2YU5A

Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Zinc finger protein 473
publication title Solution structure of the zf-C2H2 domain (669-699AA) in zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu5A00
1WJPA 3EPKA 2PRTA 4R2EA 1ZAAC 4M9VC 2ELYA 2YRHA 2YRKA 2DMIA 2EOQA 2EP3A 1DGCA 1X3CA 2EOJA 2WBTA 4IJDA 4R2RA 2GLIA 2YTEA 2EPXA 2YU5A 2J7JA 2WCC3 1B69A 2EMYA 2YTJA 2EOHA 2EOIA 1UBDC 2MKNA 1TF3A 2EN4A 2EOYA 2CT1A 1BB8A 1Z1BA 2EM6A 1P47A 1NCSA 2EPUA 1RMDA 2D9HA 2EMXA 2MDGA 1BBOA 1YSAC 2EPZA 2EMZA 2DLKA 2EL5A 2EN2A 4R2SA 1TF6A 3EPLA 2EM9A 2LCEA 2YSPA 2EMKA 2R1FA 4F6NA 2EN8A 2EOOA 2EN7A 2JP9A 1A1JA 3MHSC 2EMWA 5KL4A 4IS1C 1JK2A 2YRMA 5KL6A 2EE8A 2GHFA 2EM7A 2HGHA 3EPHA 4X9JA 2ENAA 2YTFA 3VHTB 4FK5C 2EMFA 2EPCA 2EQ0A 2EOZA 2EM0A 1A1LA 2DRPA 2EMGA 2EN1A 2YTGA 2EMHA 1ZU1A 2EPAA 1A1KA 2YTIA 2ENCA 2EMAA 2EM2A 3EPJA 2YTDA 3UK3C 4GZNC 2EM3A 2LT7A 1LLMC 1ZR9A 5KL5A 1KJKA 2EMIA 2EJ4A 2YTNA 1A1HA 2M9AA 1AAYA 1TN9A 4R2AA 1X6FA 4R2PA 2YSOA 2EMLA 2JPAA 2NABA 4F2JC 2EORA 2EPPA 2MKDA 2E72A 2EM8A 2BB8A 2EOEA 2WBUA 2I13A 2EM4A 2EQ3A 2CSHA 2VRDA 2YU8A 4WSGA 4R2CA 2RSIA 1A1GA 2EOFA 1A1FA 2EN3A 2CTDA 1G2FC 4R2DA 2ENHA 1F2IG 4F6MA 1A1IA 2RPCA 2DLQA 2LVHA 5KL3A 3M99B 2A25A 1X5WA 5KL2A 2EL6A 1UN6B 2EOSA 4R2QA 2EM5A 3MHHC 2EOXA 1YUIA 2YTOA 2EOMA 1MEYC 2LV2A 1YUJA 1JK1A 2DGCA 1G2DC 2EMBA 1X6HA 2LO3A 2EN6A 1X6EA 2YTPA 2EPRA 2EL4A 5KL7A 2WBSA 2YTQA 2EMCA 2ADRA 2EQ1A 2ELZA
chains in the Genus database with same CATH superfamily
1WJPA 4P78A 3OMLA 4O24A 2DSYA 1ZAAC 4M9VC 2ELYA 4I8OA 1DQ3A 4BMJA 2EP3A 2H36X 5TSEA 1X3CA 1T38A 2YTEA 2J7JA 2K7IA 3H09A 4DV1E 1UILA 2UUCE 2CT1A 4DUYE 3C6MA 1P47A 1O0WA 3KZYA 2DMYA 5A6AA 1EH7A 3HXLA 5AASA 4X65E 1BBOA 2ODRC 4GEQB 3EPLA 2EN8A 1N32E 2JP9A 3RMPA 2VQFE 2EPMX 5KL6A 2HGHA 1N36E 4X9JA 2L2KB 2ENAA 1N33E 1IBLE 2VE7C 1WXRA 2EOZA 2V89A 2EN1A 2YTGA 2LUQA 2B7VA 4P7DA 2YTIA 3T1HE 3MSWA 2EM2A 2L33A 4JI5E 2LT7A 2RS6A 1KJKA 4R03A 1A1HA 2UU9E 