2YU5A

Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the zf-C2H2 domain (669-699AA) in zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu5A00
1G2FC 2MKNA 2R1FA 2EM0A 2M9AA 2EOIA 2LCEA 2RPCA 2EP3A 3EPKA 2YSPA 2EM3A 2EOMA 2EMHA 1A1IA 2EM2A 2YTOA 2EORA 2EPCA 1WJPA 2ELZA 1DGCA 2EM5A 2YTGA 1ZAAC 2EE8A 2RSIA 1TN9A 2EL5A 3EPJA 2YRHA 2DRPA 2DLKA 1TF3A 1NCSA 2CSHA 2BB8A 5KL2A 1JK2A 2EOJA 1LLMC 1UBDC 2EPXA 2EJ4A 2EOZA 1X3CA 2EN2A 2GHFA 2CT1A 2EQ3A 2WBSA 3UK3C 1B69A 2DMIA 4GZNC 5KL7A 2J7JA 2YSOA 1A1JA 2JPAA 4M9VC 1BBOA 3MHHC 2JP9A 2EOFA 2MKDA 2PRTA 2LT7A 5KL4A 4R2RA 1A1FA 1YUIA 2HGHA 1AAYA 2ELYA 1X6FA 1F2IG 2YTJA 2WCC3 4X9JA 2EMFA 2EM7A 1A1LA 2YTNA 2VRDA 1A1HA 2EPAA 4F2JC 1A1KA 2EL4A 2EOYA 4R2AA 2LV2A 2EOHA 2EQ0A 2EN1A 2EMKA 4IJDA 3EPLA 2A25A 2LVHA 2EN4A 2YTPA 2EMCA 2EMWA 5KL3A 2GLIA 2EOSA 2EM4A 2EMYA 1X6EA 2EN7A 2EMGA 1TF6A 2DGCA 1X5WA 2EOEA 1RMDA 2EN3A 2EOXA 3MHSC 4F6NA 1ZR9A 2ENHA 1YSAC 2YU8A 1P47A 2LO3A 4R2PA 1YUJA 2EQ1A 2EPZA 2CTDA 2EMLA 2WBTA 4FK5C 2MDGA 2EOOA 2I13A 5KL5A 2YTFA 1Z1BA 1KJKA 5KL6A 4R2CA 1G2DC 2YTQA 2EM6A 2EN6A 2EM9A 2YTIA 2EN8A 2EMIA 3M99B 4WSGA 1UN6B 4R2QA 2EOQA 4F6MA 2DLQA 2YTDA 3VHTB 2YU5A 4R2SA 2EM8A 2EPUA 2WBUA 2YRMA 1ZU1A 1JK1A 2E72A 2EMZA 1MEYC 4R2DA 2EMAA 2D9HA 2EL6A 1A1GA 2ENCA 2EPPA 3EPHA 2ADRA 4IS1C 1BB8A 2ENAA 2NABA 2EMXA 4R2EA 1X6HA 2YTEA 2EMBA 2YRKA 2EPRA
chains in the Genus database with same CATH superfamily
3JU0A 2ODRC 2LTSA 5LMNE 2EP3A 2FTXB 2LTRA 2LE2A 2EOMA 4JI7E 2EM2A 3DJWA 2YTOA 4DV0E 2EM5A 4BCAA 4DV1E 1WHQA 1XNQE 2YRHA 2DRPA 4DR4E 4MLVA 2N3HA 2YT4A 1STUA 1LLMC 2EPXA 2NA2A 5A2QC 1WHNA 2FGGA 5A6AA 4ZYDA 3C6KA 2IHR1 4RHBB 2L3JA 4F9AB 1YUIA 5FLXC 1EKZA 1F2IG 1ZBTA 2YTJA 2R76A 4HEIA 1T4NA 2EPOA 5LMUE 5T6JA 1A1LA 4NZVA 2VRDA 4B3SE 4F54A 1PJSA 2EL4A 4BHCA 3KWRA 4BC9A 1YYKA 2E1MA 2WZOA 3C4TA 2EMWA 5KL3A 2GLIA 1N36E 2EMYA 4ZYGA 1X6EA 2EMGA 4BS9A 2DGCA 3MHSC 4F6NA 1ZR9A 4HTGA 2EQ1A 2UXBE 4M0VA 3ZOQB 4ZYHA 