2YTJA

Solution structure of the c2h2 type zinc finger (region 771-803) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYICAECGKAFTIRSNLIKHQKIHTKQKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 771-803) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytjA01
2EJ4A 2ELYA 1JK1A 4R2SA 2EM4A 1B69A 1A1HA 2YTPA 1ZAAC 2EL5A 2DLQA 2RPCA 2GLIA 1UN6B 2EMZA 4F6MA 2EN3A 5KL5A 2EOZA 2EOIA 2EMWA 3MHHC 1RMDA 2WBSA 2MKDA 2RSIA 1LLMC 2EOSA 2EQ0A 2YTOA 1A1GA 2EM8A 1DGCA 1MEYC 2YTJA 2M9AA 1A1JA 2YU5A 2YTFA 1A1FA 2EL6A 2EN1A 2DRPA 1TF3A 3EPJA 2EQ3A 2EN4A 2EN2A 4R2RA 2EPPA 2EMKA 2EM2A 2YRKA 2EQ1A 1BBOA 2MKNA 2EMXA 2EPXA 1X6HA 1JK2A 2EPUA 1G2DC 2PRTA 2NABA 2D9HA 2EOFA 2EOEA 2EMAA 2YTDA 4R2DA 3M99B 4X9JA 2YTGA 2MDGA 2YU8A 3MHSC 1X6FA 2EOQA 2JP9A 4FK5C 2LV2A 2WCC3 1UBDC 2EM6A 1YUJA 2LT7A 1A1KA 2EM5A 2EOYA 2EMHA 2J7JA 4IJDA 2CTDA 1NCSA 2EMLA 2EOMA 5KL4A 2EORA 3VHTB 2HGHA 2CSHA 4R2EA 1TF6A 2JPAA 2WBTA 2EN6A 2EMBA 3EPLA 2EP3A 2EOHA 2EOXA 2LCEA 1G2FC 2DLKA 2ENAA 2DMIA 2EM9A 2EL4A 2EN7A 4M9VC 1A1LA 1ZU1A 2E72A 2GHFA 1TN9A 2R1FA 2LVHA 1YSAC 4R2PA 2EM3A 1KJKA 2EOOA 2EMYA 2EN8A 5KL6A 4GZNC 3UK3C 2EM0A 2YRHA 4R2AA 1YUIA 1X6EA 4R2QA 1BB8A 4F2JC 2I13A 4WSGA 5KL2A 4IS1C 2EOJA 4F6NA 2YTEA 2EPRA 2YTQA 2CT1A 5KL3A 1F2IG 2EMFA 2EMCA 2YSPA 2EPCA 1AAYA 2EMIA 2BB8A 2ENCA 4R2CA 2ELZA 1X5WA 2ADRA 1A1IA 2WBUA 2DGCA 2EPZA 2EMGA 2YRMA 1P47A 2EPAA 2A25A 2YTNA 2YTIA 3EPKA 2EE8A 2ENHA 1Z1BA 2VRDA 1WJPA 1ZR9A 1X3CA 2LO3A 5KL7A 2YSOA 3EPHA 2EM7A
chains in the Genus database with same CATH superfamily
4R2SA 2RPCA 1UN6B 2B7VA 2WZOA 3HQ1A 1T4LB 2L2NA 3MHHC 1KYQA 2E5LE 2HJJA 2RSIA 2L3CA 1N33E 2EQ0A 2YTOA 4JI8E 2VE7C 5BR8E 2EM8A 1A1GA 2E1MA 4OX9E 1A1JA 2EL6A 2EN1A 3DF6A 3FIGA 1N32E 2Q8UA 4JI2E 2EQ3A 2VQFE 1GTKA 4DV6E 2EMKA 4TUGA 4RH8A 3F6GA 1XNRE 5AE3A 2EPUA 1UHZA 1HR0E 2D9HA 3KZZA 1NEIA 4KWYA 3H09A 4X9JA 2JP9A 4LF4E 2DB2A 4KHPE 2EM6A 1YUJA 2MC5A 5AASA 4LFBE 2EOYA 4X64E 3K6QA 2L6MA 2EMHA 2LJHA 