1UBDC

Co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*GP*GP*TP*CP*TP*CP*CP*AP*TP*TP*TP*TP*GP*AP*A
publication title Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ubdC01
1UBDC 4R2QA 2EOEA 2WBSA 2EMKA 5KL6A 4R2RA 1F2IG 1G2FC 2EOXA 2EN6A 2EMGA 2YTEA 2YTQA 5KL4A 3EPKA 2DRPA 3EPHA 2E72A 1KJKA 3EPLA 2DGCA 1DGCA 2EMLA 5KL5A 2I13A 2EOJA 3EPJA 2EMHA 5KL3A 2RPCA 2EOQA 2WBTA 1BB8A 2YU5A 2YTNA 2EE8A 1P47A 2EN2A 3VHTB 2YTPA 2GLIA 2YSPA 2EPXA 1X5WA 1JK1A 2EMFA 1NCSA 4R2EA 2CTDA 2DLKA 2YTGA 2DMIA 4X9JA 1Z1BA 4M9VC 2EMBA 2EN4A 4IJDA 1A1IA 2EOFA 3UK3C 2ADRA 1ZU1A 2YRKA 2EOIA 1RMDA 2ENAA 2EPAA 4R2DA 2YTOA 2YU8A 1LLMC 2EL4A 2EPUA 1B69A 2EPRA 2ENHA 2EQ0A 1X6EA 2EMYA 2EM7A 2EOYA 2J7JA 2EMIA 1YSAC 2YRHA 2EM6A 4FK5C 1JK2A 2WCC3 5KL7A 1A1HA 1X6FA 4WSGA 4R2AA 1G2DC 2EP3A 1A1LA 1TF3A 1BBOA 4IS1C 2CT1A 2EQ1A 2EPPA 2LVHA 2BB8A 2EMXA 2MKDA 2HGHA 2YTFA 1X3CA 2EPZA 1X6HA 2EOMA 2JPAA 2EL5A 4R2CA 4F2JC 2LV2A 4F6NA 2EN7A 2DLQA 2ENCA 4R2PA 2EN8A 2YTIA 2YTJA 2EM3A 1A1JA 2EM5A 2MKNA 2RSIA 4F6MA 1YUIA 1A1GA 1A1FA 2LCEA 3M99B 2EN3A 2EOSA 2EM4A 2CSHA 2EJ4A 2M9AA 5KL2A 2LT7A 1YUJA 2EM0A 2EMCA 2EPCA 2EMWA 2ELZA 2EQ3A 1ZR9A 2EORA 2YRMA 1ZAAC 2EOZA 2R1FA 2EMZA 2LO3A 2EM9A 2GHFA 2EMAA 4R2SA 2JP9A 3MHSC 4GZNC 3MHHC 1TN9A 1UN6B 1WJPA 2MDGA 2VRDA 2EN1A 1A1KA 2D9HA 2EOHA 2PRTA 1AAYA 2NABA 2ELYA 2EOOA 2YTDA 2EM8A 2EL6A 2YSOA 2EM2A 1MEYC 2A25A 1TF6A 2WBUA
chains in the Genus database with same CATH superfamily
1UBDC 2HC5A 3T1YE 2EOXA 2EN6A 2YTEA 2YTQA 2NUFA 3EPLA 1N32E 2EMLA 3J81C 4LFBE 4I8OA 4F9CB 2VQFE 4LF7E 2B7TA 2I13A 2EOJA 1J26A 3EPJA 4TUGA 5A6BD 2RPCA 2WBTA 4X8WA 1T4NA 3VHTB 2B3TB 5BR8E 2KHXA 3KWRA 1JK1A 1NCSA 4ZYGA 2DMIA 5A6AA 4JV5E 4IJDA 4HTGA 5A6BA 2EPOA 3UK3C 1YFHA 4BCAA 4MLVA 4DR3E 5AC5A 1SR9A 2ENAA 4LTYA 5LMUE 5IV8B 3P1XA 4DUZE 2YTOA 4LF8E 2V83A 1LLMC 2EPUA 4DR5E 2DIXA 2ENHA 4LU9A 1X6EA 3J7AG 2V88A 4L5NC 2EOYA 2RQLA 2YRHA 2LTSA 1JK2A 4JI0E 5AC4A 4JI3E 2EP3A 1TF3A 