5A6BD 2JVAA 2WBTA 2EPMX 4I8OA 1X47A 2I13A 2YTFA 1SFEA 4LFCE 2M7QA 1N32E 2HC5A 2JOBA 4WXDA 1N34E 2EN8A 4F9CB 3IWBA 4DR6E 1EH8A 1L4SA 2B7VA 1WRJA 4JI4E 4WPYA 2YU5A 2L8TA 2EM8A 2LMZA 2EMZA 2YPNA 5A69A 4O5GA 4B3TE 2EMAA 2EL6A 1A1GA 4JI1E 4LFBE 3EPHA 4WYQB 5A6JA 4OOGC 1GZ6A 3C4BA 2EPRA 5AE2A 4O43A 2R1FA 2MKNA 1IMUA 2EOIA 2RPCA 3EPKA 2EM3A 1YYOA 2EMHA 4Q28A 2EPKX 2UUBE 2EPCA 1DGCA 3J7AG 1N33E 3HXLA 1IBLE 3P1XA 4LF9E 2RSIA 1TN9A 1KYQA 5F3WA 3EPJA 1TF3A 2MDRA 5KL2A 4LF5E 2EOJA 3AV0A 3JAMC 2EOZA 1X3CA 2EN2A 2CT1A 3T1HE 1T38A 4LU9A 5KL7A 2ODRD 4M9VC 2EZ6A 2JP9A 2EOFA 2PRTA 2LT7A 5KL4A 2K7IA 4R2RA 1AAYA 2ELYA 1X6FA 2LUQA 2E5LE 2WCC3 1AH5A 2EM7A 3HQ1A 1O0WA 2LUPB 4LF7E 2EOYA 2EPNA 2ZM6E 2LV2A 2EQ0A 2V88A 4M30A 1T4LB 1FJGE 1IQOA 4WXCA 2UXDE 2KOUA 3L00A 4JI8E 2YZTA 2EMKA 2LVHA 4BHBA 2EN4A 4NXME 5ADZA 1T39A 5IV8B 3TQMA 4JV5E 2EOSA 3ADLA 1XMOE 4OX9E 2UUCE 2EM4A 1TF6A 1X5WA 2EOEA 1RMDA 2HJJA 2L2KB 4X8WA 1YSAC 2YU8A 2KONA 1YUJA 3THNA 4DV3E 4LFAE 3F6GA 4FK5C 2EOOA 2LRSA 4TUGA 2EWLA 4R2CA 2DMYA 2DB2A 2YTQA 4F9BB 2EM6A 3BBGA 4RH8A 2EN6A 1ZBQA 2DSYA 3M99B 2NUFA 1EH7A 1UILA 2DIXA 3JTZA 2N8XA 4KZSA 2V83A 2YRMA 2NUGA 1FKAE 1MEYC 4DV4E 2D9HA 2ENCA 2EPPA 1BB8A 1J26A 4IS1C 2LJHA 2VE7C 1DQ3A 2ENAA 2NABA 2MC6A 2JXPA 3DF6A 4L5NC 4X66E 5AE1A 2Q8UA 5A6KA 4LF6E 5DNYA 1G2FC 4JI3E 2EM0A 4DR5E 2EPLX 2YSPA 4WFTA 3ADGA 1A1IA 2UUAE 2L33A 4DV5E 4P7DA 2RQLA 1WJPA 4BBYA 2M4IA 2YTGA 3KZYA 1PJTA 4LF4E 4R03A 2DLKA 2BB8A 1JK2A 1UBDC 2L2MA 4Q35B 4YHHE 2GHFA 2JWOA 4BC7A 4K0KE 1B69A 4GKJE 4BMJA 4GZNC 2UU9E 3K6QA 2YSOA 2JPAA 2GPIA 3MHHC 2MKDA 2HGHA 2JR1A 3LLHA 4WSPA 1HNXE 1YYWA 3IWCA 5AC5A 4KHPE 4DV7E 4DV6E 2M1SA 2FV4B 5TSEA 1QNTA 4B3ME 2EPAA 3THOB 3H09A 2EOHA 3ADIA 2K4VA 4DMIA 2B3TB 2A25A 5CFFE 2VQFE 2LJUA 2YTPA 2EMCA 5AE3A 4DUYE 4NHRA 3J81C 3IWDA 4JYAE 3BF2A 3BGHA 2EN7A 4JI5E 5IT9C 2EN3A 1RC7A 2ENHA 4JI0E 1X48A 1P47A 3HTXA 3KZZA 4R2PA 1I94E 2CTDA 3T1YE 4DR1E 5IXMB 2YWQA 2V86A 1Z1BA 