4GEQB

Crystal structure of the spc24-spc25/cnn1 binding interface
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
58
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinetochore protein SPC25
publication title A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Cell cycle
total genus 15
structure length 58
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4geqB00
4GEQB 2FV4B 2FTXB 5T6JA
chains in the Genus database with same CATH superfamily
2HC5A 2EQ1A 4BBYA 1TF6A 2YTEA 2KONA 2UUBE 4JI6E 1LLMC 2YPNA 2LTRA 2JXPA 1XMQE 3QG5C 2K7IA 1MGTA 4YY3E 5A6KA 4WFTA 4LFCE 2L92A 1HNXE 4BCAA 5LLQA 3C6KA 2R76A 4X9JA 3JTZA 2KOUA 4DR2E 1A1IA 3H09A 5KL3A 1Z1BA 3EPLA 4I8OA 2YU5A 1IBLE 1DGCA 2I9IA 2NUGA 2EM3A 1BB8A 1YPNA 2YTNA 2DIXA 2UUCE 1BBOA 3OMLA 4WSPA 4TUIA 2L2MA 4DUZE 2A25A 2GHFA 3MHHC 2EN3A 3TQMA 5FLXC 2IHR1 2EL6A 1FJGE 5A6BD 2LUQA 2B7VA 4LU9A 2GLIA 2L33A 3IWBA 2YTIA 2UU9E 4JI7E 2EOMA 2EMGA 2JR1A 4BMJA 3HQ1A 1YUJA 1X5WA 1P47A 2EOXA 4DV1E 2LMZA 1B69A 1WHNA 1GZ6A 2E72A 4JYAE 4LF7E 4DR1E 2DGCA 2KHXA 2YTFA 2VQFE 2F8BA 2ADRA 2YU8A 2EOEA 5BR8E 2WBUA 2RS7A 4WXCA 4DR5E 4X62E 1TF3A 4M30A 4R8OA 5AE1A 4KWYA 4JI0E 4IS1C 2EMZA 1A1FA 4AQYE 2DLQA 4F2JC 1X6EA 1WHQA 1YYKA 1WJPA 2DMYA 1JK2A 4P78A 1I94E 2JPAA 4ZYGA 5LMUE 4FK5C 5KL7A 2EOHA 5IV8B 3MSWA 2EMKA 2N3GA 4WXDA 3J7AG 2EPLX 1PDAA 4LF6E 1IBME 5AE2A 2EP3A 2YSPA 4MLVA 2RS6A 4YHHE 3DJWA 3KWRA 4WPYA 1UHZA 4DR4E 2EPAA 4ZYDA 1SFEA 1BBGA 2N3HA 4DV7E 1RMDA 2V86A 3UK3C 2EM6A 2JOBA 1PKPA 3C4TA 5A69A 2LCEA 2EM8A 1PJSA 2EPMX 2UXBE 1EH6A 2M1SA 2RSIA 3HXLA 4WX9A 1X6FA 4DR7E 1RQ0A 2EM7A 4GKKE 2FTXB 3LMLA 4M0VA 3EQ1A 4BS9A 4LF9E 4B3RE 1ZBQA 1XNQE 3BGHA 2LO3A 1G2FC 3M99B 1YYWA 1IQSA 2HGHA 4KZSA 2EL4A 2NA2A 1PJQA 4MLQA 2N8XA 1A1LA 4O5GA 1N36E 2H36X 2HJJA 2EMAA 2LBSB 1QNTA 2WBSA 1GTKA 1KYQA 1QU6A 4BC9A 5IWAE 2EOFA 3T1HE 1ZAAC 1N33E 1DQ3A 3MHSC 2EM2A 3BIDA 1G2DC 1ZR9A 4F9AB 2EJ4A 3BBGA 1T4NA 5LMNE 3RMPA 2L3JA 2L3CA 3F6HA 4L8NA 4RH8A 4KHPE 2EN8A 2DLKA 3F6GA 3P1XA 2F4VE 1SR9A 1X3CA 4DR6E 5DNYA 3T1YE 1XNRE 4F6NA 1A1GA 1HNZE 