2YTJA

Solution structure of the c2h2 type zinc finger (region 771-803) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYICAECGKAFTIRSNLIKHQKIHTKQKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 771-803) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytjA01
1JK2A 1BBOA 3EPJA 2EN1A 2EQ3A 2EOOA 1YSAC 1ZAAC 2YRMA 2DLKA 2EMWA 1TN9A 2PRTA 2EOIA 5KL3A 4F2JC 2JP9A 1Z1BA 2EOJA 2YTIA 2WBTA 1JK1A 2YRHA 2EM0A 5KL2A 2LT7A 4R2PA 2RSIA 2YU5A 2DLQA 2NABA 2ELZA 2EL4A 2YTFA 4IJDA 2EJ4A 2EMGA 4R2CA 1LLMC 2EE8A 2EM3A 4WSGA 2EN4A 4R2RA 2ELYA 2DGCA 1A1IA 3MHHC 2EM9A 2WCC3 2ADRA 4R2DA 2EOFA 1A1LA 1YUJA 2DRPA 2EN6A 2MKNA 1X3CA 2EP3A 2EPUA 2YSPA 2R1FA 2JPAA 2LVHA 1TF3A 2YTGA 2EM4A 2EN2A 4F6MA 2EMCA 4GZNC 1BB8A 1X6HA 2MKDA 2EMKA 2RPCA 5KL5A 2EM6A 2EOHA 2MDGA 3M99B 2EOXA 2BB8A 2EPPA 5KL7A 2VRDA 4R2AA 2CT1A 2EPCA 2E72A 1ZR9A 2YTEA 2LCEA 2GLIA 1X6EA 2EPRA 1TF6A 4X9JA 1UN6B 2WBSA 1A1KA 2EOMA 4R2EA 1WJPA 2EMLA 2YTNA 2EMHA 2EM7A 4IS1C 5KL4A 2EQ1A 3UK3C 4F6NA 1DGCA 2EOQA 2YRKA 2EL5A 2EPXA 2D9HA 1G2DC 2EM2A 2YSOA 1UBDC 4FK5C 1A1FA 2EN7A 1YUIA 2EOYA 1X6FA 2HGHA 1ZU1A 2I13A 2EMBA 2YTPA 3VHTB 4R2SA 2YTJA 3EPKA 1A1HA 1B69A 2A25A 2ENCA 2EOZA 2EPZA 2LV2A 2M9AA 1X5WA 2YU8A 2CTDA 1A1JA 2EL6A 2EMXA 2ENAA 1AAYA 2EQ0A 2CSHA 5KL6A 2ENHA 2EM5A 2EORA 3MHSC 2EN8A 1A1GA 2YTDA 1NCSA 1KJKA 2EMIA 2YTQA 1F2IG 2EMYA 2WBUA 4M9VC 3EPLA 1G2FC 1MEYC 2EM8A 1RMDA 4R2QA 2EOEA 3EPHA 2EN3A 2LO3A 1P47A 2YTOA 2EOSA 2J7JA 2EMAA 2GHFA 2DMIA 2EPAA 2EMFA 2EMZA
chains in the Genus database with same CATH superfamily
2B3TB 1IBLE 4WXDA 2UU9E 2L8TA 5A69A 1YSAC 2NUFA 4K0KE 2EMWA 2EPNA 2UUAE 5KL3A 2N8XA 4DV5E 1JK1A 1N36E 2DLQA 2YT4A 2NABA 2K7IA 4R2CA 4DKKA 2EM3A 2EN4A 2UXDE 2UXBE 4R2RA 1RQ0A 2DIXA 1A1IA 4Q35B 4P78A 2ADRA 4R2DA 1EH8A 2HJJA 4X65E 2DRPA 2EPUA 2R1FA 4LU9A 2EPMX 2M7QA 2F4VE 2EN2A 2EMCA 3AUZA 4ZYDA 3IWDA 4MLQA 2RPCA 1DQ3A 2L2MA 5IWAE 4JI3E 2JXPA 4YY3E 4B3ME 4O4KA 3K6QA 2L33A 4R8OA 1X47A 4F9AB 4O24A 