3ZOQB 2BBGA 4BC7A 4YY3E 2EPZA 4WXCA 4X66E 3JU0A 2LV2A 4WYQB 2I9IA 4F54A 2KOUA 2FTXB 2L3JA 3C6MA 2VF1A 1PJQA 3C4TA 2UUBE 1A1GA 1WRJA 4YHHE 2CSHA 5KL2A 2EPLX 1WHQA 2EM0A 4GKJE 3HTXA 2EQ3A 4OOGC 5AE3A 2N3GA 4JI2E 2EMZA 2LO3A 2EM9A 5TSEA 4R2SA 2JP9A 4B3RE 2UXCE 3MHHC 1X49A 2MDGA 1X47A 2Q8UA 5DNYA 2D9HA 4DV5E 2EOHA 2PRTA 2R76A 2UXDE 3ADIA 4P78A 3MSWA 2LUPB 2RS7A 2EL6A 2A25A 5FLXC 5IWAE 2JWOA 3ADJA 4X62E 1DQ3A 2EMKA 5KL6A 2EPKX 1EH7A 2EMGA 5KL4A 1DI2A 2LJUA 4WSPA 1KJKA 2L2NA 2V85A 2GPIA 4OX9E 2B9DA 1XMQE 4B3ME 4WX9A 5A69A 1BB8A 2YU5A 3ECRA 3VYYA 2EE8A 2FGGA 2EN2A 3OTOE 1FKAE 2NUEA 4R2EA 4X9JA 2DLKA 4O5GA 4M30A 2L3CA 2EMBA 4X65E 1N3GA 2L6MA 5T6JA 2DMYA 2M1SA 1XNRE 2V8QB 2EPAA 1QNTA 4R2DA 3BIDA 2JXPA 4WXDA 4RHBB 5A6KA 4KZSA 1XMOE 2EMYA 5LL6R 3L00A 4DV6E 1IMUA 4NXNE 2JOBA 1X6FA 2LMZA 3HXLA 4DV1E 1IQSA 1ZBTA 1A1LA 1BBOA 5A6JA 3JTZA 4DR2E 1X48A 4IS1C 2CT1A 2EMXA 2MKDA 2YTFA 1X3CA 3F6GA 2EOMA 2JPAA 4F6NA 4F2JC 1MGTA 4JI6E 2EN8A 4N4RB 1T39A 1A1JA 2EM5A 1IBLE 2ODRD 5CFFE 4Q35B 2LCEA 2JOXA 2EN3A 2UU9E 2EOSA 3TQMA 1STUA 4LFCE 1YZ9A 2EMWA 4R8OA 2ELZA 2JVAA 4NZVA 1ZR9A 2FV4B 2NA2A 1ZAAC 2R1FA 2DSYA 4RH8A 2M7QA 5AASA 3RMPA 1UHZA 2L2MA 3BGHA 3C6KA 2EPNA 4JI4E 4DV4E 3MHSC 1SFEA 4BBYA 1TN9A 2VRDA 2EN1A 1A1KA 3EQ1A 5AE2A 2VQEE 2L8TA 2NABA 2WZOA 2YTDA 2EM8A 2K7IA 2ZM6E 1MEYC 4LF4E 4L8NA 4WFTA 1IBME 4WPYA 1T4OA 1YPNA 2WBUA 1PDAA 4R2QA 1F2IG 4R2RA 1G2FC 3EPKA 2YWQA 1KYQA 2LUQA 1DGCA 3IWBA 4JI7E 2CPNA 1BBGA 2LRSA 2K4VA 4DV2E 1RC7A 5LLQA 2JY9A 1N36E 4JI1E 4DR1E 3KZYA 1PJSA 4LF5E 2GLIA 1GZ6A 2YTPA 3IWDA 3FIGA 2YSPA 1X5WA 2EPXA 2V87A 2CTDA 1Z1BA 4M9VC 4F9BB 1XNQE 1HR0E 4DR7E 3HQ1A 4M0VA 1ZU1A 4BC9A 2N8XA 4O43A 2YRKA 1RQ0A 3OMLA 1RMDA 3DJWA 3J7Yp 2F4VE 3DF6A 4F9AB 3IWCA 1WXRA 2LBSB 3ADGA 2EQ0A 4DKKA 2UUAE 2EM7A 1GTKA 1YSAC 4FK5C 2WCC3 1FJGE 2L2KB 4WSGA 4R2AA 4BHBA 1G2DC 2LTRA 2EQ1A 1N34E 4R03A 3AV0A 5F3WA 2BB8A 2HGHA 3LMLA 3QG5C 2EZ6A 1EH6A 1X6HA 3BF2A 4MLQA 2ENCA 4K0KE 2YTIA 