1T4OA 1KJKA 5KL6A 5AASA 1G2DC 4JI6E 3EQ1A 2EM9A 3C6MA 2RSMA 2YTIA 3RMPA 2G7HA 4F6MA 1PDAA 2DLQA 4DR3E 1YFHA 1BBGA 2EPUA 2E72A 2JY9A 4R2DA 2F8BA 4DKKA 3VK6A 4X65E 4DV2E 3J7Yp 4X64E 4GEQB 1HNWE 1YPNA 2M9AA 1PKPA 1XMQE 2V87A 1RQ0A 2LCEA 2V8QB 4DUZE 3FIGA 1HNZE 3VYYA 2B9DA 3QG5C 4LF8E 1DI2A 4TUIA 2NUEA 3LMLA 1PJQA 2EORA 2ELZA 4YY3E 1ZAAC 2EE8A 2MC5A 2EL5A 1N3GA 2L92A 1NCSA 2CSHA 3HPZA 2HHHE 2V85A 2EJ4A 2H36X 2EQ3A 2WBSA 3UK3C 2DMIA 2UXCE 4J8ZA 4M2ZA 2J7JA 4DR2E 1A1JA 1IBKE 2F4VE 1BBOA 1WXRA 2VF1A 1A1FA 2LBSB 4AQYE 1IQSA 2VQEE 4X9JA 2B7TA 1GQEA 1UHZA 2EMFA 2BBGA 2L2NA 2YTNA 1A1HA 3VYXA 4F2JC 1A1KA 1GTKA 2N3GA 4R2AA 3OTOE 2RTXA 4P78A 4DR7E 2EN1A 2L6MA 5A6BA 2I9IA 4IJDA 3EPLA 3OMLA 1IBME 3ADJA 4B3RE 2JOXA 3F6HA 4X62E 1HR0E 4LTYA 2EOXA 4KWYA 1EH6A 3BIDA 2JYAA 2LO3A 4NXNE 2EPZA 2L3CA 2EMLA 1MGTA 4N4RB 3AUZA 5BR8E 1J5EE 2RS7A 2MDGA 4O4KA 4GKKE 5KL5A 1QU6A 3ECRA 1X49A 1XNRE 2EMIA 5LL6R 4WSGA 1UN6B 4R2QA 2RS6A 2EOQA 1NEIA 5LLQA 2YTDA 2CPNA 3VHTB 4R2SA 4ZYEA 1YZ9A 4WX9A 2WBUA 2KHXA 4L8NA 1ZU1A 4R8OA 1JK1A 4MLQA 5IWAE 2ADRA 2EMXA 2V89A 4R2EA 1X6HA 4JI2E 3J80C 1SR9A 2YTEA 2EMBA 4O24A 2YRKA 5AC4A 3HPSA 3MSWA
chains in the Genus database with same CATH topology
1G2FC 2MKNA 2R1FA 2EM0A 2M9AA 2EOIA 2LCEA 2RPCA 2EP3A 3EPKA 2YSPA 2EM3A 2EOMA 2EMHA 1A1IA 2EM2A 2YTOA 2EORA 2EPCA 1WJPA 2ELZA 1DGCA 2EM5A 2YTGA 1ZAAC 2EE8A 2RSIA 1TN9A 2EL5A 3EPJA 2YRHA 2DRPA 2DLKA 1TF3A 1NCSA 2CSHA 2BB8A 5KL2A 1JK2A 2EOJA 1LLMC 1UBDC 2EPXA 2EJ4A 2EOZA 1X3CA 2EN2A 2GHFA 2CT1A 2EQ3A 2WBSA 3UK3C 1B69A 2DMIA 4GZNC 5KL7A 2J7JA 2YSOA 1A1JA 2JPAA 4M9VC 1BBOA 3MHHC 2JP9A 2EOFA 2MKDA 2PRTA 2LT7A 5KL4A 4R2RA 1A1FA 1YUIA 2HGHA 1AAYA 2ELYA 1X6FA 1F2IG 2YTJA 2WCC3 4X9JA 2EMFA 2EM7A 1A1LA 2YTNA 2VRDA 1A1HA 2EPAA 4F2JC 1A1KA 2EL4A 2EOYA 4R2AA 2LV2A 2EOHA 2EQ0A 2EN1A 2EMKA 4IJDA 3EPLA 2A25A 2LVHA 2EN4A 2YTPA 2EMCA 2EMWA 5KL3A 2GLIA 2EOSA 2EM4A 2EMYA 1X6EA 2EN7A 2EMGA 1TF6A 2DGCA 1X5WA 2EOEA 1RMDA 