1UBDC

Co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*TP*CP*TP*CP*CP*AP*TP*TP*TP*TP*GP*AP*A
publication title Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC01
2CT1A 2EOZA 2R1FA 2EN2A 1A1GA 1X6EA 1ZR9A 2EMCA 2EMZA 1ZU1A 4R2PA 2RSIA 2EM0A 2EPUA 2DLQA 2MDGA 2YTEA 1BBOA 2EN4A 1MEYC 3EPHA 2EM9A 3EPJA 1X5WA 2EM5A 2EOYA 1RMDA 3MHHC 2PRTA 5KL7A 1X6HA 2ENAA 1YUIA 2LCEA 2EN8A 2ADRA 2YSPA 3MHSC 1ZAAC 2WBTA 2EOSA 2EQ0A 2YTJA 2EPRA 2EL6A 2EL5A 2EMXA 2DGCA 4M9VC 2WCC3 2JPAA 1JK2A 2D9HA 2EMYA 2YRHA 1NCSA 2YSOA 2ENHA 3VHTB 4IS1C 3UK3C 2EN7A 2YRMA 1TF3A 3EPKA 2EN6A 2EMBA 2EPCA 1TF6A 2YTDA 4F2JC 2EOEA 2YTNA 1A1IA 2EP3A 2RPCA 5KL3A 2EE8A 1BB8A 2EMIA 4R2SA 2YTGA 2YTPA 4F6NA 1AAYA 1B69A 2ENCA 1G2DC 4R2QA 2I13A 2EPAA 4R2CA 2NABA 2EL4A 1X6FA 1LLMC 5KL6A 1F2IG 1UBDC 5KL5A 4F6MA 2EM8A 2EOJA 2EMWA 2A25A 2BB8A 2EJ4A 4FK5C 2GHFA 2LO3A 2ELZA 2YU5A 3EPLA 2DLKA 1A1HA 2HGHA 2EOQA 2EPZA 2M9AA 2DRPA 2EMGA 4R2DA 2LVHA 1JK1A 2DMIA 1X3CA 2JP9A 2EM7A 1A1LA 2EPXA 1DGCA 2ELYA 2EOIA 5KL4A 1A1JA 2EM3A 2EQ1A 2GLIA 2EORA 2LV2A 1YSAC 2E72A 2EMFA 1UN6B 2CTDA 1P47A 2EM6A 2VRDA 2EPPA 2EN3A 3M99B 2EN1A 2WBUA 2MKNA 1YUJA 2J7JA 1TN9A 2EOMA 2EOXA 1Z1BA 2EMLA 2EM4A 5KL2A 1KJKA 2YTIA 2EQ3A 2YTFA 2EMAA 2YTOA 4IJDA 2EOFA 4WSGA 4GZNC 4R2RA 4X9JA 2EM2A 4R2EA 1WJPA 2EMHA 2YTQA 1G2FC 2CSHA 2EOHA 2EMKA 2WBSA 1A1FA 2EOOA 2LT7A 2YU8A 4R2AA 1A1KA 2MKDA 2YRKA
chains in the Genus database with same CATH superfamily
4NXNE 1T4OA 2R1FA 1UHZA 2EPKX 5LL6R 1ZU1A 1N3GA 2DIXA 4JI8E 2LMZA 2EPOA 1BBOA 2JVAA 4BC9A 3EPJA 2CPNA 4WFTA 2R76A 4MLVA 4BC7A 3THNA 2EOYA 4F9BB 5KL7A 2DMYA 1X6HA 4F9AB 1IQOA 2EN8A 4B3RE 1XNRE 3MHSC 4LFAE 4K0KE 2EQ0A 4M9VC 1JK2A 2JWOA 4GKKE 3UK3C 3FIGA 1TF3A 3HPZA 2UXCE 1O0WA 4DV0E 2EMBA 3K6QA 2RSMA 2YTNA 2EP3A 4O24A 3BBGA 4LF5E 1BB8A 4R2SA 2YTGA 2L3CA 2K4VA 2M1SA 1G2DC 2EPAA 4BMJA 5TSEA 2EL4A 1UBDC 1F2IG 5KL6A 2VQEE 1SR9A 1AH5A 4DV6E 4BHBA 1J26A 1X49A 4M30A 3J81C 2RS6A 1XNQE 