1UBDC

Co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*TP*CP*TP*CP*CP*AP*TP*TP*TP*TP*GP*AP*A
publication title Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC01
1Z1BA 4R2AA 2WBSA 1ZR9A 2YTFA 1YUIA 2EQ3A 2EOMA 1NCSA 1UN6B 2VRDA 2I13A 2LV2A 2JP9A 2YTIA 4F2JC 4R2SA 2EMLA 4FK5C 2PRTA 2ENCA 2YRHA 1JK1A 2EM6A 1YSAC 2EMWA 2EJ4A 2EMAA 2YTQA 2EPXA 2E72A 2EMZA 2YRKA 2EM2A 3EPKA 2EN3A 2YU8A 2ENHA 5KL4A 1A1LA 2EE8A 2CTDA 2JPAA 4R2RA 2LCEA 2LO3A 5KL6A 4R2DA 2EL5A 1UBDC 1DGCA 1X6FA 4R2PA 1A1KA 2EM8A 1X5WA 2EP3A 2EMFA 2LVHA 1G2FC 1A1HA 3VHTB 2EMGA 2WBTA 1A1FA 1A1IA 2CSHA 2DLQA 1A1JA 2HGHA 1ZAAC 2EN8A 2YTNA 2GHFA 1WJPA 2DMIA 2EMHA 2YTOA 2YRMA 2EOEA 2ELYA 2EOHA 1MEYC 2MDGA 2RPCA 2EM7A 2DRPA 2EPUA 1ZU1A 2R1FA 2YSPA 2MKDA 4X9JA 2EOJA 4R2QA 1BBOA 2EPPA 2MKNA 1X6EA 2EMKA 2EOXA 1LLMC 2EM0A 2EN2A 2ELZA 2EOQA 2EOIA 3EPHA 2EN7A 1A1GA 2EQ0A 2YTJA 2WBUA 2ADRA 2YTGA 3M99B 3EPLA 3UK3C 2EMIA 2D9HA 2EPZA 2DGCA 1F2IG 2A25A 2EM9A 2YSOA 2M9AA 4WSGA 2LT7A 4F6NA 2YTPA 5KL3A 4M9VC 5KL5A 1X3CA 3EPJA 1X6HA 1P47A 2EM4A 4IJDA 2EL4A 1B69A 2EPRA 2EPCA 4F6MA 2EMXA 2EMCA 4R2CA 2EOFA 1TF6A 2ENAA 2YTDA 2YTEA 2EM3A 2EOYA 5KL2A 2J7JA 4GZNC 4R2EA 2EQ1A 2EMYA 2EN1A 2GLIA 2EL6A 1G2DC 2EN6A 1YUJA 2EOZA 2NABA 1KJKA 2EMBA 3MHHC 1BB8A 2BB8A 1JK2A 2DLKA 5KL7A 4IS1C 2CT1A 1RMDA 2EN4A 2EOSA 2EOOA 1AAYA 2EPAA 2EM5A 2RSIA 2YU5A 3MHSC 2WCC3 1TF3A 2EORA 1TN9A
chains in the Genus database with same CATH superfamily
2YWQA 2YPNA 4N4RB 2YTFA 1J5EE 4NZVA 4DR7E 4O24A 4BC9A 5DNYA 4JI3E 2LV2A 1SR9A 2LRSA 2EMLA 4BS9A 1XMOE 4WYQB 1HNZE 2M1SA 2PRTA 2ENCA 5AASA 1JK1A 1IQOA 2H36X 2EM6A 2EMWA 4KWYA 1WXRA 2UUAE 2M4IA 4DR4E 2V86A 2NUEA 4ZYHA 2EWLA 2YU8A 4GKJE 2CTDA 2L8TA 4DV3E 3HQ1A 5A2QC 4R2RA 2LO3A 1EH8A 5AE3A 1DGCA 2FV4B 4R2PA 1A1KA 2V87A 1DI2A 4DUZE 4Q28A 2N8XA 2G7HA 5A6BD 4M0VA 1T4LB 1STUA 2B9DA 2HGHA 1ZAAC 2YTNA 2YRMA 2VQFE 5IT9C 1MEYC 4DKKA 2E5LE 1N32E 1IQSA 1WRJA 4X9JA 2FTXB 2EOIA 2HJJA 2EN7A 1A1GA 