4GEQB

Crystal structure of the spc24-spc25/cnn1 binding interface
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
58
Chain Sequence
b'ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinetochore protein SPC25
publication title A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Cell cycle
total genus 15
structure length 58
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4geqB00
2FTXB 2FV4B 4GEQB 5T6JA
chains in the Genus database with same CATH superfamily
3OMLA 2YTNA 3THNA 2EMYA 2R76A 1EH6A 1YUIA 2JVAA 3BGHA 3UK3C 1YYKA 2EN1A 2LMZA 4B3SE 2GPIA 4WFTA 2LJUA 4R2AA 1N3GA 1XNQE 4DR3E 2M7QA 3VHTB 1SR9A 1O0WA 3K6QA 4FK5C 2F8BA 2N3HA 5A6JA 1PJQA 2M4IA 2J7JA 2NUGA 1LLMC 2EMXA 4JI1E 1YPNA 2PRTA 2MDGA 2EN4A 2L8TA 4X8WA 2YRKA 4ZYGA 2EPAA 2EOHA 1UBDC 2H36X 2EM6A 2FGGA 2EP3A 1GQEA 2DLKA 2B9DA 5A69A 1ZU1A 2JXPA 2CT1A 4R2DA 4JI2E 2LTSA 2VF1A 1T4NA 2EOOA 2EOZA 2EMLA 4O4KA 3HQ1A 3ADIA 3QG5C 2B3TB 2EM2A 4MLVA 1HNZE 4ZYHA 2EPOA 4WYQB 4BS9A 1X6EA 4LF9E 2EOFA 2EPMX 2YZTA 4DUZE 4DV1E 2NUFA 2MC5A 2RSIA 4NXME 1XNRE 4L8NA 5AC5A 2WBUA 1EH7A 3IWBA 2LVHA 5IXMB 1KYQA 4YHHE 2EN2A 5T6JA 2EMIA 2E72A 2V89A 2ENHA 2WCC3 1NCSA 1N36E 5KL4A 1QU6A 2UUCE 2UXBE 4DR7E 4L5NC 1FKAE 3VYXA 4DR4E 2DSYA 4DV5E 3BIDA 2EPUA 2V85A 5FLXC 2JOBA 4WXCA 1RQ0A 1T39A 3DF6A 4R2QA 3AV0A 2EL4A 3OTOE 2EQ3A 1DGCA 1WJPA 1J5EE 5KL5A 2L2KB 2V86A 1ZBQA 2YRHA 2EPNA 2EM5A 1BB8A 1XMOE 4NHRA 1GZ6A 2EQ1A 4KHPE 2BB8A 4KZSA 3T1YE 2EL6A 4BBYA 5A2QC 4GEQB 1DQ3A 3LMLA 1YUJA 2UU9E 1AAYA 1ZR9A 4DMIA 2G7HA 3C6MA 4BHCA 3VYYA 4NZVA 3ADLA 2F4VE 2RPCA 2HC5A 1UN6B 4M9VC 1KJKA 2EQ0A 1IQSA 2KHXA 2R1FA 3KZZA 1L4SA 2RSMA 4JYAE 4KWYA 4X9JA 1A1LA 5KL6A 4HEIA 5LMUE 1N32E 3HXLA 4WSGA 2ENAA 3THOB 2ODRC 2YSPA 2V83A 1YYOA 2UXDE 2DB2A 2M9AA 3EQ1A 4BMJA 4NXNE 2GHFA 2EOIA 2LUPB 3JTZA 4R2CA 5TSEA 3KWRA 2NA2A 3C4BA 1A1JA 2YTIA 2K7IA 2M1SA 5F3WA 3DJWA 1Z1BA 2JR1A 4O24A 3EPLA 2YU8A 2KOUA 2ZM6E 1X47A 1TF6A 4R2EA 4M2ZA 4LFBE 4WX9A 2EL5A 4I8OA 3C4TA 2ADRA 2V88A 2MKDA 4LF4E 3JU0A 4F9BB 2E5LE 1SFEA 1T38A 1WHQA 4JI8E 2KONA 2V8QB 4ZYDA 