2M7QA 3HPSA 2HGHA 2K7IA 4B3SE 2EOQA 4WYQB 2I9IA 2EZ6A 4DV2E 2HC5A 5A6AA 3J80C 4F54A 1IMUA 1YYKA 3ADJA 4O5GA 1BBGA 2JP9A 2EPXA 2L6MA 2V85A 3RMPA 1DGCA 2ELYA 4DR7E 3T1HE 4P78A 5A69A 4TUGA 2LV2A 5T6JA 3JTZA 5FLXC 4M2ZA 4ZYHA 4DR4E 2VRDA 2EN3A 3J7AG 4KZSA 2LE2A 5A2QC 4B3ME 4WSPA 1KJKA 3HQ1A 4B3TE 2EQ3A 4NZVA 2DB2A 4J8ZA 1T4NA 3T1YE 1MGTA 2YTQA 4JI5E 1YYOA 2IHR1 4Q35B 5IWAE 1A1KA 3IWDA 4X66E 2CT1A 4OOGC 2EMCA 4DR3E 2EPUA 3LMLA 4GEQB 2DLQA 2L3JA 2MDGA 2YTEA 4JYAE 1IBME 2EN4A 3EPHA 3LLHA 2LJHA 2EM5A 5A6KA 4LF8E 2F4VE 2PRTA 3KWRA 1N33E 2ENAA 1YUIA 3EQ1A 2ADRA 4DR2E 3P1XA 5A6BD 3HXLA 4WXCA 2EMXA 2YZTA 4DKKA 3DJWA 2EMYA 1NCSA 2ENHA 3VHTB 5CFFE 4JI6E 4JI4E 4X62E 4DUZE 2HJJA 4AQYE 2EN6A 1RC7A 1STUA 5IXMB 1WXRA 2UUBE 2L92A 2YTDA 4P7DA 1RQ0A 2EOEA 5ADZA 1FKAE 2RPCA 5IV8B 1ZBQA 4LU9A 2JOBA 3JAMC 2L8TA 2Q8UA 2LRSA 1AAYA 2ENCA 2KHXA 1EH7A 4JI2E 1X6FA 1LLMC 3C6KA 1IQSA 3JU0A 4N4RB 2G7HA 5KL5A 4F6MA 2VF1A 1XMOE 2EOJA 2A25A 1XMQE 2BB8A 2EJ4A 2RTXA 1PKPA 4DMIA 2N3GA 2GHFA 2LO3A 2LTRA 2JXPA 3H09A 3OTOE 1N34E 2EPZA 2M9AA 2EPNA 2V86A 5DNYA 1X3CA 2EM7A 1I94E 1GTKA 5AE2A 2EOIA 5KL4A 4LFBE 1A1JA 2N3HA 2EM3A 5AC4A 2MC5A 4LF7E 3BGHA 5AC5A 1YZ9A 2FTXB 4X8WA 1UN6B 3ADLA 1FJGE 2EM6A 2E1MA 3M99B 2MKNA 2WBUA 3L00A 1Z1BA 5KL2A 3F6GA 4JV5E 2RQLA 2YTOA 2NUEA 4R2RA 2EM2A 1WHNA 1WJPA 4R2EA 1IBKE 5AE1A 2BBGA 2L2KB 2LT7A 4R2AA 2UXDE 4HEIA 2KOUA 2MC6A 2F8BA 4RH8A 1T38A 1PJTA 2EN2A 2V88A 4Q28A 1X6EA 3BIDA 1ZR9A 2EMZA 2EPMX 4DR1E 2EM0A 4WX9A 2N8XA 4L8NA 1HNWE 1EH6A 4I8OA 4X65E 1RMDA 3MHHC 2JOXA 3MSWA 4TUIA 4BCAA 3OMLA 2LJUA 2LTSA 2YSPA 4JI7E 2WBTA 3ZOQB 2YTJA 1T39A 2EL6A 2EL5A 2DGCA 2NUGA 2UU9E 3QG5C 2JPAA 2D9HA 4O4KA 1HNZE 4IS1C 2JY9A 2EN7A 2YWQA 2HHHE 3AUZA 3DF6A 5KL3A 1HR0E 2EE8A 2EMIA 2B7TA 2FGGA 2RS7A 5A6BA 1NEIA 1B69A 2LUQA 3ADGA 4R2CA 2NABA 4LF9E 3KZZA 2L2MA 2L33A 1GQEA 5LMNE 4DUYE 1PDAA 3C4TA 4FK5C 2YU5A 1T4LB 2ZM6E 1GZ6A 4DV3E 2DRPA 4R2DA 2LVHA 1JK1A 2DMIA 4KHPE 1QNTA 1WHQA 