4GEQB

Crystal structure of the spc24-spc25/cnn1 binding interface
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
58
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Cell cycle
molecule keywords Kinetochore protein SPC25
total genus 15
structure length 58
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4geqB00
5T6JA 2FV4B 2FTXB 4GEQB
chains in the Genus database with same CATH superfamily
2N8XA 2EQ0A 2FV4B 2EN6A 2VQEE 4I8OA 2YWQA 4J8ZA 2EPPA 3HPZA 3J81C 2L33A 2EE8A 1A1JA 1GZ6A 4M2ZA 2RS6A 1DI2A 5KL5A 4R2CA 5AASA 2B7VA 2LO3A 1X49A 3BGHA 4R2QA 4DV3E 4TUIA 1L4SA 1N33E 2E5LE 4R2DA 3JU0A 3BF2A 1X6FA 3ADIA 4O4KA 2DIXA 5KL2A 2K4VA 2EOSA 1ZU1A 4BC7A 3IWBA 2YTJA 2EOYA 1KJKA 1A1GA 5LL6R 1IQSA 2LCEA 1IBKE 1YYKA 5AC4A 2LT7A 1YFHA 2EPMX 4B3TE 4JI4E 3KZZA 2LBSB 2PRTA 1RQ0A 1YZ9A 4NXNE 4LF9E 2EM0A 1IMUA 2MC5A 2EMXA 2R76A 4B3ME 4ZYGA 2EPAA 1STUA 2LVHA 1XNQE 2L2KB 4DMIA 5LMNE 3THNA 2L92A 2EPZA 5AE2A 2YT4A 2EN1A 2UUAE 2EMYA 1N34E 1SFEA 2EMCA 2EP3A 2LUPB 5TSEA 2V87A 4AQYE 1Z1BA 2B3TB 2DB2A 2RS7A 5IV8B 2KONA 2EPKX 4NHRA 5IWAE 2E1MA 3OTOE 1TF3A 1HNWE 4Q28A 4DR2E 4M30A 3VK6A 4DV7E 2M7QA 4X62E 1EKZA 2EORA 4F54A 1FKAE 2LUQA 1I94E 4DR1E 2M9AA 2IHR1 5A6BD 2JOBA 1YYOA 2EZ6A 1X48A 3BBGA 2F8BA 2YTOA 1EH6A 4MLQA 5KL7A 2EMKA 4JI7E 2YTPA 3C6MA 2UXBE 5A69A 4ZYEA 4BS9A 1RMDA 1WHNA 3VYXA 2L6MA 2EL5A 2EMHA 5A6AA 4BBYA 1YUIA 2EPRA 5AE1A 4BC9A 4DUYE 4X8WA 4DR6E 4L5NC 3QG5C 2UU9E 4FK5C 5T6JA 2EMIA 4WX9A 2DLQA 4DR7E 2EOFA 2WCC3 1O0WA 2L3JA 2MKDA 2EOMA 2EN8A 2KHXA 2EQ3A 1J26A 1WHQA 2D9HA 4R2EA 2M4IA 2R1FA 3VYYA 2B7TA 2EMBA 2UXCE 1HNXE 4NXME 1TN9A 1G2DC 2EM8A 3ADJA 4LF6E 4WSGA 5AC5A 2EM6A 2JR1A 4O43A 2EPOA 3HQ1A 4YY3E 2L3CA 2YRMA 2JP9A 1IQOA 2EMLA 4IJDA 2HJJA 2JXPA 5DNYA 2DSYA 2YTNA 4DV5E 1BBOA 2EL6A 4GEQB 2LJHA 2LV2A 3EPLA 3HTXA 2EMZA 4LF7E 2DGCA 4HEIA 2VQFE 4DV0E 2EOZA 3OMLA 3AUZA 2JOXA 1WXRA 1JK2A 2VE7C 2LTRA 2CTDA 4R2PA 2EMAA 4LF4E 1QNTA 3JTZA 3FIGA 4F9BB 1UBDC 1UN6B 2EM7A 2RQLA 1N36E 4KWYA 5AE3A 4LFBE 1YPNA 2RSIA 2EPNA 2M1SA 2NA2A 2DMYA 2EM5A 2YTDA 