4BC9A 1AAYA 4M2ZA 1X6FA 2V8QB 1IQSA 1MGTA 4R2PA 4ZYDA 2NABA 4F2JC 2EORA 2RSMA 3QG5C 4DR4E 4BS9A 2YU8A 4DR2E 4LF7E 5F3WA 1J5EE 1A1GA 4NXME 2EN3A 2DIXA 1PJQA 1GTKA 1A1IA 2RPCA 1XMQE 2A25A 1X5WA 3ADGA 2JWOA 2EOSA 2YWQA 4R2QA 1N3GA 4DV7E 4X62E 4JI7E 2G7HA 1YUJA 1JK1A 3BF2A 2DB2A 2LTSA 2EPNA 3THNA 2GPIA 2KHXA 1EKZA 4OX9E 4B3RE 1PJTA 2B3TB 2EPRA 2FTXB 4LF8E 1T4OA 2EQ1A 2ELZA 2D9HA 3EPKA 4GKJE 2PRTA 4DKKA 2UXDE 2N3GA 2YRHA 2YRKA 3F6HA 2DMIA 1T4LB 2EOQA 2LUPB 4JI4E 3VYXA 4IJDA 4R2RA 3IWDA 3JTZA 2GLIA 2MC6A 2WCC3 2EMYA 2EPLX 2L8TA 4Q28A 1Z1BA 5IT9C 1IQOA 2EPUA 4WPYA 2FV4B 2ODRD 1YSAC 2EPZA 2EL5A 2EN2A 1ZBQA 2HHHE 2JOBA 3VK6A 1RC7A 3HTXA 4O43A 2EN7A 4IS1C 1JK2A 2EE8A 2GHFA 2M4IA 2LE2A 2YT4A 3LLHA 4X8WA 5LMNE 1UHZA 4DMIA 3K6QA 4KZSA 1X49A 1IMUA 2V87A 1ZU1A 2NUEA 4DR7E 1X47A 2V85A 2YTDA 1LLMC 2EPOA 5KL5A 3BGHA 4X66E 4DR3E 4BBYA 2NUGA 4JI1E 4ZYGA 4BC7A 4R2AA 4NZVA 2UUAE 4BHBA 4L5NC 4O4KA 3KWRA 2LBSB 4DR6E 1J26A 2EOEA 4HEIA 2WBUA 2VRDA 2V86A 4WYQB 5FLXC 2EOFA 3L00A 4LF6E 4TUIA 2ENHA 2DLQA 3M99B 2JYAA 2WZOA 1UN6B 3JU0A 4JYAE 5A6JA 4JI6E 2EM5A 4F9AB 2LJHA 2JVAA 3OTOE 2R76A 1MEYC 2DGCA 2FGGA 4KHPE 4NHRA 1G2DC 2E5LE 2Q8UA 4WSPA 2LO3A 2EN6A 1X6EA 3KZZA 1DI2A 2YZTA 2YTQA 2EMCA 2ADRA 2CPNA 3ADJA 2LMZA 2MC5A 5AC5A 4DUZE 2JR1A 2EPKX 2NUFA 1T4NA 5A6KA 3THOB 1HNWE 1WRJA 4L8NA 1I94E 1GQEA 1YFHA 1B69A 2EN4A 2NA2A 2EOYA 4JI0E 1YYKA 2N8XA 4ZYHA 4MLVA 4LF5E 3LMLA 3ADIA 1AH5A 1NCSA 1RMDA 2EMXA 2YPNA 2MDGA 1YYWA 5LL6R 2EMZA 4R2SA 3VYYA 4WX9A 2YSPA 2EMKA 2R1FA 4DV3E 2KOUA 2HJJA 1WHNA 1N34E 3P1XA 5KL4A 2YRMA 3C6KA 2LTRA 2UUBE 3EPHA 2EM7A 2L6MA 2B7TA 5IV8B 4YHHE 1FKAE 2YTFA 3TQMA 4WXCA 2M1SA 3VHTB 3C4TA 4FK5C 2RS7A 1QU6A 2EQ0A 2DRPA 4K0KE 4LFCE 5A6BD 4O5GA 2EMHA 1L4SA 2EPAA 4BCAA 1A1KA 2JOXA 3FIGA 3EPJA 2EM3A 1WHQA 1ZR9A 2BBGA 2YTNA 1TN9A 1X48A 4HTGA 3IWCA 1QNTA 2EMLA 2RTXA 4F9BB 2L3JA 2UXCE 5A69A 1YYOA 2M7QA 2BB8A 2EQ3A 2CSHA 1GZ6A 2LJUA 1IBME 4KWYA 5A6BA 2V88A 2IHR1 4JI2E 2I9IA 