1UBDC

Co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*TP*CP*TP*CP*CP*AP*TP*TP*TP*TP*GP*AP*A
publication title Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC01
2ADRA 1DGCA 2EM6A 2CSHA 2DGCA 2HGHA 2EOOA 2EPAA 2ELYA 1ZAAC 2PRTA 1YUJA 2LO3A 2EQ1A 2BB8A 1P47A 2LV2A 2EOYA 5KL3A 1UBDC 2E72A 2RSIA 1BBOA 1A1KA 2EN6A 2EN8A 1A1FA 2EPCA 2EOMA 5KL6A 2YRMA 2LT7A 2DRPA 2MKNA 1Z1BA 2YTOA 1A1GA 2YTQA 2EPRA 3VHTB 1A1JA 4IJDA 2WCC3 2EMWA 2YTGA 2EN7A 2YU5A 1F2IG 2MDGA 4F6MA 2YTFA 2EMFA 1X6HA 2D9HA 4WSGA 1G2DC 4R2RA 1MEYC 1TF3A 2EP3A 2GLIA 3M99B 2A25A 5KL4A 1A1IA 2DLKA 2EMCA 2YRKA 2EPPA 1G2FC 1JK1A 2EE8A 2EN3A 3EPJA 2YTEA 2NABA 5KL7A 1YSAC 2CT1A 2YTNA 2YSPA 2EM4A 2EOJA 2DMIA 2EL5A 2EN4A 2EL6A 2YTDA 2EM0A 3EPKA 1TF6A 4X9JA 2LCEA 2EOFA 4R2QA 4R2AA 1UN6B 4F6NA 1KJKA 2EPXA 2EMBA 2YRHA 4FK5C 2EMYA 2YU8A 2EOXA 5KL5A 4R2PA 2EN2A 2EQ0A 2WBUA 2I13A 1A1HA 2JP9A 2CTDA 2EOQA 2EOEA 1A1LA 3UK3C 2EMAA 2EMGA 2YTJA 2VRDA 4R2SA 2WBSA 1X3CA 2DLQA 2WBTA 1X5WA 1RMDA 3MHHC 1TN9A 1B69A 1ZR9A 1ZU1A 2EM7A 1NCSA 2EM8A 4R2DA 3EPLA 2EM9A 2M9AA 2EM5A 2EPUA 4R2EA 2EN1A 2YSOA 2EM2A 1X6EA 2EMKA 4M9VC 3EPHA 2EOIA 2EM3A 2YTIA 2EPZA 3MHSC 2J7JA 1WJPA 2EOSA 4GZNC 2EMLA 2EMIA 2EMHA 4R2CA 1YUIA 2RPCA 2EMZA 2EL4A 5KL2A 1LLMC 4IS1C 2EJ4A 2GHFA 1X6FA 2EORA 1BB8A 2R1FA 2ENHA 2ENAA 1JK2A 2EMXA 2MKDA 2EOHA 2ENCA 2YTPA 2LVHA 2JPAA 2ELZA 2EOZA 1AAYA 4F2JC 2EQ3A
chains in the Genus database with same CATH superfamily
2DSYA 2I9IA 1DGCA 2EM6A 2HGHA 3OMLA 1IBLE 2JYAA 3QG5C 4O24A 1NEIA 2BB8A 4OOGC 4DR7E 1UBDC 4BHCA 1BBOA 2EN6A 3ADGA 1A1FA 2DIXA 4YHHE 2EPKX 1X49A 3C6KA 3OTOE 2MKNA 4ZYEA 5CFFE 2ZM6E 4IJDA 2EMWA 3C6MA 2YU5A 1F2IG 4F6MA 5AE1A 5IWAE 1PJTA 4N4RB 3THNA 1PDAA 3AV0A 3M99B 2L3JA 1IMUA 2RS6A 2IHR1 2RSMA 1JK1A 2EE8A 4X8WA 2EN3A 4M0VA 2YTEA 2CT1A 1WHNA 2YSPA 5A6BA 4R03A 2EM4A 2L92A 4JYAE 4LFBE 4KWYA 2LCEA 2EOFA 1KJKA 5IV8B 4JI2E 4F54A 2V87A 2EPXA 2EMBA 2LBSB 2EOXA 5AE3A 3HXLA 2FGGA 2LUQA 4LF9E 