1NEIA 1UN6B 4NXNE 1A1KA 3ADJA 4KHPE 4BHBA 5KL4A 2YRKA 4M30A 2EL5A 1XNRE 2EPLX 2EM2A 1UBDC 3J80C 1T39A 4FK5C 1A1FA 3L00A 2YPNA 1X6FA 5TSEA 1ZU1A 2I13A 2HC5A 1B69A 1XMQE 2LRSA 4WFTA 2Q8UA 2MC5A 2YU8A 2MC6A 2JVAA 5AC4A 4BBYA 4GEQB 2ENAA 4I8OA 2EQ0A 2R76A 2ENHA 2EM5A 4WPYA 1J26A 5CFFE 2JYAA 3HXLA 2EN8A 1A1GA 4X8WA 1KJKA 2EMIA 2YTQA 4LF8E 2JOBA 3HPZA 2M4IA 4R2QA 2RS6A 1FKAE 2V89A 2JOXA 1P47A 2YTOA 2UUCE 1GTKA 3VYYA 4X66E 5F3WA 2YRMA 3DF6A 2DLKA 1TN9A 5T6JA 4DR7E 4X62E 2YWQA 1BBGA 3EQ1A 5IV8B 2YTIA 2L3CA 2LUQA 4JI2E 4J8ZA 1RC7A 4DMIA 2DSYA 2RSIA 3OMLA 1SFEA 2JY9A 3VYXA 1T4NA 2EL4A 2YTFA 2EJ4A 2EE8A 4WSGA 2BBGA 2EPKX 3F6HA 4DV4E 4F54A 3ADGA 4BS9A 5A6BD 4DV1E 2FTXB 2HHHE 2E1MA 3MSWA 4DV2E 1T4LB 1YUJA 1A1LA 2VF1A 2EN6A 3THOB 3ADLA 2EP3A 2ODRC 2YSPA 1YZ9A 1YYOA 2YTGA 2M1SA 3F6GA 1BB8A 5IXMB 5LLQA 2I9IA 2IHR1 4LTYA 1N34E 2RSMA 2EOHA 1IQSA 2L2NA 3BBGA 2VRDA 4JI0E 2L2KB 3C6KA 2CT1A 2EPCA 1ZR9A 1HNXE 3BGHA 3QG5C 1TF6A 4LF7E 4B3RE 1QNTA 2YZTA 2EMLA 2LJUA 4WX9A 2KONA 1HNZE 1IBME 2L6MA 4BC7A 5LMNE 4IS1C 5IT9C 1PJQA 2B7VA 2EQ1A 3UK3C 2EOQA 4LF6E 5DNYA 2N3HA 2EN7A 2ODRD 2EOYA 4LFBE 1A1HA 4F9BB 2RS7A 1QU6A 2EOZA 4LFAE 5FLXC 5ADZA 2LMZA 3C4TA 1DI2A 2CTDA 4WSPA 2LJHA 1AAYA 3BF2A 2CSHA 1J5EE 2EORA 2V8QB 1WHQA 2UUBE 3BIDA 1YYKA 4GKJE 2JR1A 4BMJA 1F2IG 2EMYA 2WBUA 1WRJA 1G2FC 1MEYC 1HNWE 4RH8A 2B7TA 2EOEA 4DV0E 3JAMC 4DR5E 3IWBA 2EOSA 4TUGA 2EMAA 2GHFA 3ZOQB 2LUPB 2EQ3A 2EOOA 4YHHE 1FJGE 4DR4E 2PRTA 4B3SE 2EOIA 1Z1BA 4JYAE 4ZYGA 2FGGA 2YRHA 3TQMA 4GKKE 3ADIA 2EM0A 2LT7A 4R2PA 3HPSA 2YU5A 3KWRA 4R03A 5A6AA 4JI5E 4DV6E 2V88A 2GPIA 4MLVA 1LLMC 2LTRA 3LLHA 4LF4E 4JI1E 4NHRA 2EWLA 2DGCA 4OX9E 3AV0A 3MHHC 2FV4B 4DR1E 2WCC3 1MGTA 2MKNA 4JV5E 1X3CA 2V85A 4B3TE 2EZ6A 2CPNA 2LVHA 1TF3A 2NUEA 5BR8E 4F6MA 4P7DA 2MKDA 1GZ6A 1ZBTA 2EMKA 1X48A 5LMUE 2EM6A 2F8BA 2MDGA 2EOXA 2EPPA 3J7Yp 1T4OA 2ZM6E 2RTXA 2N3GA 1WXRA 2LCEA 3LMLA 2EPRA 2WBSA 1KYQA 1WJPA 4F9CB 2EMHA 2V86A 4O43A 2EM7A 4DR2E 3KZYA 