2YU5A

Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the zf-C2H2 domain (669-699AA) in zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu5A00
2EOEA 2WBUA 2EQ1A 2EOOA 2EP3A 2R1FA 4X9JA 2EOIA 2YTNA 2EOMA 2EQ0A 1X6FA 3UK3C 4F2JC 2WCC3 2RSIA 1A1HA 2I13A 2M9AA 2YTEA 2CTDA 1ZAAC 1NCSA 2D9HA 2CSHA 1A1LA 2EN3A 3MHSC 4R2EA 2DRPA 4F6NA 2ENCA 2GLIA 5KL3A 1ZU1A 2DGCA 2WBSA 4R2QA 3EPLA 5KL4A 1ZR9A 2DMIA 2EOXA 4R2DA 2EOZA 2YU8A 2EN7A 2EMIA 2JP9A 3EPHA 2EE8A 2LT7A 2EOFA 2GHFA 1YSAC 2EOSA 2A25A 1G2FC 2EM3A 1X6HA 2EPZA 2EPAA 2EM0A 1BB8A 2ELZA 2EPPA 2YTOA 3EPJA 2LVHA 1X5WA 2EMXA 1G2DC 1B69A 2EMHA 2EOQA 2ELYA 2EMWA 2LO3A 2JPAA 1MEYC 2EMBA 2YTIA 2EMYA 2EQ3A 2J7JA 2EN8A 4R2PA 4GZNC 2EPUA 1A1KA 2EM2A 2EMLA 2EL6A 2DLKA 2EM7A 4R2RA 1JK1A 1RMDA 2EPRA 1YUJA 3MHHC 2LV2A 2EM8A 2RPCA 2ENAA 2EMFA 1X3CA 1A1JA 2EOYA 2EJ4A 2EL4A 2YU5A 1JK2A 1LLMC 1X6EA 4IJDA 5KL2A 2EM4A 2YSPA 2EMCA 3M99B 3EPKA 2NABA 2EOHA 1UN6B 1KJKA 2DLQA 3VHTB 2EM9A 1WJPA 2EN2A 2EPXA 4F6MA 2EMAA 4M9VC 2EOJA 2EN1A 1UBDC 1TF3A 2EL5A 2YRKA 2EMZA 2EPCA 2EM6A 2YTFA 4R2CA 2CT1A 1F2IG 4R2SA 1TF6A 1DGCA 4IS1C 4R2AA 2MKNA 2E72A 2YRHA 2BB8A 2VRDA 2MKDA 2YSOA 5KL6A 2EM5A 2HGHA 2YTPA 4FK5C 2YTJA 2EN4A 2EORA 2ADRA 5KL7A 2EMGA 1BBOA 2EMKA 1AAYA 1YUIA 5KL5A 1TN9A 2MDGA 2EN6A 2LCEA 1Z1BA 2PRTA 4WSGA 2WBTA 2YTDA 1P47A 1A1GA 1A1FA 2YTGA 2YTQA 2YRMA 2ENHA 1A1IA
chains in the Genus database with same CATH superfamily
5IT9C 2M1SA 2WBUA 3THOB 2KOUA 5A6BD 4LTYA 1XNQE 2EOIA 3BIDA 4P7DA 1J5EE 1KYQA 2L2MA 3UK3C 5CFFE 4F2JC 3KWRA 4P78A 2L3CA 4J8ZA 2L2KB 2I13A 2M9AA 4B3RE 1GZ6A 2V83A 4B3SE 1NCSA 4LF5E 4DR3E 5A6JA 2EN3A 4O5GA 4JI7E 2ENCA 5KL3A 2RSMA 2WBSA 3EPLA 2L3JA 2DSYA 2L33A 5A6AA 2EOFA 3T1YE 1YSAC 4F9CB 2A25A 4LU9A 2VQFE 4DR6E 2K4VA 4DV5E 1BB8A 2EPKX 2ELZA 2EPPA 2E1MA 5IWAE 1GTKA 3HPZA 3KZZA 4OX9E 2ELYA 1SR9A 2L92A 3MSWA 4X65E 1J26A 1DI2A 1DQ3A 4LF6E 2EMWA 2LO3A 4NZVA 2EMBA 2EPLX 3ADJA 3ADLA 2LRSA 2EN8A 3ECRA 1A1KA 2EMLA 3LMLA 2EL6A 4YHHE 1JK1A 2UXDE 5AE1A 1RMDA 4X64E 1YFHA 