2EQ0A 1IQSA 4B3ME 2EOQA 2EPLX 1A1LA 3UK3C 4M2ZA 1N36E 4JI8E 2EMGA 1QU6A 2JOXA 2VRDA 4R2SA 2WBSA 1KYQA 4DV1E 1SFEA 3MHHC 5T6JA 5BR8E 1NCSA 3BF2A 3EQ1A 4LF8E 2M9AA 2N3GA 1BBGA 4B3TE 2E1MA 2DMYA 5A6JA 2EM2A 2EMKA 4JI5E 3JTZA 2H36X 4M9VC 2EOIA 3HTXA 2YTIA 4JI6E 1WJPA 4O5GA 3JAMC 2EMLA 2EMHA 2VE7C 3T1HE 1YUIA 2RPCA 2EMZA 5LL6R 1UHZA 2E5LE 1DQ3A 1PKPA 2EL4A 4P78A 2BBGA 4BS9A 1YPNA 4HTGA 4GKJE 4KHPE 1IBME 2ENAA 2EOHA 4RHBB 2EOZA 4JI4E 4DMIA 2HC5A 4F2JC 4Q35B 1XMQE 1EH7A 2JY9A 2DGCA 2UXBE 3LLHA 2V88A 3J7AG 3FIGA 2LTSA 4NHRA 1YUJA 2EQ1A 2EOYA 4JV5E 3C4TA 3HPZA 2RSIA 2HHHE 4DUYE 5AC5A 1I94E 2EOMA 2YRMA 2YTOA 1A1GA 2YPNA 3DJWA 3MSWA 2YTGA 2LJUA 4BBYA 2MDGA 5A6BD 1T39A 2EMFA 4DV6E 1HNXE 4X66E 1HNZE 4J8ZA 4R2RA 1TF3A 4DV7E 4K0KE 5KL4A 3VYXA 2YRKA 3BGHA 2N8XA 1GQEA 3IWBA 1YSAC 2NUFA 1WXRA 4B3RE 2YTNA 4RH8A 1DI2A 2EPNA 1GTKA 2DMIA 3EPKA 1X48A 1YYKA 4P7DA 2YRHA 4FK5C 3L00A 2YU8A 1UILA 3IWDA 3IWCA 4O43A 2L2KB 2EN2A 2WBUA 2VQFE 3ZOQB 2EMAA 1YZ9A 2DLQA 1X5WA 2V89A 1TN9A 1ZU1A 1QNTA 2M4IA 2EM8A 4R2DA 1YYOA 2EM5A 4YY3E 2EPUA 2EN1A 1X6EA 3EPHA 4DUZE 2EPZA 2LRSA 2EOSA 4GZNC 2NUGA 4TUGA 1WHQA 1GZ6A 4JI1E 1J5EE 2JXPA 2JOBA 4TUIA 1T4NA 4LU9A 3HQ1A 5ADZA 4X62E 1T38A 1PJQA 2EORA 2LE2A 3F6HA 1FKAE 2EPMX 2ENCA 4DR3E 5FLXC 2RQLA 4DR2E 2EWLA 4MLVA 2YT4A 3LMLA 2EQ3A 2L33A 2L8TA 2EOOA 2EPAA 2ELYA 2UU9E 3RMPA 2RS7A 3C4BA 4LTYA 2LV2A 4KZSA 5KL3A 3J7Yp 2M7QA 2JVAA 2E72A 1A1KA 2EN8A 2KHXA 5KL6A 2LT7A 5IXMB 2YTQA 1T4LB 1ZBTA 2EPRA 2GPIA 2L2MA 2WCC3 1A1JA 3ADIA 2KONA 2EN7A 2JR1A 2N3HA 3KWRA 2YTFA 4BMJA 1X6HA 2MDRA 5AC4A 1MEYC 2K4VA 4DV2E 2GLIA 3P1XA 4GEQB 2DLKA 2FTXB 1EKZA 2EPPA 3AUZA 1G2FC 5DNYA 2NUEA 4WXDA 2NABA 2B7VA 4F9CB 2V8QB 4NZVA 1IBKE 4NXNE 2M1SA 2EN4A 2EL5A 2EZ6A 2EL6A 2EM0A 2B9DA 4R2QA 4R2AA 4X64E 4F6NA 1UN6B 2VF1A 4BC9A 4DV3E 4DV4E 1IQOA 4F9BB 2CPNA 2R76A 5LLQA 2EOEA 5IT9C 4B3SE 2K7IA 1L4SA 2VQEE 1AH5A 1RQ0A 2YZTA 4Q28A 1N32E 3KZYA 1ZR9A 1B69A 1N3GA 2EM7A 2L6MA 4X65E 