2ODRC 2YSOA 1YYOA 3ADLA 2ZM6E 4GEQB 2LE2A 3FIGA 1X6HA 2EMBA 2PRTA 2ODRD 1NCSA 4X65E 5AASA 3ADIA 1UN6B 4L5NC 4LF5E 2EOJA 4M2ZA 3AUZA 3VYXA 2EN7A 1AAYA 2DRPA 3J7Yp 2J7JA 2E5LE 3AV0A 2B3TB 2M9AA 1YZ9A 2EPOA 4OX9E 2M7QA 1O0WA 3L00A 4DR3E 2EOSA 3EPKA 2YTPA 1WRJA 2WZOA 2JWOA 4GKJE 1GQEA 4N4RB 3OTOE 2RTXA 2LTSA 2ELZA 2EMIA 2EMCA 4LFAE 4TUGA 2CTDA 1J5EE 4BHBA 2CT1A 3J80C 4LF4E 2EMHA 2EN2A 3EPHA 2FGGA 2NUEA 3ZOQB 2YRKA 2V83A 2MDRA 2VRDA 3DF6A 2EM0A 3K6QA 2UXCE 4IJDA 3KZYA 2YTDA 1F2IG 3LLHA 2EPZA 4ZYHA 4X64E 2YT4A 3THOB 1EKZA 2EOZA 1HNWE 2MC5A 4B3ME 2ENAA 4DV5E 4F6MA 2CSHA 3VHTB 5A6JA 4BC7A 2K4VA 2LT7A 1KJKA 2EMFA 2Q8UA 4DV4E 4JI3E 4F9BB 4B3SE 2EZ6A 1T4LB 2EMLA 2B9DA 5KL5A 3C4BA 1UBDC 2EL5A 2YWQA 2VE7C 2LUPB 2EN6A 2EWLA 2EORA 2EMWA 2EPRA 4JI4E 2YTQA 1ZBTA 3HPZA 2RPCA 2EQ3A 2L2KB 3C6MA 4DKKA 4NZVA 2JYAA 4JI5E 4O4KA 2EPNA 2V85A 3VYYA 2EMYA 4F54A 1T38A 5ADZA 4P7DA 1X48A 3ADGA 3VK6A 4X66E 4ZYEA 2UXDE 2ENHA 2B7TA 2EOIA 1A1KA 4GZNC 2RQLA 2HHHE 2MKNA 4HEIA 2VF1A 5T6JA 2EPKX 4Q28A 2MDGA 5A6AA 5IT9C 2EPCA 1DI2A 1EH8A 2YRHA 1T4OA 3J81C 3HTXA 2JP9A 3EPJA 2YTGA 4Q35B 2CPNA 2DSYA 2EOQA 1JK1A 4B3TE 2EPXA 2EE8A 1N34E 5CFFE 1HR0E 4JI8E 1TN9A 2BBGA 1J26A 1STUA 3IWDA 1EH7A 4OOGC 5A2QC 1IMUA 2EQ0A 4F9CB 2MKDA 1L4SA 2JOXA 4WYQB 1PJTA 4J8ZA 2I13A 1T39A 4M9VC 2D9HA 5AC4A 2G7HA 4NXNE 5TSEA 2EPPA 2V88A 4R2QA 1RC7A 1NEIA 4R2RA 2EN1A 2FV4B 4R2SA 4DV2E 1X49A 1IQOA 2VQEE 1X47A 2YRMA 2ENCA 1YFHA 2WCC3 5IXMB 2NABA 1N3GA 4R2CA 4JV5E 2BB8A 1AH5A 2JVAA 4LFBE 4R2PA 2DB2A 2EOOA 2L2NA 2LVHA 2NUFA 4RHBB 3ECRA 2EPUA 3IWCA 3JAMC 1XMOE 2L6MA 4HTGA 4O24A 1N32E 2LV2A 4WSGA 2M4IA 4R03A 2E1MA 5KL2A 2R1FA 5KL6A 5F3WA 4R2DA 3BF2A 2JY9A 3JU0A 4JI2E 1IBKE 2V89A 2YTJA 2ELYA 4DV6E 3KZZA 2EM5A 2V87A 4LF8E 5AE3A 4R2AA 4DV0E 2EM4A 1FKAE 2GPIA 2LJHA 2V8QB 2LJUA 5AC5A 4DV3E 2MC6A 3THNA 4DUYE 3HPSA 2LRSA 2WBTA 1A1HA 2RSMA 1MEYC 1YSAC 2UUAE 2EN4A 2EOYA 2YZTA 4X8WA 4BHCA 4O43A 4K0KE 1UILA 2EM9A 2L8TA 3ADJA 5KL4A 2DMIA 1YUIA 2YTOA 1WXRA 5LL6R 4R2EA 4NXME 1ZU1A 2EMXA 4NHRA 5A6BA 4JI1E 4DMIA 1A1JA 4LTYA