4R2DA 4MLQA 4F6MA 1XMOE 5KL3A 3EQ1A 3BBGA 2B9DA 1FJGE 4DV0E 3F6GA 4Q35B 4RH8A 3MHHC 1YUIA 4AQYE 2LV2A 2EMBA 1X6HA 1YPNA 2YTPA 4WXDA 2EL4A 2WBSA 4LFAE 3T1YE 1SR9A 3JAMC 4R2EA 3ZOQB 4B3TE 5A2QC 4J8ZA 1HNZE 2MDRA 1DGCA 2JY9A 5AC4A 2EOJA 2WBTA 4F9CB 2EPXA 5AE2A 2RQLA 2YU5A 2YTJA 2EOHA 2EOIA 5DNYA 5LMUE 1UBDC 2MKNA 1TF3A 1BB8A 5CFFE 2EM6A 1PKPA 3HQ1A 3J7Yp 4LU9A 4WFTA 4ZYEA 3AUZA 2DLKA 1NEIA 1PDAA 1STUA 1ZBTA 4N4RB 4NXNE 1TF6A 2V83A 2EM9A 2LCEA 5ADZA 4F6NA 1YZ9A 2EOOA 3DF6A 4LF4E 4DR1E 1A1JA 3MHSC 2EMWA 4RHBB 4F54A 4DV4E 5AE1A 1SFEA 2N3HA 1HNXE 4OOGC 2L92A 2EMFA 4B3ME 2EPCA 1A1LA 2UXBE 1PJSA 2EM0A 2EMGA 3ECRA 2VQEE 4DV2E 4JI3E 4LFBE 3IWBA 4R8OA 1BBGA 1EH6A 2ENCA 2EMAA 4DV5E 4GZNC 3UK3C 1XNQE 3ADLA 2F4VE 1XNRE 2EMIA 2L2NA 3HPZA 5LLQA 2EJ4A 4LTYA 2EWLA 2M9AA 3DJWA 2ZM6E 2JXPA 5IWAE 2YSOA 2EZ6A 3J7AG 2JPAA 2EPPA 2MKDA 2E1MA 2E72A 2KONA 3J81C 2EM8A 2I13A 2EM4A 2F8BA 1IBKE 4BHCA 4WSGA 4R2CA 2RSIA 4DV6E 1A1FA 3HPSA 2CTDA 1G2FC 1F2IG 1T39A 4DR5E 2VF1A 4M0VA 2LVHA 5KL2A 2EL6A 3BIDA 1RQ0A 4X64E 5T6JA 2L2MA 2K4VA 4JI8E 5IXMB 2EOXA 4LF9E 4GKKE 2YTOA 2EOMA 1HR0E 2HC5A 4M30A 4YY3E 5BR8E 3AV0A 3C4BA 5AE3A 2L3CA 4TUGA 4B3SE 1EH8A 1KYQA 2LRSA 5KL7A 4JV5E 3J80C
chains in the Genus database with same CATH topology
1WJPA 3EPKA 2PRTA 4R2EA 1ZAAC 4M9VC 2ELYA 2YRHA 2YRKA 2DMIA 2EOQA 2EP3A 1DGCA 1X3CA 2EOJA 2WBTA 4IJDA 4R2RA 2GLIA 2YTEA 2EPXA 2YU5A 2J7JA 2WCC3 1B69A 2EMYA 2YTJA 2EOHA 2EOIA 1UBDC 2MKNA 1TF3A 2EN4A 2EOYA 2CT1A 1BB8A 1Z1BA 2EM6A 1P47A 1NCSA 2EPUA 1RMDA 2D9HA 2EMXA 2MDGA 1BBOA 1YSAC 2EPZA 2EMZA 2DLKA 2EL5A 2EN2A 4R2SA 1TF6A 3EPLA 2EM9A 2LCEA 2YSPA 2EMKA 2R1FA 4F6NA 2EN8A 2EOOA 2EN7A 2JP9A 1A1JA 3MHSC 2EMWA 5KL4A 4IS1C 1JK2A 2YRMA 5KL6A 2EE8A 2GHFA 2EM7A 2HGHA 3EPHA 4X9JA 2ENAA 2YTFA 3VHTB 4FK5C 2EMFA 2EPCA 2EQ0A 2EOZA 2EM0A 1A1LA 2DRPA 2EMGA 2EN1A 2YTGA 2EMHA 1ZU1A 2EPAA 1A1KA 2YTIA 2ENCA 2EMAA 2EM2A 3EPJA 2YTDA 3UK3C 4GZNC 2EM3A 2LT7A 1LLMC 1ZR9A 5KL5A 1KJKA 2EMIA 