1IBKE 2EM3A 2MKNA 4F6MA 4LFAE 4ZYDA 2M4IA 1T4LB 1HNXE 1YUIA 4KWYA 2L92A 3M99B 2EPMX 5ADZA 1EH8A 2EM4A 2EJ4A 1YUJA 2EPCA 2V86A 3HPZA 2E1MA 2YRMA 2LJHA 3C4BA 4J8ZA 2RS6A 4B3SE 2RSMA 4DMIA 2EMAA 3KZZA 4HEIA 2E5LE 1UN6B 1WJPA 4M2ZA 3LLHA 1AAYA 5LMNE 4KHPE 3K6QA 3AUZA 2RTXA 1I94E 2YSOA 2UUCE 2EM2A 2G7HA 2HJJA 2YZTA 2UXBE 2LE2A 2WBSA 2EOEA 1GQEA 1T38A 2EWLA 1QU6A 3EPHA 2DRPA 2HHHE 2E72A 4NXME 1YYOA 4JI8E 2DGCA 4DV3E 2JYAA 5KL5A 4X64E 1HNZE 2V89A 4LF9E 2EMHA 2YT4A 5KL3A 1WHNA 3F6HA 2EOQA 4Q28A 1J5EE 4O4KA 2YTNA 3JAMC 1P47A 1IQOA 4GKKE 4DUYE 1PKPA 2EMFA 4TUIA 2YTGA 4BHCA 5A2QC 3THNA 2EN4A 4ZYHA 1A1IA 2L33A 4ZYEA 2ODRC 3J80C 2EOFA 3VYXA 2ADRA 2YPNA 4NHRA 1YYWA 2EOIA 4DV7E 4LF6E 1YYKA 5IXMB 2H36X 4GEQB 1NEIA 2YU8A 2EL4A 2DB2A 1B69A 2EPRA 4BMJA 4DV0E 1ZBQA 2MC6A 4JYAE 2J7JA 1AH5A 2EMIA 2EM6A 4P7DA 4AQYE 1A1HA 5KL7A 1PJTA 4DR6E 5AE1A 2EPPA 2LVHA 1UILA 4B3TE 3VK6A 2EL5A 4R2CA 2EN7A 2DLQA 1N33E 4R2PA 4DR4E 2F8BA 2YTJA 2IHR1 2RSIA 2N3HA 2NUGA 1A1FA 3ADLA 3HPSA 4O24A 2VE7C 2LT7A 2M9AA 5IT9C 2EMCA 2EORA 3BBGA 2EOZA 2MC5A 2GHFA 2MDRA 1L4SA 4GZNC 1HNWE 2B7VA 1EKZA 3H09A 4JI5E 3T1HE 1O0WA 2KONA 2ELYA 2EOOA 3THOB 4BS9A 2JR1A 1TF6A
chains in the Genus database with same CATH topology
1UBDC 4R2QA 2EOEA 2WBSA 2EMKA 5KL6A 4R2RA 1F2IG 1G2FC 2EOXA 2EN6A 2EMGA 2YTEA 2YTQA 5KL4A 3EPKA 2DRPA 3EPHA 2E72A 1KJKA 3EPLA 2DGCA 1DGCA 2EMLA 5KL5A 2I13A 2EOJA 3EPJA 2EMHA 5KL3A 2RPCA 2EOQA 2WBTA 1BB8A 2YU5A 2YTNA 2EE8A 1P47A 2EN2A 3VHTB 2YTPA 2GLIA 2YSPA 2EPXA 1X5WA 1JK1A 2EMFA 1NCSA 4R2EA 2CTDA 2DLKA 2YTGA 2DMIA 4X9JA 1Z1BA 4M9VC 2EMBA 2EN4A 4IJDA 1A1IA 2EOFA 3UK3C 2ADRA 1ZU1A 2YRKA 2EOIA 1RMDA 2ENAA 2EPAA 4R2DA 2YTOA 2YU8A 1LLMC 2EL4A 2EPUA 1B69A 2EPRA 2ENHA 2EQ0A 1X6EA 2EMYA 2EM7A 2EOYA 2J7JA 2EMIA 1YSAC 2YRHA 2EM6A 4FK5C 1JK2A 2WCC3 5KL7A 1A1HA 1X6FA 4WSGA 4R2AA 1G2DC 2EP3A 1A1LA 1TF3A 1BBOA 4IS1C 2CT1A 2EQ1A 2EPPA 2LVHA 2BB8A 2EMXA 2MKDA 2HGHA 2YTFA 1X3CA 2EPZA 1X6HA 2EOMA 