4P7DA 4DV3E 1X6FA 2EMWA 1HNWE 4JI7E 4TUGA 2L3JA 1BBGA 3HPZA 3L00A 1XMQE 1A1IA 2EPXA 2EWLA 4R2PA 5KL2A 2DLQA 2JY9A 4JI0E 1IBLE 2YTEA 2UUAE 3HPSA 1JK1A 1WRJA 3BF2A 2ELYA 4M0VA 1DI2A 1A1HA 4DV7E 3C6KA 2L3CA 4DUYE 2RS6A 3J7Yp 2YSOA 5KL7A 3MHSC 2YTJA 2HJJA 4JI3E 2EN6A 1HR0E 2LT7A 2YT4A 4IJDA 2L92A 1J26A 2YPNA 2EPCA 1A1GA 4DR5E 2LTRA 2LUQA 3HTXA 2WBTA 2EM9A 2EOMA 2YTGA 2EPZA 1T4LB 2CTDA 4ZYEA 5CFFE 2EOYA 4LF5E 4GKJE 4LF7E 2A25A 1PKPA 2EMHA 1RC7A 4B3TE 1N33E 2RS7A 2NUEA 1HNXE 2WBSA 1TN9A 2LV2A 4F9CB 3EPHA 2DGCA 5LLQA 4LFCE 4B3ME 2EOXA 1FJGE 1YZ9A 1X5WA 3BBGA 1T4OA 4YY3E 2ODRD 2L33A 2GLIA 4F6NA 3EPKA 4O5GA 2EN8A 3P1XA 2V87A 4GZNC 2L2MA 2JPAA 3RMPA 2UUBE 4JI6E 2N3GA 2JOXA 5DNYA 1BBOA 2EMAA 5IV8B 4X62E 1NEIA 2B7VA 4HTGA 2WZOA 1UILA 1ZAAC 3ADJA 4B3RE 4AQYE 1EKZA 1A1FA 4OX9E 2DIXA 1IBME 1ZBTA 4R8OA 1IMUA 4DR1E 2IHR1 2LCEA 4IS1C 2NABA 1IQOA 4LU9A 5A6BA 1X48A 4LF8E 2EN7A 2I13A 4O43A 2EM3A 1UHZA 2EMBA 2VRDA 2EORA 4DV4E 5IT9C 5AE2A 4M30A 5ADZA 2LE2A 1I94E 2EMKA 5A6AA 2UXCE 1AH5A 4X66E 2B7TA 2YU5A 2FTXB 1F2IG 2L2NA 2EN3A 2CPNA 4BHBA 1WXRA 4F6MA 4JI5E 1QNTA 4LFAE 2VQFE 2JYAA 1PDAA 1PJSA 2EPPA 2N8XA 2Q8UA 4BCAA 4X65E 4GKKE 2YWQA 2EMCA 2EOJA 2YTFA 3H09A 4WPYA 2DMIA 2EMGA 2DMYA 3MHHC 2JP9A 4Q28A 3J80C 3IWCA 3LLHA 4R2SA 2E1MA 4Q35B 2YTDA 4F54A 4JI4E 4N4RB 2MKNA 2EMZA 5AC4A 1YYWA 2D9HA 4F2JC 4R03A 2LBSB 2K4VA 2EOSA 5A6BD 4OOGC 1X3CA 2EPKX 3IWDA 5AE1A 2VQEE 1YFHA 2RTXA 2EM8A 3TQMA 3M99B 2LJHA 1WHNA 1A1KA 2BBGA 2I9IA 4R2RA 4LF6E 4WXDA 2EPLX 2EZ6A 2MDRA 1PJTA 1STUA 2L6MA 4DR6E 2ENCA 3MSWA 1JK2A 2LRSA 1G2FC 2EM7A 2EM4A 5LMNE 2EMFA 5A6KA 1EH8A 5AASA 5IWAE 5KL3A 3EPJA 3AUZA 2CSHA 3J7AG 4BC9A 2EPRA 2YTOA 2VE7C 2ELZA 2YTPA 2LO3A 3ECRA 1GTKA 4X64E 4DKKA 3T1HE 2DRPA 4RHBB 4DV0E 2MC6A 2JWOA 3VK6A 3J81C 4F9AB 2HGHA 2YTQA 4RH8A 4WSPA 4BC7A 5AE3A 1X49A 2FV4B 2EOEA 3KZYA 2EE8A 2EM0A 1X6HA 1G2DC 3JAMC 4J8ZA 1N34E 3ADGA 4DR2E 1RMDA 2YRMA 5BR8E 2EOQA 2EJ4A 4P78A 1TF3A 1YSAC 3F6HA 3FIGA 1MEYC 4MLQA 1B69A 4K0KE 4DV2E 4DV6E 3ZOQB 4LTYA 1IBKE 2HHHE 4JV5E 5LL6R 1P47A 2RQLA 1MGTA 3F6GA 4TUIA