2EJ4A 2YTNA 1A1HA 2M9AA 1AAYA 1TN9A 4R2AA 1X6FA 4R2PA 2YSOA 2EMLA 2JPAA 2NABA 4F2JC 2EORA 2EPPA 2MKDA 2E72A 2EM8A 2BB8A 2EOEA 2WBUA 2I13A 2EM4A 2EQ3A 2CSHA 2VRDA 2YU8A 4WSGA 4R2CA 2RSIA 1A1GA 2EOFA 1A1FA 2EN3A 2CTDA 1G2FC 4R2DA 2ENHA 1F2IG 4F6MA 1A1IA 2RPCA 2DLQA 2LVHA 5KL3A 3M99B 2A25A 1X5WA 5KL2A 2EL6A 1UN6B 2EOSA 4R2QA 2EM5A 3MHHC 2EOXA 1YUIA 2YTOA 2EOMA 1MEYC 2LV2A 1YUJA 1JK1A 2DGCA 1G2DC 2EMBA 1X6HA 2LO3A 2EN6A 1X6EA 2YTPA 2EPRA 2EL4A 5KL7A 2WBSA 2YTQA 2EMCA 2ADRA 2EQ1A 2ELZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJP A;  3EPK A;  2PRT A;  4R2E A;  1ZAA C;  4M9V C;  2ELY A;  2YRH A;  2YRK A;  2DMI A;  2EOQ A;  2EP3 A;  1DGC A;  1X3C A;  2EOJ A;  2WBT A;  4IJD A;  4R2R A;  2GLI A;  2YTE A;  2EPX A;  2YU5 A;  2J7J A;  2WCC 3;  1B69 A;  2EMY A;  2YTJ A;  2EOH A;  2EOI A;  1UBD C;  2MKN A;  1TF3 A;  2EN4 A;  2EOY A;  2CT1 A;  1BB8 A;  1Z1B A;  2EM6 A;  1P47 A;  1NCS A;  2EPU A;  1RMD A;  2D9H A;  2EMX A;  2MDG A;  1BBO A;  1YSA C;  2EPZ A;  2EMZ A;  2DLK A;  2EL5 A;  2EN2 A;  4R2S A;  1TF6 A;  3EPL A;  2EM9 A;  2LCE A;  2YSP A;  2EMK A;  2R1F A;  4F6N A;  2EN8 A;  2EOO A;  2EN7 A;  2JP9 A;  1A1J A;  3MHS C;  2EMW A;  5KL4 A;  4IS1 C;  1JK2 A;  2YRM A;  5KL6 A;  2EE8 A;  2GHF A;  2EM7 A;  2HGH A;  3EPH A;  4X9J A;  2ENA A;  2YTF A;  3VHT B;  4FK5 C;  2EMF A;  2EPC A;  2EQ0 A;  2EOZ A;  2EM0 A;  1A1L A;  2DRP A;  2EMG A;  2EN1 A;  2YTG A;  2EMH A;  1ZU1 A;  2EPA A;  1A1K A;  2YTI A;  2ENC A;  2EMA A;  2EM2 A;  3EPJ A;  2YTD A;  3UK3 C;  4GZN C;  2EM3 A;  2LT7 A;  1LLM C;  1ZR9 A;  5KL5 A;  1KJK A;  2EMI A;  2EJ4 A;  2YTN A;  1A1H A;  2M9A A;  1AAY A;  1TN9 A;  4R2A A;  1X6F A;  4R2P A;  2YSO A;  2EML A;  2JPA A;  2NAB A;  4F2J C;  2EOR A;  2EPP A;  2MKD A;  2E72 A;  2EM8 A;  2BB8 A;  2EOE A;  2WBU A;  2I13 A;  2EM4 A;  2EQ3 A;  2CSH A;  2VRD A;  2YU8 A;  4WSG A;  4R2C A;  2RSI A;  1A1G A;  2EOF A;  1A1F A;  2EN3 A;  2CTD A;  1G2F C;  