1EH8A 5TSEA 2L3CA 4LFCE 4R2EA 4WSPA 2YSOA 3BBGA 3DF6A 3K6QA 2J7JA 2EMIA 4R2CA 1T4OA 2YWQA 2RTXA 2WZOA 5KL2A 1PJSA 1XNRE 4DV0E 2GHFA 4DV5E 1HNWE 5A2QC 1BB8A 1FJGE 2ENHA 2V83A 3F6GA 2MKDA 4F9AB 2YTPA 1SR9A 2LVHA 4R8OA 2ELZA 1N34E 1AAYA 5F3WA 3T1YE 2ADRA 4AQYE 2CSHA 1N33E 4LF4E 2Q8UA 1ZAAC 2PRTA 4DKKA 3ECRA 2UUAE 2LO3A 1YFHA 1P47A 2UUBE 4DR4E 4WFTA 4BC7A 3TQMA 3THOB 2V85A 2KOUA 3JU0A 2EPCA 2MC6A 2LMZA 4DR5E 2DRPA 3J81C 2LJHA 1Z1BA 2F8BA 3VHTB 4L5NC 2ODRC 1STUA 4LF5E 2D9HA 3BIDA 4WSGA 4WX9A 1XMOE 1G2DC 1YYWA 2EPOA 1MGTA 2EP3A 3KZZA 3ADJA 1X47A 5AASA 2A25A 4LF6E 4O4KA 1RC7A 1EH6A 1A1IA 2EMCA 4JI0E 1XNQE 5AE2A 2HJJA 3EPJA 5KL7A 1HR0E 1O0WA 2B3TB 4JI7E 5A6KA 2EOJA 1TF6A 2NA2A 2YTDA 5A6AA 4X9JA 2LUPB 2EMYA 5LMNE 5KL5A 2FV4B 4R2PA 2ODRD 2DB2A 2I13A 4BCAA 1A1HA 2JP9A 2CTDA 4L8NA 3H09A 2V86A 3VYYA 2YTJA 4I8OA 2F4VE 1X3CA 2WBTA 4WYQB 1RMDA 1WRJA 2JWOA 4ZYHA 2UXDE 3HPSA 3J80C 1ZBQA 4NXME 3VK6A 4GKKE 3EPLA 3ADLA 2EM9A 4M30A 4JI3E 4BHBA 4WXCA 2UXCE 2EM3A 3MHSC 5LMUE 4LF7E 1LLMC 4DR6E 4IS1C 4OX9E 2EJ4A 2LTRA 1X6FA 1J26A 2R1FA 2B7TA 4HEIA 2L2NA 2MC5A 4ZYGA 1JK2A 2EMXA 4WPYA 2JPAA 4ZYDA 2G7HA 2UUCE 4MLQA 5A69A 4DR1E 4LFAE
chains in the Genus database with same CATH topology
2ADRA 1DGCA 2EM6A 2CSHA 2DGCA 2HGHA 2EOOA 2EPAA 2ELYA 1ZAAC 2PRTA 1YUJA 2LO3A 2EQ1A 2BB8A 1P47A 2LV2A 2EOYA 5KL3A 1UBDC 2E72A 2RSIA 1BBOA 1A1KA 2EN6A 2EN8A 1A1FA 2EPCA 2EOMA 5KL6A 2YRMA 2LT7A 2DRPA 2MKNA 1Z1BA 2YTOA 1A1GA 2YTQA 2EPRA 3VHTB 1A1JA 4IJDA 2WCC3 2EMWA 2YTGA 2EN7A 2YU5A 1F2IG 2MDGA 4F6MA 2YTFA 2EMFA 1X6HA 2D9HA 4WSGA 1G2DC 4R2RA 1MEYC 1TF3A 2EP3A 2GLIA 3M99B 2A25A 5KL4A 1A1IA 2DLKA 2EMCA 2YRKA 2EPPA 1G2FC 1JK1A 2EE8A 2EN3A 3EPJA 2YTEA 2NABA 5KL7A 1YSAC 2CT1A 2YTNA 2YSPA 2EM4A 2EOJA 2DMIA 2EL5A 2EN4A 2EL6A 2YTDA 2EM0A 3EPKA 1TF6A 4X9JA 2LCEA 2EOFA 4R2QA 4R2AA 1UN6B 4F6NA 1KJKA 2EPXA 2EMBA 2YRHA 4FK5C 2EMYA 2YU8A 2EOXA 5KL5A 4R2PA 2EN2A 2EQ0A 2WBUA 2I13A 1A1HA 2JP9A 2CTDA 2EOQA 