2VQFE 4HTGA 1L4SA 3J7Yp 5LMUE 4YY3E 2NA2A 2E72A 2EMFA 2CTDA 2EN1A 1PJSA 2J7JA 2YPNA 1YUJA 1TN9A 2EM4A 2YTFA 2V8QB 1J5EE 2V89A 2V83A 3VYXA 4DR6E 1G2FC 1DQ3A 2ODRD 2CSHA 4DR5E 2EMKA 2B3TB 2L2NA 2UUCE 3ADIA 1A1FA 4LF4E 2YU8A 1QU6A 4R03A 4MLQA 2EOZA 1HNXE 4ZYEA 2H36X 1A1GA 4R2PA 5A6JA 2RSIA 4GKJE 1KYQA 2JR1A 1N36E 1ZBTA 1MEYC 2MDRA 4R8OA 2EM9A 4JI3E 1X5WA 1UILA 4ZYGA 3VK6A 2B7VA 3IWCA 2LCEA 1YFHA 4L5NC 1ZAAC 2EOSA 1EKZA 4X64E 1X48A 2EPRA 4WPYA 2B9DA 2WCC3 2YRHA 1PJQA 2YSOA 4BHCA 2YRMA 3EPKA 3BF2A 3KZYA 2EPCA 1TF6A 2V87A 4F2JC 4OX9E 1A1IA 4LFCE 2LUPB 4BS9A 5BR8E 4ZYDA 2YTPA 4F6NA 4M0VA 2KONA 4R2QA 1WRJA 2I13A 4F9CB 3VYYA 4YHHE 2EM8A 2EMWA 4RHBB 4LTYA 4BBYA 3F6HA 2DSYA 2ELZA 4O43A 2E5LE 3THOB 2DLKA 3EPLA 1A1HA 2WZOA 3ECRA 2FV4B 4LF6E 3C6MA 2GPIA 1YPNA 2EMGA 3AV0A 4JI1E 1A1LA 2LBSB 1N32E 4WXDA 5AE3A 1IBLE 2EPLX 5LLQA 1DI2A 2EQ1A 2JYAA 2GLIA 2EORA 1SFEA 1YSAC 2NUFA 1P47A 2UUAE 2EPPA 4DV1E 5F3WA 4NXME 3TQMA 2EWLA 2EOMA 2EOXA 2ODRC 2EMLA 4DV4E 3IWBA 2YTIA 2VE7C 1X47A 2EMAA 4IJDA 2EOFA 4WSGA 5AASA 4GZNC 1YYWA 4X9JA 3HTXA 2EMHA 4NHRA 5IT9C 4DV5E 4KWYA 4DV7E 2YT4A 2EOHA 2WBSA 2UXBE 2M4IA 3C4BA 1EH8A 2EOOA 4JI0E 2MKDA 2YRKA
chains in the Genus database with same CATH topology
2CT1A 2EOZA 2R1FA 2EN2A 1A1GA 1X6EA 1ZR9A 2EMCA 2EMZA 1ZU1A 4R2PA 2RSIA 2EM0A 2EPUA 2DLQA 2MDGA 2YTEA 1BBOA 2EN4A 1MEYC 3EPHA 2EM9A 3EPJA 1X5WA 2EM5A 2EOYA 1RMDA 3MHHC 2PRTA 5KL7A 1X6HA 2ENAA 1YUIA 2LCEA 2EN8A 2ADRA 2YSPA 3MHSC 1ZAAC 2WBTA 2EOSA 2EQ0A 2YTJA 2EPRA 2EL6A 2EL5A 2EMXA 2DGCA 4M9VC 2WCC3 2JPAA 1JK2A 2D9HA 2EMYA 2YRHA 1NCSA 2YSOA 2ENHA 3VHTB 4IS1C 3UK3C 2EN7A 2YRMA 1TF3A 3EPKA 2EN6A 2EMBA 2EPCA 1TF6A 2YTDA 4F2JC 2EOEA 2YTNA 1A1IA 2EP3A 2RPCA 5KL3A 2EE8A 1BB8A 2EMIA 4R2SA 2YTGA 2YTPA 4F6NA 1AAYA 1B69A 2ENCA 1G2DC 4R2QA 2I13A 2EPAA 4R2CA 2NABA 2EL4A 1X6FA 1LLMC 5KL6A 1F2IG 1UBDC 5KL5A 4F6MA 2EM8A 2EOJA 2EMWA 2A25A 2BB8A 2EJ4A 4FK5C 2GHFA 2LO3A 2ELZA 2YU5A 3EPLA 2DLKA 