2EQ0A 2YTJA 2WBUA 4M2ZA 4KHPE 1RQ0A 3UK3C 4LFCE 2D9HA 4JI1E 2EPZA 5A6BA 4JI8E 4ZYDA 2M9AA 4WSGA 2LT7A 1PJTA 2YTPA 3F6HA 5KL3A 3EPJA 1GZ6A 1X6HA 5FLXC 2UUBE 2EMCA 4WXCA 2L2MA 2ENAA 2YTDA 3C4TA 4DV7E 2UU9E 4O43A 2ODRD 4WXDA 2UXCE 2GLIA 2LJUA 2N3HA 2EZ6A 1QU6A 3T1YE 2KOUA 4YHHE 3AV0A 5A6JA 1AAYA 4LF7E 4JI7E 4DV2E 1EH6A 4R2AA 1RC7A 3LMLA 1ZR9A 1XNRE 2VE7C 1XNQE 2EOMA 1J26A 2VRDA 2I13A 4J8ZA 4F54A 2JXPA 4X66E 4F2JC 2UXDE 2Q8UA 4L5NC 3J81C 2JYAA 2EMAA 3ADLA 4DR1E 2EM2A 4HTGA 2RS6A 4X8WA 3HPSA 2EE8A 4TUIA 4BMJA 1N33E 2L6MA 1I94E 4RHBB 4DV1E 1X47A 1QNTA 1WHNA 1X6FA 4AQYE 4JI2E 2ODRC 3AUZA 5BR8E 1YFHA 2EP3A 2LVHA 1G2FC 2WBTA 1PKPA 2DLQA 4P7DA 4DMIA 2JWOA 2DMIA 2EMHA 2YTOA 4R03A 2ELYA 2EOHA 2MDGA 2BBGA 4DR6E 2EPUA 1ZU1A 2EPOA 1EH7A 2YSPA 2MKDA 2F8BA 4R2QA 1BBOA 2EPPA 4F9BB 2MKNA 2JOXA 2EMKA 2EOXA 1LLMC 3BF2A 2ELZA 2L3CA 3EPHA 2JR1A 2LTSA 5A69A 2YTGA 3M99B 2E1MA 4YY3E 3IWBA 2DGCA 1FJGE 1F2IG 4BC7A 4BCAA 2A25A 1PJSA 1L4SA 4LF8E 4WPYA 1GQEA 1B69A 2EL4A 4ZYEA 1N36E 2L33A 3THNA 4R2CA 4OOGC 2MC5A 2LTRA 2EM3A 2YTEA 4JYAE 4LFAE 2B3TB 2J7JA 3JTZA 4R2EA 1YPNA 2EQ1A 2DIXA 4LF6E 2LE2A 3RMPA 2EN1A 2VF1A 3T1HE 2EL6A 1G2DC 3C6MA 2EOZA 2UXBE 2NABA 3MSWA 3QG5C 3H09A 1YYKA 1HNWE 2EMBA 3LLHA 3VK6A 1BB8A 4F9CB 2BB8A 1KYQA 1PDAA 1JK2A 1DQ3A 3JAMC 5KL7A 1RMDA 1PJQA 2L2NA 2MC6A 2CPNA 2RSIA 3MHSC 4JI0E 5F3WA 3J80C 2V8QB 2DMYA 1Z1BA 4BHCA 3THOB 1HR0E 3K6QA 1WHQA 5T6JA 1YUIA 2EQ3A 4RH8A 3C4BA 2R76A 1UN6B 4MLVA 1T4NA 2YTIA 4P78A 1IBLE 2HHHE 1N3GA 2YRHA 1YSAC 3ADIA 5ADZA 1UHZA 2JY9A 2EJ4A 2YTQA 4K0KE 3ADGA 2E72A 3VYYA 2EN3A 3IWCA 5KL4A 4BHBA 4LF9E 2JPAA 2K7IA 1HNXE 2LCEA 4R2DA 2EL5A 4JI6E 1UBDC 2B7VA 2RTXA 4B3ME 1FKAE 1UILA 2EM8A 2EMFA 2IHR1 4GKKE 3HPZA 3VHTB 2EMGA 4F9AB 2L92A 1A1IA 2CSHA 1IBME 5AE2A 2V88A 2GHFA 2JVAA 5AC4A 5LLQA 2L3JA 2EOEA 2NA2A 3ZOQB 2DRPA 4DV5E 3HTXA 4TUGA 2R1FA 4JI4E 2EOJA 1X6EA 2EM0A 3ADJA 3KWRA 1T4OA 2LUQA 5LMUE 2EMIA 2LBSB 2GPIA 2EM9A 3JU0A 4F6NA 1EKZA 