2EOEA 1A1LA 3UK3C 2EMAA 2EMGA 2YTJA 2VRDA 4R2SA 2WBSA 1X3CA 2DLQA 2WBTA 1X5WA 1RMDA 3MHHC 1TN9A 1B69A 1ZR9A 1ZU1A 2EM7A 1NCSA 2EM8A 4R2DA 3EPLA 2EM9A 2M9AA 2EM5A 2EPUA 4R2EA 2EN1A 2YSOA 2EM2A 1X6EA 2EMKA 4M9VC 3EPHA 2EOIA 2EM3A 2YTIA 2EPZA 3MHSC 2J7JA 1WJPA 2EOSA 4GZNC 2EMLA 2EMIA 2EMHA 4R2CA 1YUIA 2RPCA 2EMZA 2EL4A 5KL2A 1LLMC 4IS1C 2EJ4A 2GHFA 1X6FA 2EORA 1BB8A 2R1FA 2ENHA 2ENAA 1JK2A 2EMXA 2MKDA 2EOHA 2ENCA 2YTPA 2LVHA 2JPAA 2ELZA 2EOZA 1AAYA 4F2JC 2EQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADR A;  1DGC A;  2EM6 A;  2CSH A;  2DGC A;  2HGH A;  2EOO A;  2EPA A;  2ELY A;  1ZAA C;  2PRT A;  1YUJ A;  2LO3 A;  2EQ1 A;  2BB8 A;  1P47 A;  2LV2 A;  2EOY A;  5KL3 A;  1UBD C;  2E72 A;  2RSI A;  1BBO A;  1A1K A;  2EN6 A;  2EN8 A;  1A1F A;  2EPC A;  2EOM A;  5KL6 A;  2YRM A;  2LT7 A;  2DRP A;  2MKN A;  1Z1B A;  2YTO A;  1A1G A;  2YTQ A;  2EPR A;  3VHT B;  1A1J A;  4IJD A;  2WCC 3;  2EMW A;  2YTG A;  2EN7 A;  2YU5 A;  1F2I G;  2MDG A;  4F6M A;  2YTF A;  2EMF A;  1X6H A;  2D9H A;  4WSG A;  1G2D C;  4R2R A;  1MEY C;  1TF3 A;  2EP3 A;  2GLI A;  3M99 B;  2A25 A;  5KL4 A;  1A1I A;  2DLK A;  2EMC A;  2YRK A;  2EPP A;  1G2F C;  1JK1 A;  2EE8 A;  2EN3 A;  3EPJ A;  2YTE A;  2NAB A;  5KL7 A;  1YSA C;  2CT1 A;  2YTN A;  2YSP A;  2EM4 A;  2EOJ A;  2DMI A;  2EL5 A;  2EN4 A;  2EL6 A;  2YTD A;  2EM0 A;  3EPK A;  1TF6 A;  4X9J A;  2LCE A;  2EOF A;  4R2Q A;  4R2A A;  1UN6 B;  4F6N A;  1KJK A;  2EPX A;  2EMB A;  2YRH A;  4FK5 C;  2EMY A;  2YU8 A;  2EOX A;  5KL5 A;  4R2P A;  2EN2 A;  2EQ0 A;  2WBU A;  2I13 A;  1A1H A;  2JP9 A;  2CTD A;  2EOQ A;  2EOE A;  1A1L A;  3UK3 C;  2EMA A;  2EMG A;  2YTJ A;  2VRD A;  4R2S A;  2WBS A;  1X3C A;  2DLQ A;  2WBT A;  1X5W A;  1RMD A;  3MHH C;  1TN9 A;  1B69 A;  1ZR9 A;  1ZU1 A;  2EM7 A;  1NCS A;  2EM8 A;  4R2D A;  3EPL A;  2EM9 A;  2M9A A;  2EM5 A;  2EPU A;  4R2E A;  2EN1 A;  2YSO A;  2EM2 A;  1X6E A;  2EMK A;  4M9V C;  3EPH