AASA 4F9AB 1J26A 4OX9E 1T4NA 1HNZE 4GKKE 1O0WA 1YZ9A 2UXBE 4LFBE 2JOXA 2L92A 2V83A 4B3TE 2VF1A 5AE3A 2MDRA 4P78A 4YY3E 2IHR1 4DV6E 1XNRE 2F4VE 1HNWE 3ADJA 3DF6A 5LL6R 3VYYA 4BMJA 2NUFA 1EKZA 2JY9A 4JI3E 3HQ1A 2UUAE 4YHHE 4DR3E 2VE7C 3C4TA 1HNXE 2LTRA 2HHHE 1UILA 5IT9C 4B3RE 1DQ3A 2F8BA 5FLXC 2LUPB 4X66E 4L8NA 2LUQA 4KHPE 4J8ZA 4JV5E 1WXRA 4X65E 1GQEA 5IWAE 4LF9E 2RTXA 4DV0E 2ODRD 2L2KB 2KOUA 1T4LB 3FIGA 1XNQE 2EZ6A 2L2MA 2ODRC 3HXLA 3AUZA 4AQYE 4B3ME 4B3SE 3HPZA 2V85A 2YZTA 4LU9A 3IWCA 3VK6A 4Q28A 4JI2E 2JWOA 4LF5E 1FJGE 2JR1A 1IBKE 4R8OA 1N34E 4DR4E 4DUYE 4JI1E 1WHQA 4KZSA 1ZBQA 2LTSA 4F9CB 1SR9A 3VYXA 2RS6A 5CFFE 4DV3E 2UXCE 4JI0E 3T1HE 2L2NA 3F6GA 3P1XA 4DV2E 4M30A 2UUCE 1STUA 2B3TB 1N36E 2E5LE 2RS7A 1X49A 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTX B;  5T6J A;  2FV4 B;  4GEQ B; 
#chains in the Genus database with same CATH topology
 4DR2 E;  1TN9 A;  2JOB A;  2EPR A;  4JYA E;  2MC6 A;  3LLH A;  2L8T A;  1YUI A;  4BCA A;  4R2P A;  3M99 B;  1X5W A;  5A6B D;  1DGC A;  4DR6 E;  4O4K A;  4BC9 A;  1FKA E;  1IMU A;  4R2R A;  1HR0 E;  1N33 E;  2V89 A;  1PKP A;  4X8W A;  4ZYG A;  2DMY A;  2JXP A;  1YYO A;  3QG5 C;  2E1M A;  2LO3 A;  2VQE E;  3MSW A;  1Z1B A;  4LF8 E;  4GZN C;  2UUB E;  2KHX A;  1A1F A;  2DLQ A;  4BHB A;  2EOR A;  3OTO E;  2DGC A;  2EQ1 A;  4LTY A;  4KWY A;  2DB2 A;  4F6M A;  2K4V A;  4MLQ A;  1JK2 A;  4DUZ E;  1N32 E;  2M7Q A;  4M2Z A;  5AE2 A;  2GLI A;  4LF7 E;  4ZYD A;  5LMN E;  4WXD A;  2EOS A;  2N3G A;  2YTG A;  4DKK A;  4LF4 E;  5A2Q C;  1PJS A;  3BF2 A;  1WHN A;  2RQL A;  2E72 A;  5AC5 A;  1HNZ E;  4GKK E;  2EN6 A;  2V83 A;  1ZU1 A;  2VF1 A;  4ZYH A;  2J7J A;  4YY3 E;  1YSA C;  4R2D A;  5LL6 R;  2DRP A;  2NUF A;  2JY9 A;  2EL6 A;  3THN A;  4YHH E;  2HHH E;  2LTR A;  2EMC A;  2ENA A;  2LUQ A;  4KHP E;  4X65 E;  2EPC A;  2ODR D;  1EH7 A;  1YPN A;  2KOU A;  2ODR C;  3AUZ A;  4AQY E;  2RSI A;  2I13 A;  4JI2 E;  4LF5 E;  2JR1 A;  4M9V C;  1N34 E;  2CTD A;  4KZS A;  1ZBQ A;  2YTI A;  4O43 A;  2RS6 A;  1P47 A;  1STU A;  2B3T B;  1N36 E;  2E5L E;  2V8Q B;  4JI6 E;  3IWB A;  4WYQ B;  1ZBT A;  3JAM C;  4HEI A;  2LBS B;  2EPX A;  4MLV A;  1TF6 A;  1ZR9 A;  2MC5 A;  2JVA A;  3JU0 A;  4BC7 A;  4JI7 E;  2EM4 A;  2EPM X;  4X9J A;  1I94 E;  4WSP