2MDGA 3LLHA 1QU6A 3AV0A 2VF1A 3C4BA 1P47A 3DF6A 1UHZA 2WBTA 2NUEA 2L2NA 4O5GA 2EQ1A 3F6GA 3T1YE 4OX9E 4NZVA 2EOHA 4LFAE 4JI0E 5FLXC 3T1HE 4LF8E 2MKNA 2YRHA 3ADLA 4WSPA 2CPNA 2FGGA 5CFFE 2E72A 2EL4A 2A25A 2EN7A 3DJWA 3THOB 2ELZA 2KOUA 4F9CB 1N3GA 4B3SE 4TUGA 5A6JA 4DV1E 5LLQA 4L8NA 2LE2A 4LU9A 2EM4A 2LJUA 3UK3C 1RC7A 1JK1A 2CSHA 4JI5E 2UXDE 3IWDA 1A1KA 3MHHC 4IS1C 5KL4A 1BBGA 1A1HA 2LTSA 2I13A 1GTKA 4YHHE 3L00A 2FTXB 4KHPE 1PJQA 1X6HA 1ZBQA 2JY9A 2JWOA 1NCSA 5ADZA 4JV5E 4F2JC 1A1IA 2EOEA 2YZTA 1T4NA 3C4TA 2L8TA 4MLVA 2EOQA 3JAMC 3KWRA 1X6EA 2EM3A 5KL6A 3MSWA 4OOGC 1FJGE 2EN2A 2EM9A 2GPIA 1PKPA 3H09A 1DGCA 1KYQA 3J7AG 2F4VE 1MGTA 1X3CA 2EPXA 4BCAA 2V85A 2VRDA 3KZYA 4WFTA 3TQMA 5A2QC 2EJ4A 1EH7A 2N3HA 2EN3A 2G7HA 3F6HA 3BIDA 4JI3E 2GLIA 4B3RE 4F6NA 2H36X 2N3GA 4JI2E 1ZR9A 2EPCA 1PDAA 2K7IA 3C6KA 1YSAC 2GHFA 4WYQB 2V88A 4DR5E 2EN4A 2B9DA 3ECRA 2EM2A 3HXLA 3ADGA 1NEIA 4F9AB 4JYAE 1AH5A 4K0KE 3LMLA 2NUGA 5LMUE 4JI8E 3EQ1A 4N4RB 1ZAAC 4RH8A 2EOOA 3EPKA 4DV2E 1HNZE 1XNRE 2EOIA 2YTFA 1DQ3A 2EMGA 4M9VC 2CT1A 1G2FC 2Q8UA 2YSOA 1BB8A 4GKKE 4M0VA 1F2IG 2HGHA 2YPNA 1LLMC 4X9JA 2EWLA 4R2AA 2NUFA 2ENCA 1B69A 3M99B 2WBUA 4R2SA 2BBGA 4GKJE 1XMQE 1WRJA 4DR4E 2V8QB 4P7DA 2HHHE 2MDRA 1X47A 1AAYA 4BMJA 4JI1E 2HC5A 4R8OA 3EPJA 4X66E 1X5WA 5BR8E 3EPHA 2YU5A 2JPAA 4WXCA 2UUCE 5IT9C 4WXDA 2DLKA 4RHBB 2EPUA 1YUJA 4GZNC 2ENAA 1T4OA 4LF5E 1IBME 2ODRD 1EH8A 2EMFA 2DMIA 3IWCA 1T39A 2DRPA 4DUZE 4HTGA 2JVAA 1PJTA 2YRKA 1TF6A 2J7JA 2EOJA 4DR3E 2UUBE 3J7Yp 1GQEA 1YYWA 3J80C 2V89A 3K6QA 2L2MA 2YTEA 2NABA 4DKKA 2V83A 5A6BA 2EOXA 3MHSC 1J5EE 2ADRA 4R2RA 4WPYA 2YU8A 1WJPA 1UILA 2V86A 3ZOQB 1N32E 4Q35B 4P78A 3VHTB 4X64E 4KZSA 2YSPA 1PJSA 4JI6E 1T4LB 4BHCA 4ZYDA 3P1XA 4ZYHA 2YTQA 2LMZA 5IXMB 4F6MA 2WZOA 4O24A 2LRSA 1XMOE 4R03A 1A1LA 2BB8A 5A6KA 2JYAA 1MEYC 3HPSA 2ODRC 5KL3A 4DV6E 2YTGA 4BHBA 2EPLX 2ENHA 5F3WA 2ZM6E 3RMPA 2EMWA 1T38A 2RPCA 1A1FA 2I9IA 1HR0E 1SR9A 4X65E 4DV4E 1IBLE 1ZBTA 2YTIA 4LFCE 4LTYA 2RSMA 2WBSA 2RTXA 2ELYA 2MC6A
chains in the Genus database with same CATH topology