2FV4B 1IMUA 5AC4A 3T1HE 4BC9A 4F54A 1NCSA 2CSHA 4R2EA 2JPAA 1EH8A 2NA2A 5T6JA 2EMBA 1G2FC 2ENAA 2DMIA 2V8QB 2EM9A 1O0WA 4GEQB 1WRJA 4MLVA 1QNTA 1A1LA 1TN9A 2EOOA 5KL6A 3J7AG 4GZNC 4LF7E 3F6HA 2F8BA 5A6AA 1YUIA 1YPNA 2M1SA 4F9CB 1X6EA 4R2QA 4ZYDA 4F2JC 2I13A 4HEIA 1DQ3A 5KL2A 2EWLA 2UUCE 2EOJA 2MC6A 2YTQA 2N3GA 2EMFA 2YSPA 4RHBB 4LF9E 4LU9A 2NUGA 2ODRC 4DUYE 2DGCA 1P47A 2A25A 3OMLA 2ENHA 2M7QA 4GKKE 2VRDA 1WJPA 3VK6A 3KZYA 5AE2A 1DI2A 5KL7A 2YSOA 5LLQA 2RSMA 4DV0E 3JTZA 2ODRD 2EJ4A 2L8TA 2ELYA 2EM4A 3J80C 2YTPA 2GLIA 2EL5A 4WPYA 3KWRA 2IHR1 2WBSA 2NUFA 1LLMC 4DMIA 2EOSA 2L3JA 2V87A 5AC5A 1N3GA 2YTJA 4YY3E 1IQOA 5IXMB 2L33A 2DIXA 2YU5A 2YTFA 2DRPA 1HNWE 1X49A 4JI7E 1TF3A 4X62E 3THOB 3EPJA 4WX9A 1EH6A 2EPPA 5LMNE 2EM2A 2EPMX 3TQMA 1YZ9A 5IT9C 2EQ1A 1BBOA 3THNA 4JV5E 1X6HA 1T39A 1EH7A 2LJUA 1XMQE 4M30A 2EOEA 2YTDA 2YTGA 4R8OA 2MDGA 3OTOE 4L5NC 1WHNA 2V85A 2LV2A 3C6KA 2WCC3 1UBDC 1RC7A 4JI0E 2LT7A 1A1KA 2EM5A 4JI3E 3BBGA 1HNXE 2V88A 2UU9E 3HPSA 4LTYA 1WHQA 5KL4A 1J5EE 2R76A 3MSWA 2YPNA 2LUQA 4KZSA 2EN6A 4R03A 1ZBQA 3EPLA 4NXNE 1SR9A 2DLKA 2YWQA 1PDAA 4OOGC 2M4IA 5ADZA 1GQEA 4BHBA 2EL4A 1QU6A 3ADLA 2E72A 4GKJE 2UUBE 4X66E 3IWBA 4DR5E 1N36E 3J81C 2EMYA 2EPKX 2LE2A 2YRHA 3QG5C 2JOXA 1BB8A 4DUZE 4WSGA 3L00A 2GPIA 4IS1C 5A6BD 2YTEA 2EPRA 2CT1A 1XMOE 4AQYE 3P1XA 3ADJA 2ENCA 2ADRA 2EPZA 3AV0A 2HHHE 2YRMA 3ADGA 4YHHE 2EPAA 2V83A 2YTNA 2MDRA 1Z1BA 4M0VA 1BBGA 1ZR9A 2N8XA 2EZ6A 4BCAA 2LO3A 2B3TB 3C4BA 4L8NA 5IWAE 5IV8B 5A69A 2RS7A 4DR3E 4DR6E 2DLQA 4BBYA 2EMZA 1IBKE 1AH5A 5KL5A 4DR7E 2EOZA 2EOIA 2EMWA 1STUA 2EPOA 2MKDA 2FGGA 2L92A 1FKAE 1MEYC 2M9AA 4WFTA 4X65E 2KONA 3BIDA 4JI4E 4ZYHA 2VF1A 4R2RA 2UXCE 4BS9A 3BGHA 2MKNA 2RS6A 2EMXA 5AE1A 2EPXA 1JK2A 1G2DC 2PRTA 2NABA 2K4VA 2EMAA 3M99B 1YYOA 2YU8A 3MHSC 1X6FA 2EOQA 2KOUA 4P7DA 1PKPA 3ADIA 2UXDE 2CTDA 4WXCA 2EPNA 2EOMA 2YZTA 2HGHA 2FTXB 2JOBA 4Q35B 2JR1A 4DKKA 4DV3E 2EP3A 2LMZA 4N4RB 2LCEA 2RTXA 1WXRA 2LBSB 2JYAA 2L2MA 