4GEQB

Crystal structure of the spc24-spc25/cnn1 binding interface
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
58
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Cell cycle
molecule keywords Kinetochore protein SPC25
total genus 15
structure length 58
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4geqB00
2FV4B 4GEQB 5T6JA 2FTXB
chains in the Genus database with same CATH superfamily
3VYXA 5LL6R 2EQ0A 3HPZA 4BHCA 1T4NA 2I9IA 2GLIA 2B3TB 4DV6E 2RS7A 4P7DA 2MDGA 3ADLA 4O24A 1A1HA 2EZ6A 2CT1A 2YPNA 4NZVA 2YRHA 1RQ0A 2YTJA 5AASA 4DR1E 3J7Yp 2BB8A 3AV0A 4DV0E 1A1LA 3JU0A 3BIDA 1QU6A 4DV7E 4JI0E 4R2AA 2MKNA 2EM4A 2L3CA 1PJQA 2EM7A 1YUJA 3MHHC 2CTDA 4DV2E 3T1HE 1J26A 3OTOE 4DUZE 4L8NA 5LMNE 2M7QA 2EMGA 2EN8A 4L5NC 3L00A 4LF4E 2KONA 4F54A 3IWCA 2DLQA 2WBTA 2EN4A 2EN7A 2NA2A 1ZR9A 2YTNA 5KL3A 1RMDA 1X49A 4LFBE 4JI6E 4B3ME 4DR6E 5IV8B 2L6MA 3JAMC 5A6BA 3HPSA 2RQLA 2LUPB 2EMLA 2HGHA 2LRSA 2EM3A 3VHTB 2EOSA 4WSPA 1YSAC 4JI4E 1EKZA 1PJTA 3ECRA 1YPNA 1Z1BA 4LFCE 2LUQA 4GEQB 4P78A 2EPAA 2LE2A 2EMCA 2MC6A 3JTZA 1HNZE 1ZU1A 2EOQA 4JV5E 2YTQA 4F9BB 3THOB 1T38A 1J5EE 2EN2A 2EPOA 2KHXA 2JP9A 2YWQA 4R2PA 3ADGA 4M0VA 4NXME 2V87A 2UUCE 4FK5C 1WHQA 2EOMA 5IXMB 1WJPA 4DV1E 2EM9A 2ADRA 2EORA 1X3CA 2EN1A 1DQ3A 2B7TA 5A6KA 2RSIA 4M9VC 4LF5E 2YTIA 2FV4B 2LVHA 3VK6A 2EOYA 1P47A 2N3GA 2EJ4A 2I13A 2EL6A 3MHSC 2EM2A 2IHR1 4O43A 4BCAA 4OX9E 3J80C 4M2ZA 1NEIA 2EOOA 3H09A 4ZYDA 3M99B 2WCC3 2EMZA 3C4BA 1TN9A 2EMAA 2EE8A 4KZSA 1TF6A 2V89A 2HHHE 2V86A 2JY9A 5LMUE 5A2QC 2YT4A 1HNWE 2EPNA 2EMFA 3BF2A 5AE3A 1T4OA 5A6BD 4GKJE 1YZ9A 3BBGA 2MDRA 2LV2A 2YZTA 5DNYA 4JI3E 2LCEA 1WRJA 3HXLA 4R2EA 2VQFE 2EN3A 4GZNC 1AAYA 2F8BA 2LMZA 4JI7E 4K0KE 2LO3A 5T6JA 4GKKE 1JK1A 3LLHA 1TF3A 2EOHA 2HJJA 1F2IG 3EPKA 2FGGA 5CFFE 5TSEA 1GZ6A 1FKAE 3VYYA 1X5WA 5A6JA 4X9JA 4WXDA 2N8XA 4I8OA 2ODRC 2NUEA 3THNA 3EQ1A 3KZZA 5KL2A 3HTXA 1QNTA 1YYKA 3P1XA 1T39A 3ADIA 1N33E 4DMIA 2EOEA 2L3JA 1X6HA 2J7JA 3KZYA 2YU8A 4IS1C 2R1FA 5IWAE 1XMQE 4R2QA 2JOXA 2YSPA 1DI2A 1G2DC 1SR9A 1MGTA 2WBSA 