5AE1A 4KHPE 4BC9A 4BMJA 4DUYE 4X8WA 2FV4B 4JI1E 4DR6E 2VQEE 4I8OA 1X47A 4R8OA 4L5NC 2UU9E 4J8ZA 3HPZA 5T6JA 3J81C 2L33A 1ZBQA 2JY9A 2JWOA 4X66E 5ADZA 1GZ6A 4M2ZA 4DR7E 5BR8E 4JV5E 2YZTA 2RS6A 1DI2A 1T4NA 3C4TA 2L8TA 5AASA 5IT9C 1O0WA 3JAMC 2B7VA 3KWRA 1X49A 2L3JA 4DV3E 2KHXA 1T4OA 4TUIA 1J26A 1WHQA 3MSWA 4OOGC 1N33E 2E5LE 2M4IA 4LF5E 1FJGE 3JU0A 1IBME 3H09A 1PKPA 2ODRD 3ADIA 3VYYA 2B7TA 2UXCE 2DIXA 1HNXE 3J7AG 2K4VA 4BC7A 4NXME 3IWBA 3IWCA 2F4VE 4BCAA 5LL6R 2V85A 3ADJA 4LF6E 4WFTA 1IBKE 4DUZE 1YYKA 4YY3E 2JR1A 3HQ1A 5A2QC 2JVAA 2L3CA 2N3HA 4B3TE 2G7HA 4JI4E 2UUCE 3F6HA 4DR3E 2UUBE 5DNYA 3J7Yp 1GQEA 2LBSB 2DSYA 4JI3E 1RQ0A 3J80C 2V89A 1YYWA 4DV5E 2H36X 2N3GA 4JI2E 4B3RE 4GEQB 2LJHA 4NXNE 3K6QA 4LF9E 1YZ9A 2L2MA 2MC5A 3HTXA 4B3ME 4LF7E 4DKKA 1STUA 2V83A 2VQFE 1XNQE 2L2KB 4DV0E 3OMLA 4DMIA 4WYQB 1J5EE 1HNWE 5LMNE 4WPYA 2V88A 2JOXA 3AUZA 1WXRA 2VE7C 2LTRA 2L92A 4DR5E 5AE2A 2B9DA 2YT4A 1UILA 2V86A 3HXLA 4LF4E 3ZOQB 2UUAE 3JTZA 1N32E 3ADGA 4P78A 4X64E 4F9AB 3FIGA 1N34E 4JYAE 4KZSA 4F9BB 2LUPB 4JI6E 4K0KE 3LMLA 1N36E 2NUGA 5LMUE 2V87A 1T4LB 4AQYE 3P1XA 4JI8E 5AE3A 4LFBE 2B3TB 2M1SA 2DB2A 2RS7A 2NA2A 2DMYA 2LMZA 2KONA 5IWAE 3LLHA 2WZOA 1QU6A 2E1MA 3AV0A 2LRSA 2VF1A 3C4BA 3OTOE 4Q28A 4DV2E 4DR2E 1HNZE 4M30A 3VK6A 1XNRE 4DV7E 1XMOE 3DF6A 1UHZA 4R03A 2M7QA 4F54A 4X62E 1EKZA 1FKAE 1DQ3A 2NUEA 2LUQA 2L2NA 1I94E 3F6GA 3HPSA 4DR1E 3T1YE 2ODRC 4OX9E 2IHR1 1YYOA 2JOBA 4DV6E 2EZ6A 4LFAE 4JI0E 1X48A 5FLXC 3T1HE 4LF8E 3ADLA 4WSPA 5F3WA 2F8BA 2CPNA 2FGGA 4M0VA 5CFFE 4GKKE 2ZM6E 3RMPA 2EWLA 4JI7E 3DJWA 2NUFA 2KOUA 2UXBE 4F9CB 4B3SE 4TUGA 1HR0E 1SR9A 4DV1E 3VYXA 4BS9A 4X65E 1WHNA 4L8NA 2LE2A 4DV4E 4LU9A 2L6MA 4GKJE 1IBLE 1XMQE 1ZBTA 4BBYA 1RC7A 4LFCE 4LTYA 4DR4E 4JI5E 2RSMA 2V8QB 2UXDE 3IWDA 4P7DA 2RTXA 2LTSA 2HHHE 4YHHE 2MC6A 2MDRA 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  2FV4 B;  2FTX B;  4GEQ B; 
#chains in the Genus database with same CATH topology