chains in the Genus database with same CATH topology
3OMLA 1HR0E 2L2NA 3OTOE 2CPNA 2YT4A 1J5EE 1WXRA 2L2KB 2L92A 4JI5E 1J26A 2V86A 4LFAE 1ZBQA 2VQFE 2JVAA 4BCAA 4X65E 4DR5E 4GKKE 2LTRA 2LUQA 1YYKA 1XMOE 2LMZA 4B3SE 1GZ6A 3H09A 3HTXA 4WPYA 4KHPE 2DMYA 4Q28A 4KZSA 4WFTA 3T1YE 3J80C 3IWCA 3LLHA 4BBYA 4GEQB 5A2QC 1DQ3A 3LMLA 2E1MA 1XNQE 4F54A 4DR3E 2UU9E 4JI4E 2M7QA 4DMIA 2G7HA 3VYYA 1YYWA 3ADLA 2F4VE 1T4LB 1SR9A 1O0WA 3K6QA 2KHXA 5CFFE 4LF5E 4GKJE 2F8BA 4R03A 4LF7E 2N3HA 2LBSB 1PKPA 2K4VA 2M4IA 2RSMA 4JYAE 2NUGA 4OOGC 1RC7A 3IWDA 5AE1A 2VQEE 4JI1E 2RTXA 4B3TE 1N33E 5LMUE 2RS7A 1N32E 2NUEA 1HNXE 2LJHA 1WHNA 2L8TA 3HXLA 4X8WA 4F9CB 4LF6E 2EZ6A 2MDRA 2ODRC 2V83A 4LFCE 4B3ME 1STUA 2H36X 2L6MA 3MSWA 1YYOA 4DR6E 2DB2A 2FGGA 4BMJA 2UXDE 1GQEA 2LRSA 2B9DA 1FJGE 1YZ9A 4NXNE 1T4OA 4YY3E 4JI2E 2LUPB 5LMNE 2LTSA 3JTZA 2ODRD 2L33A 5AASA 5IWAE 2VF1A 1T4NA 3AUZA 3P1XA 3J7AG 3HQ1A 2V87A 4BC9A 3ADIA 2B3TB 3KWRA 2L2MA 2NA2A 2VE7C 3C4BA 1HNZE 3RMPA 2UUBE 4JI6E 2N3GA 4WYQB 4DKKA 4BS9A 2JOXA 2M1SA 4X64E 3T1HE 5F3WA 4DV0E 2YZTA 5DNYA 3DJWA 4DUZE 4DV1E 2NUFA 4LF9E 2MC6A 2MC5A 2JWOA 2JR1A 4X62E 3VK6A 3J81C 4F9AB 4NXME 2B7VA 4L8NA 1XNRE 2KOUA 3IWBA 4WSPA 2WZOA 4BC7A 1X47A 2ZM6E 4M2ZA 1UILA 4LFBE 5AE3A 1X49A 2FV4B 3ADJA 4YHHE 4AQYE 4I8OA 1EKZA 4B3RE 3C4TA 2V88A 5T6JA 4LF4E 3JU0A 4F9BB 2V89A 2DIXA 1IBME 2E5LE 4OX9E 1WHQA 4J8ZA 2KONA 1ZBTA 2V8QB 4R8OA 4JI8E 3JAMC 4DR1E 3ADGA 4DR2E 1N36E 1QU6A 2IHR1 4P7DA 2UUCE 4DV3E 2UXBE 1HNWE 5BR8E 4DR7E 4LU9A 4P78A 4JI7E 4L5NC 4TUGA 3HPZA 3F6HA 2L3JA 3FIGA 1N34E 1XMQE 1FKAE 3VYXA 1X48A 4LF8E 4K0KE 4DV2E 4DV6E 4DR4E 2EWLA 2DSYA 3ZOQB 2JY9A 1UHZA 4JI0E 1IBLE 4DV5E 2UUAE 4LTYA 5IT9C 4DV4E 1IBKE 2HHHE 5AE2A 4JV5E 3HPSA 4M30A 4M0VA 5LL6R 1DI2A 5ADZA 4DV7E 2LE2A 2L3CA 2V85A 5FLXC 1I94E 4DUYE 2RS6A 3J7Yp 2JOBA 2UXCE 4X66E 1RQ0A 4JI3E 2B7TA 3F6GA 4TUIA 3DF6A 2FTXB 3AV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTX B;  2FV4 B;  4GEQ B;  5T6J A; 
#chains in the Genus database with same CATH topology