1DGCA 4LFCE 4HEIA 1L4SA 2EPXA 2D9HA 2YSOA 1YUIA 2HGHA 2EMBA 2YTPA 3VHTB 4R2SA 2YTJA 4O5GA 2A25A 3HQ1A 4AQYE 2EPZA 1X5WA 4N4RB 1IMUA 1A1JA 1XMOE 2E5LE 4JI7E 3C6MA 1T38A 3MHSC 1WHNA 1EKZA 2VE7C 4JI8E 2WZOA 2EPOA 3EPLA 3J81C 1PKPA 1RMDA 3FIGA 1EH7A 4ZYEA 1N3GA 1YPNA 1PJTA 4LF5E 3J7AG 3JTZA 5LL6R 4NXME 2EPAA 2EMZA 3IWCA 1JK2A 1BBOA 3EPJA 1YYWA 2EN1A 5A6BA 4DV7E 2JWOA 4L5NC 1ZAAC 2LBSB 3DJWA 2G7HA 1XNQE 4DR3E 4TUIA 1YFHA 4F2JC 5AE2A 2L3JA 2DB2A 2JP9A 1PDAA 2NUGA 2EOJA 2V83A 2WBTA 2MDRA 5KL2A 4WYQB 3KZZA 4JI6E 2ELZA 5A6KA 3T1YE 4IJDA 2EMGA 3VK6A 2LE2A 4KWYA 3HTXA 2ELYA 3OTOE 1STUA 4OOGC 4M2ZA 2EM9A 1O0WA 2EOFA 2DMYA 5AC5A 2JPAA 3ECRA 2KOUA 2EM4A 2LTSA 1X49A 4GZNC 1HR0E 4NZVA 1X6HA 4LF9E 2K4VA 4BHCA 5KL5A 3M99B 4ZYHA 4DR6E 2H36X 2UXCE 2BB8A 5KL7A 4R2AA 4Q28A 1EH6A 4KZSA 2E72A 2YTEA 3JU0A 3T1HE 2GLIA 1X6EA 4X9JA 1I94E 1UILA 2EOMA 4R2EA 5AASA 2YTNA 1AH5A 3RMPA 4F6NA 5A2QC 1SR9A 1G2DC 3P1XA 4BCAA 2B9DA 3EPKA 1IQOA 5AE1A 4L8NA 4JI4E 2ENCA 2KHXA 4HTGA 2VQFE 2LV2A 2M9AA 4RHBB 4DUZE 4WXCA 4X64E 2EL6A 2EMXA 2NA2A 1IBKE 1UHZA 5KL6A 4DUYE 1N33E 3THNA 5A6JA 1PJSA 2YTDA 1NCSA 2VQEE 2RQLA 1ZBQA 1GQEA 4M0VA 4BC9A 4M9VC 1N32E 2EM8A 2V87A 3C4BA 3EPHA 2EN3A 3H09A 2LO3A 2L92A 4DV3E 2J7JA 2DMIA 5AE3A 2EMFA
chains in the Genus database with same CATH topology
1JK2A 1BBOA 3EPJA 2EN1A 2EQ3A 2EOOA 1YSAC 1ZAAC 2YRMA 2DLKA 2EMWA 1TN9A 2PRTA 2EOIA 5KL3A 4F2JC 2JP9A 1Z1BA 2EOJA 2YTIA 2WBTA 1JK1A 2YRHA 2EM0A 5KL2A 2LT7A 4R2PA 2RSIA 2YU5A 2DLQA 2NABA 2ELZA 2EL4A 2YTFA 4IJDA 2EJ4A 2EMGA 4R2CA 1LLMC 2EE8A 2EM3A 4WSGA 2EN4A 4R2RA 2ELYA 2DGCA 1A1IA 3MHHC 2EM9A 2WCC3 2ADRA 4R2DA 2EOFA 1A1LA 1YUJA 2DRPA 2EN6A 2MKNA 1X3CA 2EP3A 2EPUA 2YSPA 2R1FA 2JPAA 2LVHA 1TF3A 2YTGA 2EM4A 2EN2A 4F6MA 2EMCA 4GZNC 1BB8A 1X6HA 2MKDA 2EMKA 2RPCA 5KL5A 2EM6A 2EOHA 2MDGA 3M99B 2EOXA 2BB8A 2EPPA 5KL7A 2VRDA 4R2AA 2CT1A 2EPCA 2E72A 1ZR9A 2YTEA 2LCEA 2GLIA 1X6EA 2EPRA 1TF6A 4X9JA 1UN6B 2WBSA 1A1KA 2EOMA 4R2EA 1WJPA 2EMLA 