 2N8X A;  2EQ0 A;  2FV4 B;  2EN6 A;  2VQE E;  4I8O A;  2YWQ A;  4J8Z A;  2EPP A;  3HPZ A;  3J81 C;  2L33 A;  2EE8 A;  1A1J A;  1GZ6 A;  4M2Z A;  2RS6 A;  1DI2 A;  5KL5 A;  4R2C A;  5AAS A;  2B7V A;  2LO3 A;  1X49 A;  3BGH A;  4R2Q A;  4DV3 E;  4TUI A;  1L4S A;  1N33 E;  2E5L E;  4R2D A;  3JU0 A;  3BF2 A;  1X6F A;  3ADI A;  4O4K A;  2DIX A;  5KL2 A;  2K4V A;  2EOS A;  1ZU1 A;  4BC7 A;  3IWB A;  2YTJ A;  2EOY A;  1KJK A;  1A1G A;  5LL6 R;  1IQS A;  2LCE A;  1IBK E;  1YYK A;  5AC4 A;  2LT7 A;  1YFH A;  2EPM X;  4B3T E;  4JI4 E;  3KZZ A;  2LBS B;  2PRT A;  1RQ0 A;  1YZ9 A;  4NXN E;  4LF9 E;  2EM0 A;  1IMU A;  2MC5 A;  2EMX A;  2R76 A;  4B3M E;  4ZYG A;  2EPA A;  1STU A;  2LVH A;  1XNQ E;  2L2K B;  4DMI A;  5LMN E;  3THN A;  2L92 A;  2EPZ A;  5AE2 A;  2YT4 A;  2EN1 A;  2UUA E;  2EMY A;  1N34 E;  1SFE A;  2EMC A;  2EP3 A;  2LUP B;  5TSE A;  2V87 A;  4AQY E;  1Z1B A;  2B3T B;  2DB2 A;  2RS7 A;  5IV8 B;  2KON A;  2EPK X;  4NHR A;  5IWA E;  2E1M A;  3OTO E;  1TF3 A;  1HNW E;  4Q28 A;  4DR2 E;  4M30 A;  3VK6 A;  4DV7 E;  2M7Q A;  4X62 E;  1EKZ A;  2EOR A;  4F54 A;  1FKA E;  2LUQ A;  1I94 E;  4DR1 E;  2M9A A;  2IHR 1;  5A6B D;  2JOB A;  1YYO A;  2EZ6 A;  1X48 A;  3BBG A;  2F8B A;  2YTO A;  1EH6 A;  4MLQ A;  5KL7 A;  2EMK A;  4JI7 E;  2YTP A;  3C6M A;  2UXB E;  5A69 A;  4ZYE A;  4BS9 A;  1RMD A;  1WHN A;  3VYX A;  2L6M A;  2EL5 A;  2EMH A;  5A6A A;  4BBY A;  1YUI A;  2EPR A;  5AE1 A;  4BC9 A;  4DUY E;  4X8W A;  4DR6 E;  4L5N C;  3QG5 C;  2UU9 E;  4FK5 C;  5T6J A;  2EMI A;  4WX9 A;  2DLQ A;  4DR7 E;  2EOF A;  2WCC 3;  1O0W A;  2L3J A;  2MKD A;  2EOM A;  2EN8 A;  2KHX A;  2EQ3 A;  1J26 A;  1WHQ A;  2D9H A;  4R2E A;  2M4I A;  2R1F A;  3VYY A;  2B7T A;  2EMB A;  2UXC E;  1HNX E;  4NXM E;  1TN9 A;  1G2D C;  2EM8 A;  3ADJ A;  4LF6 E;  4WSG A;  5AC5 A;  2EM6 A;  2JR1 A;  4O43 A;  2EPO A;  3HQ1 A;  4YY3 E;  2L3C A;  2YRM A;  2JP9 A;  1IQO A;  2EML A;  4IJD A;  2HJJ A;  2JXP A;  5DNY A;  2DSY A;  2YTN A;  4DV5 E;  1BBO A;  2EL6 A;  4GEQ B;  2LJH A;  2LV2 A;  3EPL A;  3HTX A;  2EMZ A;  4LF7 E;  2DGC A;  4HEI A;  2VQF E;  