2EN3A 2EOXA 3MHSC 4F6NA 1ZR9A 2ENHA 1YSAC 2YU8A 1P47A 2LO3A 4R2PA 1YUJA 2EQ1A 2EPZA 2CTDA 2EMLA 2WBTA 4FK5C 2MDGA 2EOOA 2I13A 5KL5A 2YTFA 1Z1BA 1KJKA 5KL6A 4R2CA 1G2DC 2YTQA 2EM6A 2EN6A 2EM9A 2YTIA 2EN8A 2EMIA 3M99B 4WSGA 1UN6B 4R2QA 2EOQA 4F6MA 2DLQA 2YTDA 3VHTB 2YU5A 4R2SA 2EM8A 2EPUA 2WBUA 2YRMA 1ZU1A 1JK1A 2E72A 2EMZA 1MEYC 4R2DA 2EMAA 2D9HA 2EL6A 1A1GA 2ENCA 2EPPA 3EPHA 2ADRA 4IS1C 1BB8A 2ENAA 2NABA 2EMXA 4R2EA 1X6HA 2YTEA 2EMBA 2YRKA 2EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  2MKN A;  2R1F A;  2EM0 A;  2M9A A;  2EOI A;  2LCE A;  2RPC A;  2EP3 A;  3EPK A;  2YSP A;  2EM3 A;  2EOM A;  2EMH A;  1A1I A;  2EM2 A;  2YTO A;  2EOR A;  2EPC A;  1WJP A;  2ELZ A;  1DGC A;  2EM5 A;  2YTG A;  1ZAA C;  2EE8 A;  2RSI A;  1TN9 A;  2EL5 A;  3EPJ A;  2YRH A;  2DRP A;  2DLK A;  1TF3 A;  1NCS A;  2CSH A;  2BB8 A;  5KL2 A;  1JK2 A;  2EOJ A;  1LLM C;  1UBD C;  2EPX A;  2EJ4 A;  2EOZ A;  1X3C A;  2EN2 A;  2GHF A;  2CT1 A;  2EQ3 A;  2WBS A;  3UK3 C;  1B69 A;  2DMI A;  4GZN C;  5KL7 A;  2J7J A;  2YSO A;  1A1J A;  2JPA A;  4M9V C;  1BBO A;  3MHH C;  2JP9 A;  2EOF A;  2MKD A;  2PRT A;  2LT7 A;  5KL4 A;  4R2R A;  1A1F A;  1YUI A;  2HGH A;  1AAY A;  2ELY A;  1X6F A;  1F2I G;  2YTJ A;  2WCC 3;  4X9J A;  2EMF A;  2EM7 A;  1A1L A;  2YTN A;  2VRD A;  1A1H A;  2EPA A;  4F2J C;  1A1K A;  2EL4 A;  2EOY A;  4R2A A;  2LV2 A;  2EOH A;  2EQ0 A;  2EN1 A;  2EMK A;  4IJD A;  3EPL A;  2A25 A;  2LVH A;  2EN4 A;  2YTP A;  2EMC A;  2EMW A;  5KL3 A;  2GLI A;  2EOS A;  2EM4 A;  2EMY A;  1X6E A;  2EN7 A;  2EMG A;  1TF6 A;  2DGC A;  1X5W A;  2EOE A;  1RMD A;  2EN3 A;  2EOX A;  3MHS C;  4F6N A;  1ZR9 A;  2ENH A;  1YSA C;  2YU8 A;  1P47 A;  2LO3 A;  4R2P A;  1YUJ A;  2EQ1 A;  2EPZ A;  2CTD A;  2EML A;  2WBT A;  4FK5 C;  2MDG A;  2EOO A;  2I13 A;  5KL5 A;  2YTF A;  1Z1B A;  1KJK A;  5KL6 A;  4R2C A;  1G2D C;  2YTQ A;  2EM6 A;  2EN6 A;  2EM9 A;  2YTI A;  2EN8 A;  2EMI A;  