4R2D A;  2ENH A;  1F2I G;  4F6M A;  1A1I A;  2RPC A;  2DLQ A;  2LVH A;  5KL3 A;  3M99 B;  2A25 A;  1X5W A;  5KL2 A;  2EL6 A;  1UN6 B;  2EOS A;  4R2Q A;  2EM5 A;  3MHH C;  2EOX A;  1YUI A;  2YTO A;  2EOM A;  1MEY C;  2LV2 A;  1YUJ A;  1JK1 A;  2DGC A;  1G2D C;  2EMB A;  1X6H A;  2LO3 A;  2EN6 A;  1X6E A;  2YTP A;  2EPR A;  2EL4 A;  5KL7 A;  2WBS A;  2YTQ A;  2EMC A;  2ADR A;  2EQ1 A;  2ELZ A; 
#chains in the Genus database with same CATH topology
 1WJP A;  4P78 A;  3OML A;  4O24 A;  2DSY A;  1ZAA C;  4M9V C;  2ELY A;  4I8O A;  1DQ3 A;  4BMJ A;  2EP3 A;  2H36 X;  5TSE A;  1X3C A;  1T38 A;  2YTE A;  2J7J A;  2K7I A;  3H09 A;  4DV1 E;  1UIL A;  2UUC E;  2CT1 A;  4DUY E;  3C6M A;  1P47 A;  1O0W A;  3KZY A;  2DMY A;  5A6A A;  1EH7 A;  3HXL A;  5AAS A;  4X65 E;  1BBO A;  2ODR C;  4GEQ B;  3EPL A;  2EN8 A;  1N32 E;  2JP9 A;  3RMP A;  2VQF E;  2EPM X;  5KL6 A;  2HGH A;  1N36 E;  4X9J A;  2L2K B;  2ENA A;  1N33 E;  1IBL E;  2VE7 C;  1WXR A;  2EOZ A;  2V89 A;  2EN1 A;  2YTG A;  2LUQ A;  2B7V A;  4P7D A;  2YTI A;  3T1H E;  3MSW A;  2EM2 A;  2L33 A;  4JI5 E;  2LT7 A;  2RS6 A;  1KJK A;  4R03 A;  1A1H A;  2UU9 E;  4BC9 A;  1AAY A;  4M2Z A;  1X6F A;  2V8Q B;  1IQS A;  1MGT A;  4R2P A;  4ZYD A;  2NAB A;  4F2J C;  2EOR A;  2RSM A;  3QG5 C;  4DR4 E;  4BS9 A;  2YU8 A;  4DR2 E;  4LF7 E;  5F3W A;  1J5E E;  1A1G A;  4NXM E;  2EN3 A;  2DIX A;  1PJQ A;  1GTK A;  1A1I A;  2RPC A;  1XMQ E;  2A25 A;  1X5W A;  3ADG A;  2JWO A;  2EOS A;  2YWQ A;  4R2Q A;  1N3G A;  4DV7 E;  4X62 E;  4JI7 E;  2G7H A;  1YUJ A;  1JK1 A;  3BF2 A;  2DB2 A;  2LTS A;  2EPN A;  3THN A;  2GPI A;  2KHX A;  1EKZ A;  4OX9 E;  4B3R E;  1PJT A;  2B3T B;  2EPR A;  2FTX B;  4LF8 E;  1T4O A;  2EQ1 A;  2ELZ A;  2D9H A;  3EPK A;  4GKJ E;  2PRT A;  4DKK A;  2UXD E;  2N3G A;  2YRH A;  2YRK A;  3F6H A;  2DMI A;  1T4L B;  2EOQ A;  2LUP B;  4JI4 E;  3VYX A;  4IJD A;  4R2R A;  3IWD A;  3JTZ A;  2GLI A;  2MC6 A;  2WCC 