chains in the Genus database with same CATH topology
2DSYA 1UHZA 2WZOA 2JWOA 4BBYA 4GKJE 2KONA 1GQEA 2UUBE 3OTOE 4B3TE 2RTXA 2LTSA 4JI6E 4DR4E 2LTRA 1XMQE 1N34E 5CFFE 1HR0E 2N3HA 4JI8E 4YY3E 4DV7E 4LFAE 4TUGA 2V86A 1J26A 1STUA 3IWDA 4WFTA 4OOGC 2JOBA 1PKPA 3C4TA 1J5EE 5A2QC 4LFCE 2L92A 1HNXE 4BCAA 4F9CB 3J80C 4LF4E 2JOXA 2F4VE 2FGGA 2NUEA 3JTZA 2KOUA 3ZOQB 2UXBE 2M1SA 2V83A 4WYQB 4J8ZA 2MDRA 3HXLA 4DR2E 3DF6A 3H09A 4DR7E 1RQ0A 4GKKE 3K6QA 2G7HA 4I8OA 2FTXB 3LMLA 4M0VA 1IBLE 4NXNE 2UXCE 4BS9A 2NUGA 3LLHA 2V88A 4LF9E 4X64E 4B3RE 1ZBQA 2YT4A 1RC7A 1XNQE 1EKZA 2UUCE 2DIXA 1HNWE 2FV4B 2MC5A 3OMLA 4B3ME 4WSPA 4TUIA 2L2MA 4DUZE 1YYWA 4DV2E 1X49A 4DV5E 2VQEE 1X47A 4KZSA 5FLXC 2NA2A 2IHR1 4BC7A 1FJGE 2LUQA 2B7VA 4JV5E 4LU9A 2K4VA 2JVAA 1N36E 2H36X 2L33A 2LBSB 4LFBE 4DV4E 3IWBA 4JI3E 4F9BB 2DB2A 2UU9E 4B3SE 2EZ6A 1T4LB 2L2NA 1QU6A 4BC9A 2NUFA 2B9DA 4JI7E 5IWAE 3C4BA 3IWCA 3T1HE 3JAMC 2JR1A 4BMJA 2VE7C 3HQ1A 2LUPB 1XMOE 4WPYA 2L6MA 1N33E 1DQ3A 2EWLA 4DV1E 1N32E 2LMZA 1WHNA 2M4IA 1GZ6A 4F9AB 4JYAE 4LF7E 4JI4E 4R03A 2E1MA 1ZBTA 3HPZA 1T4NA 5LMNE 4DR1E 3RMPA 2L2KB 5F3WA 2L3JA 2L3CA 3F6HA 2JY9A 3JU0A 4L8NA 4JI2E 4KHPE 2KHXA 1IBKE 2V89A 3F6GA 2F8BA 3P1XA 1SR9A 4DKKA 5BR8E 2VQFE 5DNYA 4DV6E 3T1YE 4JI5E 4DR6E 2V87A 2RS7A 4DR5E 4X62E 2V85A 3VYYA 4LF8E 4M30A 5AE3A 4F54A 1HNZE 4R8OA 5ADZA 5AE1A 4DV0E 1XNRE 2ODRC 4P7DA 1YYOA 2LJHA 1X48A 2V8QB 1FKAE 4DV3E 4JI0E 3ADGA 4GEQB 2LE2A 2MC6A 3FIGA 3VK6A 2ZM6E 4DUYE 3ADLA 4X66E 3HPSA 2ODRD 2LRSA 4AQYE 2UXDE 4X65E 5AASA 3ADIA 1WHQA 2B7TA 4L5NC 4LF5E 1YYKA 2RSMA 4M2ZA 2DMYA 3AUZA 4P78A 1I94E 2HHHE 2UUAE 2YZTA 5LMUE 4X8WA 2VF1A 3VYXA 5T6JA 4Q28A 5IT9C 3J7Yp 4K0KE 1DI2A 3MSWA 2E5LE 1UILA 1T4OA 2L8TA 2N3GA 3ADJA 3AV0A 3J81C 3HTXA 3J7AG 4LF6E 1IBME 5AE2A 2B3TB 1WXRA 1YZ9A 5LL6R 2CPNA 4NXME 4OX9E 2M7QA 1O0WA 2RS6A 4DR3E 4JI1E 4DMIA 4YHHE 3DJWA 3KWRA 4LTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEQ B;  2FV4 B;  2FTX B;  5T6J A; 
#chains in the Genus database with same CATH topology