4DV0 E;  2EOZ A;  3OML A;  3AUZ A;  2JOX A;  1WXR A;  1JK2 A;  2VE7 C;  2LTR A;  2CTD A;  4R2P A;  2EMA A;  4LF4 E;  1QNT A;  3JTZ A;  3FIG A;  4F9B B;  1UBD C;  1UN6 B;  2EM7 A;  2RQL A;  1N36 E;  4KWY A;  5AE3 A;  4LFB E;  1YPN A;  2RSI A;  2EPN A;  2M1S A;  2NA2 A;  2DMY A;  2EM5 A;  2YTD A;  2MDG A;  3LLH A;  1QU6 A;  3AV0 A;  2VF1 A;  3C4B A;  1P47 A;  3DF6 A;  1UHZ A;  2WBT A;  2NUE A;  2L2N A;  4O5G A;  2EQ1 A;  3F6G A;  3T1Y E;  4OX9 E;  4NZV A;  2EOH A;  4LFA E;  4JI0 E;  5FLX C;  3T1H E;  4LF8 E;  2MKN A;  2YRH A;  3ADL A;  4WSP A;  2CPN A;  2FGG A;  5CFF E;  2E72 A;  2EL4 A;  2A25 A;  2EN7 A;  3DJW A;  3THO B;  2ELZ A;  2KOU A;  4F9C B;  1N3G A;  4B3S E;  4TUG A;  5A6J A;  4DV1 E;  5LLQ A;  4L8N A;  2LE2 A;  4LU9 A;  2EM4 A;  2LJU A;  3UK3 C;  1RC7 A;  1JK1 A;  2CSH A;  4JI5 E;  2UXD E;  3IWD A;  1A1K A;  3MHH C;  4IS1 C;  5KL4 A;  1BBG A;  1A1H A;  2LTS A;  2I13 A;  1GTK A;  4YHH E;  3L00 A;  2FTX B;  4KHP E;  1PJQ A;  1X6H A;  1ZBQ A;  2JY9 A;  2JWO A;  1NCS A;  5ADZ A;  4JV5 E;  4F2J C;  1A1I A;  2EOE A;  2YZT A;  1T4N A;  3C4T A;  2L8T A;  4MLV A;  2EOQ A;  3JAM C;  3KWR A;  1X6E A;  2EM3 A;  5KL6 A;  3MSW A;  4OOG C;  1FJG E;  2EN2 A;  2EM9 A;  2GPI A;  1PKP A;  3H09 A;  1DGC A;  1KYQ A;  3J7A G;  2F4V E;  1MGT A;  1X3C A;  2EPX A;  4BCA A;  2V85 A;  2VRD A;  3KZY A;  4WFT A;  3TQM A;  5A2Q C;  2EJ4 A;  1EH7 A;  2N3H A;  2EN3 A;  2G7H A;  3F6H A;  3BID A;  4JI3 E;  2GLI A;  4B3R E;  4F6N A;  2H36 X;  2N3G A;  4JI2 E;  1ZR9 A;  2EPC A;  1PDA A;  2K7I A;  3C6K A;  1YSA C;  2GHF A;  4WYQ B;  2V88 A;  4DR5 E;  2EN4 A;  2B9D A;  3ECR A;  2EM2 A;  3HXL A;  3ADG A;  1NEI A;  4F9A B;  4JYA E;  1AH5 A;  4K0K E;  3LML A;  2NUG A;  5LMU E;  4JI8 E;  3EQ1 A;  4N4R B;  1ZAA C;  4RH8 A;  2EOO A;  3EPK A;  4DV2 E;  1HNZ E;  1XNR E;  2EOI A;  2YTF A;  1DQ3 A;  2EMG A;  4M9V C;  2CT1 A;  1G2F C;  2Q8U A;  2YSO A;  1BB8 A;  4GKK E;  4M0V A;  1F2I G;  2HGH A;  2YPN A;  1LLM C;  4X9J A;  2EWL A;  4R2A A;  2NUF A;  2ENC A;  1B69 A;  3M99 