A;  2EOI A;  2EM3 A;  2YTI A;  2EPZ A;  3MHS C;  2J7J A;  1WJP A;  2EOS A;  4GZN C;  2EML A;  2EMI A;  2EMH A;  4R2C A;  1YUI A;  2RPC A;  2EMZ A;  2EL4 A;  5KL2 A;  1LLM C;  4IS1 C;  2EJ4 A;  2GHF A;  1X6F A;  2EOR A;  1BB8 A;  2R1F A;  2ENH A;  2ENA A;  1JK2 A;  2EMX A;  2MKD A;  2EOH A;  2ENC A;  2YTP A;  2LVH A;  2JPA A;  2ELZ A;  2EOZ A;  1AAY A;  4F2J C;  2EQ3 A; 
#chains in the Genus database with same CATH topology
 2DSY A;  2I9I A;  1DGC A;  2EM6 A;  2HGH A;  3OML A;  1IBL E;  2JYA A;  3QG5 C;  4O24 A;  1NEI A;  2BB8 A;  4OOG C;  4DR7 E;  1UBD C;  4BHC A;  1BBO A;  2EN6 A;  3ADG A;  1A1F A;  2DIX A;  4YHH E;  2EPK X;  1X49 A;  3C6K A;  3OTO E;  2MKN A;  4ZYE A;  5CFF E;  2ZM6 E;  4IJD A;  2EMW A;  3C6M A;  2YU5 A;  1F2I G;  4F6M A;  5AE1 A;  5IWA E;  1PJT A;  4N4R B;  3THN A;  1PDA A;  3AV0 A;  3M99 B;  2L3J A;  1IMU A;  2RS6 A;  2IHR 1;  2RSM A;  1JK1 A;  2EE8 A;  4X8W A;  2EN3 A;  4M0V A;  2YTE A;  2CT1 A;  1WHN A;  2YSP A;  5A6B A;  4R03 A;  2EM4 A;  2L92 A;  4JYA E;  4LFB E;  4KWY A;  2LCE A;  2EOF A;  1KJK A;  5IV8 B;  4JI2 E;  4F54 A;  2V87 A;  2EPX A;  2EMB A;  2LBS B;  2EOX A;  5AE3 A;  3HXL A;  2FGG A;  2LUQ A;  4LF9 E;  2EQ0 A;  1IQS A;  4B3M E;  2EOQ A;  2EPL X;  1A1L A;  3UK3 C;  4M2Z A;  1N36 E;  4JI8 E;  2EMG A;  1QU6 A;  2JOX A;  2VRD A;  4R2S A;  2WBS A;  1KYQ A;  4DV1 E;  1SFE A;  3MHH C;  5T6J A;  5BR8 E;  1NCS A;  3BF2 A;  3EQ1 A;  4LF8 E;  2M9A A;  2N3G A;  1BBG A;  4B3T E;  2E1M A;  2DMY A;  5A6J A;  2EM2 A;  2EMK A;  4JI5 E;  3JTZ A;  2H36 X;  4M9V C;  2EOI A;  3HTX A;  2YTI A;  4JI6 E;  1WJP A;  4O5G A;  3JAM C;  2EML A;  2EMH A;  2VE7 C;  3T1H E;  1YUI A;  2RPC A;  2EMZ A;  5LL6 R;  1UHZ A;  2E5L E;  1DQ3 A;  1PKP A;  2EL4 A;  4P78 A;  2BBG A;  4BS9 A;  1YPN A;  4HTG A;  4GKJ E;  4KHP E;  1IBM E;  2ENA A;  2EOH A;  4RHB B;  2EOZ A;  4JI4 E;  4DMI A;  2HC5 A;  4F2J C;  4Q35 B;  1XMQ E;  1EH7 A;  2JY9 A;  2DGC