2M1SA 2UXCE 1XNQE 2EPMX 4ZYHA 4DR7E 1IQSA 1EH6A 4Q35B 2JPAA 1ZBQA 4F9AB 2RS6A 4WXCA 2E1MA 2EPXA 4RH8A 5AC4A 2GPIA 2RTXA 2D9HA 2EWLA 2JVAA 2NUFA 4AQYE 3EPLA 1N3GA 4N4RB 2LTRA 1YFHA 1UBDC 2EMIA 2JOBA 2EOFA 2EPKX 2EMXA 4ZYGA 5AE1A 4J8ZA 4BBYA 2RPCA 2V83A 2LJUA 4DR3E 4OOGC 1IMUA 4F2JC 3J7AG 4B3RE 1UILA 5A69A 2A25A 1N36E 1UHZA 4WFTA 1IQOA 1A1KA 1LLMC 1A1IA 4Q28A 2LTSA 2EL4A 4R2CA 4R8OA 4BMJA 3DF6A 3DJWA 2YTEA 1BBGA 2Q8UA 1L4SA 1GQEA 4LF6E 2V85A 1HR0E 2E5LE 2V88A 1IBME 1O0WA 2L92A 1N34E 3QG5C 1ZBTA 1JK2A 3TQMA 2EM0A 2LT7A 2H36X 2L33A 2UUAE 4O4KA 2DMYA 1ZAAC 2EPCA 2HC5A 4WYQB 5KL6A 4DV3E 4LU9A 2EPLX 1XNRE 2EOXA 3IWDA 2LJHA 2ENCA 2EMHA 4F6NA 1IBKE 1SFEA 1EH8A 1PJSA 4X66E 1X47A 3BGHA 2KOUA 2DB2A 2UXDE 4R2DA 2ZM6E 4DUYE 1IBLE 3ZOQB 1WHNA 1NCSA 1BB8A 2GHFA 4IJDA 2YTPA 3C4TA 5KL5A 4LF9E 2EM6A 3F6GA 1B69A 4X8WA 2FTXB 2VRDA 5A6AA 4B3TE 2E72A 2JR1A 2K7IA 5FLXC 1FJGE 5ADZA 3UK3C 1XMOE 4B3SE 2YSOA 4JYAE 4WPYA 4R2SA 2EL5A 1A1JA 2JXPA 3EPHA 2B9DA 4BC7A 4YY3E 3LMLA 2ENHA 2EP3A 1AH5A 2DRPA 4YHHE 1YUIA 2CSHA 1HNXE 4BC9A 4M30A 4F9CB 2CPNA 2M4IA 2LBSB 2G7HA 3K6QA 3F6HA 1A1FA 2NABA 3AUZA 4LF7E 4R2RA 2ELYA 2YTGA 2ELZA 2DGCA 2MC5A 4DR4E 2EPZA 3EPJA 1X48A 2L2MA 2JWOA 4ZYEA 1YYWA 2EOZA 2ODRD 3T1YE 1KJKA 2EPPA 5KL7A 3KWRA 5AC5A 2RSMA 2DSYA 2YTOA 2YTDA 2K4VA 1MEYC 2R76A 3IWBA 4DR2E 5KL4A 4DR5E 3FIGA 1STUA 4BS9A 3RMPA 1N32E 3C6KA 4WSGA 1X6EA 4X65E 4BHBA 4X64E 2EMKA 4MLVA 4LF8E 5IT9C 2DIXA 4TUGA 2EMYA 1G2FC 2NUGA 2PRTA 4DKKA 4LFAE 2WBUA 2EPUA 5F3WA 2EQ3A 2BBGA 2DMIA 1DGCA 1EH7A 4DV4E 2VE7C 2YRMA 2EM5A 3ADJA 4HEIA 4TUIA 1KYQA 2EMBA 4MLQA 2UUBE 2UXBE 2EN6A 1YYOA 4WX9A 2EPRA 2MKDA 2L8TA 4LTYA 2YTFA 2L2NA 2JYAA 2EOJA 4X62E 4DV5E 5BR8E 2WZOA 2VQEE 1A1GA 4JI2E 1PDAA 2ENAA 4O5GA 2F4VE 1GTKA 4RHBB 3C6MA 3HQ1A 1I94E 4JI5E 2N3HA 2V8QB 4R03A 5AE2A 1X6FA 5LLQA 2EMWA 1UN6B 2VF1A 2B7VA 4KHPE 1T4LB 3OMLA 4KWYA 3J81C 1RC7A 4HTGA 2EQ1A 4NHRA 1BBOA 1PKPA 2YRKA 4NXNE 2L2KB 4JI8E 2M9AA 2YU5A 1WXRA 3MSWA 4JI1E 4F6MA 2EOIA 2EM8A 2DLKA 2UU9E
chains in the Genus database with same CATH topology