2YT4A 2LUPB 2EM8A 1STUA 4M2ZA 2F8BA 1RC7A 2EWLA 3OMLA 3LLHA 4WXDA 2FV4B 3OTOE 2YSPA 2YZTA 2EPNA 2EPMX 4JV5E 5FLXC 1IBKE 1UN6B 3JTZA 2K7IA 3VHTB 2FGGA 2EN2A 5TSEA 4DUYE 4M9VC 2EOJA 1T4NA 3ZOQB 2EL5A 5AASA 2EM6A 4BHBA 1X48A 1TF6A 4WYQB 4X8WA 4OOGC 4NXME 1FJGE 2E72A 2L8TA 2YRHA 2Q8UA 2VRDA 5BR8E 3HQ1A 2EM5A 4FK5C 5DNYA 4KZSA 1BBOA 2V87A 1HNWE 4DV3E 2MDGA 1Z1BA 4JI2E 4WSGA 2YTDA 2YTGA 4O24A 2YRMA 4NXNE 1A1IA 2EOEA 1XMQE 1HR0E 2L2NA 1PKPA 2EP3A 2R1FA 5LL6R 2YTNA 4JI4E 2DMYA 2EOMA 2GPIA 2LBSB 1N36E 1ZAAC 4MLQA 2D9HA 2CSHA 1N33E 3MHSC 2HJJA 2DRPA 4F6NA 3BF2A 1IQOA 1N32E 2DGCA 2B7VA 1WHQA 3H09A 2EOXA 5IV8B 4DV7E 4JYAE 3VYYA 3EPHA 3HTXA 1X47A 3RMPA 1G2FC 2EM3A 2EPZA 2EPAA 2N8XA 1T4OA 4AQYE 1SFEA 3EPJA 1ZBTA 1B69A 2H36X 2EMHA 2EOQA 3QG5C 2NUFA 5T6JA 4BHCA 3VK6A 2JPAA 1MEYC 4RHBB 3HXLA 2EMYA 2MDRA 2EQ3A 3IWCA 4N4RB 4GZNC 2KONA 2UUBE 2EPUA 2LJUA 2RQLA 2EPRA 4RH8A 2UXCE 2EMFA 4DR5E 1A1JA 2YU5A 4ZYDA 2DB2A 1NEIA 1YZ9A 3J7AG 2DIXA 3F6HA 1I94E 2NA2A 2EM4A 2E5LE 1IQSA 4BCAA 4GKJE 3DJWA 3M99B 5A6KA 3EPKA 2NABA 1KJKA 2DLQA 1MGTA 1XNRE 2N3HA 2UXBE 2EM9A 2UUAE 1WJPA 2LTSA 2LE2A 3J81C 1BBGA 4F6MA 1UILA 2EMAA 3IWDA 4DR2E 2EN1A 4LF9E 2G7HA 1TF3A 2EPCA 2JOBA 2YTFA 4R2CA 2NUGA 2F4VE 2JWOA 1DGCA 2LUQA 3JAMC 5AE2A 1IBLE 2YTPA 2YTJA 3C6MA 4M0VA 2EMKA 4ZYEA 1T38A 1QU6A 5KL5A 2V88A 2LCEA 3ADIA 1A1FA 4HEIA 2MC6A 1RQ0A 4Q35B 2YTEA 1QNTA 3VYXA 2EQ1A 2EOOA 4ZYGA 3TQMA 4X9JA 2FTXB 4LFCE 1GQEA 2V86A 2EQ0A 2VE7C 4BBYA 2WCC3 4DR1E 1A1HA 4X66E 3F6GA 3C6KA 4LFAE 3BGHA 1L4SA 2JY9A 2V85A 2M7QA 2GLIA 4DR7E 2HHHE 3DF6A 4R2QA 2ODRD 2DMIA 3JU0A 4R2DA 2YU8A 4DUZE 2EMIA 2EE8A 2M4IA 2JOXA 2EOSA 3J7Yp 2EM0A 4DV0E 2YTOA 4DKKA 2EMXA 1T39A 4MLVA 2RS7A 4DV2E 5IXMB 1O0WA 2B7TA 4M30A 2NUEA 1EH6A 4JI6E 2DLKA 1YUJA 3MHHC 4JI5E 4DV1E 1EH7A 5LMNE 4BS9A 1YYWA 4BC9A 1PJTA 2EOYA 1N34E 1LLMC 1X6EA 4IJDA 5AC4A 2B9DA 2WZOA 2EOHA 4LF8E 4NHRA 4I8OA 2LTRA 1PDAA 2RS6A 2EPXA 3P1XA 3L00A 2KHXA 1FKAE 1UBDC 4TUIA 1XMOE 4F9BB 2JR1A 3AV0A 4LF7E 4JI3E 4IS1C 4WPYA 2HC5A 4R2AA 