A;  2UXB E;  3LLH A;  2V88 A;  3J7A G;  3FIG A;  2LTS A;  4NHR A;  1YUJ A;  2EQ1 A;  2EOY A;  4JV5 E;  3C4T A;  3HPZ A;  2RSI A;  2HHH E;  4DUY E;  5AC5 A;  1I94 E;  2EOM A;  2YRM A;  2YTO A;  1A1G A;  2YPN A;  3DJW A;  3MSW A;  2YTG A;  2LJU A;  4BBY A;  2MDG A;  5A6B D;  1T39 A;  2EMF A;  4DV6 E;  1HNX E;  4X66 E;  1HNZ E;  4J8Z A;  4R2R A;  1TF3 A;  4DV7 E;  4K0K E;  5KL4 A;  3VYX A;  2YRK A;  3BGH A;  2N8X A;  1GQE A;  3IWB A;  1YSA C;  2NUF A;  1WXR A;  4B3R E;  2YTN A;  4RH8 A;  1DI2 A;  2EPN A;  1GTK A;  2DMI A;  3EPK A;  1X48 A;  1YYK A;  4P7D A;  2YRH A;  4FK5 C;  3L00 A;  2YU8 A;  1UIL A;  3IWD A;  3IWC A;  4O43 A;  2L2K B;  2EN2 A;  2WBU A;  2VQF E;  3ZOQ B;  2EMA A;  1YZ9 A;  2DLQ A;  1X5W A;  2V89 A;  1TN9 A;  1ZU1 A;  1QNT A;  2M4I A;  2EM8 A;  4R2D A;  1YYO A;  2EM5 A;  4YY3 E;  2EPU A;  2EN1 A;  1X6E A;  3EPH A;  4DUZ E;  2EPZ A;  2LRS A;  2EOS A;  4GZN C;  2NUG A;  4TUG A;  1WHQ A;  1GZ6 A;  4JI1 E;  1J5E E;  2JXP A;  2JOB A;  4TUI A;  1T4N A;  4LU9 A;  3HQ1 A;  5ADZ A;  4X62 E;  1T38 A;  1PJQ A;  2EOR A;  2LE2 A;  3F6H A;  1FKA E;  2EPM X;  2ENC A;  4DR3 E;  5FLX C;  2RQL A;  4DR2 E;  2EWL A;  4MLV A;  2YT4 A;  3LML A;  2EQ3 A;  2L33 A;  2L8T A;  2EOO A;  2EPA A;  2ELY A;  2UU9 E;  3RMP A;  2RS7 A;  3C4B A;  4LTY A;  2LV2 A;  4KZS A;  5KL3 A;  3J7Y p;  2M7Q A;  2JVA A;  2E72 A;  1A1K A;  2EN8 A;  2KHX A;  5KL6 A;  2LT7 A;  5IXM B;  2YTQ A;  1T4L B;  1ZBT A;  2EPR A;  2GPI A;  2L2M A;  2WCC 3;  1A1J A;  3ADI A;  2KON A;  2EN7 A;  2JR1 A;  2N3H A;  3KWR A;  2YTF A;  4BMJ A;  1X6H A;  2MDR A;  5AC4 A;  1MEY C;  2K4V A;  4DV2 E;  2GLI A;  3P1X A;  4GEQ B;  2DLK A;  2FTX B;  1EKZ A;  2EPP A;  3AUZ A;  1G2F C;  5DNY A;  2NUE A;  4WXD A;  2NAB A;  2B7V A;  4F9C B;  2V8Q B;  4NZV A;  1IBK E;  4NXN E;  2M1S A;  2EN4 A;  2EL5 A;  2EZ6 A;  2EL6 A;  2EM0 A;  2B9D A;  4R2Q A;  4R2A A;  4X64 E;  4F6N A;  1UN6 B;  2VF1 A;  4BC9 A;  4DV3 