2JPAA 2EL5A 4R2CA 4F2JC 2LV2A 4F6NA 2EN7A 2DLQA 2ENCA 4R2PA 2EN8A 2YTIA 2YTJA 2EM3A 1A1JA 2EM5A 2MKNA 2RSIA 4F6MA 1YUIA 1A1GA 1A1FA 2LCEA 3M99B 2EN3A 2EOSA 2EM4A 2CSHA 2EJ4A 2M9AA 5KL2A 2LT7A 1YUJA 2EM0A 2EMCA 2EPCA 2EMWA 2ELZA 2EQ3A 1ZR9A 2EORA 2YRMA 1ZAAC 2EOZA 2R1FA 2EMZA 2LO3A 2EM9A 2GHFA 2EMAA 4R2SA 2JP9A 3MHSC 4GZNC 3MHHC 1TN9A 1UN6B 1WJPA 2MDGA 2VRDA 2EN1A 1A1KA 2D9HA 2EOHA 2PRTA 1AAYA 2NABA 2ELYA 2EOOA 2YTDA 2EM8A 2EL6A 2YSOA 2EM2A 1MEYC 2A25A 1TF6A 2WBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBD C;  4R2Q A;  2EOE A;  2WBS A;  2EMK A;  5KL6 A;  4R2R A;  1F2I G;  1G2F C;  2EOX A;  2EN6 A;  2EMG A;  2YTE A;  2YTQ A;  5KL4 A;  3EPK A;  2DRP A;  3EPH A;  2E72 A;  1KJK A;  3EPL A;  2DGC A;  1DGC A;  2EML A;  5KL5 A;  2I13 A;  2EOJ A;  3EPJ A;  2EMH A;  5KL3 A;  2RPC A;  2EOQ A;  2WBT A;  1BB8 A;  2YU5 A;  2YTN A;  2EE8 A;  1P47 A;  2EN2 A;  3VHT B;  2YTP A;  2GLI A;  2YSP A;  2EPX A;  1X5W A;  1JK1 A;  2EMF A;  1NCS A;  4R2E A;  2CTD A;  2DLK A;  2YTG A;  2DMI A;  4X9J A;  1Z1B A;  4M9V C;  2EMB A;  2EN4 A;  4IJD A;  1A1I A;  2EOF A;  3UK3 C;  2ADR A;  1ZU1 A;  2YRK A;  2EOI A;  1RMD A;  2ENA A;  2EPA A;  4R2D A;  2YTO A;  2YU8 A;  1LLM C;  2EL4 A;  2EPU A;  1B69 A;  2EPR A;  2ENH A;  2EQ0 A;  1X6E A;  2EMY A;  2EM7 A;  2EOY A;  2J7J A;  2EMI A;  1YSA C;  2YRH A;  2EM6 A;  4FK5 C;  1JK2 A;  2WCC 3;  5KL7 A;  1A1H A;  1X6F A;  4WSG A;  4R2A A;  1G2D C;  2EP3 A;  1A1L A;  1TF3 A;  1BBO A;  4IS1 C;  2CT1 A;  2EQ1 A;  2EPP A;  2LVH A;  2BB8 A;  2EMX A;  2MKD A;  2HGH A;  2YTF A;  1X3C A;  2EPZ A;  1X6H A;  2EOM A;  2JPA A;  2EL5 A;  4R2C A;  4F2J C;  2LV2 A;  4F6N A;  2EN7 A;  2DLQ A;  2ENC A;  4R2P A;  2EN8 A;  2YTI A;  2YTJ A;  2EM3 A;  1A1J A;  2EM5 A;  2MKN A;  2RSI A;  4F6M A;  1YUI A;  1A1G A;  1A1F A;  2LCE A;  3M99 B;  2EN3 A;  2EOS A;  2EM4 A;  2CSH A;  2EJ4 A;  2M9A A;  5KL2 A;  2LT7 A;  1YUJ A;  2EM0 A;  2EMC A;  2EPC A;  