 2HC5 A;  2EQ1 A;  4BBY A;  1TF6 A;  2YTE A;  2KON A;  2UUB E;  4JI6 E;  1LLM C;  2YPN A;  2LTR A;  2JXP A;  1XMQ E;  3QG5 C;  2K7I A;  1MGT A;  4YY3 E;  5A6K A;  4WFT A;  4LFC E;  2L92 A;  1HNX E;  4BCA A;  5LLQ A;  3C6K A;  2R76 A;  4X9J A;  3JTZ A;  2KOU A;  4DR2 E;  1A1I A;  3H09 A;  5KL3 A;  1Z1B A;  3EPL A;  4I8O A;  2YU5 A;  1IBL E;  1DGC A;  2I9I A;  2NUG A;  2EM3 A;  1BB8 A;  1YPN A;  2YTN A;  2DIX A;  2UUC E;  1BBO A;  3OML A;  4WSP A;  4TUI A;  2L2M A;  4DUZ E;  2A25 A;  2GHF A;  3MHH C;  2EN3 A;  3TQM A;  5FLX C;  2IHR 1;  2EL6 A;  1FJG E;  5A6B D;  2LUQ A;  2B7V A;  4LU9 A;  2GLI A;  2L33 A;  3IWB A;  2YTI A;  2UU9 E;  4JI7 E;  2EOM A;  2EMG A;  2JR1 A;  4BMJ A;  3HQ1 A;  1YUJ A;  1X5W A;  1P47 A;  2EOX A;  4DV1 E;  2LMZ A;  1B69 A;  1WHN A;  1GZ6 A;  2E72 A;  4JYA E;  4LF7 E;  4DR1 E;  2DGC A;  2KHX A;  2YTF A;  2VQF E;  2F8B A;  2ADR A;  2YU8 A;  2EOE A;  5BR8 E;  2WBU A;  2RS7 A;  4WXC A;  4DR5 E;  4X62 E;  1TF3 A;  4M30 A;  4R8O A;  5AE1 A;  4KWY A;  4JI0 E;  4IS1 C;  2EMZ A;  1A1F A;  4AQY E;  2DLQ A;  4F2J C;  1X6E A;  1WHQ A;  1YYK A;  1WJP A;  2DMY A;  1JK2 A;  4P78 A;  1I94 E;  2JPA A;  4ZYG A;  5LMU E;  4FK5 C;  5KL7 A;  2EOH A;  5IV8 B;  3MSW A;  2EMK A;  2N3G A;  4WXD A;  3J7A G;  2EPL X;  1PDA A;  4LF6 E;  1IBM E;  5AE2 A;  2EP3 A;  2YSP A;  4MLV A;  2RS6 A;  4YHH E;  3DJW A;  3KWR A;  4WPY A;  1UHZ A;  4DR4 E;  2EPA A;  4ZYD A;  1SFE A;  1BBG A;  2N3H A;  4DV7 E;  1RMD A;  2V86 A;  3UK3 C;  2EM6 A;  2JOB A;  1PKP A;  3C4T A;  5A69 A;  2LCE A;  2EM8 A;  1PJS A;  2EPM X;  2UXB E;  1EH6 A;  2M1S A;  2RSI A;  3HXL A;  4WX9 A;  1X6F A;  4DR7 E;  1RQ0 A;  2EM7 A;  4GKK E;  2FTX B;  3LML A;  4M0V A;  3EQ1 A;  4BS9 A;  4LF9 E;  4B3R E;  1ZBQ A;  1XNQ E;  3BGH A;  2LO3 A;  1G2F C;  3M99 B;  1YYW A;  1IQS A;  2HGH A;  4KZS A;  2EL4 A;  2NA2 A;  1PJQ A;  4MLQ A;  2N8X A;  1A1L A;  4O5G A;  1N36 E;  2H36 X;  2HJJ A;  2EMA A;  2LBS B;  1QNT A;  2WBS A;  1GTK A;  1KYQ A;  1QU6 A;  4BC9 A;  5IWA E;  2EOF A;  3T1H E;  1ZAA C;  1N33 E;  1DQ3 A;  3MHS C;  2EM2 A;  3BID A;  1G2D