 3OML A;  2YTN A;  3THN A;  2EMY A;  2R76 A;  1EH6 A;  1YUI A;  2JVA A;  3BGH A;  3UK3 C;  1YYK A;  2EN1 A;  2LMZ A;  4B3S E;  2GPI A;  4WFT A;  2LJU A;  4R2A A;  1N3G A;  1XNQ E;  4DR3 E;  2M7Q A;  3VHT B;  1SR9 A;  1O0W A;  3K6Q A;  4FK5 C;  2F8B A;  2N3H A;  5A6J A;  1PJQ A;  2M4I A;  2J7J A;  2NUG A;  1LLM C;  2EMX A;  4JI1 E;  1YPN A;  2PRT A;  2MDG A;  2EN4 A;  2L8T A;  4X8W A;  2YRK A;  4ZYG A;  2EPA A;  2EOH A;  1UBD C;  2H36 X;  2EM6 A;  2FGG A;  2EP3 A;  1GQE A;  2DLK A;  2B9D A;  5A69 A;  1ZU1 A;  2JXP A;  2CT1 A;  4R2D A;  4JI2 E;  2LTS A;  2VF1 A;  1T4N A;  2EOO A;  2EOZ A;  2EML A;  4O4K A;  3HQ1 A;  3ADI A;  3QG5 C;  2B3T B;  2EM2 A;  4MLV A;  1HNZ E;  4ZYH A;  2EPO A;  4WYQ B;  4BS9 A;  1X6E A;  4LF9 E;  2EOF A;  2EPM X;  2YZT A;  4DUZ E;  4DV1 E;  2NUF A;  2MC5 A;  2RSI A;  4NXM E;  1XNR E;  4L8N A;  5AC5 A;  2WBU A;  1EH7 A;  3IWB A;  2LVH A;  5IXM B;  1KYQ A;  4YHH E;  2EN2 A;  5T6J A;  2EMI A;  2E72 A;  2V89 A;  2ENH A;  2WCC 3;  1NCS A;  1N36 E;  5KL4 A;  1QU6 A;  2UUC E;  2UXB E;  4DR7 E;  4L5N C;  1FKA E;  3VYX A;  4DR4 E;  2DSY A;  4DV5 E;  3BID A;  2EPU A;  2V85 A;  5FLX C;  2JOB A;  4WXC A;  1RQ0 A;  1T39 A;  3DF6 A;  4R2Q A;  3AV0 A;  2EL4 A;  3OTO E;  2EQ3 A;  1DGC A;  1WJP A;  1J5E E;  5KL5 A;  2L2K B;  2V86 A;  1ZBQ A;  2YRH A;  2EPN A;  2EM5 A;  1BB8 A;  1XMO E;  4NHR A;  1GZ6 A;  2EQ1 A;  4KHP E;  2BB8 A;  4KZS A;  3T1Y E;  2EL6 A;  4BBY A;  5A2Q C;  4GEQ B;  1DQ3 A;  3LML A;  1YUJ A;  2UU9 E;  1AAY A;  1ZR9 A;  4DMI A;  2G7H A;  3C6M A;  4BHC A;  3VYY A;  4NZV A;  3ADL A;  2F4V E;  2RPC A;  2HC5 A;  1UN6 B;  4M9V C;  1KJK A;  2EQ0 A;  1IQS A;  2KHX A;  2R1F A;  3KZZ A;  1L4S A;  2RSM A;  4JYA E;  4KWY A;  4X9J A;  1A1L A;  5KL6 A;  4HEI A;  5LMU E;  1N32 E;  3HXL A;  4WSG A;  2ENA A;  3THO B;  2ODR C;  2YSP A;  2V83 A;  1YYO A;  2UXD E;  2DB2 A;  2M9A A;  3EQ1 A;  4BMJ A;  4NXN E;  2GHF A;  2EOI A;  2LUP B;  3JTZ A;  4R2C A;  5TSE A;  3KWR A;  2NA2 A;  3C4B A;  1A1J A;  2YTI A;  2K7I A;  2M1S A;  5F3W A;  3DJW A;  1Z1B A;  2JR1 A;  4O24 A;  3EPL