1A1HA 2HGHA 2EOQA 2EPZA 2M9AA 2DRPA 2EMGA 4R2DA 2LVHA 1JK1A 2DMIA 1X3CA 2JP9A 2EM7A 1A1LA 2EPXA 1DGCA 2ELYA 2EOIA 5KL4A 1A1JA 2EM3A 2EQ1A 2GLIA 2EORA 2LV2A 1YSAC 2E72A 2EMFA 1UN6B 2CTDA 1P47A 2EM6A 2VRDA 2EPPA 2EN3A 3M99B 2EN1A 2WBUA 2MKNA 1YUJA 2J7JA 1TN9A 2EOMA 2EOXA 1Z1BA 2EMLA 2EM4A 5KL2A 1KJKA 2YTIA 2EQ3A 2YTFA 2EMAA 2YTOA 4IJDA 2EOFA 4WSGA 4GZNC 4R2RA 4X9JA 2EM2A 4R2EA 1WJPA 2EMHA 2YTQA 1G2FC 2CSHA 2EOHA 2EMKA 2WBSA 1A1FA 2EOOA 2LT7A 2YU8A 4R2AA 1A1KA 2MKDA 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2EOZ A;  2R1F A;  2EN2 A;  1A1G A;  1X6E A;  1ZR9 A;  2EMC A;  2EMZ A;  1ZU1 A;  4R2P A;  2RSI A;  2EM0 A;  2EPU A;  2DLQ A;  2MDG A;  2YTE A;  1BBO A;  2EN4 A;  1MEY C;  3EPH A;  2EM9 A;  3EPJ A;  1X5W A;  2EM5 A;  2EOY A;  1RMD A;  3MHH C;  2PRT A;  5KL7 A;  1X6H A;  2ENA A;  1YUI A;  2LCE A;  2EN8 A;  2ADR A;  2YSP A;  3MHS C;  1ZAA C;  2WBT A;  2EOS A;  2EQ0 A;  2YTJ A;  2EPR A;  2EL6 A;  2EL5 A;  2EMX A;  2DGC A;  4M9V C;  2WCC 3;  2JPA A;  1JK2 A;  2D9H A;  2EMY A;  2YRH A;  1NCS A;  2YSO A;  2ENH A;  3VHT B;  4IS1 C;  3UK3 C;  2EN7 A;  2YRM A;  1TF3 A;  3EPK A;  2EN6 A;  2EMB A;  2EPC A;  1TF6 A;  2YTD A;  4F2J C;  2EOE A;  2YTN A;  1A1I A;  2EP3 A;  2RPC A;  5KL3 A;  2EE8 A;  1BB8 A;  2EMI A;  4R2S A;  2YTG A;  2YTP A;  4F6N A;  1AAY A;  1B69 A;  2ENC A;  1G2D C;  4R2Q A;  2I13 A;  2EPA A;  4R2C A;  2NAB A;  2EL4 A;  1X6F A;  1LLM C;  5KL6 A;  1F2I G;  1UBD C;  5KL5 A;  4F6M A;  2EM8 A;  2EOJ A;  2EMW A;  2A25 A;  2BB8 A;  2EJ4 A;  4FK5 C;  2GHF A;  2LO3 A;  2ELZ A;  2YU5 A;  3EPL A;  2DLK A;  1A1H A;  2HGH A;  2EOQ A;  2EPZ A;  2M9A A;  2DRP A;  2EMG A;  4R2D A;  2LVH A;  1JK1 A;  2DMI A;  1X3C A;  2JP9 A;  2EM7 A;  1A1L A;  2EPX A;  1DGC A;  2ELY A;  2EOI A;  5KL4 A;  1A1J A;  2EM3 A;  2EQ1 A;  2GLI A;  2EOR A;  2LV2 A;  1YSA C;  2E72 A;  2EMF A;  1UN6 B;  2CTD A;  1P47 A;  2EM6 A;  2VRD A;  2EPP A;  2EN3 A;  3M99 B;  