C;  1ZR9 A;  4F9A B;  2EJ4 A;  3BBG A;  1T4N A;  5LMN E;  3RMP A;  2L3J A;  2L3C A;  3F6H A;  4L8N A;  4RH8 A;  4KHP E;  2EN8 A;  2DLK A;  3F6G A;  3P1X A;  2F4V E;  1SR9 A;  1X3C A;  4DR6 E;  5DNY A;  3T1Y E;  1XNR E;  4F6N A;  1A1G A;  1HNZ E;  2ODR C;  2YSO A;  1YYO A;  3ADL A;  2ZM6 E;  4GEQ B;  2LE2 A;  3FIG A;  1X6H A;  2EMB A;  2PRT A;  2ODR D;  1NCS A;  4X65 E;  5AAS A;  3ADI A;  1UN6 B;  4L5N C;  4LF5 E;  2EOJ A;  4M2Z A;  3AUZ A;  3VYX A;  2EN7 A;  1AAY A;  2DRP A;  3J7Y p;  2J7J A;  2E5L E;  3AV0 A;  2B3T B;  2M9A A;  1YZ9 A;  2EPO A;  4OX9 E;  2M7Q A;  1O0W A;  3L00 A;  4DR3 E;  2EOS A;  3EPK A;  2YTP A;  1WRJ A;  2WZO A;  2JWO A;  4GKJ E;  1GQE A;  4N4R B;  3OTO E;  2RTX A;  2LTS A;  2ELZ A;  2EMI A;  2EMC A;  4LFA E;  4TUG A;  2CTD A;  1J5E E;  4BHB A;  2CT1 A;  3J80 C;  4LF4 E;  2EMH A;  2EN2 A;  3EPH A;  2FGG A;  2NUE A;  3ZOQ B;  2YRK A;  2V83 A;  2MDR A;  2VRD A;  3DF6 A;  2EM0 A;  3K6Q A;  2UXC E;  4IJD A;  3KZY A;  2YTD A;  1F2I G;  3LLH A;  2EPZ A;  4ZYH A;  4X64 E;  2YT4 A;  3THO B;  1EKZ A;  2EOZ A;  1HNW E;  2MC5 A;  4B3M E;  2ENA A;  4DV5 E;  4F6M A;  2CSH A;  3VHT B;  5A6J A;  4BC7 A;  2K4V A;  2LT7 A;  1KJK A;  2EMF A;  2Q8U A;  4DV4 E;  4JI3 E;  4F9B B;  4B3S E;  2EZ6 A;  1T4L B;  2EML A;  2B9D A;  5KL5 A;  3C4B A;  1UBD C;  2EL5 A;  2YWQ A;  2VE7 C;  2LUP B;  2EN6 A;  2EWL A;  2EOR A;  2EMW A;  2EPR A;  4JI4 E;  2YTQ A;  1ZBT A;  3HPZ A;  2RPC A;  2EQ3 A;  2L2K B;  3C6M A;  4DKK A;  4NZV A;  2JYA A;  4JI5 E;  4O4K A;  2EPN A;  2V85 A;  3VYY A;  2EMY A;  4F54 A;  1T38 A;  5ADZ A;  4P7D A;  1X48 A;  3ADG A;  3VK6 A;  4X66 E;  4ZYE A;  2UXD E;  2ENH A;  2B7T A;  2EOI A;  1A1K A;  4GZN C;  2RQL A;  2HHH E;  2MKN A;  4HEI A;  2VF1 A;  5T6J A;  2EPK X;  4Q28 A;  2MDG A;  5A6A A;  5IT9 C;  2EPC A;  1DI2 A;  1EH8 A;  2YRH A;  1T4O A;  3J81 C;  3HTX A;  2JP9 A;  3EPJ A;  2YTG A;  4Q35 B;  2CPN A;  2DSY A;  2EOQ A;  1JK1 A;  4B3T E;  2EPX A;  2EE8 A;  1N34 E;  5CFF E;  1HR0 E;  4JI8 E;  1TN9 A;  2BBG A;  1J26 A;  1STU A;  