2YTNA 2EMHA 2EM7A 4IS1C 5KL4A 2EQ1A 3UK3C 4F6NA 1DGCA 2EOQA 2YRKA 2EL5A 2EPXA 2D9HA 1G2DC 2EM2A 2YSOA 1UBDC 4FK5C 1A1FA 2EN7A 1YUIA 2EOYA 1X6FA 2HGHA 1ZU1A 2I13A 2EMBA 2YTPA 3VHTB 4R2SA 2YTJA 3EPKA 1A1HA 1B69A 2A25A 2ENCA 2EOZA 2EPZA 2LV2A 2M9AA 1X5WA 2YU8A 2CTDA 1A1JA 2EL6A 2EMXA 2ENAA 1AAYA 2EQ0A 2CSHA 5KL6A 2ENHA 2EM5A 2EORA 3MHSC 2EN8A 1A1GA 2YTDA 1NCSA 1KJKA 2EMIA 2YTQA 1F2IG 2EMYA 2WBUA 4M9VC 3EPLA 1G2FC 1MEYC 2EM8A 1RMDA 4R2QA 2EOEA 3EPHA 2EN3A 2LO3A 1P47A 2YTOA 2EOSA 2J7JA 2EMAA 2GHFA 2DMIA 2EPAA 2EMFA 2EMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK2 A;  1BBO A;  3EPJ A;  2EN1 A;  2EQ3 A;  2EOO A;  1YSA C;  1ZAA C;  2YRM A;  2DLK A;  2EMW A;  1TN9 A;  2PRT A;  2EOI A;  5KL3 A;  4F2J C;  2JP9 A;  1Z1B A;  2EOJ A;  2YTI A;  2WBT A;  1JK1 A;  2YRH A;  2EM0 A;  5KL2 A;  2LT7 A;  4R2P A;  2RSI A;  2YU5 A;  2DLQ A;  2NAB A;  2ELZ A;  2EL4 A;  2YTF A;  4IJD A;  2EJ4 A;  2EMG A;  4R2C A;  1LLM C;  2EE8 A;  2EM3 A;  4WSG A;  2EN4 A;  4R2R A;  2ELY A;  2DGC A;  1A1I A;  3MHH C;  2EM9 A;  2WCC 3;  2ADR A;  4R2D A;  2EOF A;  1A1L A;  1YUJ A;  2DRP A;  2EN6 A;  2MKN A;  1X3C A;  2EP3 A;  2EPU A;  2YSP A;  2R1F A;  2JPA A;  2LVH A;  1TF3 A;  2YTG A;  2EM4 A;  2EN2 A;  4F6M A;  2EMC A;  4GZN C;  1BB8 A;  1X6H A;  2MKD A;  2EMK A;  2RPC A;  5KL5 A;  2EM6 A;  2EOH A;  2MDG A;  3M99 B;  2EOX A;  2BB8 A;  2EPP A;  5KL7 A;  2VRD A;  4R2A A;  2CT1 A;  2EPC A;  2E72 A;  1ZR9 A;  2YTE A;  2LCE A;  2GLI A;  1X6E A;  2EPR A;  1TF6 A;  4X9J A;  1UN6 B;  2WBS A;  1A1K A;  2EOM A;  4R2E A;  1WJP A;  2EML A;  2YTN A;  2EMH A;  2EM7 A;  4IS1 C;  5KL4 A;  2EQ1 A;  3UK3 C;  4F6N A;  1DGC A;  2EOQ A;  2YRK A;  2EL5 A;  2EPX A;  2D9H A;  1G2D C;  2EM2 A;  2YSO A;  1UBD C;  4FK5 C;  1A1F A;  2EN7 A;  1YUI A;  2EOY A;  1X6F A;  2HGH A;  1ZU1 A;  2I13 A;  2EMB A;  2YTP A;  3VHT B;  4R2S A;  2YTJ A;  3EPK A;  1A1H A;  1B69 A;  2A25 A;  2ENC A;  2EOZ A;  2EPZ A;  2LV2 A;  