A;  1GZ6 A;  2V88 A;  4Q35 B;  3ADG A;  2RSM A;  1G2D C;  1WRJ A;  2YTE A;  5T6J A;  2WBS A;  2DLK A;  5AE1 A;  4F9B B;  2EPO A;  3HPS A;  4NHR A;  1A1I A;  1KJK A;  3ADI A;  1PDA A;  2L3C A;  2EL4 A;  2VQF E;  2FTX B;  1AAY A;  2WZO A;  2B7V A;  1RMD A;  1A1K A;  2YT4 A;  2HJJ A;  3DJW A;  5KL5 A;  2L33 A;  1JK1 A;  5DNY A;  2DMI A;  2A25 A;  1L4S A;  2ELY A;  2EMX A;  2EP3 A;  2M9A A;  5F3W A;  2FV4 B;  2EN7 A;  2EPZ A;  2LJH A;  4R2Q A;  3EPJ A;  4BS9 A;  5KL7 A;  1IBL E;  2EM0 A;  3J81 C;  4OOG C;  1MEY C;  3C4B A;  1J5E E;  4R2A A;  2CSH A;  2YTD A;  3MHH C;  2M4I A;  4DV5 E;  2JYA A;  2HGH A;  2EMH A;  2EPP A;  1O0W A;  2UXB E;  2L92 A;  2WBT A;  5AE3 A;  2MDR A;  4P78 A;  4DV6 E;  1XNR E;  2F4V E;  2MKN A;  3VYY A;  1F2I G;  4DR3 E;  4B3R E;  4NZV A;  2R76 A;  4J8Z A;  4JV5 E;  1WXR A;  4F6N A;  4DV0 E;  4RHB B;  2EOF A;  2YTJ A;  3VHT B;  1T4L B;  2EZ6 A;  2L2M A;  2EM9 A;  4B3M E;  4HTG A;  1UBD C;  3IWC A;  4Q28 A;  2JWO A;  4R8O A;  4DUY E;  1WJP A;  3UK3 C;  1WHQ A;  2LTS A;  4F9C B;  1LLM C;  3VYX A;  2D9H A;  1A1L A;  3T1H E;  3P1X A;  4M30 A;  2ADR A;  1KYQ A;  2RS7 A;  1X49 A;  2EM7 A;  5A6B A;  4DR1 E;  2LV2 A;  3BGH A;  2MDG A;  4LF6 E;  4DV7 E;  4F54 A;  3AV0 A;  2UU9 E;  5ADZ A;  4M0V A;  1A1G A;  5LLQ A;  3KWR A;  4DV1 E;  2EM3 A;  1X6E A;  1EH6 A;  2B9D A;  2DIX A;  4P7D A;  1IQO A;  4DR5 E;  3MHS C;  1SFE A;  4BBY A;  3J7A G;  3ECR A;  4O24 A;  5AC4 A;  3BBG A;  2NA2 A;  4TUG A;  4DMI A;  1X48 A;  3IWD A;  1NCS A;  4DV4 E;  1UHZ A;  1AH5 A;  4TUI A;  4L5N C;  4N4R B;  1XMQ E;  1X6H A;  1B69 A;  5KL2 A;  2YTO A;  2R1F A;  4O5G A;  2EWL A;  4WFT A;  4JI8 E;  1T39 A;  2L6M A;  1X6F A;  2UXD E;  4WSG A;  2H36 X;  5LMU E;  4WPY A;  2EN1 A;  3TQM A;  2EE8 A;  3K6Q A;  2LVH A;  4RH8 A;  4FK5 C;  2BBG A;  1RQ0 A;  3T1Y E;  2EMK A;  1XMO E;  2YPN A;  4JI4 E;  1IBM E;  2L3J A;  2EM6 A;  4I8O A;  1ZAA C;  2VRD A;  2EQ3 A;  1QNT A;  4R03 A;  2PRT A;  1A1H A;  4LFC E;  1YYW A;  2EMY A;  1EH8 A;  2G7H A;  4F9A B;  1J26 A;  4OX9 E;  1T4N A;  5A6J A;  3THO B;  1YZ9 A;  2EMW A;  4R2E A;  2YTQ A;  4LFB E;  2EPL X;  5A69 A;  2I9I A;  4IJD A;  1PJT A;  1BBO A;  2EOQ A;  3EPK A;  4IS1 C;  1HNW E;  3DF6 A;  4JI3 E;  2EOJ A;  3HQ1 A;  2JP9 A;  2EN8 A;  3C4T A;  