4B3ME 4P78A 2EN7A 4WSPA 4M9VC 3ZOQB 1ZU1A 4J8ZA 5F3WA 2R1FA 1YSAC 2EM3A 1KJKA 1FJGE 1YYWA 2EN8A 5CFFE 1L4SA 3UK3C 4R2AA 3JAMC 4F9BB 2RQLA 4DV1E 2B9DA 2LRSA 2CPNA 3BF2A 4X8WA 1X47A 2JVAA 4F6NA 4JYAE 2EMCA 1AAYA 2V89A 2EMIA 2UXBE 4TUIA 4B3RE 3AUZA 1YFHA 1A1IA 3HTXA 2HC5A 1ZBTA 4DV5E 1SFEA 4BMJA 2V86A 2YTIA 3JU0A 3EPKA 4JI5E 4ZYEA 1PJSA 3EPHA 2EM7A 1MGTA 4LFAE 2F4VE 4B3TE 3VYXA 5A6BA 4B3SE 2VQEE 1JK1A 1IBLE 1B69A 1A1HA 1ZAAC 4ZYGA 2EPLX 4O5GA 2BBGA 4F6MA 2EN3A 2I9IA 4WXDA 1IQSA 3J7Yp 2DSYA 4NZVA 1RMDA 3IWCA 3HXLA 5LMUE 5TSEA 4BHCA 4K0KE 5A6JA 1DGCA 1HNZE 2LTSA 5A2QC 3LLHA 2JWOA 2LTRA 1A1FA 2JY9A 2JXPA 5A6KA 2EN4A 4LF5E 2EN2A 2DMYA 5LL6R 1EKZA 1T38A 2YRKA 4O4KA 4BC7A 2H36X 4Q28A 2EOFA 4R2DA 4I8OA 4FK5C 4DV4E 1X48A 4JI1E 4NXME 4DV7E 3C6MA 4DR4E 4LF8E 2K7IA 1T4NA 2J7JA 4IJDA 1I94E 1UILA 4DR1E 2NUEA 2ZM6E 5FLXC 2EMLA 2L2KB 1IBME 2EORA 3VHTB 1TF6A 2WBTA 1YYKA 2EOHA 2EOXA 4O43A 2B7TA 1PJTA 3IWDA 2KHXA 4DV2E 4NHRA 4DR2E 1XNQE 1PJQA 2GHFA 3EQ1A 3RMPA 2LVHA 3DJWA 4R2PA 5DNYA 4JI6E 4MLQA 4WYQB 3LMLA 2EM0A 4HTGA 1RQ0A 4O24A 1N34E 2G7HA 4LF6E 2YT4A 5KL3A 1F2IG 2EPCA 2N3HA 3C4TA 1T4OA 2BB8A 1GZ6A 4R2CA 2ELZA 1X5WA 4F9AB 2WBUA 3HPZA 2EMGA 3VYYA 3T1YE 1J26A 2EE8A 2UUAE 1X3CA 4LFCE 3ECRA 4M2ZA 2LUPB
chains in the Genus database with same CATH topology
2EJ4A 2ELYA 1JK1A 4R2SA 2EM4A 1B69A 1A1HA 2YTPA 1ZAAC 2EL5A 2DLQA 2RPCA 2GLIA 1UN6B 2EMZA 4F6MA 2EN3A 5KL5A 2EOZA 2EOIA 2EMWA 3MHHC 1RMDA 2WBSA 2MKDA 2RSIA 1LLMC 2EOSA 2EQ0A 2YTOA 1A1GA 2EM8A 1DGCA 1MEYC 2YTJA 2M9AA 1A1JA 2YU5A 2YTFA 1A1FA 2EL6A 2EN1A 2DRPA 1TF3A 3EPJA 2EQ3A 2EN4A 2EN2A 4R2RA 2EPPA 2EMKA 2EM2A 2YRKA 2EQ1A 1BBOA 2MKNA 2EMXA 2EPXA 1X6HA 1JK2A 2EPUA 1G2DC 2PRTA 2NABA 2D9HA 2EOFA 2EOEA 2EMAA 2YTDA 4R2DA 3M99B 4X9JA 2YTGA 2MDGA 2YU8A 3MHSC 1X6FA 2EOQA 2JP9A 4FK5C 2LV2A 2WCC3 1UBDC 2EM6A 1YUJA 2LT7A 1A1KA 2EM5A 2EOYA 2EMHA 2J7JA 4IJDA 2CTDA 1NCSA 2EMLA 2EOMA 5KL4A 2EORA 3VHTB 2HGHA 2CSHA 4R2EA 1TF6A 2JPAA 2WBTA 2EN6A 