2M9A A;  1X5W A;  2YU8 A;  2CTD A;  1A1J A;  2EL6 A;  2EMX A;  2ENA A;  1AAY A;  2EQ0 A;  2CSH A;  5KL6 A;  2ENH A;  2EM5 A;  2EOR A;  3MHS C;  2EN8 A;  1A1G A;  2YTD A;  1NCS A;  1KJK A;  2EMI A;  2YTQ A;  1F2I G;  2EMY A;  2WBU A;  4M9V C;  3EPL A;  1G2F C;  1MEY C;  2EM8 A;  1RMD A;  4R2Q A;  2EOE A;  3EPH A;  2EN3 A;  2LO3 A;  1P47 A;  2YTO A;  2EOS A;  2J7J A;  2EMA A;  2GHF A;  2DMI A;  2EPA A;  2EMF A;  2EMZ A; 
#chains in the Genus database with same CATH topology
 2B3T B;  1IBL E;  4WXD A;  2UU9 E;  2L8T A;  5A69 A;  1YSA C;  2NUF A;  4K0K E;  2EMW A;  2EPN A;  2UUA E;  5KL3 A;  2N8X A;  4DV5 E;  1JK1 A;  1N36 E;  2DLQ A;  2YT4 A;  2NAB A;  2K7I A;  4R2C A;  4DKK A;  2EM3 A;  2EN4 A;  2UXD E;  2UXB E;  4R2R A;  1RQ0 A;  2DIX A;  1A1I A;  4Q35 B;  4P78 A;  2ADR A;  4R2D A;  1EH8 A;  2HJJ A;  4X65 E;  2DRP A;  2EPU A;  2R1F A;  4LU9 A;  2EPM X;  2M7Q A;  2F4V E;  2EN2 A;  2EMC A;  3AUZ A;  4ZYD A;  3IWD A;  4MLQ A;  2RPC A;  1DQ3 A;  2L2M A;  5IWA E;  4JI3 E;  2JXP A;  4YY3 E;  4B3M E;  4O4K A;  3K6Q A;  2L33 A;  4R8O A;  1X47 A;  4F9A B;  4O24 A;  1NEI A;  1UN6 B;  4NXN E;  1A1K A;  3ADJ A;  4KHP E;  4BHB A;  5KL4 A;  2YRK A;  4M30 A;  2EL5 A;  1XNR E;  2EPL X;  2EM2 A;  1UBD C;  3J80 C;  1T39 A;  4FK5 C;  1A1F A;  3L00 A;  2YPN A;  1X6F A;  5TSE A;  1ZU1 A;  2I13 A;  2HC5 A;  1B69 A;  1XMQ E;  2LRS A;  4WFT A;  2Q8U A;  2MC5 A;  2YU8 A;  2MC6 A;  2JVA A;  5AC4 A;  4BBY A;  4GEQ B;  2ENA A;  4I8O A;  2EQ0 A;  2R76 A;  2ENH A;  2EM5 A;  4WPY A;  1J26 A;  5CFF E;  2JYA A;  3HXL A;  2EN8 A;  1A1G A;  4X8W A;  1KJK A;  2EMI A;  2YTQ A;  4LF8 E;  2JOB A;  3HPZ A;  2M4I A;  4R2Q A;  2RS6 A;  1FKA E;  2V89 A;  2JOX A;  1P47 A;  2YTO A;  2UUC E;  1GTK A;  3VYY A;  4X66 E;  5F3W A;  2YRM A;  3DF6 A;  2DLK A;  1TN9 A;  5T6J A;  4DR7 E;  4X62 E;  2YWQ A;  1BBG A;  3EQ1 A;  5IV8 B;  2YTI A;  2L3C A;  2LUQ A;  4JI2 E;  4J8Z A;  1RC7 A;  4DMI A;  2DSY A;  2RSI