3IWD A;  1EH7 A;  4OOG C;  5A2Q C;  1IMU A;  2EQ0 A;  4F9C B;  2MKD A;  1L4S A;  2JOX A;  4WYQ B;  1PJT A;  4J8Z A;  2I13 A;  1T39 A;  4M9V C;  2D9H A;  5AC4 A;  2G7H A;  4NXN E;  5TSE A;  2EPP A;  2V88 A;  4R2Q A;  1RC7 A;  1NEI A;  4R2R A;  2EN1 A;  2FV4 B;  4R2S A;  4DV2 E;  1X49 A;  1IQO A;  2VQE E;  1X47 A;  2YRM A;  2ENC A;  1YFH A;  2WCC 3;  5IXM B;  2NAB A;  1N3G A;  4R2C A;  4JV5 E;  2BB8 A;  1AH5 A;  2JVA A;  4LFB E;  4R2P A;  2DB2 A;  2EOO A;  2L2N A;  2LVH A;  2NUF A;  4RHB B;  3ECR A;  2EPU A;  3IWC A;  3JAM C;  1XMO E;  2L6M A;  4HTG A;  4O24 A;  1N32 E;  2LV2 A;  4WSG A;  2M4I A;  4R03 A;  2E1M A;  5KL2 A;  2R1F A;  5KL6 A;  5F3W A;  4R2D A;  3BF2 A;  2JY9 A;  3JU0 A;  4JI2 E;  1IBK E;  2V89 A;  2YTJ A;  2ELY A;  4DV6 E;  3KZZ A;  2EM5 A;  2V87 A;  4LF8 E;  5AE3 A;  4R2A A;  4DV0 E;  2EM4 A;  1FKA E;  2GPI A;  2LJH A;  2V8Q B;  2LJU A;  5AC5 A;  4DV3 E;  2MC6 A;  3THN A;  4DUY E;  3HPS A;  2LRS A;  2WBT A;  1A1H A;  2RSM A;  1MEY C;  1YSA C;  2UUA E;  2EN4 A;  2EOY A;  2YZT A;  4X8W A;  4BHC A;  4O43 A;  4K0K E;  1UIL A;  2EM9 A;  2L8T A;  3ADJ A;  5KL4 A;  2DMI A;  1YUI A;  2YTO A;  1WXR A;  5LL6 R;  4R2E A;  4NXM E;  1ZU1 A;  2EMX A;  4NHR A;  5A6B A;  4JI1 E;  4DMI A;  1A1J A;  4LTY A; 
#chains in the Genus database with same CATH homology
 2DSY A;  1UHZ A;  2WZO A;  2JWO A;  4BBY A;  4GKJ E;  2KON A;  1GQE A;  2UUB E;  3OTO E;  4B3T E;  2RTX A;  2LTS A;  4JI6 E;  4DR4 E;  2LTR A;  1XMQ E;  1N34 E;  5CFF E;  1HR0 E;  2N3H A;  4JI8 E;  4YY3 E;  4DV7 E;  4LFA E;  4TUG A;  2V86 A;  1J26 A;  1STU A;  3IWD A;  4WFT A;  4OOG C;  2JOB A;  1PKP A;  3C4T A;  1J5E E;  5A2Q C;  4LFC E;  2L92 A;  1HNX E;  4BCA A;  4F9C B;  3J80 C;  4LF4 E;  2JOX A;  2F4V E;  2FGG A;  2NUE A;  3JTZ A;  2KOU A;  3ZOQ B;  2UXB E;  2M1S A;  2V83 A;  4WYQ B;  4J8Z A;  2MDR A;  3HXL A;  4DR2 E;  3DF6 A;  3H09 A;  4DR7 E;  1RQ0 A;  4GKK E;  3K6Q A;  2G7H A;  4I8O A;  2FTX B;  3LML A;  4M0V A;  1IBL E;  4NXN E;  2UXC E;  4BS9 A;  2NUG A;  3LLH A;  2V88 A;  