3J80C 3VYXA 5LL6R 4OX9E 3HPZA 3K6QA 3F6HA 4M2ZA 3H09A 1UILA 3AUZA 1T4NA 1N36E 1UHZA 4WFTA 2B3TB 4DV6E 4LF7E 4Q28A 2LTSA 2RS7A 3C4BA 4P7DA 4KZSA 2HHHE 2V89A 4R8OA 4BMJA 3DF6A 2MC5A 2V86A 3ADLA 4DR4E 2JY9A 4BCAA 5LMUE 5A2QC 3DJWA 2YT4A 1HNWE 1X48A 1GQEA 1T4OA 2L2MA 5AE3A 2JWOA 4LF6E 2V85A 2EZ6A 3J7AG 1YYWA 1HR0E 2E5LE 1YZ9A 2V88A 1RQ0A 4GKJE 1IBME 2ODRD 5AASA 4DR1E 1O0WA 3J7Yp 3T1YE 2MDRA 3AV0A 2YZTA 4DV0E 2L92A 1N34E 5DNYA 4JI3E 3JU0A 1ZBTA 3HXLA 3KWRA 2VQFE 2F8BA 2RSMA 1QU6A 2LMZA 2DSYA 4JI7E 4K0KE 4DV7E 2H36X 2L33A 2K4VA 5T6JA 2DMYA 2UUAE 4JI0E 4GKKE 4DR2E 3IWBA 3LLHA 4WYQB 2L3CA 4DR5E 3FIGA 2FGGA 1STUA 5CFFE 1GZ6A 4BS9A 4DV2E 3RMPA 4DV3E 3T1HE 3VYYA 1FKAE 1N32E 1J26A 3OTOE 4DUZE 4L8NA 4LU9A 2M7QA 5LMNE 4X65E 1XNRE 4L5NC 3IWDA 4LF4E 2KONA 2ODRC 3IWCA 2LJHA 4I8OA 4F54A 4X64E 2NUEA 2NA2A 1IBKE 4LF8E 3HTXA 5IT9C 2DIXA 4TUGA 1X49A 4X66E 1YYKA 2NUGA 4DKKA 4LFAE 1X47A 3P1XA 4B3ME 4JI6E 4LFBE 5F3WA 4DR6E 2KOUA 2L6MA 3JAMC 3ADIA 2DB2A 3HPSA 4DV4E 2LUPB 1N33E 2LRSA 2VE7C 4DMIA 3ADJA 2UXDE 2L3JA 4TUIA 2ZM6E 2UUBE 4WSPA 2UXBE 4JI4E 4DUYE 1IBLE 1EKZA 1YYOA 3ZOQB 1WHNA 5IWAE 2LUQA 4GEQB 1XMQE 4LFCE 4P78A 2L8TA 4LF9E 2JOXA 2LE2A 3C4TA 4LTYA 1DI2A 3F6GA 2MC6A 1SR9A 2FTXB 3JTZA 4X8WA 4B3TE 2L2NA 2JR1A 1HNZE 5FLXC 2M1SA 4X62E 4DV5E 1FJGE 2UXCE 5BR8E 5ADZA 2WZOA 2VQEE 1XNQE 1XMOE 4B3SE 4JI2E 4JYAE 4JV5E 4DR7E 4WPYA 4F9BB 4LF5E 1J5EE 2F4VE 1ZBQA 2KHXA 4F9AB 2B9DA 3ADGA 4BC7A 4YY3E 2RS6A 3HQ1A 4M0VA 2E1MA 3LMLA 1I94E 4JI5E 2N3HA 4NXME 2V8QB 4R03A 2V87A 2UUCE 5AE2A 1WHQA 2VF1A 2B7VA 2RTXA 4KHPE 1T4LB 4DV1E 3OMLA 2EWLA 2JVAA 2NUFA 3J81C 1RC7A 4AQYE 2LTRA 2JOBA 4YHHE 1DQ3A 2B7TA 1PKPA 1HNXE 4BC9A 5AE1A 4M30A 4J8ZA 2CPNA 4BBYA 4F9CB 2L2KB 2FV4B 3VK6A 2V83A 4JI8E 4NXNE 4JI1E 1WXRA 2N3GA 3MSWA 4OOGC 2M4IA 4DR3E 2LBSB 2G7HA 2IHR1 2UU9E 4B3RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV4 B;  4GEQ B;  5T6J A;  2FTX B; 
#chains in the Genus database with same CATH topology