2EMBA 3EPLA 2EP3A 2EOHA 2EOXA 2LCEA 1G2FC 2DLKA 2ENAA 2DMIA 2EM9A 2EL4A 2EN7A 4M9VC 1A1LA 1ZU1A 2E72A 2GHFA 1TN9A 2R1FA 2LVHA 1YSAC 4R2PA 2EM3A 1KJKA 2EOOA 2EMYA 2EN8A 5KL6A 4GZNC 3UK3C 2EM0A 2YRHA 4R2AA 1YUIA 1X6EA 4R2QA 1BB8A 4F2JC 2I13A 4WSGA 5KL2A 4IS1C 2EOJA 4F6NA 2YTEA 2EPRA 2YTQA 2CT1A 5KL3A 1F2IG 2EMFA 2EMCA 2YSPA 2EPCA 1AAYA 2EMIA 2BB8A 2ENCA 4R2CA 2ELZA 1X5WA 2ADRA 1A1IA 2WBUA 2DGCA 2EPZA 2EMGA 2YRMA 1P47A 2EPAA 2A25A 2YTNA 2YTIA 3EPKA 2EE8A 2ENHA 1Z1BA 2VRDA 1WJPA 1ZR9A 1X3CA 2LO3A 5KL7A 2YSOA 3EPHA 2EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ4 A;  2ELY A;  1JK1 A;  4R2S A;  2EM4 A;  1B69 A;  1A1H A;  2YTP A;  1ZAA C;  2EL5 A;  2DLQ A;  2RPC A;  2GLI A;  1UN6 B;  2EMZ A;  4F6M A;  2EN3 A;  5KL5 A;  2EOZ A;  2EOI A;  2EMW A;  3MHH C;  1RMD A;  2WBS A;  2MKD A;  2RSI A;  1LLM C;  2EOS A;  2EQ0 A;  2YTO A;  1A1G A;  2EM8 A;  1DGC A;  1MEY C;  2YTJ A;  2M9A A;  1A1J A;  2YU5 A;  2YTF A;  1A1F A;  2EL6 A;  2EN1 A;  2DRP A;  1TF3 A;  3EPJ A;  2EQ3 A;  2EN4 A;  2EN2 A;  4R2R A;  2EPP A;  2EMK A;  2EM2 A;  2YRK A;  2EQ1 A;  1BBO A;  2MKN A;  2EMX A;  2EPX A;  1X6H A;  1JK2 A;  2EPU A;  1G2D C;  2PRT A;  2NAB A;  2D9H A;  2EOF A;  2EOE A;  2EMA A;  2YTD A;  4R2D A;  3M99 B;  4X9J A;  2YTG A;  2MDG A;  2YU8 A;  3MHS C;  1X6F A;  2EOQ A;  2JP9 A;  4FK5 C;  2LV2 A;  2WCC 3;  1UBD C;  2EM6 A;  1YUJ A;  2LT7 A;  1A1K A;  2EM5 A;  2EOY A;  2EMH A;  2J7J A;  4IJD A;  2CTD A;  1NCS A;  2EML A;  2EOM A;  5KL4 A;  2EOR A;  3VHT B;  2HGH A;  2CSH A;  4R2E A;  1TF6 A;  2JPA A;  2WBT A;  2EN6 A;  2EMB A;  3EPL A;  2EP3 A;  2EOH A;  2EOX A;  2LCE A;  1G2F C;  2DLK A;  2ENA A;  2DMI A;  2EM9 A;  2EL4 A;  2EN7 A;  4M9V C;  1A1L A;  1ZU1 A;  2E72 A;  2GHF A;  1TN9 A;  2R1F A;  2LVH A;  1YSA C;  4R2P A;  2EM3 A;  1KJK A;  2EOO A;  2EMY A;  2EN8 A;  5KL6 A;  4GZN C;  3UK3 C;  2EM0 A;  2YRH A;  4R2A A;  1YUI A;  1X6E A;  4R2Q A;  1BB8 A;  4F2J C;  2I13 A;  