2EN1 A;  2WBU A;  2MKN A;  1YUJ A;  2J7J A;  1TN9 A;  2EOM A;  2EOX A;  1Z1B A;  2EML A;  2EM4 A;  5KL2 A;  1KJK A;  2YTI A;  2EQ3 A;  2YTF A;  2EMA A;  2YTO A;  4IJD A;  2EOF A;  4WSG A;  4GZN C;  4R2R A;  4X9J A;  2EM2 A;  4R2E A;  1WJP A;  2EMH A;  2YTQ A;  1G2F C;  2CSH A;  2EOH A;  2EMK A;  2WBS A;  1A1F A;  2EOO A;  2LT7 A;  2YU8 A;  4R2A A;  1A1K A;  2MKD A;  2YRK A; 
#chains in the Genus database with same CATH topology
 4NXN E;  1T4O A;  2R1F A;  1UHZ A;  2EPK X;  5LL6 R;  1ZU1 A;  1N3G A;  2DIX A;  4JI8 E;  2LMZ A;  2EPO A;  1BBO A;  2JVA A;  4BC9 A;  3EPJ A;  2CPN A;  4WFT A;  2R76 A;  4MLV A;  4BC7 A;  3THN A;  2EOY A;  4F9B B;  5KL7 A;  2DMY A;  1X6H A;  4F9A B;  1IQO A;  2EN8 A;  4B3R E;  1XNR E;  3MHS C;  4LFA E;  4K0K E;  2EQ0 A;  4M9V C;  1JK2 A;  2JWO A;  4GKK E;  3UK3 C;  3FIG A;  1TF3 A;  3HPZ A;  2UXC E;  1O0W A;  4DV0 E;  2EMB A;  3K6Q A;  2RSM A;  2YTN A;  2EP3 A;  4O24 A;  3BBG A;  4LF5 E;  1BB8 A;  4R2S A;  2YTG A;  2L3C A;  2K4V A;  2M1S A;  1G2D C;  2EPA A;  4BMJ A;  5TSE A;  2EL4 A;  1UBD C;  1F2I G;  5KL6 A;  2VQE E;  1SR9 A;  1AH5 A;  4DV6 E;  4BHB A;  1J26 A;  1X49 A;  4M30 A;  3J81 C;  2RS6 A;  1XNQ E;  2M7Q A;  3HPS A;  2HGH A;  2K7I A;  4B3S E;  2EOQ A;  4WYQ B;  2I9I A;  2EZ6 A;  4DV2 E;  2HC5 A;  5A6A A;  3J80 C;  4F54 A;  1IMU A;  1YYK A;  3ADJ A;  4O5G A;  1BBG A;  2JP9 A;  2EPX A;  2L6M A;  2V85 A;  3RMP A;  1DGC A;  2ELY A;  4DR7 E;  3T1H E;  4P78 A;  5A69 A;  4TUG A;  2LV2 A;  5T6J A;  3JTZ A;  5FLX C;  4M2Z A;  4ZYH A;  4DR4 E;  2VRD A;  2EN3 A;  3J7A G;  4KZS A;  2LE2 A;  5A2Q C;  4B3M E;  4WSP A;  1KJK A;  3HQ1 A;  4B3T E;  2EQ3 A;  4NZV A;  2DB2 A;  4J8Z A;  1T4N A;  3T1Y E;  1MGT A;  2YTQ A;  4JI5 E;  1YYO A;  2IHR 1;  4Q35 B;  5IWA E;  1A1K A;  3IWD A;  4X66 E;  2CT1 A;  4OOG C;  2EMC A;  4DR3 E;  2EPU A;  3LML A;  4GEQ B;  2DLQ A;  2L3J A;  2MDG A;  2YTE A;  4JYA E;  1IBM E;  2EN4 A;  3EPH