3M99 B;  4WSG A;  1UN6 B;  4R2Q A;  2EOQ A;  4F6M A;  2DLQ A;  2YTD A;  3VHT B;  2YU5 A;  4R2S A;  2EM8 A;  2EPU A;  2WBU A;  2YRM A;  1ZU1 A;  1JK1 A;  2E72 A;  2EMZ A;  1MEY C;  4R2D A;  2EMA A;  2D9H A;  2EL6 A;  1A1G A;  2ENC A;  2EPP A;  3EPH A;  2ADR A;  4IS1 C;  1BB8 A;  2ENA A;  2NAB A;  2EMX A;  4R2E A;  1X6H A;  2YTE A;  2EMB A;  2YRK A;  2EPR A; 
#chains in the Genus database with same CATH topology
 3JU0 A;  2ODR C;  2LTS A;  5LMN E;  2EP3 A;  2FTX B;  2LTR A;  2LE2 A;  2EOM A;  4JI7 E;  2EM2 A;  3DJW A;  2YTO A;  4DV0 E;  2EM5 A;  4BCA A;  4DV1 E;  1WHQ A;  1XNQ E;  2YRH A;  2DRP A;  4DR4 E;  4MLV A;  2N3H A;  2YT4 A;  1STU A;  1LLM C;  2EPX A;  2NA2 A;  5A2Q C;  1WHN A;  2FGG A;  5A6A A;  4ZYD A;  3C6K A;  2IHR 1;  4RHB B;  2L3J A;  4F9A B;  1YUI A;  5FLX C;  1EKZ A;  1F2I G;  1ZBT A;  2YTJ A;  2R76 A;  4HEI A;  1T4N A;  2EPO A;  5LMU E;  5T6J A;  1A1L A;  4NZV A;  2VRD A;  4B3S E;  4F54 A;  1PJS A;  2EL4 A;  4BHC A;  3KWR A;  4BC9 A;  1YYK A;  2E1M A;  2WZO A;  3C4T A;  2EMW A;  5KL3 A;  2GLI A;  1N36 E;  2EMY A;  4ZYG A;  1X6E A;  2EMG A;  4BS9 A;  2DGC A;  3MHS C;  4F6N A;  1ZR9 A;  4HTG A;  2EQ1 A;  2UXB E;  4M0V A;  3ZOQ B;  4ZYH A;  5A6B D;  2JVA A;  2WBT A;  2EPM X;  4I8O A;  1X47 A;  2I13 A;  2YTF A;  1SFE A;  4LFC E;  2M7Q A;  1N32 E;  2HC5 A;  2JOB A;  4WXD A;  1N34 E;  2EN8 A;  4F9C B;  3IWB A;  4DR6 E;  1EH8 A;  1L4S A;  2B7V A;  1WRJ A;  4JI4 E;  4WPY A;  2YU5 A;  2L8T A;  2EM8 A;  2LMZ A;  2EMZ A;  2YPN A;  5A69 A;  4O5G A;  4B3T E;  2EMA A;  2EL6 A;  1A1G A;  4JI1 E;  4LFB E;  3EPH A;  4WYQ B;  5A6J A;  4OOG C;  1GZ6 A;  3C4B A;  2EPR A;  5AE2 A;  4O43 A;  2R1F A;  2MKN A;  1IMU A;  2EOI A;  2RPC A;  3EPK A;  2EM3 A;  1YYO A;  2EMH A;  4Q28 A;  2EPK X;  2UUB E;  2EPC A;  1DGC A;  3J7A G;  1N33 E;  3HXL A;  1IBL E;  3P1X A;  4LF9 E;  2RSI A;  1TN9 A;  1KYQ A;  5F3W A;  3EPJ A;  1TF3 A;  2MDR A;  5KL2 A;  4LF5 