3L00A 1NEIA 1IBKE 1P47A 2EM4A 4IJDA 3VYXA 2EPRA 2EPCA 4F6MA 2EMXA 5A6KA 1SFEA 2EOFA 1TF6A 1YYWA 1X48A 4DV4E 4B3SE 2RSMA 2EOYA 5KL2A 3ECRA 1YYOA 4GZNC 2I9IA 1YZ9A 3BIDA 5A6AA 4LF4E 2EMYA 3FIGA 2V83A 2V85A 3MHHC 3EQ1A 2KHXA 4B3RE 3BGHA 4Q35B 2K4VA 3C6KA 2CT1A 3DF6A 2EPNA 4ZYGA 2EPAA 4BBYA 5AE1A 2LJHA 2YU5A 1TF3A 2WCC3 4LF5E 2B7TA 4R8OA 5LL6R 1TN9A 4DR3E 4NXME 2WBSA 2YZTA 2WZOA 4GEQB 3P1XA 1NCSA 2ZM6E 4DV6E 1MGTA 2JP9A 5IV8B 4R2SA 2HC5A 4FK5C 3HXLA 2V89A 2DB2A 1T38A 4LU9A 4X62E 3TQMA 1IMUA 2EPXA 2EMZA 2YRKA 3EPKA 4NXNE 4LTYA 2ENHA 1A1LA 5CFFE 4O4KA 5KL6A 4WX9A 4X64E 1AH5A 2LMZA 4WFTA 3DJWA 4OX9E 1X5WA 5AC5A 4WSPA 1GTKA 4LFBE 1A1HA 4NHRA 4B3TE 5IWAE 3J7Yp 1A1FA 3IWDA 1A1JA 2EN8A 1WJPA 2RPCA 2EM7A 5TSEA 2FGGA 4X65E 2DSYA 2EN2A 2UUCE 2EOQA 3KZYA 3J7AG 2ADRA 2N3GA 5IXMB 3EPLA 2MDRA 4DR2E 1T39A 3OTOE 2EPMX 4KZSA 3OMLA 2YSOA 2M7QA 1ZBQA 4M9VC 5LMNE 5KL5A 1X3CA 2L2KB 1X49A 4DR5E 2EPLX 2NUFA 2EPKX 4DUYE 4I8OA 4JV5E 3F6GA 4DV0E 2EN6A 3KZZA 1BBGA 1YUJA 4M30A 1O0WA 4HEIA 2RQLA 1KJKA 2JOBA 1ZBTA 2VQEE 2DLKA 2RS7A 4L8NA 2NUGA 4O5GA 4IS1C 1XMQE 2EN4A 2EOSA 4MLQA 2EOOA 2YT4A 2LUPB 3BBGA 2EM5A 4JI5E 1N34E 2EORA 2F4VE 2KONA
chains in the Genus database with same CATH topology
1Z1BA 4R2AA 2WBSA 1ZR9A 2YTFA 1YUIA 2EQ3A 2EOMA 1NCSA 1UN6B 2VRDA 2I13A 2LV2A 2JP9A 2YTIA 4F2JC 4R2SA 2EMLA 4FK5C 2PRTA 2ENCA 2YRHA 1JK1A 2EM6A 1YSAC 2EMWA 2EJ4A 2EMAA 2YTQA 2EPXA 2E72A 2EMZA 2YRKA 2EM2A 3EPKA 2EN3A 2YU8A 2ENHA 5KL4A 1A1LA 2EE8A 2CTDA 2JPAA 4R2RA 2LCEA 2LO3A 5KL6A 4R2DA 2EL5A 1UBDC 1DGCA 1X6FA 4R2PA 1A1KA 2EM8A 1X5WA 2EP3A 2EMFA 2LVHA 1G2FC 1A1HA 3VHTB 2EMGA 2WBTA 1A1FA 1A1IA 2CSHA 2DLQA 1A1JA 2HGHA 1ZAAC 2EN8A 2YTNA 2GHFA 1WJPA 2DMIA 2EMHA 2YTOA 2YRMA 2EOEA 2ELYA 2EOHA 1MEYC 2MDGA 2RPCA 2EM7A 2DRPA 2EPUA 1ZU1A 2R1FA 2YSPA 2MKDA 4X9JA 2EOJA 4R2QA 1BBOA 2EPPA 2MKNA 1X6EA 2EMKA 2EOXA 1LLMC 2EM0A 2EN2A 2ELZA 2EOQA 2EOIA 3EPHA 2EN7A 1A1GA 2EQ0A 2YTJA 2WBUA 2ADRA 2YTGA 3M99B 