4LF9 E;  4X64 E;  4B3R E;  1ZBQ A;  2YT4 A;  1RC7 A;  1XNQ E;  1EKZ A;  2UUC E;  2DIX A;  1HNW E;  2FV4 B;  2MC5 A;  3OML A;  4B3M E;  4WSP A;  4TUI A;  2L2M A;  4DUZ E;  1YYW A;  4DV2 E;  1X49 A;  4DV5 E;  2VQE E;  1X47 A;  4KZS A;  5FLX C;  2NA2 A;  2IHR 1;  4BC7 A;  1FJG E;  2LUQ A;  2B7V A;  4JV5 E;  4LU9 A;  2K4V A;  2JVA A;  1N36 E;  2H36 X;  2L33 A;  2LBS B;  4LFB E;  4DV4 E;  3IWB A;  4JI3 E;  4F9B B;  2DB2 A;  2UU9 E;  4B3S E;  2EZ6 A;  1T4L B;  2L2N A;  1QU6 A;  4BC9 A;  2NUF A;  2B9D A;  4JI7 E;  5IWA E;  3C4B A;  3IWC A;  3T1H E;  3JAM C;  2JR1 A;  4BMJ A;  2VE7 C;  3HQ1 A;  2LUP B;  1XMO E;  4WPY A;  2L6M A;  1N33 E;  1DQ3 A;  2EWL A;  4DV1 E;  1N32 E;  2LMZ A;  1WHN A;  2M4I A;  1GZ6 A;  4F9A B;  4JYA E;  4LF7 E;  4JI4 E;  4R03 A;  2E1M A;  1ZBT A;  3HPZ A;  1T4N A;  5LMN E;  4DR1 E;  3RMP A;  2L2K B;  5F3W A;  2L3J A;  2L3C A;  3F6H A;  2JY9 A;  3JU0 A;  4L8N A;  4JI2 E;  4KHP E;  2KHX A;  1IBK E;  2V89 A;  3F6G A;  2F8B A;  3P1X A;  1SR9 A;  4DKK A;  5BR8 E;  2VQF E;  5DNY A;  4DV6 E;  3T1Y E;  4JI5 E;  4DR6 E;  2V87 A;  2RS7 A;  4DR5 E;  4X62 E;  2V85 A;  3VYY A;  4LF8 E;  4M30 A;  5AE3 A;  4F54 A;  1HNZ E;  4R8O A;  5ADZ A;  5AE1 A;  4DV0 E;  1XNR E;  2ODR C;  4P7D A;  1YYO A;  2LJH A;  1X48 A;  2V8Q B;  1FKA E;  4DV3 E;  4JI0 E;  3ADG A;  4GEQ B;  2LE2 A;  2MC6 A;  3FIG A;  3VK6 A;  2ZM6 E;  4DUY E;  3ADL A;  4X66 E;  3HPS A;  2ODR D;  2LRS A;  4AQY E;  2UXD E;  4X65 E;  5AAS A;  3ADI A;  1WHQ A;  2B7T A;  4L5N C;  4LF5 E;  1YYK A;  2RSM A;  4M2Z A;  2DMY A;  3AUZ A;  4P78 A;  1I94 E;  2HHH E;  2UUA E;  2YZT A;  5LMU E;  4X8W A;  2VF1 A;  3VYX A;  5T6J A;  4Q28 A;  5IT9 C;  3J7Y p;  4K0K E;  1DI2 A;  3MSW A;  2E5L E;  1UIL A;  1T4O A;  2L8T A;  2N3G A;  3ADJ A;  3AV0 A;  3J81 C;  3HTX A;  3J7A G;  4LF6 E;  1IBM E;  5AE2 A;  2B3T B;  1WXR A;  1YZ9 A;  5LL6 R;  2CPN A;  4NXM E;  4OX9 E;  2M7Q A;  1O0W A;  2RS6 A;  4DR3 E;  4JI1 E;  4DMI A;  4YHH E;  3DJW A;  3KWR A;  4LTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...