4WSG A;  5KL2 A;  4IS1 C;  2EOJ A;  4F6N A;  2YTE A;  2EPR A;  2YTQ A;  2CT1 A;  5KL3 A;  1F2I G;  2EMF A;  2EMC A;  2YSP A;  2EPC A;  1AAY A;  2EMI A;  2BB8 A;  2ENC A;  4R2C A;  2ELZ A;  1X5W A;  2ADR A;  1A1I A;  2WBU A;  2DGC A;  2EPZ A;  2EMG A;  2YRM A;  1P47 A;  2EPA A;  2A25 A;  2YTN A;  2YTI A;  3EPK A;  2EE8 A;  2ENH A;  1Z1B A;  2VRD A;  1WJP A;  1ZR9 A;  1X3C A;  2LO3 A;  5KL7 A;  2YSO A;  3EPH A;  2EM7 A; 
#chains in the Genus database with same CATH topology
 4R2S A;  2RPC A;  1UN6 B;  2B7V A;  2WZO A;  3HQ1 A;  1T4L B;  2L2N A;  3MHH C;  1KYQ A;  2E5L E;  2HJJ A;  2RSI A;  2L3C A;  1N33 E;  2EQ0 A;  2YTO A;  4JI8 E;  2VE7 C;  5BR8 E;  2EM8 A;  1A1G A;  2E1M A;  4OX9 E;  1A1J A;  2EL6 A;  2EN1 A;  3DF6 A;  3FIG A;  1N32 E;  2Q8U A;  4JI2 E;  2EQ3 A;  2VQF E;  1GTK A;  4DV6 E;  2EMK A;  4TUG A;  4RH8 A;  3F6G A;  1XNR E;  5AE3 A;  2EPU A;  1UHZ A;  1HR0 E;  2D9H A;  3KZZ A;  1NEI A;  4KWY A;  3H09 A;  4X9J A;  2JP9 A;  4LF4 E;  2DB2 A;  4KHP E;  2EM6 A;  1YUJ A;  2MC5 A;  5AAS A;  4LFB E;  2EOY A;  4X64 E;  3K6Q A;  2L6M A;  2EMH A;  2LJH A;  2FV4 B;  1IMU A;  5AC4 A;  3T1H E;  4BC9 A;  4F54 A;  1NCS A;  2CSH A;  4R2E A;  2JPA A;  1EH8 A;  2NA2 A;  5T6J A;  2EMB A;  1G2F C;  2ENA A;  2DMI A;  2V8Q B;  2EM9 A;  1O0W A;  4GEQ B;  1WRJ A;  4MLV A;  1QNT A;  1A1L A;  1TN9 A;  2EOO A;  5KL6 A;  3J7A G;  4GZN C;  4LF7 E;  3F6H A;  2F8B A;  5A6A A;  1YUI A;  1YPN A;  2M1S A;  4F9C B;  1X6E A;  4R2Q A;  4ZYD A;  4F2J C;  2I13 A;  4HEI A;  1DQ3 A;  5KL2 A;  2EWL A;  2UUC E;  2EOJ A;  2MC6 A;  2YTQ A;  2N3G A;  2EMF A;  2YSP A;  4RHB B;  4LF9 E;  4LU9 A;  2NUG A;  2ODR C;  4DUY E;  2DGC A;  1P47 A;  2A25 A;  3OML A;  2ENH A;  2M7Q A;  4GKK E;  2VRD A;  1WJP A;  3VK6 A;  3KZY A;  5AE2 A;  1DI2 A;  5KL7 A;  2YSO A;  5LLQ A;  2RSM A;  4DV0 E;  3JTZ A;  2ODR D;  2EJ4 A;  2L8T A;  2ELY A;  2EM4 A;  3J80 C;  2YTP A;  2GLI A;  2EL5 A;  4WPY A;  3KWR A;  2IHR 