3EPLA 3UK3C 2EMIA 2D9HA 2EPZA 2DGCA 1F2IG 2A25A 2EM9A 2YSOA 2M9AA 4WSGA 2LT7A 4F6NA 2YTPA 5KL3A 4M9VC 5KL5A 1X3CA 3EPJA 1X6HA 1P47A 2EM4A 4IJDA 2EL4A 1B69A 2EPRA 2EPCA 4F6MA 2EMXA 2EMCA 4R2CA 2EOFA 1TF6A 2ENAA 2YTDA 2YTEA 2EM3A 2EOYA 5KL2A 2J7JA 4GZNC 4R2EA 2EQ1A 2EMYA 2EN1A 2GLIA 2EL6A 1G2DC 2EN6A 1YUJA 2EOZA 2NABA 1KJKA 2EMBA 3MHHC 1BB8A 2BB8A 1JK2A 2DLKA 5KL7A 4IS1C 2CT1A 1RMDA 2EN4A 2EOSA 2EOOA 1AAYA 2EPAA 2EM5A 2RSIA 2YU5A 3MHSC 2WCC3 1TF3A 2EORA 1TN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  4R2A A;  2WBS A;  1ZR9 A;  2YTF A;  1YUI A;  2EQ3 A;  2EOM A;  1NCS A;  1UN6 B;  2VRD A;  2I13 A;  2LV2 A;  2JP9 A;  2YTI A;  4F2J C;  4R2S A;  2EML A;  4FK5 C;  2PRT A;  2ENC A;  2YRH A;  1JK1 A;  2EM6 A;  1YSA C;  2EMW A;  2EJ4 A;  2EMA A;  2YTQ A;  2EPX A;  2E72 A;  2EMZ A;  2YRK A;  2EM2 A;  3EPK A;  2EN3 A;  2YU8 A;  2ENH A;  5KL4 A;  1A1L A;  2EE8 A;  2CTD A;  2JPA A;  4R2R A;  2LCE A;  2LO3 A;  5KL6 A;  4R2D A;  2EL5 A;  1UBD C;  1DGC A;  1X6F A;  4R2P A;  1A1K A;  2EM8 A;  1X5W A;  2EP3 A;  2EMF A;  2LVH A;  1G2F C;  1A1H A;  3VHT B;  2EMG A;  2WBT A;  1A1F A;  1A1I A;  2CSH A;  2DLQ A;  1A1J A;  2HGH A;  1ZAA C;  2EN8 A;  2YTN A;  2GHF A;  1WJP A;  2DMI A;  2EMH A;  2YTO A;  2YRM A;  2EOE A;  2ELY A;  2EOH A;  1MEY C;  2MDG A;  2RPC A;  2EM7 A;  2DRP A;  2EPU A;  1ZU1 A;  2R1F A;  2YSP A;  2MKD A;  4X9J A;  2EOJ A;  4R2Q A;  1BBO A;  2EPP A;  2MKN A;  1X6E A;  2EMK A;  2EOX A;  1LLM C;  2EM0 A;  2EN2 A;  2ELZ A;  2EOQ A;  2EOI A;  3EPH A;  2EN7 A;  1A1G A;  2EQ0 A;  2YTJ A;  2WBU A;  2ADR A;  2YTG A;  3M99 B;  3EPL A;  3UK3 C;  2EMI A;  2D9H A;  2EPZ A;  2DGC A;  1F2I G;  2A25 A;  2EM9 A;  2YSO A;  2M9A A;  4WSG A;  2LT7 A;  4F6N A;  2YTP A;  5KL3 A;  4M9V C;  5KL5 A;  1X3C A;  3EPJ A;  1X6H A;  1P47 A;  2EM4 A;  4IJD A;  2EL4 A;  1B69 A;  2EPR A;  2EPC A;  4F6M A;  2EMX A;  2EMC A;  4R2C A;  2EOF A;  1TF6 A;  2ENA A;  2YTD