4LF4E 2JYAA 2MKDA 2YSOA 1EH8A 2CPNA 5KL6A 1IMUA 2EN4A 5F3WA 5KL7A 4B3TE 4B3ME 2WBTA 1A1GA 2YTQA 2ENHA 2I9IA 4O4KA 2UU9E 5LMUE 2YPNA 3IWBA 1YYKA 3KZYA 1X6FA 4GKKE 4WX9A 2RSIA 4WXCA 1EKZA 2CTDA 4TUGA 3T1HE 2RTXA 1ZBQA 1T4LB 1A1LA 4O43A 4R2EA 3C4TA 4BMJA 1ZU1A 1YYOA 2MC5A 1WHNA 1ZR9A 5KL4A 2EOZA 3THNA 3J80C 2EN7A 3EQ1A 4KHPE 2UUCE 2JP9A 5A6BA 2LT7A 2GHFA 4YY3E 1AH5A 4DR4E 1X6HA 4BC7A 2ZM6E 4ZYHA 4F54A 2YWQA 2VQEE 4DV4E 2LVHA 1X5WA 1G2DC 1UHZA 2JVAA 4WFTA 2V89A 4JI0E 1IBME 4LFBE 2YTIA 1YPNA 2J7JA 2V8QB 3FIGA 4R2PA 2EM2A 2EM7A 4R2RA 5AE3A 2EZ6A 4K0KE 1WXRA 2LV2A 2VF1A 2RPCA 2ENAA 1X3CA 4HTGA 4KWYA 5A2QC 4L8NA 2LJHA 2R76A 2EJ4A 2EL4A 5AC5A 1JK2A 5A69A 5KL2A 2B3TB 2LMZA 2EPOA 2L6MA 2EMCA 4R8OA 3ADGA 3HPSA 4WSPA 3K6QA 3AUZA 4X62E 1PJQA 2IHR1 4Q28A 4R03A 4JI8E 1N3GA 5ADZA 4F9AB 5LLQA 2YRKA 2EMZA 1X49A 2CT1A 1F2IG 4R2SA 2BBGA 1WRJA 2MKNA 2BB8A 1HNXE 2HGHA 4DV6E 4L5NC 2JXPA 2EORA 2ADRA 2EMGA 2N3GA 1AAYA 1PJSA 1YUIA 4JI1E 2ODRC 1TN9A 2EN6A 1HNZE 2PRTA 1P47A 4GEQB 3C4BA 3BBGA 4DMIA
chains in the Genus database with same CATH topology
2EOEA 2WBUA 2EQ1A 2EOOA 2EP3A 2R1FA 4X9JA 2EOIA 2YTNA 2EOMA 2EQ0A 1X6FA 3UK3C 4F2JC 2WCC3 2RSIA 1A1HA 2I13A 2M9AA 2YTEA 2CTDA 1ZAAC 1NCSA 2D9HA 2CSHA 1A1LA 2EN3A 3MHSC 4R2EA 2DRPA 4F6NA 2ENCA 2GLIA 5KL3A 1ZU1A 2DGCA 2WBSA 4R2QA 3EPLA 5KL4A 1ZR9A 2DMIA 2EOXA 4R2DA 2EOZA 2YU8A 2EN7A 2EMIA 2JP9A 3EPHA 2EE8A 2LT7A 2EOFA 2GHFA 1YSAC 2EOSA 2A25A 1G2FC 2EM3A 1X6HA 2EPZA 2EPAA 2EM0A 1BB8A 2ELZA 2EPPA 2YTOA 3EPJA 2LVHA 1X5WA 2EMXA 1G2DC 1B69A 2EMHA 2EOQA 2ELYA 2EMWA 2LO3A 2JPAA 1MEYC 2EMBA 2YTIA 2EMYA 2EQ3A 2J7JA 2EN8A 4R2PA 4GZNC 2EPUA 1A1KA 2EM2A 2EMLA 2EL6A 2DLKA 2EM7A 4R2RA 1JK1A 1RMDA 2EPRA 1YUJA 3MHHC 2LV2A 2EM8A 2RPCA 2ENAA 2EMFA 1X3CA 1A1JA 2EOYA 2EJ4A 2EL4A 2YU5A 1JK2A 1LLMC 1X6EA 4IJDA 5KL2A 2EM4A 2YSPA 2EMCA 3M99B 3EPKA 2NABA 2EOHA 1UN6B 1KJKA 2DLQA 3VHTB 2EM9A 1WJPA 2EN2A 2EPXA 4F6MA 2EMAA 4M9VC 2EOJA 2EN1A 1UBDC 1TF3A 2EL5A 2YRKA 2EMZA 2EPCA 2EM6A 2YTFA 4R2CA 2CT1A 1F2IG 4R2SA 1TF6A 