2EMW A;  2ELZ A;  2EQ3 A;  1ZR9 A;  2EOR A;  2YRM A;  1ZAA C;  2EOZ A;  2R1F A;  2EMZ A;  2LO3 A;  2EM9 A;  2GHF A;  2EMA A;  4R2S A;  2JP9 A;  3MHS C;  4GZN C;  3MHH C;  1TN9 A;  1UN6 B;  1WJP A;  2MDG A;  2VRD A;  2EN1 A;  1A1K A;  2D9H A;  2EOH A;  2PRT A;  1AAY A;  2NAB A;  2ELY A;  2EOO A;  2YTD A;  2EM8 A;  2EL6 A;  2YSO A;  2EM2 A;  1MEY C;  2A25 A;  1TF6 A;  2WBU A; 
#chains in the Genus database with same CATH topology
 1UBD C;  2HC5 A;  3T1Y E;  2EOX A;  2EN6 A;  2YTE A;  2YTQ A;  2NUF A;  3EPL A;  1N32 E;  2EML A;  3J81 C;  4LFB E;  4I8O A;  4F9C B;  2VQF E;  4LF7 E;  2B7T A;  2I13 A;  2EOJ A;  1J26 A;  3EPJ A;  4TUG A;  5A6B D;  2RPC A;  2WBT A;  4X8W A;  1T4N A;  3VHT B;  2B3T B;  5BR8 E;  2KHX A;  3KWR A;  1JK1 A;  1NCS A;  4ZYG A;  2DMI A;  5A6A A;  4JV5 E;  4IJD A;  4HTG A;  5A6B A;  2EPO A;  3UK3 C;  1YFH A;  4BCA A;  4MLV A;  4DR3 E;  5AC5 A;  1SR9 A;  2ENA A;  4LTY A;  5LMU E;  5IV8 B;  3P1X A;  4DUZ E;  2YTO A;  4LF8 E;  2V83 A;  1LLM C;  2EPU A;  4DR5 E;  2DIX A;  2ENH A;  4LU9 A;  1X6E A;  3J7A G;  2V88 A;  4L5N C;  2EOY A;  2RQL A;  2YRH A;  2LTS A;  1JK2 A;  4JI0 E;  5AC4 A;  4JI3 E;  2EP3 A;  1TF3 A;  3ZOQ B;  2BBG A;  4BC7 A;  4YY3 E;  2EPZ A;  4WXC A;  4X66 E;  3JU0 A;  2LV2 A;  4WYQ B;  2I9I A;  4F54 A;  2KOU A;  2FTX B;  2L3J A;  3C6M A;  2VF1 A;  1PJQ A;  3C4T A;  2UUB E;  1A1G A;  1WRJ A;  4YHH E;  2CSH A;  5KL2 A;  2EPL X;  1WHQ A;  2EM0 A;  4GKJ E;  3HTX A;  2EQ3 A;  4OOG C;  5AE3 A;  2N3G A;  4JI2 E;  2EMZ A;  2LO3 A;  2EM9 A;  5TSE A;  4R2S A;  2JP9 A;  4B3R E;  2UXC E;  3MHH C;  1X49 A;  2MDG A;  1X47 A;  2Q8U A;  5DNY A;  2D9H A;  4DV5 E;  2EOH A;  2PRT A;  2R76 A;  2UXD E;  3ADI A;  4P78 A;  3MSW A;  2LUP B;  2RS7 A;  2EL6 A;  2A25 A;  5FLX C;  5IWA E;  2JWO A;  3ADJ A;  4X62 E;  1DQ3 A;  2EMK A;  5KL6 A;  2EPK X;  1EH7 A;  2EMG A;  5KL4 A;  1DI2 A;  2LJU A;  4WSP A;  1KJK A;  2L2N A;  2V85 A;  2GPI A;  