E;  4DV4 E;  1IQO A;  4F9B B;  2CPN A;  2R76 A;  5LLQ A;  2EOE A;  5IT9 C;  4B3S E;  2K7I A;  1L4S A;  2VQE E;  1AH5 A;  1RQ0 A;  2YZT A;  4Q28 A;  1N32 E;  3KZY A;  1ZR9 A;  1B69 A;  1N3G A;  2EM7 A;  2L6M A;  4X65 E;  1EH8 A;  5TSE A;  2L3C A;  4LFC E;  4R2E A;  4WSP A;  2YSO A;  3BBG A;  3DF6 A;  3K6Q A;  2J7J A;  2EMI A;  4R2C A;  1T4O A;  2YWQ A;  2RTX A;  2WZO A;  5KL2 A;  1PJS A;  1XNR E;  4DV0 E;  2GHF A;  4DV5 E;  1HNW E;  5A2Q C;  1BB8 A;  1FJG E;  2ENH A;  2V83 A;  3F6G A;  2MKD A;  4F9A B;  2YTP A;  1SR9 A;  2LVH A;  4R8O A;  2ELZ A;  1N34 E;  1AAY A;  5F3W A;  3T1Y E;  2ADR A;  4AQY E;  2CSH A;  1N33 E;  4LF4 E;  2Q8U A;  1ZAA C;  2PRT A;  4DKK A;  3ECR A;  2UUA E;  2LO3 A;  1YFH A;  1P47 A;  2UUB E;  4DR4 E;  4WFT A;  4BC7 A;  3TQM A;  3THO B;  2V85 A;  2KOU A;  3JU0 A;  2EPC A;  2MC6 A;  2LMZ A;  4DR5 E;  2DRP A;  3J81 C;  2LJH A;  1Z1B A;  2F8B A;  3VHT B;  4L5N C;  2ODR C;  1STU A;  4LF5 E;  2D9H A;  3BID A;  4WSG A;  4WX9 A;  1XMO E;  1G2D C;  1YYW A;  2EPO A;  1MGT A;  2EP3 A;  3KZZ A;  3ADJ A;  1X47 A;  5AAS A;  2A25 A;  4LF6 E;  4O4K A;  1RC7 A;  1EH6 A;  1A1I A;  2EMC A;  4JI0 E;  1XNQ E;  5AE2 A;  2HJJ A;  3EPJ A;  5KL7 A;  1HR0 E;  1O0W A;  2B3T B;  4JI7 E;  5A6K A;  2EOJ A;  1TF6 A;  2NA2 A;  2YTD A;  5A6A A;  4X9J A;  2LUP B;  2EMY A;  5LMN E;  5KL5 A;  2FV4 B;  4R2P A;  2ODR D;  2DB2 A;  2I13 A;  4BCA A;  1A1H A;  2JP9 A;  2CTD A;  4L8N A;  3H09 A;  2V86 A;  3VYY A;  2YTJ A;  4I8O A;  2F4V E;  1X3C A;  2WBT A;  4WYQ B;  1RMD A;  1WRJ A;  2JWO A;  4ZYH A;  2UXD E;  3HPS A;  3J80 C;  1ZBQ A;  4NXM E;  3VK6 A;  4GKK E;  3EPL A;  3ADL A;  2EM9 A;  4M30 A;  4JI3 E;  4BHB A;  4WXC A;  2UXC E;  2EM3 A;  3MHS C;  5LMU E;  4LF7 E;  1LLM C;  4DR6 E;  4IS1 C;  4OX9 E;  2EJ4 A;  2LTR A;  1X6F A;  1J26 A;  2R1F A;  2B7T A;  4HEI A;  2L2N A;  2MC5 A;  4ZYG A;  1JK2 A;  2EMX A;  4WPY A;  2JPA A;  4ZYD A;  2G7H A;  2UUC E;  4MLQ A;  5A69 A;  4DR1 E;  4LFA E; 