 3VYX A;  5LL6 R;  2EQ0 A;  3HPZ A;  4BHC A;  1T4N A;  2I9I A;  2GLI A;  2B3T B;  4DV6 E;  2RS7 A;  4P7D A;  2MDG A;  3ADL A;  4O24 A;  1A1H A;  2EZ6 A;  2CT1 A;  2YPN A;  4NZV A;  2YRH A;  1RQ0 A;  2YTJ A;  5AAS A;  4DR1 E;  3J7Y p;  2BB8 A;  3AV0 A;  4DV0 E;  1A1L A;  3JU0 A;  3BID A;  1QU6 A;  4DV7 E;  4JI0 E;  4R2A A;  2MKN A;  2EM4 A;  2L3C A;  1PJQ A;  2EM7 A;  1YUJ A;  3MHH C;  2CTD A;  4DV2 E;  3T1H E;  1J26 A;  3OTO E;  4DUZ E;  4L8N A;  5LMN E;  2M7Q A;  2EMG A;  2EN8 A;  4L5N C;  3L00 A;  4LF4 E;  2KON A;  4F54 A;  3IWC A;  2DLQ A;  2WBT A;  2EN4 A;  2EN7 A;  2NA2 A;  1ZR9 A;  2YTN A;  5KL3 A;  1RMD A;  1X49 A;  4LFB E;  4JI6 E;  4B3M E;  4DR6 E;  5IV8 B;  2L6M A;  3JAM C;  5A6B A;  3HPS A;  2RQL A;  2LUP B;  2EML A;  2HGH A;  2LRS A;  2EM3 A;  3VHT B;  2EOS A;  4WSP A;  1YSA C;  4JI4 E;  1EKZ A;  1PJT A;  3ECR A;  1YPN A;  1Z1B A;  4LFC E;  2LUQ A;  4GEQ B;  4P78 A;  2EPA A;  2LE2 A;  2EMC A;  2MC6 A;  3JTZ A;  1HNZ E;  1ZU1 A;  2EOQ A;  4JV5 E;  2YTQ A;  4F9B B;  3THO B;  1T38 A;  1J5E E;  2EN2 A;  2EPO A;  2KHX A;  2JP9 A;  2YWQ A;  4R2P A;  3ADG A;  4M0V A;  4NXM E;  2V87 A;  2UUC E;  4FK5 C;  1WHQ A;  2EOM A;  5IXM B;  1WJP A;  4DV1 E;  2EM9 A;  2ADR A;  2EOR A;  1X3C A;  2EN1 A;  1DQ3 A;  2B7T A;  5A6K A;  2RSI A;  4M9V C;  4LF5 E;  2YTI A;  2FV4 B;  2LVH A;  3VK6 A;  2EOY A;  1P47 A;  2N3G A;  2EJ4 A;  2I13 A;  2EL6 A;  3MHS C;  2EM2 A;  2IHR 1;  4O43 A;  4BCA A;  4OX9 E;  3J80 C;  4M2Z A;  1NEI A;  2EOO A;  3H09 A;  4ZYD A;  3M99 B;  2WCC 3;  2EMZ A;  3C4B A;  1TN9 A;  2EMA A;  2EE8 A;  4KZS A;  1TF6 A;  2V89 A;  2HHH E;  2V86 A;  2JY9 A;  5LMU E;  5A2Q C;  2YT4 A;  1HNW E;  2EPN A;  2EMF A;  3BF2 A;  5AE3 A;  1T4O A;  5A6B D;  4GKJ E;  1YZ9 A;  3BBG A;  2MDR A;  2LV2 A;  2YZT A;  5DNY A;  4JI3 E;  2LCE A;  1WRJ A;  3HXL A;  4R2E A;  2VQF E;  2EN3 A;  4GZN C;  1AAY A;  2F8B A;  2LMZ A;  4JI7 E;  4K0K E;  2LO3 A;  5T6J A;  4GKK E;  1JK1 A;  3LLH A;  1TF3 A;  2EOH A;  2HJJ A;  1F2I G;  3EPK A;  2FGG A;  5CFF E;  5TSE A;  1GZ6 A;  1FKA E;  3VYY A;  1X5W A;  5A6J A;  4X9J A;  4WXD A;  2N8X A;  