3;  2EMY A;  2EPL X;  2L8T A;  4Q28 A;  1Z1B A;  5IT9 C;  1IQO A;  2EPU A;  4WPY A;  2FV4 B;  2ODR D;  1YSA C;  2EPZ A;  2EL5 A;  2EN2 A;  1ZBQ A;  2HHH E;  2JOB A;  3VK6 A;  1RC7 A;  3HTX A;  4O43 A;  2EN7 A;  4IS1 C;  1JK2 A;  2EE8 A;  2GHF A;  2M4I A;  2LE2 A;  2YT4 A;  3LLH A;  4X8W A;  5LMN E;  1UHZ A;  4DMI A;  3K6Q A;  4KZS A;  1X49 A;  1IMU A;  2V87 A;  1ZU1 A;  2NUE A;  4DR7 E;  1X47 A;  2V85 A;  2YTD A;  1LLM C;  2EPO A;  5KL5 A;  3BGH A;  4X66 E;  4DR3 E;  4BBY A;  2NUG A;  4JI1 E;  4ZYG A;  4BC7 A;  4R2A A;  4NZV A;  2UUA E;  4BHB A;  4L5N C;  4O4K A;  3KWR A;  2LBS B;  4DR6 E;  1J26 A;  2EOE A;  4HEI A;  2WBU A;  2VRD A;  2V86 A;  4WYQ B;  5FLX C;  2EOF A;  3L00 A;  4LF6 E;  4TUI A;  2ENH A;  2DLQ A;  3M99 B;  2JYA A;  2WZO A;  1UN6 B;  3JU0 A;  4JYA E;  5A6J A;  4JI6 E;  2EM5 A;  4F9A B;  2LJH A;  2JVA A;  3OTO E;  2R76 A;  1MEY C;  2DGC A;  2FGG A;  4KHP E;  4NHR A;  1G2D C;  2E5L E;  2Q8U A;  4WSP A;  2LO3 A;  2EN6 A;  1X6E A;  3KZZ A;  1DI2 A;  2YZT A;  2YTQ A;  2EMC A;  2ADR A;  2CPN A;  3ADJ A;  2LMZ A;  2MC5 A;  5AC5 A;  4DUZ E;  2JR1 A;  2EPK X;  2NUF A;  1T4N A;  5A6K A;  3THO B;  1HNW E;  1WRJ A;  4L8N A;  1I94 E;  1GQE A;  1YFH A;  1B69 A;  2EN4 A;  2NA2 A;  2EOY A;  4JI0 E;  1YYK A;  2N8X A;  4ZYH A;  4MLV A;  4LF5 E;  3LML A;  3ADI A;  1AH5 A;  1NCS A;  1RMD A;  2EMX A;  2YPN A;  2MDG A;  1YYW A;  5LL6 R;  2EMZ A;  4R2S A;  3VYY A;  4WX9 A;  2YSP A;  2EMK A;  2R1F A;  4DV3 E;  2KOU A;  2HJJ A;  1WHN A;  1N34 E;  3P1X A;  5KL4 A;  2YRM A;  3C6K A;  2LTR A;  2UUB E;  3EPH A;  2EM7 A;  2L6M A;  2B7T A;  5IV8 B;  4YHH E;  1FKA E;  2YTF A;  3TQM A;  4WXC A;  2M1S A;  3VHT B;  3C4T A;  4FK5 C;  2RS7 A;  1QU6 A;  2EQ0 A;  2DRP A;  4K0K E;  4LFC E;  5A6B D;  4O5G A;  2EMH A;  1L4S A;  2EPA A;  4BCA A;  1A1K A;  2JOX A;  3FIG A;  3EPJ A;  2EM3 A;  1WHQ A;  1ZR9 A;  2BBG A;  2YTN A;  1TN9 A;  1X48 A;  4HTG A;  3IWC A;  1QNT A;  2EML