#chains in the Genus database with same CATH homology
 2ADR A;  1DGC A;  2EM6 A;  2CSH A;  2DGC A;  2HGH A;  2EOO A;  2EPA A;  2ELY A;  1ZAA C;  2PRT A;  1YUJ A;  2LO3 A;  2EQ1 A;  2BB8 A;  1P47 A;  2LV2 A;  2EOY A;  5KL3 A;  1UBD C;  2E72 A;  2RSI A;  1BBO A;  1A1K A;  2EN6 A;  2EN8 A;  1A1F A;  2EPC A;  2EOM A;  5KL6 A;  2YRM A;  2LT7 A;  2DRP A;  2MKN A;  1Z1B A;  2YTO A;  1A1G A;  2YTQ A;  2EPR A;  3VHT B;  1A1J A;  4IJD A;  2WCC 3;  2EMW A;  2YTG A;  2EN7 A;  2YU5 A;  1F2I G;  2MDG A;  4F6M A;  2YTF A;  2EMF A;  1X6H A;  2D9H A;  4WSG A;  1G2D C;  4R2R A;  1MEY C;  1TF3 A;  2EP3 A;  2GLI A;  3M99 B;  2A25 A;  5KL4 A;  1A1I A;  2DLK A;  2EMC A;  2YRK A;  2EPP A;  1G2F C;  1JK1 A;  2EE8 A;  2EN3 A;  3EPJ A;  2YTE A;  2NAB A;  5KL7 A;  1YSA C;  2CT1 A;  2YTN A;  2YSP A;  2EM4 A;  2EOJ A;  2DMI A;  2EL5 A;  2EN4 A;  2EL6 A;  2YTD A;  2EM0 A;  3EPK A;  1TF6 A;  4X9J A;  2LCE A;  2EOF A;  4R2Q A;  4R2A A;  1UN6 B;  4F6N A;  1KJK A;  2EPX A;  2EMB A;  2YRH A;  4FK5 C;  2EMY A;  2YU8 A;  2EOX A;  5KL5 A;  4R2P A;  2EN2 A;  2EQ0 A;  2WBU A;  2I13 A;  1A1H A;  2JP9 A;  2CTD A;  2EOQ A;  2EOE A;  1A1L A;  3UK3 C;  2EMA A;  2EMG A;  2YTJ A;  2VRD A;  4R2S A;  2WBS A;  1X3C A;  2DLQ A;  2WBT A;  1X5W A;  1RMD A;  3MHH C;  1TN9 A;  1B69 A;  1ZR9 A;  1ZU1 A;  2EM7 A;  1NCS A;  2EM8 A;  4R2D A;  3EPL A;  2EM9 A;  2M9A A;  2EM5 A;  2EPU A;  4R2E A;  2EN1 A;  2YSO A;  2EM2 A;  1X6E A;  2EMK A;  4M9V C;  3EPH A;  2EOI A;  2EM3 A;  2YTI A;  2EPZ A;  3MHS C;  2J7J A;  1WJP A;  2EOS A;  4GZN C;  2EML A;  2EMI A;  2EMH A;  4R2C A;  1YUI A;  2RPC A;  2EMZ A;  2EL4 A;  5KL2 A;  1LLM C;  4IS1 C;  2EJ4 A;  2GHF A;  1X6F A;  2EOR A;  1BB8 A;  2R1F A;  2ENH A;  2ENA A;  1JK2 A;  2EMX A;  2MKD A;  2EOH A;  2ENC A;  2YTP A;  2LVH A;  2JPA A;  2ELZ A;  2EOZ A;  1AAY A;  4F2J C;  2EQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...