4I8O A;  2ODR C;  2NUE A;  3THN A;  3EQ1 A;  3KZZ A;  5KL2 A;  3HTX A;  1QNT A;  1YYK A;  3P1X A;  1T39 A;  3ADI A;  1N33 E;  4DMI A;  2EOE A;  2L3J A;  1X6H A;  2J7J A;  3KZY A;  2YU8 A;  4IS1 C;  2R1F A;  5IWA E;  1XMQ E;  4R2Q A;  2JOX A;  2YSP A;  1DI2 A;  1G2D C;  1SR9 A;  1MGT A;  2WBS A;  2M1S A;  2UXC E;  1XNQ E;  2EPM X;  4ZYH A;  4DR7 E;  1IQS A;  1EH6 A;  4Q35 B;  2JPA A;  1ZBQ A;  4F9A B;  2RS6 A;  4WXC A;  2E1M A;  2EPX A;  4RH8 A;  5AC4 A;  2GPI A;  2RTX A;  2D9H A;  2EWL A;  2JVA A;  2NUF A;  4AQY E;  3EPL A;  1N3G A;  4N4R B;  2LTR A;  1YFH A;  1UBD C;  2EMI A;  2JOB A;  2EOF A;  2EPK X;  2EMX A;  4ZYG A;  5AE1 A;  4J8Z A;  4BBY A;  2RPC A;  2V83 A;  2LJU A;  4DR3 E;  4OOG C;  1IMU A;  4F2J C;  3J7A G;  4B3R E;  1UIL A;  5A69 A;  2A25 A;  1N36 E;  1UHZ A;  4WFT A;  1IQO A;  1A1K A;  1LLM C;  1A1I A;  4Q28 A;  2LTS A;  2EL4 A;  4R2C A;  4R8O A;  4BMJ A;  3DF6 A;  3DJW A;  2YTE A;  1BBG A;  2Q8U A;  1L4S A;  1GQE A;  4LF6 E;  2V85 A;  1HR0 E;  2E5L E;  2V88 A;  1IBM E;  1O0W A;  2L92 A;  1N34 E;  3QG5 C;  1ZBT A;  1JK2 A;  3TQM A;  2EM0 A;  2LT7 A;  2H36 X;  2L33 A;  2UUA E;  4O4K A;  2DMY A;  1ZAA C;  2EPC A;  2HC5 A;  4WYQ B;  5KL6 A;  4DV3 E;  4LU9 A;  2EPL X;  1XNR E;  2EOX A;  3IWD A;  2LJH A;  2ENC A;  2EMH A;  4F6N A;  1IBK E;  1SFE A;  1EH8 A;  1PJS A;  4X66 E;  1X47 A;  3BGH A;  2KOU A;  2DB2 A;  2UXD E;  4R2D A;  2ZM6 E;  4DUY E;  1IBL E;  3ZOQ B;  1WHN A;  1NCS A;  1BB8 A;  2GHF A;  4IJD A;  2YTP A;  3C4T A;  5KL5 A;  4LF9 E;  2EM6 A;  3F6G A;  1B69 A;  4X8W A;  2FTX B;  2VRD A;  5A6A A;  4B3T E;  2E72 A;  2JR1 A;  2K7I A;  5FLX C;  1FJG E;  5ADZ A;  3UK3 C;  1XMO E;  4B3S E;  2YSO A;  4JYA E;  4WPY A;  4R2S A;  2EL5 A;  1A1J A;  2JXP A;  3EPH A;  2B9D A;  4BC7 A;  4YY3 E;  3LML A;  2ENH A;  2EP3 A;  1AH5 A;  2DRP A;  4YHH E;  1YUI A;  2CSH A;  1HNX E;  4BC9 A;  4M30 A;  4F9C B;  2CPN A;  2M4I A;  2LBS B;  2G7H A;  3K6Q A;  3F6H A;  1A1F A;  2NAB A;  3AUZ A;  4LF7 E;  4R2R A;  2ELY A;  2YTG A;  2ELZ A;  2DGC