A;  2YU8 A;  2KOU A;  2ZM6 E;  1X47 A;  1TF6 A;  4R2E A;  4M2Z A;  4LFB E;  4WX9 A;  2EL5 A;  4I8O A;  3C4T A;  2ADR A;  2V88 A;  2MKD A;  4LF4 E;  3JU0 A;  4F9B B;  2E5L E;  1SFE A;  1T38 A;  1WHQ A;  4JI8 E;  2KON A;  2V8Q B;  4ZYD A;  4P7D A;  4DV3 E;  1X6F A;  2EMW A;  1HNW E;  4JI7 E;  4TUG A;  2L3J A;  1BBG A;  3HPZ A;  3L00 A;  1XMQ E;  1A1I A;  2EPX A;  2EWL A;  4R2P A;  5KL2 A;  2DLQ A;  2JY9 A;  4JI0 E;  1IBL E;  2YTE A;  2UUA E;  3HPS A;  1JK1 A;  1WRJ A;  3BF2 A;  2ELY A;  4M0V A;  1DI2 A;  1A1H A;  4DV7 E;  3C6K A;  2L3C A;  4DUY E;  2RS6 A;  3J7Y p;  2YSO A;  5KL7 A;  3MHS C;  2YTJ A;  2HJJ A;  4JI3 E;  2EN6 A;  1HR0 E;  2LT7 A;  2YT4 A;  4IJD A;  2L92 A;  1J26 A;  2YPN A;  2EPC A;  1A1G A;  4DR5 E;  2LTR A;  2LUQ A;  3HTX A;  2WBT A;  2EM9 A;  2EOM A;  2YTG A;  2EPZ A;  1T4L B;  2CTD A;  4ZYE A;  5CFF E;  2EOY A;  4LF5 E;  4GKJ E;  4LF7 E;  2A25 A;  1PKP A;  2EMH A;  1RC7 A;  4B3T E;  1N33 E;  2RS7 A;  2NUE A;  1HNX E;  2WBS A;  1TN9 A;  2LV2 A;  4F9C B;  3EPH A;  2DGC A;  5LLQ A;  4LFC E;  4B3M E;  2EOX A;  1FJG E;  1YZ9 A;  1X5W A;  3BBG A;  1T4O A;  4YY3 E;  2ODR D;  2L33 A;  2GLI A;  4F6N A;  3EPK A;  4O5G A;  2EN8 A;  3P1X A;  2V87 A;  4GZN C;  2L2M A;  2JPA A;  3RMP A;  2UUB E;  4JI6 E;  2N3G A;  2JOX A;  5DNY A;  1BBO A;  2EMA A;  5IV8 B;  4X62 E;  1NEI A;  2B7V A;  4HTG A;  2WZO A;  1UIL A;  1ZAA C;  3ADJ A;  4B3R E;  4AQY E;  1EKZ A;  1A1F A;  4OX9 E;  2DIX A;  1IBM E;  1ZBT A;  4R8O A;  1IMU A;  4DR1 E;  2IHR 1;  2LCE A;  4IS1 C;  2NAB A;  1IQO A;  4LU9 A;  5A6B A;  1X48 A;  4LF8 E;  2EN7 A;  2I13 A;  4O43 A;  2EM3 A;  1UHZ A;  2EMB A;  2VRD A;  2EOR A;  4DV4 E;  5IT9 C;  5AE2 A;  4M30 A;  5ADZ A;  2LE2 A;  1I94 E;  2EMK A;  5A6A A;  2UXC E;  1AH5 A;  4X66 E;  2B7T A;  2YU5 A;  2FTX B;  1F2I G;  2L2N A;  2EN3 A;  2CPN A;  4BHB A;  1WXR A;  4F6M A;  4JI5 E;  1QNT A;  4LFA E;  2VQF E;  2JYA A;  1PDA A;  1PJS A;  2EPP A;  2N8X A;  2Q8U A;  4BCA A;  4X65 E;  4GKK E;  2YWQ A;  2EMC A;  2EOJ A;  2YTF A;  3H09 A;  4WPY A;  2DMI