1;  2WBS A;  2NUF A;  1LLM C;  4DMI A;  2EOS A;  2L3J A;  2V87 A;  5AC5 A;  1N3G A;  2YTJ A;  4YY3 E;  1IQO A;  5IXM B;  2L33 A;  2DIX A;  2YU5 A;  2YTF A;  2DRP A;  1HNW E;  1X49 A;  4JI7 E;  1TF3 A;  4X62 E;  3THO B;  3EPJ A;  4WX9 A;  1EH6 A;  2EPP A;  5LMN E;  2EM2 A;  2EPM X;  3TQM A;  1YZ9 A;  5IT9 C;  2EQ1 A;  1BBO A;  3THN A;  4JV5 E;  1X6H A;  1T39 A;  1EH7 A;  2LJU A;  1XMQ E;  4M30 A;  2EOE A;  2YTD A;  2YTG A;  4R8O A;  2MDG A;  3OTO E;  4L5N C;  1WHN A;  2V85 A;  2LV2 A;  3C6K A;  2WCC 3;  1UBD C;  1RC7 A;  4JI0 E;  2LT7 A;  1A1K A;  2EM5 A;  4JI3 E;  3BBG A;  1HNX E;  2V88 A;  2UU9 E;  3HPS A;  4LTY A;  1WHQ A;  5KL4 A;  1J5E E;  2R76 A;  3MSW A;  2YPN A;  2LUQ A;  4KZS A;  2EN6 A;  4R03 A;  1ZBQ A;  3EPL A;  4NXN E;  1SR9 A;  2DLK A;  2YWQ A;  1PDA A;  4OOG C;  2M4I A;  5ADZ A;  1GQE A;  4BHB A;  2EL4 A;  1QU6 A;  3ADL A;  2E72 A;  4GKJ E;  2UUB E;  4X66 E;  3IWB A;  4DR5 E;  1N36 E;  3J81 C;  2EMY A;  2EPK X;  2LE2 A;  2YRH A;  3QG5 C;  2JOX A;  1BB8 A;  4DUZ E;  4WSG A;  3L00 A;  2GPI A;  4IS1 C;  5A6B D;  2YTE A;  2EPR A;  2CT1 A;  1XMO E;  4AQY E;  3P1X A;  3ADJ A;  2ENC A;  2ADR A;  2EPZ A;  3AV0 A;  2HHH E;  2YRM A;  3ADG A;  4YHH E;  2EPA A;  2V83 A;  2YTN A;  2MDR A;  1Z1B A;  4M0V A;  1BBG A;  1ZR9 A;  2N8X A;  2EZ6 A;  4BCA A;  2LO3 A;  2B3T B;  3C4B A;  4L8N A;  5IWA E;  5IV8 B;  5A69 A;  2RS7 A;  4DR3 E;  4DR6 E;  2DLQ A;  4BBY A;  2EMZ A;  1IBK E;  1AH5 A;  5KL5 A;  4DR7 E;  2EOZ A;  2EOI A;  2EMW A;  1STU A;  2EPO A;  2MKD A;  2FGG A;  2L92 A;  1FKA E;  1MEY C;  2M9A A;  4WFT A;  4X65 E;  2KON A;  3BID A;  4JI4 E;  4ZYH A;  2VF1 A;  4R2R A;  2UXC E;  4BS9 A;  3BGH A;  2MKN A;  2RS6 A;  2EMX A;  5AE1 A;  2EPX A;  1JK2 A;  1G2D C;  2PRT A;  2NAB A;  2K4V A;  2EMA A;  3M99 B;  1YYO A;  2YU8 A;  3MHS C;  1X6F A;  2EOQ A;  2KOU A;  4P7D A;  1PKP A;  3ADI A;  2UXD E;  2CTD A;  4WXC A;  2EPN A;  2EOM A;  2YZT A;  2HGH A;  2FTX