1DGCA 4IS1C 4R2AA 2MKNA 2E72A 2YRHA 2BB8A 2VRDA 2MKDA 2YSOA 5KL6A 2EM5A 2HGHA 2YTPA 4FK5C 2YTJA 2EN4A 2EORA 2ADRA 5KL7A 2EMGA 1BBOA 2EMKA 1AAYA 1YUIA 5KL5A 1TN9A 2MDGA 2EN6A 2LCEA 1Z1BA 2PRTA 4WSGA 2WBTA 2YTDA 1P47A 1A1GA 1A1FA 2YTGA 2YTQA 2YRMA 2ENHA 1A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOE A;  2WBU A;  2EQ1 A;  2EOO A;  2EP3 A;  2R1F A;  4X9J A;  2EOI A;  2YTN A;  2EOM A;  2EQ0 A;  1X6F A;  3UK3 C;  4F2J C;  2WCC 3;  2RSI A;  1A1H A;  2I13 A;  2M9A A;  2YTE A;  2CTD A;  1ZAA C;  1NCS A;  2D9H A;  2CSH A;  1A1L A;  2EN3 A;  3MHS C;  4R2E A;  2DRP A;  4F6N A;  2ENC A;  2GLI A;  5KL3 A;  1ZU1 A;  2DGC A;  2WBS A;  4R2Q A;  3EPL A;  5KL4 A;  1ZR9 A;  2DMI A;  2EOX A;  4R2D A;  2EOZ A;  2YU8 A;  2EN7 A;  2EMI A;  2JP9 A;  3EPH A;  2EE8 A;  2LT7 A;  2EOF A;  2GHF A;  1YSA C;  2EOS A;  2A25 A;  1G2F C;  2EM3 A;  1X6H A;  2EPZ A;  2EPA A;  2EM0 A;  1BB8 A;  2ELZ A;  2EPP A;  2YTO A;  3EPJ A;  2LVH A;  1X5W A;  2EMX A;  1G2D C;  1B69 A;  2EMH A;  2EOQ A;  2ELY A;  2EMW A;  2LO3 A;  2JPA A;  1MEY C;  2EMB A;  2YTI A;  2EMY A;  2EQ3 A;  2J7J A;  2EN8 A;  4R2P A;  4GZN C;  2EPU A;  1A1K A;  2EM2 A;  2EML A;  2EL6 A;  2DLK A;  2EM7 A;  4R2R A;  1JK1 A;  1RMD A;  2EPR A;  1YUJ A;  3MHH C;  2LV2 A;  2EM8 A;  2RPC A;  2ENA A;  2EMF A;  1X3C A;  1A1J A;  2EOY A;  2EJ4 A;  2EL4 A;  2YU5 A;  1JK2 A;  1LLM C;  1X6E A;  4IJD A;  5KL2 A;  2EM4 A;  2YSP A;  2EMC A;  3M99 B;  3EPK A;  2NAB A;  2EOH A;  1UN6 B;  1KJK A;  2DLQ A;  3VHT B;  2EM9 A;  1WJP A;  2EN2 A;  2EPX A;  4F6M A;  2EMA A;  4M9V C;  2EOJ A;  2EN1 A;  1UBD C;  1TF3 A;  2EL5 A;  2YRK A;  2EMZ A;  2EPC A;  2EM6 A;  2YTF A;  4R2C A;  2CT1 A;  1F2I G;  4R2S A;  1TF6 A;  1DGC A;  4IS1 C;  4R2A A;  2MKN A;  2E72 A;  2YRH A;  2BB8 A;  2VRD A;  2MKD A;  2YSO A;  5KL6 A;  2EM5 A;  2HGH A;  2YTP A;  4FK5 C;  2YTJ A;  2EN4 A;  2EOR A;  2ADR A;  5KL7 A;  2EMG A;  1BBO A;  2EMK A;  1AAY A;  1YUI A;  5KL5 A;  1TN9 A;  2MDG A;  2EN6 A;  2LCE A;  1Z1B A;  2PRT A;  4WSG A;  2WBT A;  2YTD A;  1P47 A;  1A1G A;  1A1F A;  2YTG A;  2YTQ A;  2YRM A;  2ENH A;  1A1I A; 