A;  2YTE A;  2EM3 A;  2EOY A;  5KL2 A;  2J7J A;  4GZN C;  4R2E A;  2EQ1 A;  2EMY A;  2EN1 A;  2GLI A;  2EL6 A;  1G2D C;  2EN6 A;  1YUJ A;  2EOZ A;  2NAB A;  1KJK A;  2EMB A;  3MHH C;  1BB8 A;  2BB8 A;  1JK2 A;  2DLK A;  5KL7 A;  4IS1 C;  2CT1 A;  1RMD A;  2EN4 A;  2EOS A;  2EOO A;  1AAY A;  2EPA A;  2EM5 A;  2RSI A;  2YU5 A;  3MHS C;  2WCC 3;  1TF3 A;  2EOR A;  1TN9 A; 
#chains in the Genus database with same CATH topology
 2YWQ A;  2YPN A;  4N4R B;  2YTF A;  1J5E E;  4NZV A;  4DR7 E;  4O24 A;  4BC9 A;  5DNY A;  4JI3 E;  2LV2 A;  1SR9 A;  2LRS A;  2EML A;  4BS9 A;  1XMO E;  4WYQ B;  1HNZ E;  2M1S A;  2PRT A;  2ENC A;  5AAS A;  1JK1 A;  1IQO A;  2H36 X;  2EM6 A;  2EMW A;  4KWY A;  1WXR A;  2UUA E;  2M4I A;  4DR4 E;  2V86 A;  2NUE A;  4ZYH A;  2EWL A;  2YU8 A;  4GKJ E;  2CTD A;  2L8T A;  4DV3 E;  3HQ1 A;  5A2Q C;  4R2R A;  2LO3 A;  1EH8 A;  5AE3 A;  1DGC A;  2FV4 B;  4R2P A;  1A1K A;  2V87 A;  1DI2 A;  4DUZ E;  4Q28 A;  2N8X A;  2G7H A;  5A6B D;  4M0V A;  1T4L B;  1STU A;  2B9D A;  2HGH A;  1ZAA C;  2YTN A;  2YRM A;  2VQF E;  5IT9 C;  1MEY C;  4DKK A;  2E5L E;  1N32 E;  1IQS A;  1WRJ A;  4X9J A;  2FTX B;  2EOI A;  2HJJ A;  2EN7 A;  1A1G A;  2EQ0 A;  2YTJ A;  2WBU A;  4M2Z A;  4KHP E;  1RQ0 A;  3UK3 C;  4LFC E;  2D9H A;  4JI1 E;  2EPZ A;  5A6B A;  4JI8 E;  4ZYD A;  2M9A A;  4WSG A;  2LT7 A;  1PJT A;  2YTP A;  3F6H A;  5KL3 A;  3EPJ A;  1GZ6 A;  1X6H A;  5FLX C;  2UUB E;  2EMC A;  4WXC A;  2L2M A;  2ENA A;  2YTD A;  3C4T A;  4DV7 E;  2UU9 E;  4O43 A;  2ODR D;  4WXD A;  2UXC E;  2GLI A;  2LJU A;  2N3H A;  2EZ6 A;  1QU6 A;  3T1Y E;  2KOU A;  4YHH E;  3AV0 A;  5A6J A;  1AAY A;  4LF7 E;  4JI7 E;  4DV2 E;  1EH6 A;  4R2A A;  1RC7 A;  3LML A;  1ZR9 A;  1XNR E;  2VE7 C;  1XNQ E;  2EOM A;  1J26 A;  2VRD A;  2I13 A;  4J8Z A;  4F54 A;  2JXP A;  4X66 E;  4F2J C;  2UXD E;  2Q8U A;  4L5N C;  3J81 C;  2JYA A;  2EMA A;  3ADL A;  4DR1 E;  2EM2 A;  4HTG A;  2RS6 