A;  3OML A;  1SFE A;  2JY9 A;  3VYX A;  1T4N A;  2EL4 A;  2YTF A;  2EJ4 A;  2EE8 A;  4WSG A;  2BBG A;  2EPK X;  3F6H A;  4DV4 E;  4F54 A;  3ADG A;  4BS9 A;  5A6B D;  4DV1 E;  2FTX B;  2HHH E;  2E1M A;  3MSW A;  4DV2 E;  1T4L B;  1YUJ A;  1A1L A;  2VF1 A;  2EN6 A;  3THO B;  3ADL A;  2EP3 A;  2ODR C;  2YSP A;  1YZ9 A;  1YYO A;  2YTG A;  2M1S A;  3F6G A;  1BB8 A;  5IXM B;  5LLQ A;  2I9I A;  2IHR 1;  4LTY A;  1N34 E;  2RSM A;  2EOH A;  1IQS A;  2L2N A;  3BBG A;  2VRD A;  4JI0 E;  2L2K B;  3C6K A;  2CT1 A;  2EPC A;  1ZR9 A;  1HNX E;  3BGH A;  3QG5 C;  1TF6 A;  4LF7 E;  4B3R E;  1QNT A;  2YZT A;  2EML A;  2LJU A;  4WX9 A;  2KON A;  1HNZ E;  1IBM E;  2L6M A;  4BC7 A;  5LMN E;  4IS1 C;  5IT9 C;  1PJQ A;  2B7V A;  2EQ1 A;  3UK3 C;  2EOQ A;  4LF6 E;  5DNY A;  2N3H A;  2EN7 A;  2ODR D;  2EOY A;  4LFB E;  1A1H A;  4F9B B;  2RS7 A;  1QU6 A;  2EOZ A;  4LFA E;  5FLX C;  5ADZ A;  2LMZ A;  3C4T A;  1DI2 A;  2CTD A;  4WSP A;  2LJH A;  1AAY A;  3BF2 A;  2CSH A;  1J5E E;  2EOR A;  2V8Q B;  1WHQ A;  2UUB E;  3BID A;  1YYK A;  4GKJ E;  2JR1 A;  4BMJ A;  1F2I G;  2EMY A;  2WBU A;  1WRJ A;  1G2F C;  1MEY C;  1HNW E;  4RH8 A;  2B7T A;  2EOE A;  4DV0 E;  3JAM C;  4DR5 E;  3IWB A;  2EOS A;  4TUG A;  2EMA A;  2GHF A;  3ZOQ B;  2LUP B;  2EQ3 A;  2EOO A;  4YHH E;  1FJG E;  4DR4 E;  2PRT A;  4B3S E;  2EOI A;  1Z1B A;  4JYA E;  4ZYG A;  2FGG A;  2YRH A;  3TQM A;  4GKK E;  3ADI A;  2EM0 A;  2LT7 A;  4R2P A;  3HPS A;  2YU5 A;  3KWR A;  4R03 A;  5A6A A;  4JI5 E;  4DV6 E;  2V88 A;  2GPI A;  4MLV A;  1LLM C;  2LTR A;  3LLH A;  4LF4 E;  4JI1 E;  4NHR A;  2EWL A;  2DGC A;  4OX9 E;  3AV0 A;  3MHH C;  2FV4 B;  4DR1 E;  2WCC 3;  1MGT A;  2MKN A;  4JV5 E;  1X3C A;  2V85 A;  4B3T E;  2EZ6 A;  2CPN A;  2LVH A;  1TF3 A;  2NUE A;  5BR8 E;  4F6M A;  4P7D A;  2MKD A;  1GZ6 A;  1ZBT A;  2EMK A;  1X48 A;  5LMU E;  2EM6 A;  2F8B A;  2MDG A;  2EOX A;  2EPP A;  3J7Y p;  1T4O A;  2ZM6 E;  2RTX A;  2N3G