A;  2EMG A;  2DMY A;  3MHH C;  2JP9 A;  4Q28 A;  3J80 C;  3IWC A;  3LLH A;  4R2S A;  2E1M A;  4Q35 B;  2YTD A;  4F54 A;  4JI4 E;  4N4R B;  2MKN A;  2EMZ A;  5AC4 A;  1YYW A;  2D9H A;  4F2J C;  4R03 A;  2LBS B;  2K4V A;  2EOS A;  5A6B D;  4OOG C;  1X3C A;  2EPK X;  3IWD A;  5AE1 A;  2VQE E;  1YFH A;  2RTX A;  2EM8 A;  3TQM A;  3M99 B;  2LJH A;  1WHN A;  1A1K A;  2BBG A;  2I9I A;  4R2R A;  4LF6 E;  4WXD A;  2EPL X;  2EZ6 A;  2MDR A;  1PJT A;  1STU A;  2L6M A;  4DR6 E;  2ENC A;  3MSW A;  1JK2 A;  2LRS A;  1G2F C;  2EM7 A;  2EM4 A;  5LMN E;  2EMF A;  5A6K A;  1EH8 A;  5AAS A;  5IWA E;  5KL3 A;  3EPJ A;  3AUZ A;  2CSH A;  3J7A G;  4BC9 A;  2EPR A;  2YTO A;  2VE7 C;  2ELZ A;  2YTP A;  2LO3 A;  3ECR A;  1GTK A;  4X64 E;  4DKK A;  3T1H E;  2DRP A;  4RHB B;  4DV0 E;  2MC6 A;  2JWO A;  3VK6 A;  3J81 C;  4F9A B;  2HGH A;  2YTQ A;  4RH8 A;  4WSP A;  4BC7 A;  5AE3 A;  1X49 A;  2FV4 B;  2EOE A;  3KZY A;  2EE8 A;  2EM0 A;  1X6H A;  1G2D C;  3JAM C;  4J8Z A;  1N34 E;  3ADG A;  4DR2 E;  1RMD A;  2YRM A;  5BR8 E;  2EOQ A;  2EJ4 A;  4P78 A;  1TF3 A;  1YSA C;  3F6H A;  3FIG A;  1MEY C;  4MLQ A;  1B69 A;  4K0K E;  4DV2 E;  4DV6 E;  3ZOQ B;  4LTY A;  1IBK E;  2HHH E;  4JV5 E;  5LL6 R;  1P47 A;  2RQL A;  1MGT A;  3F6G A;  4TUI A; 
#chains in the Genus database with same CATH homology
 3OML A;  1HR0 E;  2L2N A;  3OTO E;  2CPN A;  2YT4 A;  1J5E E;  1WXR A;  2L2K B;  2L92 A;  4JI5 E;  1J26 A;  2V86 A;  4LFA E;  1ZBQ A;  2VQF E;  2JVA A;  4BCA A;  4X65 E;  4DR5 E;  4GKK E;  2LTR A;  2LUQ A;  1YYK A;  1XMO E;  2LMZ A;  4B3S E;  1GZ6 A;  3H09 A;  3HTX A;  4WPY A;  4KHP E;  2DMY A;  4Q28 A;  4KZS A;  4WFT A;  3T1Y E;  3J80 C;  3IWC A;  3LLH A;  4BBY A;  4GEQ B;  5A2Q C;  1DQ3 A;  3LML A;  2E1M A;  1XNQ E;  4F54 A;  4DR3 E;  2UU9 E;  4JI4 E;  2M7Q A;  4DMI A;  2G7H A;  3VYY A;  1YYW A;  3ADL A;  2F4V E;  1T4L B;  1SR9 A;  1O0W A;  3K6Q A;  2KHX A;  5CFF E;  4LF5 E;  4GKJ E;  2F8B A;  4R03 A;  4LF7 E;  2N3H A;  2LBS B;  1PKP A;  2K4V A;  2M4I A;  2RSM A;  4JYA E;  2NUG A;  