4OX9 E;  2B9D A;  1XMQ E;  4B3M E;  4WX9 A;  5A69 A;  1BB8 A;  2YU5 A;  3ECR A;  3VYY A;  2EE8 A;  2FGG A;  2EN2 A;  3OTO E;  1FKA E;  2NUE A;  4R2E A;  4X9J A;  2DLK A;  4O5G A;  4M30 A;  2L3C A;  2EMB A;  4X65 E;  1N3G A;  2L6M A;  5T6J A;  2DMY A;  2M1S A;  1XNR E;  2V8Q B;  2EPA A;  1QNT A;  4R2D A;  3BID A;  2JXP A;  4WXD A;  4RHB B;  5A6K A;  4KZS A;  1XMO E;  2EMY A;  5LL6 R;  3L00 A;  4DV6 E;  1IMU A;  4NXN E;  2JOB A;  1X6F A;  2LMZ A;  3HXL A;  4DV1 E;  1IQS A;  1ZBT A;  1A1L A;  1BBO A;  5A6J A;  3JTZ A;  4DR2 E;  1X48 A;  4IS1 C;  2CT1 A;  2EMX A;  2MKD A;  2YTF A;  1X3C A;  3F6G A;  2EOM A;  2JPA A;  4F6N A;  4F2J C;  1MGT A;  4JI6 E;  2EN8 A;  4N4R B;  1T39 A;  1A1J A;  2EM5 A;  1IBL E;  2ODR D;  5CFF E;  4Q35 B;  2LCE A;  2JOX A;  2EN3 A;  2UU9 E;  2EOS A;  3TQM A;  1STU A;  4LFC E;  1YZ9 A;  2EMW A;  4R8O A;  2ELZ A;  2JVA A;  4NZV A;  1ZR9 A;  2FV4 B;  2NA2 A;  1ZAA C;  2R1F A;  2DSY A;  4RH8 A;  2M7Q A;  5AAS A;  3RMP A;  1UHZ A;  2L2M A;  3BGH A;  3C6K A;  2EPN A;  4JI4 E;  4DV4 E;  3MHS C;  1SFE A;  4BBY A;  1TN9 A;  2VRD A;  2EN1 A;  1A1K A;  3EQ1 A;  5AE2 A;  2VQE E;  2L8T A;  2NAB A;  2WZO A;  2YTD A;  2EM8 A;  2K7I A;  2ZM6 E;  1MEY C;  4LF4 E;  4L8N A;  4WFT A;  1IBM E;  4WPY A;  1T4O A;  1YPN A;  2WBU A;  1PDA A;  4R2Q A;  1F2I G;  4R2R A;  1G2F C;  3EPK A;  2YWQ A;  1KYQ A;  2LUQ A;  1DGC A;  3IWB A;  4JI7 E;  2CPN A;  1BBG A;  2LRS A;  2K4V A;  4DV2 E;  1RC7 A;  5LLQ A;  2JY9 A;  1N36 E;  4JI1 E;  4DR1 E;  3KZY A;  1PJS A;  4LF5 E;  2GLI A;  1GZ6 A;  2YTP A;  3IWD A;  3FIG A;  2YSP A;  1X5W A;  2EPX A;  2V87 A;  2CTD A;  1Z1B A;  4M9V C;  4F9B B;  1XNQ E;  1HR0 E;  4DR7 E;  3HQ1 A;  4M0V A;  1ZU1 A;  4BC9 A;  2N8X A;  4O43 A;  2YRK A;  1RQ0 A;  3OML A;  1RMD A;  3DJW A;  3J7Y p;  2F4V E;  3DF6 A;  4F9A B;  3IWC A;  1WXR A;  2LBS B;  3ADG A;  2EQ0 A;  4DKK A;  2UUA E;  2EM7 A;  1GTK A;  1YSA C;  4FK5 C;  2WCC 3;  