1HNX E;  1UIL A;  1DQ3 A;  2LUP B;  2K7I A;  5A6K A;  3KZY A;  4L8N A;  2EMB A;  2ENH A;  2YRM A;  4R2S A;  2EMG A;  5IWA E;  1XNQ E;  3HXL A;  3HPZ A;  2V85 A;  1FJG E;  3VK6 A;  2GPI A;  2EOI A;  4JI1 E;  2YTP A;  4BHC A;  2YTF A;  2EMA A;  2JPA A;  2EPA A;  5KL4 A;  2YRK A;  2UXC E;  2L2N A;  2YWQ A;  5IV8 B;  1G2F C;  3L00 A;  4NXM E;  2WCC 3;  1X47 A;  3C6K A;  2EOM A;  2EMI A;  4X62 E;  2NUG A;  3J80 C;  2CPN A;  2EN2 A;  1N3G A;  2FGG A;  1YFH A;  1RC7 A;  2EM8 A;  2YTN A;  3C6M A;  3F6H A;  2EMF A;  3OML A;  2EJ4 A;  3EQ1 A;  1BBG A;  1YYK A;  1TF3 A;  4F2J C;  2KON A;  3ADL A;  1NEI A;  2EPU A;  2LE2 A;  2ELZ A;  4K0K E;  2B7T A;  2LCE A;  2LMZ A;  2V87 A;  5BR8 E;  2EOE A;  1T4O A;  5IXM B;  5KL3 A;  2LJU A;  4GKJ E;  1PJQ A;  3BID A;  2LT7 A;  4WX9 A;  2WBU A;  4LFA E;  1DI2 A;  3H09 A;  4GEQ B;  2MKD A;  1QU6 A;  2N3H A;  3J7Y p;  3JTZ A;  2LRS A;  2GHF A;  2Q8U A;  3LML A;  4X64 E;  4DR7 E;  2EMZ A;  2EQ0 A;  2EOZ A;  2YU5 A;  2EM5 A;  2EN3 A;  2ZM6 E;  2NUE A;  2DSY A;  1X3C A;  3HTX A;  2V86 A;  2EPN A;  2EOH A;  3ZOQ B;  3RMP A;  4JI5 E;  2YSO A;  2M1S A;  5A6A A;  5AAS A;  2HC5 A;  2EOO A;  2JOX A;  4B3T E;  2YSP A;  2IHR 1;  3ADJ A;  4NXN E;  4BMJ A;  2EM2 A;  1EKZ A;  2UUA E;  2EN4 A;  2VE7 C;  5IT9 C;  2F8B A;  5FLX C;  4X66 E;  2EML A;  2CT1 A;  1UN6 B;  1IQS A;  1GQE A;  4LF9 E;  2RTX A;  2YU8 A;  5KL6 A;  2L2K B;  1GTK A;  1MGT A;  3FIG A;  3EPH A;  4R2C A;  2RPC A;  4B3S E;  1YUJ A;  4LU9 A;  2YZT A;  2YRH A;  1IBK E;  4DR4 E;  2NAB A;  5TSE A;  2EOX A;  4WXC A;  1SR9 A;  2BB8 A;  2EPK X;  1T38 A;  3KZZ A;  5CFF E;  4DV3 E;  2EL5 A;  4JI0 E;  4ZYE A;  3F6G A;  4DV2 E;  2ENC A;  2UUC E;  3EPL A;  1A1J A;  1BB8 A;  2N8X A;  2EOY A; 
#chains in the Genus database with same CATH homology
 4JI6 E;  4DR2 E;  4NXM E;  2JOB A;  4JYA E;  3IWB A;  4WYQ B;  2MC6 A;  1ZBT A;  3LLH A;  2L8T A;  3JAM C;  2LBS B;  1X47 A;  4NXN E;  4DR1 E;  4BCA A;  2MC5 A;  4LF6 E;  4DV7 E;  4DR6 E;  4X62 E;  2JVA A;  3AV0 A;  3JU0 A;  4F54 A;  3J80 C;  2UU9 E;  5ADZ A;  4M0V A;  2NUG A;  2CPN A;  2FGG A;  4BC9 A;  1RC7 A;  4BC7 A;  3KWR A;  4DV1 E;  4JI7 E;  1FKA E;  1I94 E;  3F6H A;  4WSP A;  1GZ6 A;  2B9D A;  2DIX A;  4P7D A;  3OML A;  2V88 A;  4DR5 E;  1HR0 E;  4BBY