A;  3LLH A;  2LJH A;  2EM5 A;  5A6K A;  4LF8 E;  2F4V E;  2PRT A;  3KWR A;  1N33 E;  2ENA A;  1YUI A;  3EQ1 A;  2ADR A;  4DR2 E;  3P1X A;  5A6B D;  3HXL A;  4WXC A;  2EMX A;  2YZT A;  4DKK A;  3DJW A;  2EMY A;  1NCS A;  2ENH A;  3VHT B;  5CFF E;  4JI6 E;  4JI4 E;  4X62 E;  4DUZ E;  2HJJ A;  4AQY E;  2EN6 A;  1RC7 A;  1STU A;  5IXM B;  1WXR A;  2UUB E;  2L92 A;  2YTD A;  4P7D A;  1RQ0 A;  2EOE A;  5ADZ A;  1FKA E;  2RPC A;  5IV8 B;  1ZBQ A;  4LU9 A;  2JOB A;  3JAM C;  2L8T A;  2Q8U A;  2LRS A;  1AAY A;  2ENC A;  2KHX A;  1EH7 A;  4JI2 E;  1X6F A;  1LLM C;  3C6K A;  1IQS A;  3JU0 A;  4N4R B;  2G7H A;  5KL5 A;  4F6M A;  2VF1 A;  1XMO E;  2EOJ A;  2A25 A;  1XMQ E;  2BB8 A;  2EJ4 A;  2RTX A;  1PKP A;  4DMI A;  2N3G A;  2GHF A;  2LO3 A;  2LTR A;  2JXP A;  3H09 A;  3OTO E;  1N34 E;  2EPZ A;  2M9A A;  2EPN A;  2V86 A;  5DNY A;  1X3C A;  2EM7 A;  1I94 E;  1GTK A;  5AE2 A;  2EOI A;  5KL4 A;  4LFB E;  1A1J A;  2N3H A;  2EM3 A;  5AC4 A;  2MC5 A;  4LF7 E;  3BGH A;  5AC5 A;  1YZ9 A;  2FTX B;  4X8W A;  1UN6 B;  3ADL A;  1FJG E;  2EM6 A;  2E1M A;  3M99 B;  2MKN A;  2WBU A;  3L00 A;  1Z1B A;  5KL2 A;  3F6G A;  4JV5 E;  2RQL A;  2YTO A;  2NUE A;  4R2R A;  2EM2 A;  1WHN A;  1WJP A;  4R2E A;  1IBK E;  5AE1 A;  2BBG A;  2L2K B;  2LT7 A;  4R2A A;  2UXD E;  4HEI A;  2KOU A;  2MC6 A;  2F8B A;  4RH8 A;  1T38 A;  1PJT A;  2EN2 A;  2V88 A;  4Q28 A;  1X6E A;  3BID A;  1ZR9 A;  2EMZ A;  2EPM X;  4DR1 E;  2EM0 A;  4WX9 A;  2N8X A;  4L8N A;  1HNW E;  1EH6 A;  4I8O A;  4X65 E;  1RMD A;  3MHH C;  2JOX A;  3MSW A;  4TUI A;  4BCA A;  3OML A;  2LJU A;  2LTS A;  2YSP A;  4JI7 E;  2WBT A;  3ZOQ B;  2YTJ A;  1T39 A;  2EL6 A;  2EL5 A;  2DGC A;  2NUG A;  2UU9 E;  3QG5 C;  2JPA A;  2D9H A;  4O4K A;  1HNZ E;  4IS1 C;  2JY9 A;  2EN7 A;  2YWQ A;  2HHH E;  3AUZ A;  3DF6 A;  5KL3 A;  1HR0 E;  2EE8 A;  2EMI A;  2B7T A;  2FGG A;  2RS7 A;  5A6B A;  1NEI A;  1B69 A;  2LUQ A;  3ADG A;  