4OOG C;  1RC7 A;  3IWD A;  5AE1 A;  2VQE E;  4JI1 E;  2RTX A;  4B3T E;  1N33 E;  5LMU E;  2RS7 A;  1N32 E;  2NUE A;  1HNX E;  2LJH A;  1WHN A;  2L8T A;  3HXL A;  4X8W A;  4F9C B;  4LF6 E;  2EZ6 A;  2MDR A;  2ODR C;  2V83 A;  4LFC E;  4B3M E;  1STU A;  2H36 X;  2L6M A;  3MSW A;  1YYO A;  4DR6 E;  2DB2 A;  2FGG A;  4BMJ A;  2UXD E;  1GQE A;  2LRS A;  2B9D A;  1FJG E;  1YZ9 A;  4NXN E;  1T4O A;  4YY3 E;  4JI2 E;  2LUP B;  5LMN E;  2LTS A;  3JTZ A;  2ODR D;  2L33 A;  5AAS A;  5IWA E;  2VF1 A;  1T4N A;  3AUZ A;  3P1X A;  3J7A G;  3HQ1 A;  2V87 A;  4BC9 A;  3ADI A;  2B3T B;  3KWR A;  2L2M A;  2NA2 A;  2VE7 C;  3C4B A;  1HNZ E;  3RMP A;  2UUB E;  4JI6 E;  2N3G A;  4WYQ B;  4DKK A;  4BS9 A;  2JOX A;  2M1S A;  4X64 E;  3T1H E;  5F3W A;  4DV0 E;  2YZT A;  5DNY A;  3DJW A;  4DUZ E;  4DV1 E;  2NUF A;  4LF9 E;  2MC6 A;  2MC5 A;  2JWO A;  2JR1 A;  4X62 E;  3VK6 A;  3J81 C;  4F9A B;  4NXM E;  2B7V A;  4L8N A;  1XNR E;  2KOU A;  3IWB A;  4WSP A;  2WZO A;  4BC7 A;  1X47 A;  2ZM6 E;  4M2Z A;  1UIL A;  4LFB E;  5AE3 A;  1X49 A;  2FV4 B;  3ADJ A;  4YHH E;  4AQY E;  4I8O A;  1EKZ A;  4B3R E;  3C4T A;  2V88 A;  5T6J A;  4LF4 E;  3JU0 A;  4F9B B;  2V89 A;  2DIX A;  1IBM E;  2E5L E;  4OX9 E;  1WHQ A;  4J8Z A;  2KON A;  1ZBT A;  2V8Q B;  4R8O A;  4JI8 E;  3JAM C;  4DR1 E;  3ADG A;  4DR2 E;  1N36 E;  1QU6 A;  2IHR 1;  4P7D A;  2UUC E;  4DV3 E;  2UXB E;  1HNW E;  5BR8 E;  4DR7 E;  4LU9 A;  4P78 A;  4JI7 E;  4L5N C;  4TUG A;  3HPZ A;  3F6H A;  2L3J A;  3FIG A;  1N34 E;  1XMQ E;  1FKA E;  3VYX A;  1X48 A;  4LF8 E;  4K0K E;  4DV2 E;  4DV6 E;  4DR4 E;  2EWL A;  2DSY A;  3ZOQ B;  2JY9 A;  1UHZ A;  4JI0 E;  1IBL E;  4DV5 E;  2UUA E;  4LTY A;  5IT9 C;  4DV4 E;  1IBK E;  2HHH E;  5AE2 A;  4JV5 E;  3HPS A;  4M30 A;  4M0V A;  5LL6 R;  1DI2 A;  5ADZ A;  4DV7 E;  2LE2 A;  2L3C A;  2V85 A;  5FLX C;  1I94 E;  4DUY E;  2RS6 A;  3J7Y p;  2JOB A;  2UXC E;  4X66 E;  1RQ0 A;  4JI3 E;  2B7T A;  3F6G A;  4TUI A;  3DF6 A;  2FTX B;  3AV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...