A;  3J7A G;  1N33 E;  2V89 A;  1PKP A;  3ADG A;  2NA2 A;  4TUG A;  2RSM A;  4X8W A;  4DMI A;  1X48 A;  3IWD A;  1YYK A;  4DV4 E;  2DMY A;  1UHZ A;  2KON A;  5T6J A;  3ADL A;  5AE1 A;  1YYO A;  2LE2 A;  4F9B B;  3HPS A;  4L5N C;  4TUI A;  4K0K E;  2E1M A;  2VQE E;  2B7T A;  5BR8 E;  2LMZ A;  2V87 A;  2L3C A;  1XMQ E;  1T4O A;  3MSW A;  3ADI A;  4LF8 E;  2VQF E;  4GKJ E;  2FTX B;  2KHX A;  2UUB E;  2WZO A;  1DI2 A;  2EWL A;  4WFT A;  2B7V A;  3H09 A;  4JI8 E;  4LFA E;  2YT4 A;  2L6M A;  3OTO E;  4GEQ B;  3DJW A;  4LTY A;  2L33 A;  1QU6 A;  2N3H A;  2DB2 A;  2UXD E;  5DNY A;  2H36 X;  2K4V A;  3J7Y p;  3JTZ A;  2LRS A;  4WPY A;  5LMU E;  3LML A;  4X64 E;  4DR7 E;  5F3W A;  2FV4 B;  3K6Q A;  2LJH A;  4DUZ E;  1N32 E;  2M7Q A;  4M2Z A;  5AE2 A;  4BS9 A;  2ZM6 E;  4LF7 E;  1RQ0 A;  3T1Y E;  2NUE A;  5LMN E;  1XMO E;  2DSY A;  1IBL E;  3HTX A;  2V86 A;  4JI4 E;  1IBM E;  2L3J A;  3ZOQ B;  3J81 C;  3RMP A;  4OOG C;  4I8O A;  4JI5 E;  3C4B A;  2N3G A;  1J5E E;  4LF4 E;  4DKK A;  2M1S A;  5A2Q C;  4R03 A;  4DV5 E;  2M4I A;  4LFC E;  1WHN A;  1YYW A;  2G7H A;  5AAS A;  4F9A B;  1J26 A;  4OX9 E;  1T4N A;  1HNZ E;  4GKK E;  1O0W A;  1YZ9 A;  2UXB E;  4LFB E;  2JOX A;  2L92 A;  2V83 A;  4B3T E;  2VF1 A;  5AE3 A;  2MDR A;  4P78 A;  4YY3 E;  2IHR 1;  4DV6 E;  1XNR E;  2F4V E;  1HNW E;  3ADJ A;  3DF6 A;  5LL6 R;  3VYY A;  4BMJ A;  2NUF A;  1EKZ A;  2JY9 A;  4JI3 E;  3HQ1 A;  2UUA E;  4YHH E;  4DR3 E;  2VE7 C;  3C4T A;  1HNX E;  2LTR A;  2HHH E;  1UIL A;  5IT9 C;  4B3R E;  1DQ3 A;  2F8B A;  5FLX C;  2LUP B;  4X66 E;  4L8N A;  2LUQ A;  4KHP E;  4J8Z A;  4JV5 E;  1WXR A;  4X65 E;  1GQE A;  5IWA E;  4LF9 E;  2RTX A;  4DV0 E;  2ODR D;  2L2K B;  2KOU A;  1T4L B;  3FIG A;  1XNQ E;  2EZ6 A;  2L2M A;  2ODR C;  3HXL A;  3AUZ A;  4AQY E;  4B3M E;  4B3S E;  3HPZ A;  2V85 A;  2YZT A;  4LU9 A;  3IWC A;  3VK6 A;  4Q28 A;  4JI2 E;  2JWO A;  4LF5 E;  1FJG E;  2JR1 A;  1IBK E;  4R8O A;  1N34 E;  4DR4 E;  4DUY E;  4JI1 E;  1WHQ A;  4KZS A;  1ZBQ A;  2LTS A;  4F9C B;  1SR9 A;  3VYX A;  2RS6 A;  5CFF E;  4DV3 E;  2UXC E;  4JI0 E;  3T1H E;  2L2N A;  3F6G A;  3P1X A;  4DV2 E;  4M30 A;  2UUC E;  1STU A;  2B3T B;  1N36 E;  2E5L E;  2RS7 A;  1X49 A;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...