B;  2WBU A;  4R2S A;  2BBG A;  4GKJ E;  1XMQ E;  1WRJ A;  4DR4 E;  2V8Q B;  4P7D A;  2HHH E;  2MDR A;  1X47 A;  1AAY A;  4BMJ A;  4JI1 E;  2HC5 A;  4R8O A;  3EPJ A;  4X66 E;  1X5W A;  5BR8 E;  3EPH A;  2YU5 A;  2JPA A;  4WXC A;  2UUC E;  5IT9 C;  4WXD A;  2DLK A;  4RHB B;  2EPU A;  1YUJ A;  4GZN C;  2ENA A;  1T4O A;  4LF5 E;  1IBM E;  2ODR D;  1EH8 A;  2EMF A;  2DMI A;  3IWC A;  1T39 A;  2DRP A;  4DUZ E;  4HTG A;  2JVA A;  1PJT A;  2YRK A;  1TF6 A;  2J7J A;  2EOJ A;  4DR3 E;  2UUB E;  3J7Y p;  1GQE A;  1YYW A;  3J80 C;  2V89 A;  3K6Q A;  2L2M A;  2YTE A;  2NAB A;  4DKK A;  2V83 A;  5A6B A;  2EOX A;  3MHS C;  1J5E E;  2ADR A;  4R2R A;  4WPY A;  2YU8 A;  1WJP A;  1UIL A;  2V86 A;  3ZOQ B;  1N32 E;  4Q35 B;  4P78 A;  3VHT B;  4X64 E;  4KZS A;  2YSP A;  1PJS A;  4JI6 E;  1T4L B;  4BHC A;  4ZYD A;  3P1X A;  4ZYH A;  2YTQ A;  2LMZ A;  5IXM B;  4F6M A;  2WZO A;  4O24 A;  2LRS A;  1XMO E;  4R03 A;  1A1L A;  2BB8 A;  5A6K A;  2JYA A;  1MEY C;  3HPS A;  2ODR C;  5KL3 A;  4DV6 E;  2YTG A;  4BHB A;  2EPL X;  2ENH A;  5F3W A;  2ZM6 E;  3RMP A;  2EMW A;  1T38 A;  2RPC A;  1A1F A;  2I9I A;  1HR0 E;  1SR9 A;  4X65 E;  4DV4 E;  1IBL E;  1ZBT A;  2YTI A;  4LFC E;  4LTY A;  2RSM A;  2WBS A;  2RTX A;  2ELY A;  2MC6 A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  4KHP E;  4BC9 A;  4BMJ A;  4DUY E;  4X8W A;  2FV4 B;  4JI1 E;  4DR6 E;  2VQE E;  4I8O A;  1X47 A;  4R8O A;  4L5N C;  2UU9 E;  4J8Z A;  3HPZ A;  5T6J A;  3J81 C;  2L33 A;  1ZBQ A;  2JY9 A;  2JWO A;  4X66 E;  5ADZ A;  1GZ6 A;  4M2Z A;  4DR7 E;  5BR8 E;  4JV5 E;  2YZT A;  2RS6 A;  1DI2 A;  1T4N A;  3C4T A;  2L8T A;  5AAS A;  5IT9 C;  1O0W A;  3JAM C;  2B7V A;  3KWR A;  1X49 A;  2L3J A;  4DV3 E;  2KHX A;  1T4O A;  4TUI A;  1J26 A;  1WHQ A;  3MSW A;  4OOG C;  1N33 E;  2E5L E;  2M4I A;  4LF5 E;  1FJG E;  3JU0 A;  1IBM E;  3H09 A;  1PKP A;  2ODR D;  3ADI A;  3VYY A;  2B7T A;  2UXC E;  2DIX A;  1HNX E;  3J7A G;  2K4V A;  4BC7 A;  4NXM E;  3IWB A;  3IWC A;  2F4V E;  4BCA A;  5LL6 R;  2V85 A;  