4R2C A;  2NAB A;  4LF9 E;  3KZZ A;  2L2M A;  2L33 A;  1GQE A;  5LMN E;  4DUY E;  1PDA A;  3C4T A;  4FK5 C;  2YU5 A;  1T4L B;  2ZM6 E;  1GZ6 A;  4DV3 E;  2DRP A;  4R2D A;  2LVH A;  1JK1 A;  2DMI A;  4KHP E;  1QNT A;  1WHQ A;  2VQF E;  4HTG A;  1L4S A;  3J7Y p;  5LMU E;  4YY3 E;  2NA2 A;  2E72 A;  2EMF A;  2CTD A;  2EN1 A;  1PJS A;  2J7J A;  2YPN A;  1YUJ A;  1TN9 A;  2EM4 A;  2YTF A;  2V8Q B;  1J5E E;  2V89 A;  2V83 A;  3VYX A;  4DR6 E;  1G2F C;  1DQ3 A;  2ODR D;  2CSH A;  4DR5 E;  2EMK A;  2B3T B;  2L2N A;  2UUC E;  3ADI A;  1A1F A;  4LF4 E;  2YU8 A;  1QU6 A;  4R03 A;  4MLQ A;  2EOZ A;  1HNX E;  4ZYE A;  2H36 X;  1A1G A;  4R2P A;  5A6J A;  2RSI A;  4GKJ E;  1KYQ A;  2JR1 A;  1N36 E;  1ZBT A;  1MEY C;  2MDR A;  4R8O A;  2EM9 A;  4JI3 E;  1X5W A;  1UIL A;  4ZYG A;  3VK6 A;  2B7V A;  3IWC A;  2LCE A;  1YFH A;  4L5N C;  1ZAA C;  2EOS A;  1EKZ A;  4X64 E;  1X48 A;  2EPR A;  4WPY A;  2B9D A;  2WCC 3;  2YRH A;  1PJQ A;  2YSO A;  4BHC A;  2YRM A;  3EPK A;  3BF2 A;  3KZY A;  2EPC A;  1TF6 A;  2V87 A;  4F2J C;  4OX9 E;  1A1I A;  4LFC E;  2LUP B;  4BS9 A;  5BR8 E;  4ZYD A;  2YTP A;  4F6N A;  4M0V A;  2KON A;  4R2Q A;  1WRJ A;  2I13 A;  4F9C B;  3VYY A;  4YHH E;  2EM8 A;  2EMW A;  4RHB B;  4LTY A;  4BBY A;  3F6H A;  2DSY A;  2ELZ A;  4O43 A;  2E5L E;  3THO B;  2DLK A;  3EPL A;  1A1H A;  2WZO A;  3ECR A;  2FV4 B;  4LF6 E;  3C6M A;  2GPI A;  1YPN A;  2EMG A;  3AV0 A;  4JI1 E;  1A1L A;  2LBS B;  1N32 E;  4WXD A;  5AE3 A;  1IBL E;  2EPL X;  5LLQ A;  1DI2 A;  2EQ1 A;  2JYA A;  2GLI A;  2EOR A;  1SFE A;  1YSA C;  2NUF A;  1P47 A;  2UUA E;  2EPP A;  4DV1 E;  5F3W A;  4NXM E;  3TQM A;  2EWL A;  2EOM A;  2EOX A;  2ODR C;  2EML A;  4DV4 E;  3IWB A;  2YTI A;  2VE7 C;  1X47 A;  2EMA A;  4IJD A;  2EOF A;  4WSG A;  5AAS A;  4GZN C;  1YYW A;  4X9J A;  3HTX A;  2EMH A;  4NHR A;  5IT9 C;  4DV5 E;  4KWY A;  4DV7 E;  2YT4 A;  2EOH A;  2WBS A;  2UXB E;  2M4I A;  3C4B A;  