#chains in the Genus database with same CATH topology
 5IT9 C;  2M1S A;  2WBU A;  3THO B;  2KOU A;  5A6B D;  4LTY A;  1XNQ E;  2EOI A;  3BID A;  4P7D A;  1J5E E;  1KYQ A;  2L2M A;  3UK3 C;  5CFF E;  4F2J C;  3KWR A;  4P78 A;  2L3C A;  4J8Z A;  2L2K B;  2I13 A;  2M9A A;  4B3R E;  1GZ6 A;  2V83 A;  4B3S E;  1NCS A;  4LF5 E;  4DR3 E;  5A6J A;  2EN3 A;  4O5G A;  4JI7 E;  2ENC A;  5KL3 A;  2RSM A;  2WBS A;  3EPL A;  2L3J A;  2DSY A;  2L33 A;  5A6A A;  2EOF A;  3T1Y E;  1YSA C;  4F9C B;  2A25 A;  4LU9 A;  2VQF E;  4DR6 E;  2K4V A;  4DV5 E;  1BB8 A;  2EPK X;  2ELZ A;  2EPP A;  2E1M A;  5IWA E;  1GTK A;  3HPZ A;  3KZZ A;  4OX9 E;  2ELY A;  1SR9 A;  2L92 A;  3MSW A;  4X65 E;  1J26 A;  1DI2 A;  1DQ3 A;  4LF6 E;  2EMW A;  2LO3 A;  4NZV A;  2EMB A;  2EPL X;  3ADJ A;  3ADL A;  2LRS A;  2EN8 A;  3ECR A;  1A1K A;  2EML A;  3LML A;  2EL6 A;  4YHH E;  1JK1 A;  2UXD E;  5AE1 A;  1RMD A;  4X64 E;  1YFH A;  2YT4 A;  2LUP B;  2EM8 A;  1STU A;  4M2Z A;  2F8B A;  1RC7 A;  2EWL A;  3OML A;  3LLH A;  4WXD A;  2FV4 B;  3OTO E;  2YSP A;  2YZT A;  2EPN A;  2EPM X;  4JV5 E;  5FLX C;  1IBK E;  1UN6 B;  3JTZ A;  2K7I A;  3VHT B;  2FGG A;  2EN2 A;  5TSE A;  4DUY E;  4M9V C;  2EOJ A;  1T4N A;  3ZOQ B;  2EL5 A;  5AAS A;  2EM6 A;  4BHB A;  1X48 A;  1TF6 A;  4WYQ B;  4X8W A;  4OOG C;  4NXM E;  1FJG E;  2E72 A;  2L8T A;  2YRH A;  2Q8U A;  2VRD A;  5BR8 E;  3HQ1 A;  2EM5 A;  4FK5 C;  5DNY A;  4KZS A;  1BBO A;  2V87 A;  1HNW E;  4DV3 E;  2MDG A;  1Z1B A;  4JI2 E;  4WSG A;  2YTD A;  2YTG A;  4O24 A;  2YRM A;  4NXN E;  1A1I A;  2EOE A;  1XMQ E;  1HR0 E;  2L2N A;  1PKP A;  2EP3 A;  2R1F A;  5LL6 R;  2YTN A;  4JI4 E;  2DMY A;  2EOM A;  2GPI A;  2LBS B;  1N36 E;  1ZAA C;  4MLQ A;  2D9H A;  2CSH A;  1N33 E;  3MHS C;  2HJJ A;  2DRP A;  4F6N A;  3BF2 A;  1IQO A;  1N32 E;  2DGC A;  2B7V A;  1WHQ A;  3H09 A;  2EOX A;  5IV8 B;  4DV7 E;  4JYA