1FJG E;  2L2K B;  4WSG A;  4R2A A;  4BHB A;  1G2D C;  2LTR A;  2EQ1 A;  1N34 E;  4R03 A;  3AV0 A;  5F3W A;  2BB8 A;  2HGH A;  3LML A;  3QG5 C;  2EZ6 A;  1EH6 A;  1X6H A;  3BF2 A;  4MLQ A;  2ENC A;  4K0K E;  2YTI A;  1IBK E;  2EM3 A;  2MKN A;  4F6M A;  4LFA E;  4ZYD A;  2M4I A;  1T4L B;  1HNX E;  1YUI A;  4KWY A;  2L92 A;  3M99 B;  2EPM X;  5ADZ A;  1EH8 A;  2EM4 A;  2EJ4 A;  1YUJ A;  2EPC A;  2V86 A;  3HPZ A;  2E1M A;  2YRM A;  2LJH A;  3C4B A;  4J8Z A;  2RS6 A;  4B3S E;  2RSM A;  4DMI A;  2EMA A;  3KZZ A;  4HEI A;  2E5L E;  1UN6 B;  1WJP A;  4M2Z A;  3LLH A;  1AAY A;  5LMN E;  4KHP E;  3K6Q A;  3AUZ A;  2RTX A;  1I94 E;  2YSO A;  2UUC E;  2EM2 A;  2G7H A;  2HJJ A;  2YZT A;  2UXB E;  2LE2 A;  2WBS A;  2EOE A;  1GQE A;  1T38 A;  2EWL A;  1QU6 A;  3EPH A;  2DRP A;  2HHH E;  2E72 A;  4NXM E;  1YYO A;  4JI8 E;  2DGC A;  4DV3 E;  2JYA A;  5KL5 A;  4X64 E;  1HNZ E;  2V89 A;  4LF9 E;  2EMH A;  2YT4 A;  5KL3 A;  1WHN A;  3F6H A;  2EOQ A;  4Q28 A;  1J5E E;  4O4K A;  2YTN A;  3JAM C;  1P47 A;  1IQO A;  4GKK E;  4DUY E;  1PKP A;  2EMF A;  4TUI A;  2YTG A;  4BHC A;  5A2Q C;  3THN A;  2EN4 A;  4ZYH A;  1A1I A;  2L33 A;  4ZYE A;  2ODR C;  3J80 C;  2EOF A;  3VYX A;  2ADR A;  2YPN A;  4NHR A;  1YYW A;  2EOI A;  4DV7 E;  4LF6 E;  1YYK A;  5IXM B;  2H36 X;  4GEQ B;  1NEI A;  2YU8 A;  2EL4 A;  2DB2 A;  1B69 A;  2EPR A;  4BMJ A;  4DV0 E;  1ZBQ A;  2MC6 A;  4JYA E;  2J7J A;  1AH5 A;  2EMI A;  2EM6 A;  4P7D A;  4AQY E;  1A1H A;  5KL7 A;  1PJT A;  4DR6 E;  5AE1 A;  2EPP A;  2LVH A;  1UIL A;  4B3T E;  3VK6 A;  2EL5 A;  4R2C A;  2EN7 A;  2DLQ A;  1N33 E;  4R2P A;  4DR4 E;  2F8B A;  2YTJ A;  2IHR 1;  2RSI A;  2N3H A;  2NUG A;  1A1F A;  3ADL A;  3HPS A;  4O24 A;  2VE7 C;  2LT7 A;  2M9A A;  5IT9 C;  2EMC A;  2EOR A;  3BBG A;  2EOZ A;  2MC5 A;  2GHF A;  2MDR A;  1L4S A;  4GZN C;  1HNW E;  2B7V A;  1EKZ A;  3H09 A;  4JI5 E;  3T1H E;  1O0W A;  2KON A;  2ELY A;  2EOO A;  3THO B;  4BS9 A;  2JR1 A;  1TF6 A; 