B;  2JOB A;  4Q35 B;  2JR1 A;  4DKK A;  4DV3 E;  2EP3 A;  2LMZ A;  4N4R B;  2LCE A;  2RTX A;  1WXR A;  2LBS B;  2JYA A;  2L2M A;  4B3M E;  4P78 A;  2EN7 A;  4WSP A;  4M9V C;  3ZOQ B;  1ZU1 A;  4J8Z A;  5F3W A;  2R1F A;  1YSA C;  2EM3 A;  1KJK A;  1FJG E;  1YYW A;  2EN8 A;  5CFF E;  1L4S A;  3UK3 C;  4R2A A;  3JAM C;  4F9B B;  2RQL A;  4DV1 E;  2B9D A;  2LRS A;  2CPN A;  3BF2 A;  4X8W A;  1X47 A;  2JVA A;  4F6N A;  4JYA E;  2EMC A;  1AAY A;  2V89 A;  2EMI A;  2UXB E;  4TUI A;  4B3R E;  3AUZ A;  1YFH A;  1A1I A;  3HTX A;  2HC5 A;  1ZBT A;  4DV5 E;  1SFE A;  4BMJ A;  2V86 A;  2YTI A;  3JU0 A;  3EPK A;  4JI5 E;  4ZYE A;  1PJS A;  3EPH A;  2EM7 A;  1MGT A;  4LFA E;  2F4V E;  4B3T E;  3VYX A;  5A6B A;  4B3S E;  2VQE E;  1JK1 A;  1IBL E;  1B69 A;  1A1H A;  1ZAA C;  4ZYG A;  2EPL X;  4O5G A;  2BBG A;  4F6M A;  2EN3 A;  2I9I A;  4WXD A;  1IQS A;  3J7Y p;  2DSY A;  4NZV A;  1RMD A;  3IWC A;  3HXL A;  5LMU E;  5TSE A;  4BHC A;  4K0K E;  5A6J A;  1DGC A;  1HNZ E;  2LTS A;  5A2Q C;  3LLH A;  2JWO A;  2LTR A;  1A1F A;  2JY9 A;  2JXP A;  5A6K A;  2EN4 A;  4LF5 E;  2EN2 A;  2DMY A;  5LL6 R;  1EKZ A;  1T38 A;  2YRK A;  4O4K A;  4BC7 A;  2H36 X;  4Q28 A;  2EOF A;  4R2D A;  4I8O A;  4FK5 C;  4DV4 E;  1X48 A;  4JI1 E;  4NXM E;  4DV7 E;  3C6M A;  4DR4 E;  4LF8 E;  2K7I A;  1T4N A;  2J7J A;  4IJD A;  1I94 E;  1UIL A;  4DR1 E;  2NUE A;  2ZM6 E;  5FLX C;  2EML A;  2L2K B;  1IBM E;  2EOR A;  3VHT B;  1TF6 A;  2WBT A;  1YYK A;  2EOH A;  2EOX A;  4O43 A;  2B7T A;  1PJT A;  3IWD A;  2KHX A;  4DV2 E;  4NHR A;  4DR2 E;  1XNQ E;  1PJQ A;  2GHF A;  3EQ1 A;  3RMP A;  2LVH A;  3DJW A;  4R2P A;  5DNY A;  4JI6 E;  4MLQ A;  4WYQ B;  3LML A;  2EM0 A;  4HTG A;  1RQ0 A;  4O24 A;  1N34 E;  2G7H A;  4LF6 E;  2YT4 A;  5KL3 A;  1F2I G;  2EPC A;  2N3H A;  3C4T A;  1T4O A;  2BB8 A;  1GZ6 A;  4R2C A;  2ELZ A;  1X5W A;  4F9A B;  2WBU A;  3HPZ A;  2EMG A;  3VYY A;  3T1Y E;  1J26 A;  2EE8 A;  2UUA E;  1X3C A;  4LFC E;  3ECR A;  4M2Z A;  2LUP B; 