A;  4X8W A;  3HPS A;  2EE8 A;  4TUI A;  4BMJ A;  1N33 E;  2L6M A;  1I94 E;  4RHB B;  4DV1 E;  1X47 A;  1QNT A;  1WHN A;  1X6F A;  4AQY E;  4JI2 E;  2ODR C;  3AUZ A;  5BR8 E;  1YFH A;  2EP3 A;  2LVH A;  1G2F C;  2WBT A;  1PKP A;  2DLQ A;  4P7D A;  4DMI A;  2JWO A;  2DMI A;  2EMH A;  2YTO A;  4R03 A;  2ELY A;  2EOH A;  2MDG A;  2BBG A;  4DR6 E;  2EPU A;  1ZU1 A;  2EPO A;  1EH7 A;  2YSP A;  2MKD A;  2F8B A;  4R2Q A;  1BBO A;  2EPP A;  4F9B B;  2MKN A;  2JOX A;  2EMK A;  2EOX A;  1LLM C;  3BF2 A;  2ELZ A;  2L3C A;  3EPH A;  2JR1 A;  2LTS A;  5A69 A;  2YTG A;  3M99 B;  2E1M A;  4YY3 E;  3IWB A;  2DGC A;  1FJG E;  1F2I G;  4BC7 A;  4BCA A;  2A25 A;  1PJS A;  1L4S A;  4LF8 E;  4WPY A;  1GQE A;  1B69 A;  2EL4 A;  4ZYE A;  1N36 E;  2L33 A;  3THN A;  4R2C A;  4OOG C;  2MC5 A;  2LTR A;  2EM3 A;  2YTE A;  4JYA E;  4LFA E;  2B3T B;  2J7J A;  3JTZ A;  4R2E A;  1YPN A;  2EQ1 A;  2DIX A;  4LF6 E;  2LE2 A;  3RMP A;  2EN1 A;  2VF1 A;  3T1H E;  2EL6 A;  1G2D C;  3C6M A;  2EOZ A;  2UXB E;  2NAB A;  3MSW A;  3QG5 C;  3H09 A;  1YYK A;  1HNW E;  2EMB A;  3LLH A;  3VK6 A;  1BB8 A;  4F9C B;  2BB8 A;  1KYQ A;  1PDA A;  1JK2 A;  1DQ3 A;  3JAM C;  5KL7 A;  1RMD A;  1PJQ A;  2L2N A;  2MC6 A;  2CPN A;  2RSI A;  3MHS C;  4JI0 E;  5F3W A;  3J80 C;  2V8Q B;  2DMY A;  1Z1B A;  4BHC A;  3THO B;  1HR0 E;  3K6Q A;  1WHQ A;  5T6J A;  1YUI A;  2EQ3 A;  4RH8 A;  3C4B A;  2R76 A;  1UN6 B;  4MLV A;  1T4N A;  2YTI A;  4P78 A;  1IBL E;  2HHH E;  1N3G A;  2YRH A;  1YSA C;  3ADI A;  5ADZ A;  1UHZ A;  2JY9 A;  2EJ4 A;  2YTQ A;  4K0K E;  3ADG A;  2E72 A;  3VYY A;  2EN3 A;  3IWC A;  5KL4 A;  4BHB A;  4LF9 E;  2JPA A;  2K7I A;  1HNX E;  2LCE A;  4R2D A;  2EL5 A;  4JI6 E;  1UBD C;  2B7V A;  2RTX A;  4B3M E;  1FKA E;  1UIL A;  2EM8 A;  2EMF A;  2IHR 1;  4GKK E;  3HPZ A;  3VHT B;  2EMG A;  4F9A B;  2L92 A;  1A1I A;  2CSH A;  1IBM E;  5AE2 A;  2V88 A;  2GHF A;  2JVA A;  5AC4 A;  5LLQ A;  2L3J