E;  2EOJ A;  3AV0 A;  3JAM C;  2EOZ A;  1X3C A;  2EN2 A;  2CT1 A;  3T1H E;  1T38 A;  4LU9 A;  5KL7 A;  2ODR D;  4M9V C;  2EZ6 A;  2JP9 A;  2EOF A;  2PRT A;  2LT7 A;  5KL4 A;  2K7I A;  4R2R A;  1AAY A;  2ELY A;  1X6F A;  2LUQ A;  2E5L E;  2WCC 3;  1AH5 A;  2EM7 A;  3HQ1 A;  1O0W A;  2LUP B;  4LF7 E;  2EOY A;  2EPN A;  2ZM6 E;  2LV2 A;  2EQ0 A;  2V88 A;  4M30 A;  1T4L B;  1FJG E;  1IQO A;  4WXC A;  2UXD E;  2KOU A;  3L00 A;  4JI8 E;  2YZT A;  2EMK A;  2LVH A;  4BHB A;  2EN4 A;  4NXM E;  5ADZ A;  1T39 A;  5IV8 B;  3TQM A;  4JV5 E;  2EOS A;  3ADL A;  1XMO E;  4OX9 E;  2UUC E;  2EM4 A;  1TF6 A;  1X5W A;  2EOE A;  1RMD A;  2HJJ A;  2L2K B;  4X8W A;  1YSA C;  2YU8 A;  2KON A;  1YUJ A;  3THN A;  4DV3 E;  4LFA E;  3F6G A;  4FK5 C;  2EOO A;  2LRS A;  4TUG A;  2EWL A;  4R2C A;  2DMY A;  2DB2 A;  2YTQ A;  4F9B B;  2EM6 A;  3BBG A;  4RH8 A;  2EN6 A;  1ZBQ A;  2DSY A;  3M99 B;  2NUF A;  1EH7 A;  1UIL A;  2DIX A;  3JTZ A;  2N8X A;  4KZS A;  2V83 A;  2YRM A;  2NUG A;  1FKA E;  1MEY C;  4DV4 E;  2D9H A;  2ENC A;  2EPP A;  1BB8 A;  1J26 A;  4IS1 C;  2LJH A;  2VE7 C;  1DQ3 A;  2ENA A;  2NAB A;  2MC6 A;  2JXP A;  3DF6 A;  4L5N C;  4X66 E;  5AE1 A;  2Q8U A;  5A6K A;  4LF6 E;  5DNY A;  1G2F C;  4JI3 E;  2EM0 A;  4DR5 E;  2EPL X;  2YSP A;  4WFT A;  3ADG A;  1A1I A;  2UUA E;  2L33 A;  4DV5 E;  4P7D A;  2RQL A;  1WJP A;  4BBY A;  2M4I A;  2YTG A;  3KZY A;  1PJT A;  4LF4 E;  4R03 A;  2DLK A;  2BB8 A;  1JK2 A;  1UBD C;  2L2M A;  4Q35 B;  4YHH E;  2GHF A;  2JWO A;  4BC7 A;  4K0K E;  1B69 A;  4GKJ E;  4BMJ A;  4GZN C;  2UU9 E;  3K6Q A;  2YSO A;  2JPA A;  2GPI A;  3MHH C;  2MKD A;  2HGH A;  2JR1 A;  3LLH A;  4WSP A;  1HNX E;  1YYW A;  3IWC A;  5AC5 A;  4KHP E;  4DV7 E;  4DV6 E;  2M1S A;  2FV4 B;  5TSE A;  1QNT A;  4B3M E;  2EPA A;  3THO B;  3H09 A;  2EOH A;  3ADI A;  2K4V A;  4DMI A;  2B3T B;  2A25 A;  5CFF E;  2VQF E;  2LJU A;  2YTP A;  2EMC A;  5AE3 A;  4DUY E;  