A;  2RTX A;  4F9B B;  2L3J A;  2UXC E;  5A69 A;  1YYO A;  2M7Q A;  2BB8 A;  2EQ3 A;  2CSH A;  1GZ6 A;  2LJU A;  1IBM E;  4KWY A;  5A6B A;  2V88 A;  2IHR 1;  4JI2 E;  2I9I A;  4R2D A;  4MLQ A;  4F6M A;  1XMO E;  5KL3 A;  3EQ1 A;  3BBG A;  2B9D A;  1FJG E;  4DV0 E;  3F6G A;  4Q35 B;  4RH8 A;  3MHH C;  1YUI A;  4AQY E;  2LV2 A;  2EMB A;  1X6H A;  1YPN A;  2YTP A;  4WXD A;  2EL4 A;  2WBS A;  4LFA E;  3T1Y E;  1SR9 A;  3JAM C;  4R2E A;  3ZOQ B;  4B3T E;  5A2Q C;  4J8Z A;  1HNZ E;  2MDR A;  1DGC A;  2JY9 A;  5AC4 A;  2EOJ A;  2WBT A;  4F9C B;  2EPX A;  5AE2 A;  2RQL A;  2YU5 A;  2YTJ A;  2EOH A;  2EOI A;  5DNY A;  5LMU E;  1UBD C;  2MKN A;  1TF3 A;  1BB8 A;  5CFF E;  2EM6 A;  1PKP A;  3HQ1 A;  3J7Y p;  4LU9 A;  4WFT A;  4ZYE A;  3AUZ A;  2DLK A;  1NEI A;  1PDA A;  1STU A;  1ZBT A;  4N4R B;  4NXN E;  1TF6 A;  2V83 A;  2EM9 A;  2LCE A;  5ADZ A;  4F6N A;  1YZ9 A;  2EOO A;  3DF6 A;  4LF4 E;  4DR1 E;  1A1J A;  3MHS C;  2EMW A;  4RHB B;  4F54 A;  4DV4 E;  5AE1 A;  1SFE A;  2N3H A;  1HNX E;  4OOG C;  2L92 A;  2EMF A;  4B3M E;  2EPC A;  1A1L A;  2UXB E;  1PJS A;  2EM0 A;  2EMG A;  3ECR A;  2VQE E;  4DV2 E;  4JI3 E;  4LFB E;  3IWB A;  4R8O A;  1BBG A;  1EH6 A;  2ENC A;  2EMA A;  4DV5 E;  4GZN C;  3UK3 C;  1XNQ E;  3ADL A;  2F4V E;  1XNR E;  2EMI A;  2L2N A;  3HPZ A;  5LLQ A;  2EJ4 A;  4LTY A;  2EWL A;  2M9A A;  3DJW A;  2ZM6 E;  2JXP A;  5IWA E;  2YSO A;  2EZ6 A;  3J7A G;  2JPA A;  2EPP A;  2MKD A;  2E1M A;  2E72 A;  2KON A;  3J81 C;  2EM8 A;  2I13 A;  2EM4 A;  2F8B A;  1IBK E;  4BHC A;  4WSG A;  4R2C A;  2RSI A;  4DV6 E;  1A1F A;  3HPS A;  2CTD A;  1G2F C;  1F2I G;  1T39 A;  4DR5 E;  2VF1 A;  4M0V A;  2LVH A;  5KL2 A;  2EL6 A;  3BID A;  1RQ0 A;  4X64 E;  5T6J A;  2L2M A;  2K4V A;  4JI8 E;  5IXM B;  2EOX A;  4LF9 E;  4GKK E;  2YTO A;  2EOM A;  1HR0 E;  2HC5 A;  4M30 A;  4YY3 E;  5BR8 E;  3AV0 A;  3C4B A;  5AE3 A;  2L3C A;  4TUG A;  4B3S E;  1EH8 A;  1KYQ A;  2LRS A;  5KL7 A;  4JV5 E;  3J80 C; 