1EH8 A;  2EOO A;  4JI0 E;  2MKD A;  2YRK A; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2EOZ A;  2R1F A;  2EN2 A;  1A1G A;  1X6E A;  1ZR9 A;  2EMC A;  2EMZ A;  1ZU1 A;  4R2P A;  2RSI A;  2EM0 A;  2EPU A;  2DLQ A;  2MDG A;  2YTE A;  1BBO A;  2EN4 A;  1MEY C;  3EPH A;  2EM9 A;  3EPJ A;  1X5W A;  2EM5 A;  2EOY A;  1RMD A;  3MHH C;  2PRT A;  5KL7 A;  1X6H A;  2ENA A;  1YUI A;  2LCE A;  2EN8 A;  2ADR A;  2YSP A;  3MHS C;  1ZAA C;  2WBT A;  2EOS A;  2EQ0 A;  2YTJ A;  2EPR A;  2EL6 A;  2EL5 A;  2EMX A;  2DGC A;  4M9V C;  2WCC 3;  2JPA A;  1JK2 A;  2D9H A;  2EMY A;  2YRH A;  1NCS A;  2YSO A;  2ENH A;  3VHT B;  4IS1 C;  3UK3 C;  2EN7 A;  2YRM A;  1TF3 A;  3EPK A;  2EN6 A;  2EMB A;  2EPC A;  1TF6 A;  2YTD A;  4F2J C;  2EOE A;  2YTN A;  1A1I A;  2EP3 A;  2RPC A;  5KL3 A;  2EE8 A;  1BB8 A;  2EMI A;  4R2S A;  2YTG A;  2YTP A;  4F6N A;  1AAY A;  1B69 A;  2ENC A;  1G2D C;  4R2Q A;  2I13 A;  2EPA A;  4R2C A;  2NAB A;  2EL4 A;  1X6F A;  1LLM C;  5KL6 A;  1F2I G;  1UBD C;  5KL5 A;  4F6M A;  2EM8 A;  2EOJ A;  2EMW A;  2A25 A;  2BB8 A;  2EJ4 A;  4FK5 C;  2GHF A;  2LO3 A;  2ELZ A;  2YU5 A;  3EPL A;  2DLK A;  1A1H A;  2HGH A;  2EOQ A;  2EPZ A;  2M9A A;  2DRP A;  2EMG A;  4R2D A;  2LVH A;  1JK1 A;  2DMI A;  1X3C A;  2JP9 A;  2EM7 A;  1A1L A;  2EPX A;  1DGC A;  2ELY A;  2EOI A;  5KL4 A;  1A1J A;  2EM3 A;  2EQ1 A;  2GLI A;  2EOR A;  2LV2 A;  1YSA C;  2E72 A;  2EMF A;  1UN6 B;  2CTD A;  1P47 A;  2EM6 A;  2VRD A;  2EPP A;  2EN3 A;  3M99 B;  2EN1 A;  2WBU A;  2MKN A;  1YUJ A;  2J7J A;  1TN9 A;  2EOM A;  2EOX A;  1Z1B A;  2EML A;  2EM4 A;  5KL2 A;  1KJK A;  2YTI A;  2EQ3 A;  2YTF A;  2EMA A;  2YTO A;  4IJD A;  2EOF A;  4WSG A;  4GZN C;  4R2R A;  4X9J A;  2EM2 A;  4R2E A;  1WJP A;  2EMH A;  2YTQ A;  1G2F C;  2CSH A;  2EOH A;  2EMK A;  2WBS A;  1A1F A;  2EOO A;  2LT7 A;  2YU8 A;  4R2A A;  1A1K A;  2MKD A;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...