A;  1WXR A;  2LCE A;  3LML A;  2EPR A;  2WBS A;  1KYQ A;  1WJP A;  4F9C B;  2EMH A;  2V86 A;  4O43 A;  2EM7 A;  4DR2 E;  3KZY A;  1DGC A;  4LFC E;  4HEI A;  1L4S A;  2EPX A;  2D9H A;  2YSO A;  1YUI A;  2HGH A;  2EMB A;  2YTP A;  3VHT B;  4R2S A;  2YTJ A;  4O5G A;  2A25 A;  3HQ1 A;  4AQY E;  2EPZ A;  1X5W A;  4N4R B;  1IMU A;  1A1J A;  1XMO E;  2E5L E;  4JI7 E;  3C6M A;  1T38 A;  3MHS C;  1WHN A;  1EKZ A;  2VE7 C;  4JI8 E;  2WZO A;  2EPO A;  3EPL A;  3J81 C;  1PKP A;  1RMD A;  3FIG A;  1EH7 A;  4ZYE A;  1N3G A;  1YPN A;  1PJT A;  4LF5 E;  3J7A G;  3JTZ A;  5LL6 R;  4NXM E;  2EPA A;  2EMZ A;  3IWC A;  1JK2 A;  1BBO A;  3EPJ A;  1YYW A;  2EN1 A;  5A6B A;  4DV7 E;  2JWO A;  4L5N C;  1ZAA C;  2LBS B;  3DJW A;  2G7H A;  1XNQ E;  4DR3 E;  4TUI A;  1YFH A;  4F2J C;  5AE2 A;  2L3J A;  2DB2 A;  2JP9 A;  1PDA A;  2NUG A;  2EOJ A;  2V83 A;  2WBT A;  2MDR A;  5KL2 A;  4WYQ B;  3KZZ A;  4JI6 E;  2ELZ A;  5A6K A;  3T1Y E;  4IJD A;  2EMG A;  3VK6 A;  2LE2 A;  4KWY A;  3HTX A;  2ELY A;  3OTO E;  1STU A;  4OOG C;  4M2Z A;  2EM9 A;  1O0W A;  2EOF A;  2DMY A;  5AC5 A;  2JPA A;  3ECR A;  2KOU A;  2EM4 A;  2LTS A;  1X49 A;  4GZN C;  1HR0 E;  4NZV A;  1X6H A;  4LF9 E;  2K4V A;  4BHC A;  5KL5 A;  3M99 B;  4ZYH A;  4DR6 E;  2H36 X;  2UXC E;  2BB8 A;  5KL7 A;  4R2A A;  4Q28 A;  1EH6 A;  4KZS A;  2E72 A;  2YTE A;  3JU0 A;  3T1H E;  2GLI A;  1X6E A;  4X9J A;  1I94 E;  1UIL A;  2EOM A;  4R2E A;  5AAS A;  2YTN A;  1AH5 A;  3RMP A;  4F6N A;  5A2Q C;  1SR9 A;  1G2D C;  3P1X A;  4BCA A;  2B9D A;  3EPK A;  1IQO A;  5AE1 A;  4L8N A;  4JI4 E;  2ENC A;  2KHX A;  4HTG A;  2VQF E;  2LV2 A;  2M9A A;  4RHB B;  4DUZ E;  4WXC A;  4X64 E;  2EL6 A;  2EMX A;  2NA2 A;  1IBK E;  1UHZ A;  5KL6 A;  4DUY E;  1N33 E;  3THN A;  5A6J A;  1PJS A;  2YTD A;  1NCS A;  2VQE E;  2RQL A;  1ZBQ A;  1GQE A;  4M0V A;  4BC9 A;  4M9V C;  1N32 E;  2EM8 A;  2V87 A;  3C4B A;  3EPH A;  2EN3 A;  3H09 A;  2LO3 A;  2L92 A;  4DV3 E;  2J7J A;  2DMI A;  5AE3 A;  2EMF A; 