4NHR A;  3J81 C;  3IWD A;  4JYA E;  3BF2 A;  3BGH A;  2EN7 A;  4JI5 E;  5IT9 C;  2EN3 A;  1RC7 A;  2ENH A;  4JI0 E;  1X48 A;  1P47 A;  3HTX A;  3KZZ A;  4R2P A;  1I94 E;  2CTD A;  3T1Y E;  4DR1 E;  5IXM B;  2YWQ A;  2V86 A;  1Z1B A;  1T4O A;  1KJK A;  5KL6 A;  5AAS A;  1G2D C;  4JI6 E;  3EQ1 A;  2EM9 A;  3C6M A;  2RSM A;  2YTI A;  3RMP A;  2G7H A;  4F6M A;  1PDA A;  2DLQ A;  4DR3 E;  1YFH A;  1BBG A;  2EPU A;  2E72 A;  2JY9 A;  4R2D A;  2F8B A;  4DKK A;  3VK6 A;  4X65 E;  4DV2 E;  3J7Y p;  4X64 E;  4GEQ B;  1HNW E;  1YPN A;  2M9A A;  1PKP A;  1XMQ E;  2V87 A;  1RQ0 A;  2LCE A;  2V8Q B;  4DUZ E;  3FIG A;  1HNZ E;  3VYY A;  2B9D A;  3QG5 C;  4LF8 E;  1DI2 A;  4TUI A;  2NUE A;  3LML A;  1PJQ A;  2EOR A;  2ELZ A;  4YY3 E;  1ZAA C;  2EE8 A;  2MC5 A;  2EL5 A;  1N3G A;  2L92 A;  1NCS A;  2CSH A;  3HPZ A;  2HHH E;  2V85 A;  2EJ4 A;  2H36 X;  2EQ3 A;  2WBS A;  3UK3 C;  2DMI A;  2UXC E;  4J8Z A;  4M2Z A;  2J7J A;  4DR2 E;  1A1J A;  1IBK E;  2F4V E;  1BBO A;  1WXR A;  2VF1 A;  1A1F A;  2LBS B;  4AQY E;  1IQS A;  2VQE E;  4X9J A;  2B7T A;  1GQE A;  1UHZ A;  2EMF A;  2BBG A;  2L2N A;  2YTN A;  1A1H A;  3VYX A;  4F2J C;  1A1K A;  1GTK A;  2N3G A;  4R2A A;  3OTO E;  2RTX A;  4P78 A;  4DR7 E;  2EN1 A;  2L6M A;  5A6B A;  2I9I A;  4IJD A;  3EPL A;  3OML A;  1IBM E;  3ADJ A;  4B3R E;  2JOX A;  3F6H A;  4X62 E;  1HR0 E;  4LTY A;  2EOX A;  4KWY A;  1EH6 A;  3BID A;  2JYA A;  2LO3 A;  4NXN E;  2EPZ A;  2L3C A;  2EML A;  1MGT A;  4N4R B;  3AUZ A;  5BR8 E;  1J5E E;  2RS7 A;  2MDG A;  4O4K A;  4GKK E;  5KL5 A;  1QU6 A;  3ECR A;  1X49 A;  1XNR E;  2EMI A;  5LL6 R;  4WSG A;  1UN6 B;  4R2Q A;  2RS6 A;  2EOQ A;  1NEI A;  5LLQ A;  2YTD A;  2CPN A;  3VHT B;  4R2S A;  4ZYE A;  1YZ9 A;  4WX9 A;  2WBU A;  2KHX A;  4L8N A;  1ZU1 A;  4R8O A;  1JK1 A;  4MLQ A;  5IWA E;  2ADR A;  2EMX A;  2V89 A;  4R2E A;  1X6H A;  4JI2 E;  3J80 C;  1SR9 A;  2YTE A;  2EMB A;  4O24 A;  2YRK A;  5AC4 A;  3HPS A;  3MSW A; 