A;  2EOE A;  2NA2 A;  3ZOQ B;  2DRP A;  4DV5 E;  3HTX A;  4TUG A;  2R1F A;  4JI4 E;  2EOJ A;  1X6E A;  2EM0 A;  3ADJ A;  3KWR A;  1T4O A;  2LUQ A;  5LMU E;  2EMI A;  2LBS B;  2GPI A;  2EM9 A;  3JU0 A;  4F6N A;  1EKZ A;  3L00 A;  1NEI A;  1IBK E;  1P47 A;  2EM4 A;  4IJD A;  3VYX A;  2EPR A;  2EPC A;  4F6M A;  2EMX A;  5A6K A;  1SFE A;  2EOF A;  1TF6 A;  1YYW A;  1X48 A;  4DV4 E;  4B3S E;  2RSM A;  2EOY A;  5KL2 A;  3ECR A;  1YYO A;  4GZN C;  2I9I A;  1YZ9 A;  3BID A;  5A6A A;  4LF4 E;  2EMY A;  3FIG A;  2V83 A;  2V85 A;  3MHH C;  3EQ1 A;  2KHX A;  4B3R E;  3BGH A;  4Q35 B;  2K4V A;  3C6K A;  2CT1 A;  3DF6 A;  2EPN A;  4ZYG A;  2EPA A;  4BBY A;  5AE1 A;  2LJH A;  2YU5 A;  1TF3 A;  2WCC 3;  4LF5 E;  2B7T A;  4R8O A;  5LL6 R;  1TN9 A;  4DR3 E;  4NXM E;  2WBS A;  2YZT A;  2WZO A;  4GEQ B;  3P1X A;  1NCS A;  2ZM6 E;  4DV6 E;  1MGT A;  2JP9 A;  5IV8 B;  4R2S A;  2HC5 A;  4FK5 C;  3HXL A;  2V89 A;  2DB2 A;  1T38 A;  4LU9 A;  4X62 E;  3TQM A;  1IMU A;  2EPX A;  2EMZ A;  2YRK A;  3EPK A;  4NXN E;  4LTY A;  2ENH A;  1A1L A;  5CFF E;  4O4K A;  5KL6 A;  4WX9 A;  4X64 E;  1AH5 A;  2LMZ A;  4WFT A;  3DJW A;  4OX9 E;  1X5W A;  5AC5 A;  4WSP A;  1GTK A;  4LFB E;  1A1H A;  4NHR A;  4B3T E;  5IWA E;  3J7Y p;  1A1F A;  3IWD A;  1A1J A;  2EN8 A;  1WJP A;  2RPC A;  2EM7 A;  5TSE A;  2FGG A;  4X65 E;  2DSY A;  2EN2 A;  2UUC E;  2EOQ A;  3KZY A;  3J7A G;  2ADR A;  2N3G A;  5IXM B;  3EPL A;  2MDR A;  4DR2 E;  1T39 A;  3OTO E;  2EPM X;  4KZS A;  3OML A;  2YSO A;  2M7Q A;  1ZBQ A;  4M9V C;  5LMN E;  5KL5 A;  1X3C A;  2L2K B;  1X49 A;  4DR5 E;  2EPL X;  2NUF A;  2EPK X;  4DUY E;  4I8O A;  4JV5 E;  3F6G A;  4DV0 E;  2EN6 A;  3KZZ A;  1BBG A;  1YUJ A;  4M30 A;  1O0W A;  4HEI A;  2RQL A;  1KJK A;  2JOB A;  1ZBT A;  2VQE E;  2DLK A;  2RS7 A;  4L8N A;  2NUG A;  4O5G A;  4IS1 C;  1XMQ E;  2EN4 A;  2EOS A;  4MLQ A;  2EOO A;  2YT4 A;  2LUP B;  3BBG A;  2EM5 A;  4JI5 E;  1N34 E;  2EOR A;  2F4V E;  2KON A; 