#chains in the Genus database with same CATH homology
 1JK2 A;  1BBO A;  3EPJ A;  2EN1 A;  2EQ3 A;  2EOO A;  1YSA C;  1ZAA C;  2YRM A;  2DLK A;  2EMW A;  1TN9 A;  2PRT A;  2EOI A;  5KL3 A;  4F2J C;  2JP9 A;  1Z1B A;  2EOJ A;  2YTI A;  2WBT A;  1JK1 A;  2YRH A;  2EM0 A;  5KL2 A;  2LT7 A;  4R2P A;  2RSI A;  2YU5 A;  2DLQ A;  2NAB A;  2ELZ A;  2EL4 A;  2YTF A;  4IJD A;  2EJ4 A;  2EMG A;  4R2C A;  1LLM C;  2EE8 A;  2EM3 A;  4WSG A;  2EN4 A;  4R2R A;  2ELY A;  2DGC A;  1A1I A;  3MHH C;  2EM9 A;  2WCC 3;  2ADR A;  4R2D A;  2EOF A;  1A1L A;  1YUJ A;  2DRP A;  2EN6 A;  2MKN A;  1X3C A;  2EP3 A;  2EPU A;  2YSP A;  2R1F A;  2JPA A;  2LVH A;  1TF3 A;  2YTG A;  2EM4 A;  2EN2 A;  4F6M A;  2EMC A;  4GZN C;  1BB8 A;  1X6H A;  2MKD A;  2EMK A;  2RPC A;  5KL5 A;  2EM6 A;  2EOH A;  2MDG A;  3M99 B;  2EOX A;  2BB8 A;  2EPP A;  5KL7 A;  2VRD A;  4R2A A;  2CT1 A;  2EPC A;  2E72 A;  1ZR9 A;  2YTE A;  2LCE A;  2GLI A;  1X6E A;  2EPR A;  1TF6 A;  4X9J A;  1UN6 B;  2WBS A;  1A1K A;  2EOM A;  4R2E A;  1WJP A;  2EML A;  2YTN A;  2EMH A;  2EM7 A;  4IS1 C;  5KL4 A;  2EQ1 A;  3UK3 C;  4F6N A;  1DGC A;  2EOQ A;  2YRK A;  2EL5 A;  2EPX A;  2D9H A;  1G2D C;  2EM2 A;  2YSO A;  1UBD C;  4FK5 C;  1A1F A;  2EN7 A;  1YUI A;  2EOY A;  1X6F A;  2HGH A;  1ZU1 A;  2I13 A;  2EMB A;  2YTP A;  3VHT B;  4R2S A;  2YTJ A;  3EPK A;  1A1H A;  1B69 A;  2A25 A;  2ENC A;  2EOZ A;  2EPZ A;  2LV2 A;  2M9A A;  1X5W A;  2YU8 A;  2CTD A;  1A1J A;  2EL6 A;  2EMX A;  2ENA A;  1AAY A;  2EQ0 A;  2CSH A;  5KL6 A;  2ENH A;  2EM5 A;  2EOR A;  3MHS C;  2EN8 A;  1A1G A;  2YTD A;  1NCS A;  1KJK A;  2EMI A;  2YTQ A;  1F2I G;  2EMY A;  2WBU A;  4M9V C;  3EPL A;  1G2F C;  1MEY C;  2EM8 A;  1RMD A;  4R2Q A;  2EOE A;  3EPH A;  2EN3 A;  2LO3 A;  1P47 A;  2YTO A;  2EOS A;  2J7J A;  2EMA A;  2GHF A;  2DMI A;  2EPA A;  2EMF A;  2EMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...