A;  2MC5 A;  4DR4 E;  2EPZ A;  3EPJ A;  1X48 A;  2L2M A;  2JWO A;  4ZYE A;  1YYW A;  2EOZ A;  2ODR D;  3T1Y E;  1KJK A;  2EPP A;  5KL7 A;  3KWR A;  5AC5 A;  2RSM A;  2DSY A;  2YTO A;  2YTD A;  2K4V A;  1MEY C;  2R76 A;  3IWB A;  4DR2 E;  5KL4 A;  4DR5 E;  3FIG A;  1STU A;  4BS9 A;  3RMP A;  1N32 E;  3C6K A;  4WSG A;  1X6E A;  4X65 E;  4BHB A;  4X64 E;  2EMK A;  4MLV A;  4LF8 E;  5IT9 C;  2DIX A;  4TUG A;  2EMY A;  1G2F C;  2NUG A;  2PRT A;  4DKK A;  4LFA E;  2WBU A;  2EPU A;  5F3W A;  2EQ3 A;  2BBG A;  2DMI A;  1DGC A;  1EH7 A;  4DV4 E;  2VE7 C;  2YRM A;  2EM5 A;  3ADJ A;  4HEI A;  4TUI A;  1KYQ A;  2EMB A;  4MLQ A;  2UUB E;  2UXB E;  2EN6 A;  1YYO A;  4WX9 A;  2EPR A;  2MKD A;  2L8T A;  4LTY A;  2YTF A;  2L2N A;  2JYA A;  2EOJ A;  4X62 E;  4DV5 E;  5BR8 E;  2WZO A;  2VQE E;  1A1G A;  4JI2 E;  1PDA A;  2ENA A;  4O5G A;  2F4V E;  1GTK A;  4RHB B;  3C6M A;  3HQ1 A;  1I94 E;  4JI5 E;  2N3H A;  2V8Q B;  4R03 A;  5AE2 A;  1X6F A;  5LLQ A;  2EMW A;  1UN6 B;  2VF1 A;  2B7V A;  4KHP E;  1T4L B;  3OML A;  4KWY A;  3J81 C;  1RC7 A;  4HTG A;  2EQ1 A;  4NHR A;  1BBO A;  1PKP A;  2YRK A;  4NXN E;  2L2K B;  4JI8 E;  2M9A A;  2YU5 A;  1WXR A;  3MSW A;  4JI1 E;  4F6M A;  2EOI A;  2EM8 A;  2DLK A;  2UU9 E; 
#chains in the Genus database with same CATH homology
 3J80 C;  3VYX A;  5LL6 R;  4OX9 E;  3HPZ A;  3K6Q A;  3F6H A;  4M2Z A;  3H09 A;  1UIL A;  3AUZ A;  1T4N A;  1N36 E;  1UHZ A;  4WFT A;  2B3T B;  4DV6 E;  4LF7 E;  4Q28 A;  2LTS A;  2RS7 A;  3C4B A;  4P7D A;  4KZS A;  2HHH E;  2V89 A;  4R8O A;  4BMJ A;  3DF6 A;  2MC5 A;  2V86 A;  3ADL A;  4DR4 E;  2JY9 A;  4BCA A;  5LMU E;  5A2Q C;  3DJW A;  2YT4 A;  1HNW E;  1X48 A;  1GQE A;  1T4O A;  2L2M A;  5AE3 A;  2JWO A;  4LF6 E;  2V85 A;  2EZ6 A;  3J7A G;  1YYW A;  1HR0 E;  2E5L E;  1YZ9 A;  2V88 A;  1RQ0 A;  4GKJ E;  1IBM E;  2ODR D;  5AAS A;  4DR1 E;  1O0W A;  3J7Y p;  3T1Y E;  2MDR A;  3AV0 A;  2YZT A;  4DV0 E;  2L92 A;  1N34 E;  5DNY A;  4JI3 E;  3JU0 A;  1ZBT A;  3HXL A;  3KWR A;  2VQF E;  2F8B A;  