#chains in the Genus database with same CATH homology
 1UBD C;  4R2Q A;  2EOE A;  2WBS A;  2EMK A;  5KL6 A;  4R2R A;  1F2I G;  1G2F C;  2EOX A;  2EN6 A;  2EMG A;  2YTE A;  2YTQ A;  5KL4 A;  3EPK A;  2DRP A;  3EPH A;  2E72 A;  1KJK A;  3EPL A;  2DGC A;  1DGC A;  2EML A;  5KL5 A;  2I13 A;  2EOJ A;  3EPJ A;  2EMH A;  5KL3 A;  2RPC A;  2EOQ A;  2WBT A;  1BB8 A;  2YU5 A;  2YTN A;  2EE8 A;  1P47 A;  2EN2 A;  3VHT B;  2YTP A;  2GLI A;  2YSP A;  2EPX A;  1X5W A;  1JK1 A;  2EMF A;  1NCS A;  4R2E A;  2CTD A;  2DLK A;  2YTG A;  2DMI A;  4X9J A;  1Z1B A;  4M9V C;  2EMB A;  2EN4 A;  4IJD A;  1A1I A;  2EOF A;  3UK3 C;  2ADR A;  1ZU1 A;  2YRK A;  2EOI A;  1RMD A;  2ENA A;  2EPA A;  4R2D A;  2YTO A;  2YU8 A;  1LLM C;  2EL4 A;  2EPU A;  1B69 A;  2EPR A;  2ENH A;  2EQ0 A;  1X6E A;  2EMY A;  2EM7 A;  2EOY A;  2J7J A;  2EMI A;  1YSA C;  2YRH A;  2EM6 A;  4FK5 C;  1JK2 A;  2WCC 3;  5KL7 A;  1A1H A;  1X6F A;  4WSG A;  4R2A A;  1G2D C;  2EP3 A;  1A1L A;  1TF3 A;  1BBO A;  4IS1 C;  2CT1 A;  2EQ1 A;  2EPP A;  2LVH A;  2BB8 A;  2EMX A;  2MKD A;  2HGH A;  2YTF A;  1X3C A;  2EPZ A;  1X6H A;  2EOM A;  2JPA A;  2EL5 A;  4R2C A;  4F2J C;  2LV2 A;  4F6N A;  2EN7 A;  2DLQ A;  2ENC A;  4R2P A;  2EN8 A;  2YTI A;  2YTJ A;  2EM3 A;  1A1J A;  2EM5 A;  2MKN A;  2RSI A;  4F6M A;  1YUI A;  1A1G A;  1A1F A;  2LCE A;  3M99 B;  2EN3 A;  2EOS A;  2EM4 A;  2CSH A;  2EJ4 A;  2M9A A;  5KL2 A;  2LT7 A;  1YUJ A;  2EM0 A;  2EMC A;  2EPC A;  2EMW A;  2ELZ A;  2EQ3 A;  1ZR9 A;  2EOR A;  2YRM A;  1ZAA C;  2EOZ A;  2R1F A;  2EMZ A;  2LO3 A;  2EM9 A;  2GHF A;  2EMA A;  4R2S A;  2JP9 A;  3MHS C;  4GZN C;  3MHH C;  1TN9 A;  1UN6 B;  1WJP A;  2MDG A;  2VRD A;  2EN1 A;  1A1K A;  2D9H A;  2EOH A;  2PRT A;  1AAY A;  2NAB A;  2ELY A;  2EOO A;  2YTD A;  2EM8 A;  2EL6 A;  2YSO A;  2EM2 A;  1MEY C;  2A25 A;  1TF6 A;  2WBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...