#chains in the Genus database with same CATH homology
 2EJ4 A;  2ELY A;  1JK1 A;  4R2S A;  2EM4 A;  1B69 A;  1A1H A;  2YTP A;  1ZAA C;  2EL5 A;  2DLQ A;  2RPC A;  2GLI A;  1UN6 B;  2EMZ A;  4F6M A;  2EN3 A;  5KL5 A;  2EOZ A;  2EOI A;  2EMW A;  3MHH C;  1RMD A;  2WBS A;  2MKD A;  2RSI A;  1LLM C;  2EOS A;  2EQ0 A;  2YTO A;  1A1G A;  2EM8 A;  1DGC A;  1MEY C;  2YTJ A;  2M9A A;  1A1J A;  2YU5 A;  2YTF A;  1A1F A;  2EL6 A;  2EN1 A;  2DRP A;  1TF3 A;  3EPJ A;  2EQ3 A;  2EN4 A;  2EN2 A;  4R2R A;  2EPP A;  2EMK A;  2EM2 A;  2YRK A;  2EQ1 A;  1BBO A;  2MKN A;  2EMX A;  2EPX A;  1X6H A;  1JK2 A;  2EPU A;  1G2D C;  2PRT A;  2NAB A;  2D9H A;  2EOF A;  2EOE A;  2EMA A;  2YTD A;  4R2D A;  3M99 B;  4X9J A;  2YTG A;  2MDG A;  2YU8 A;  3MHS C;  1X6F A;  2EOQ A;  2JP9 A;  4FK5 C;  2LV2 A;  2WCC 3;  1UBD C;  2EM6 A;  1YUJ A;  2LT7 A;  1A1K A;  2EM5 A;  2EOY A;  2EMH A;  2J7J A;  4IJD A;  2CTD A;  1NCS A;  2EML A;  2EOM A;  5KL4 A;  2EOR A;  3VHT B;  2HGH A;  2CSH A;  4R2E A;  1TF6 A;  2JPA A;  2WBT A;  2EN6 A;  2EMB A;  3EPL A;  2EP3 A;  2EOH A;  2EOX A;  2LCE A;  1G2F C;  2DLK A;  2ENA A;  2DMI A;  2EM9 A;  2EL4 A;  2EN7 A;  4M9V C;  1A1L A;  1ZU1 A;  2E72 A;  2GHF A;  1TN9 A;  2R1F A;  2LVH A;  1YSA C;  4R2P A;  2EM3 A;  1KJK A;  2EOO A;  2EMY A;  2EN8 A;  5KL6 A;  4GZN C;  3UK3 C;  2EM0 A;  2YRH A;  4R2A A;  1YUI A;  1X6E A;  4R2Q A;  1BB8 A;  4F2J C;  2I13 A;  4WSG A;  5KL2 A;  4IS1 C;  2EOJ A;  4F6N A;  2YTE A;  2EPR A;  2YTQ A;  2CT1 A;  5KL3 A;  1F2I G;  2EMF A;  2EMC A;  2YSP A;  2EPC A;  1AAY A;  2EMI A;  2BB8 A;  2ENC A;  4R2C A;  2ELZ A;  1X5W A;  2ADR A;  1A1I A;  2WBU A;  2DGC A;  2EPZ A;  2EMG A;  2YRM A;  1P47 A;  2EPA A;  2A25 A;  2YTN A;  2YTI A;  3EPK A;  2EE8 A;  2ENH A;  1Z1B A;  2VRD A;  1WJP A;  1ZR9 A;  1X3C A;  2LO3 A;  5KL7 A;  2YSO A;  3EPH A;  2EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...