#chains in the Genus database with same CATH homology
 1G2F C;  2MKN A;  2R1F A;  2EM0 A;  2M9A A;  2EOI A;  2LCE A;  2RPC A;  2EP3 A;  3EPK A;  2YSP A;  2EM3 A;  2EOM A;  2EMH A;  1A1I A;  2EM2 A;  2YTO A;  2EOR A;  2EPC A;  1WJP A;  2ELZ A;  1DGC A;  2EM5 A;  2YTG A;  1ZAA C;  2EE8 A;  2RSI A;  1TN9 A;  2EL5 A;  3EPJ A;  2YRH A;  2DRP A;  2DLK A;  1TF3 A;  1NCS A;  2CSH A;  2BB8 A;  5KL2 A;  1JK2 A;  2EOJ A;  1LLM C;  1UBD C;  2EPX A;  2EJ4 A;  2EOZ A;  1X3C A;  2EN2 A;  2GHF A;  2CT1 A;  2EQ3 A;  2WBS A;  3UK3 C;  1B69 A;  2DMI A;  4GZN C;  5KL7 A;  2J7J A;  2YSO A;  1A1J A;  2JPA A;  4M9V C;  1BBO A;  3MHH C;  2JP9 A;  2EOF A;  2MKD A;  2PRT A;  2LT7 A;  5KL4 A;  4R2R A;  1A1F A;  1YUI A;  2HGH A;  1AAY A;  2ELY A;  1X6F A;  1F2I G;  2YTJ A;  2WCC 3;  4X9J A;  2EMF A;  2EM7 A;  1A1L A;  2YTN A;  2VRD A;  1A1H A;  2EPA A;  4F2J C;  1A1K A;  2EL4 A;  2EOY A;  4R2A A;  2LV2 A;  2EOH A;  2EQ0 A;  2EN1 A;  2EMK A;  4IJD A;  3EPL A;  2A25 A;  2LVH A;  2EN4 A;  2YTP A;  2EMC A;  2EMW A;  5KL3 A;  2GLI A;  2EOS A;  2EM4 A;  2EMY A;  1X6E A;  2EN7 A;  2EMG A;  1TF6 A;  2DGC A;  1X5W A;  2EOE A;  1RMD A;  2EN3 A;  2EOX A;  3MHS C;  4F6N A;  1ZR9 A;  2ENH A;  1YSA C;  2YU8 A;  1P47 A;  2LO3 A;  4R2P A;  1YUJ A;  2EQ1 A;  2EPZ A;  2CTD A;  2EML A;  2WBT A;  4FK5 C;  2MDG A;  2EOO A;  2I13 A;  5KL5 A;  2YTF A;  1Z1B A;  1KJK A;  5KL6 A;  4R2C A;  1G2D C;  2YTQ A;  2EM6 A;  2EN6 A;  2EM9 A;  2YTI A;  2EN8 A;  2EMI A;  3M99 B;  4WSG A;  1UN6 B;  4R2Q A;  2EOQ A;  4F6M A;  2DLQ A;  2YTD A;  3VHT B;  2YU5 A;  4R2S A;  2EM8 A;  2EPU A;  2WBU A;  2YRM A;  1ZU1 A;  1JK1 A;  2E72 A;  2EMZ A;  1MEY C;  4R2D A;  2EMA A;  2D9H A;  2EL6 A;  1A1G A;  2ENC A;  2EPP A;  3EPH A;  2ADR A;  4IS1 C;  1BB8 A;  2ENA A;  2NAB A;  2EMX A;  4R2E A;  1X6H A;  2YTE A;  2EMB A;  2YRK A;  2EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...