2RSM A;  1QU6 A;  2LMZ A;  2DSY A;  4JI7 E;  4K0K E;  4DV7 E;  2H36 X;  2L33 A;  2K4V A;  5T6J A;  2DMY A;  2UUA E;  4JI0 E;  4GKK E;  4DR2 E;  3IWB A;  3LLH A;  4WYQ B;  2L3C A;  4DR5 E;  3FIG A;  2FGG A;  1STU A;  5CFF E;  1GZ6 A;  4BS9 A;  4DV2 E;  3RMP A;  4DV3 E;  3T1H E;  3VYY A;  1FKA E;  1N32 E;  1J26 A;  3OTO E;  4DUZ E;  4L8N A;  4LU9 A;  2M7Q A;  5LMN E;  4X65 E;  1XNR E;  4L5N C;  3IWD A;  4LF4 E;  2KON A;  2ODR C;  3IWC A;  2LJH A;  4I8O A;  4F54 A;  4X64 E;  2NUE A;  2NA2 A;  1IBK E;  4LF8 E;  3HTX A;  5IT9 C;  2DIX A;  4TUG A;  1X49 A;  4X66 E;  1YYK A;  2NUG A;  4DKK A;  4LFA E;  1X47 A;  3P1X A;  4B3M E;  4JI6 E;  4LFB E;  5F3W A;  4DR6 E;  2KOU A;  2L6M A;  3JAM C;  3ADI A;  2DB2 A;  3HPS A;  4DV4 E;  2LUP B;  1N33 E;  2LRS A;  2VE7 C;  4DMI A;  3ADJ A;  2UXD E;  2L3J A;  4TUI A;  2ZM6 E;  2UUB E;  4WSP A;  2UXB E;  4JI4 E;  4DUY E;  1IBL E;  1EKZ A;  1YYO A;  3ZOQ B;  1WHN A;  5IWA E;  2LUQ A;  4GEQ B;  1XMQ E;  4LFC E;  4P78 A;  2L8T A;  4LF9 E;  2JOX A;  2LE2 A;  3C4T A;  4LTY A;  1DI2 A;  3F6G A;  2MC6 A;  1SR9 A;  2FTX B;  3JTZ A;  4X8W A;  4B3T E;  2L2N A;  2JR1 A;  1HNZ E;  5FLX C;  2M1S A;  4X62 E;  4DV5 E;  1FJG E;  2UXC E;  5BR8 E;  5ADZ A;  2WZO A;  2VQE E;  1XNQ E;  1XMO E;  4B3S E;  4JI2 E;  4JYA E;  4JV5 E;  4DR7 E;  4WPY A;  4F9B B;  4LF5 E;  1J5E E;  2F4V E;  1ZBQ A;  2KHX A;  4F9A B;  2B9D A;  3ADG A;  4BC7 A;  4YY3 E;  2RS6 A;  3HQ1 A;  4M0V A;  2E1M A;  3LML A;  1I94 E;  4JI5 E;  2N3H A;  4NXM E;  2V8Q B;  4R03 A;  2V87 A;  2UUC E;  5AE2 A;  1WHQ A;  2VF1 A;  2B7V A;  2RTX A;  4KHP E;  1T4L B;  4DV1 E;  3OML A;  2EWL A;  2JVA A;  2NUF A;  3J81 C;  1RC7 A;  4AQY E;  2LTR A;  2JOB A;  4YHH E;  1DQ3 A;  2B7T A;  1PKP A;  1HNX E;  4BC9 A;  5AE1 A;  4M30 A;  4J8Z A;  2CPN A;  4BBY A;  4F9C B;  2L2K B;  2FV4 B;  3VK6 A;  2V83 A;  4JI8 E;  4NXN E;  4JI1 E;  1WXR A;  2N3G A;  3MSW A;  4OOG C;  2M4I A;  4DR3 E;  2LBS B;  2G7H A;  2IHR 1;  2UU9 E;  4B3R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...