#chains in the Genus database with same CATH homology
 1Z1B A;  4R2A A;  2WBS A;  1ZR9 A;  2YTF A;  1YUI A;  2EQ3 A;  2EOM A;  1NCS A;  1UN6 B;  2VRD A;  2I13 A;  2LV2 A;  2JP9 A;  2YTI A;  4F2J C;  4R2S A;  2EML A;  4FK5 C;  2PRT A;  2ENC A;  2YRH A;  1JK1 A;  2EM6 A;  1YSA C;  2EMW A;  2EJ4 A;  2EMA A;  2YTQ A;  2EPX A;  2E72 A;  2EMZ A;  2YRK A;  2EM2 A;  3EPK A;  2EN3 A;  2YU8 A;  2ENH A;  5KL4 A;  1A1L A;  2EE8 A;  2CTD A;  2JPA A;  4R2R A;  2LCE A;  2LO3 A;  5KL6 A;  4R2D A;  2EL5 A;  1UBD C;  1DGC A;  1X6F A;  4R2P A;  1A1K A;  2EM8 A;  1X5W A;  2EP3 A;  2EMF A;  2LVH A;  1G2F C;  1A1H A;  3VHT B;  2EMG A;  2WBT A;  1A1F A;  1A1I A;  2CSH A;  2DLQ A;  1A1J A;  2HGH A;  1ZAA C;  2EN8 A;  2YTN A;  2GHF A;  1WJP A;  2DMI A;  2EMH A;  2YTO A;  2YRM A;  2EOE A;  2ELY A;  2EOH A;  1MEY C;  2MDG A;  2RPC A;  2EM7 A;  2DRP A;  2EPU A;  1ZU1 A;  2R1F A;  2YSP A;  2MKD A;  4X9J A;  2EOJ A;  4R2Q A;  1BBO A;  2EPP A;  2MKN A;  1X6E A;  2EMK A;  2EOX A;  1LLM C;  2EM0 A;  2EN2 A;  2ELZ A;  2EOQ A;  2EOI A;  3EPH A;  2EN7 A;  1A1G A;  2EQ0 A;  2YTJ A;  2WBU A;  2ADR A;  2YTG A;  3M99 B;  3EPL A;  3UK3 C;  2EMI A;  2D9H A;  2EPZ A;  2DGC A;  1F2I G;  2A25 A;  2EM9 A;  2YSO A;  2M9A A;  4WSG A;  2LT7 A;  4F6N A;  2YTP A;  5KL3 A;  4M9V C;  5KL5 A;  1X3C A;  3EPJ A;  1X6H A;  1P47 A;  2EM4 A;  4IJD A;  2EL4 A;  1B69 A;  2EPR A;  2EPC A;  4F6M A;  2EMX A;  2EMC A;  4R2C A;  2EOF A;  1TF6 A;  2ENA A;  2YTD A;  2YTE A;  2EM3 A;  2EOY A;  5KL2 A;  2J7J A;  4GZN C;  4R2E A;  2EQ1 A;  2EMY A;  2EN1 A;  2GLI A;  2EL6 A;  1G2D C;  2EN6 A;  1YUJ A;  2EOZ A;  2NAB A;  1KJK A;  2EMB A;  3MHH C;  1BB8 A;  2BB8 A;  1JK2 A;  2DLK A;  5KL7 A;  4IS1 C;  2CT1 A;  1RMD A;  2EN4 A;  2EOS A;  2EOO A;  1AAY A;  2EPA A;  2EM5 A;  2RSI A;  2YU5 A;  3MHS C;  2WCC 3;  1TF3 A;  2EOR A;  1TN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...