#chains in the Genus database with same CATH homology
 1WJP A;  3EPK A;  2PRT A;  4R2E A;  1ZAA C;  4M9V C;  2ELY A;  2YRH A;  2YRK A;  2DMI A;  2EOQ A;  2EP3 A;  1DGC A;  1X3C A;  2EOJ A;  2WBT A;  4IJD A;  4R2R A;  2GLI A;  2YTE A;  2EPX A;  2YU5 A;  2J7J A;  2WCC 3;  1B69 A;  2EMY A;  2YTJ A;  2EOH A;  2EOI A;  1UBD C;  2MKN A;  1TF3 A;  2EN4 A;  2EOY A;  2CT1 A;  1BB8 A;  1Z1B A;  2EM6 A;  1P47 A;  1NCS A;  2EPU A;  1RMD A;  2D9H A;  2EMX A;  2MDG A;  1BBO A;  1YSA C;  2EPZ A;  2EMZ A;  2DLK A;  2EL5 A;  2EN2 A;  4R2S A;  1TF6 A;  3EPL A;  2EM9 A;  2LCE A;  2YSP A;  2EMK A;  2R1F A;  4F6N A;  2EN8 A;  2EOO A;  2EN7 A;  2JP9 A;  1A1J A;  3MHS C;  2EMW A;  5KL4 A;  4IS1 C;  1JK2 A;  2YRM A;  5KL6 A;  2EE8 A;  2GHF A;  2EM7 A;  2HGH A;  3EPH A;  4X9J A;  2ENA A;  2YTF A;  3VHT B;  4FK5 C;  2EMF A;  2EPC A;  2EQ0 A;  2EOZ A;  2EM0 A;  1A1L A;  2DRP A;  2EMG A;  2EN1 A;  2YTG A;  2EMH A;  1ZU1 A;  2EPA A;  1A1K A;  2YTI A;  2ENC A;  2EMA A;  2EM2 A;  3EPJ A;  2YTD A;  3UK3 C;  4GZN C;  2EM3 A;  2LT7 A;  1LLM C;  1ZR9 A;  5KL5 A;  1KJK A;  2EMI A;  2EJ4 A;  2YTN A;  1A1H A;  2M9A A;  1AAY A;  1TN9 A;  4R2A A;  1X6F A;  4R2P A;  2YSO A;  2EML A;  2JPA A;  2NAB A;  4F2J C;  2EOR A;  2EPP A;  2MKD A;  2E72 A;  2EM8 A;  2BB8 A;  2EOE A;  2WBU A;  2I13 A;  2EM4 A;  2EQ3 A;  2CSH A;  2VRD A;  2YU8 A;  4WSG A;  4R2C A;  2RSI A;  1A1G A;  2EOF A;  1A1F A;  2EN3 A;  2CTD A;  1G2F C;  4R2D A;  2ENH A;  1F2I G;  4F6M A;  1A1I A;  2RPC A;  2DLQ A;  2LVH A;  5KL3 A;  3M99 B;  2A25 A;  1X5W A;  5KL2 A;  2EL6 A;  1UN6 B;  2EOS A;  4R2Q A;  2EM5 A;  3MHH C;  2EOX A;  1YUI A;  2YTO A;  2EOM A;  1MEY C;  2LV2 A;  1YUJ A;  1JK1 A;  2DGC A;  1G2D C;  2EMB A;  1X6H A;  2LO3 A;  2EN6 A;  1X6E A;  2YTP A;  2EPR A;  2EL4 A;  5KL7 A;  2WBS A;  2YTQ A;  2EMC A;  2ADR A;  2EQ1 A;  2ELZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...