3ADJ A;  4LF6 E;  4WFT A;  1IBK E;  4DUZ E;  1YYK A;  4YY3 E;  2JR1 A;  3HQ1 A;  5A2Q C;  2JVA A;  2L3C A;  2N3H A;  4B3T E;  2G7H A;  4JI4 E;  2UUC E;  3F6H A;  4DR3 E;  2UUB E;  5DNY A;  3J7Y p;  1GQE A;  2LBS B;  2DSY A;  4JI3 E;  1RQ0 A;  3J80 C;  2V89 A;  1YYW A;  4DV5 E;  2H36 X;  2N3G A;  4JI2 E;  4B3R E;  4GEQ B;  2LJH A;  4NXN E;  3K6Q A;  4LF9 E;  1YZ9 A;  2L2M A;  2MC5 A;  3HTX A;  4B3M E;  4LF7 E;  4DKK A;  1STU A;  2V83 A;  2VQF E;  1XNQ E;  2L2K B;  4DV0 E;  3OML A;  4DMI A;  4WYQ B;  1J5E E;  1HNW E;  5LMN E;  4WPY A;  2V88 A;  2JOX A;  3AUZ A;  1WXR A;  2VE7 C;  2LTR A;  2L92 A;  4DR5 E;  5AE2 A;  2B9D A;  2YT4 A;  1UIL A;  2V86 A;  3HXL A;  4LF4 E;  3ZOQ B;  2UUA E;  3JTZ A;  1N32 E;  3ADG A;  4P78 A;  4X64 E;  4F9A B;  3FIG A;  1N34 E;  4JYA E;  4KZS A;  4F9B B;  2LUP B;  4JI6 E;  4K0K E;  3LML A;  1N36 E;  2NUG A;  5LMU E;  2V87 A;  1T4L B;  4AQY E;  3P1X A;  4JI8 E;  5AE3 A;  4LFB E;  2B3T B;  2M1S A;  2DB2 A;  2RS7 A;  2NA2 A;  2DMY A;  2LMZ A;  2KON A;  5IWA E;  3LLH A;  2WZO A;  1QU6 A;  2E1M A;  3AV0 A;  2LRS A;  2VF1 A;  3C4B A;  3OTO E;  4Q28 A;  4DV2 E;  4DR2 E;  1HNZ E;  4M30 A;  3VK6 A;  1XNR E;  4DV7 E;  1XMO E;  3DF6 A;  1UHZ A;  4R03 A;  2M7Q A;  4F54 A;  4X62 E;  1EKZ A;  1FKA E;  1DQ3 A;  2NUE A;  2LUQ A;  2L2N A;  1I94 E;  3F6G A;  3HPS A;  4DR1 E;  3T1Y E;  2ODR C;  4OX9 E;  2IHR 1;  1YYO A;  2JOB A;  4DV6 E;  2EZ6 A;  4LFA E;  4JI0 E;  1X48 A;  5FLX C;  3T1H E;  4LF8 E;  3ADL A;  4WSP A;  5F3W A;  2F8B A;  2CPN A;  2FGG A;  4M0V A;  5CFF E;  4GKK E;  2ZM6 E;  3RMP A;  2EWL A;  4JI7 E;  3DJW A;  2NUF A;  2KOU A;  2UXB E;  4F9C B;  4B3S E;  4TUG A;  1HR0 E;  1SR9 A;  4DV1 E;  3VYX A;  4BS9 A;  4X65 E;  1WHN A;  4L8N A;  2LE2 A;  4DV4 E;  4LU9 A;  2L6M A;  4GKJ E;  1IBL E;  1XMQ E;  1ZBT A;  4BBY A;  1RC7 A;  4LFC E;  4LTY A;  4DR4 E;  4JI5 E;  2RSM A;  2V8Q B;  2UXD E;  3IWD A;  4P7D A;  2RTX A;  2LTS A;  2HHH E;  4YHH E;  2MC6 A;  2MDR A;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...