E;  3VYY A;  3EPH A;  3HTX A;  1X47 A;  3RMP A;  1G2F C;  2EM3 A;  2EPZ A;  2EPA A;  2N8X A;  1T4O A;  4AQY E;  1SFE A;  3EPJ A;  1ZBT A;  1B69 A;  2H36 X;  2EMH A;  2EOQ A;  3QG5 C;  2NUF A;  5T6J A;  4BHC A;  3VK6 A;  2JPA A;  1MEY C;  4RHB B;  3HXL A;  2EMY A;  2MDR A;  2EQ3 A;  3IWC A;  4N4R B;  4GZN C;  2KON A;  2UUB E;  2EPU A;  2LJU A;  2RQL A;  2EPR A;  4RH8 A;  2UXC E;  2EMF A;  4DR5 E;  1A1J A;  2YU5 A;  4ZYD A;  2DB2 A;  1NEI A;  1YZ9 A;  3J7A G;  2DIX A;  3F6H A;  1I94 E;  2NA2 A;  2EM4 A;  2E5L E;  1IQS A;  4BCA A;  4GKJ E;  3DJW A;  3M99 B;  5A6K A;  3EPK A;  2NAB A;  1KJK A;  2DLQ A;  1MGT A;  1XNR E;  2N3H A;  2UXB E;  2EM9 A;  2UUA E;  1WJP A;  2LTS A;  2LE2 A;  3J81 C;  1BBG A;  4F6M A;  1UIL A;  2EMA A;  3IWD A;  4DR2 E;  2EN1 A;  4LF9 E;  2G7H A;  1TF3 A;  2EPC A;  2JOB A;  2YTF A;  4R2C A;  2NUG A;  2F4V E;  2JWO A;  1DGC A;  2LUQ A;  3JAM C;  5AE2 A;  1IBL E;  2YTP A;  2YTJ A;  3C6M A;  4M0V A;  2EMK A;  4ZYE A;  1T38 A;  1QU6 A;  5KL5 A;  2V88 A;  2LCE A;  3ADI A;  1A1F A;  4HEI A;  2MC6 A;  1RQ0 A;  4Q35 B;  2YTE A;  1QNT A;  3VYX A;  2EQ1 A;  2EOO A;  4ZYG A;  3TQM A;  4X9J A;  2FTX B;  4LFC E;  1GQE A;  2V86 A;  2EQ0 A;  2VE7 C;  4BBY A;  2WCC 3;  4DR1 E;  1A1H A;  4X66 E;  3F6G A;  3C6K A;  4LFA E;  3BGH A;  1L4S A;  2JY9 A;  2V85 A;  2M7Q A;  2GLI A;  4DR7 E;  2HHH E;  3DF6 A;  4R2Q A;  2ODR D;  2DMI A;  3JU0 A;  4R2D A;  2YU8 A;  4DUZ E;  2EMI A;  2EE8 A;  2M4I A;  2JOX A;  2EOS A;  3J7Y p;  2EM0 A;  4DV0 E;  2YTO A;  4DKK A;  2EMX A;  1T39 A;  4MLV A;  2RS7 A;  4DV2 E;  5IXM B;  1O0W A;  2B7T A;  4M30 A;  2NUE A;  1EH6 A;  4JI6 E;  2DLK A;  1YUJ A;  3MHH C;  4JI5 E;  4DV1 E;  1EH7 A;  5LMN E;  4BS9 A;  1YYW A;  4BC9 A;  1PJT A;  2EOY A;  1N34 E;  1LLM C;  1X6E A;  4IJD A;  5AC4 A;  2B9D A;  2WZO A;  2EOH A;  4LF8 E;  4NHR A;  4I8O A;  2LTR A;  1PDA A;  2RS6 A;  2EPX A;  3P1X A;  3L00 A;  2KHX A;  1FKA E;  1UBD C;  4TUI A;  1XMO E;  4F9B B;  2JR1 A;  3AV0 A;  4LF7 E;  4JI3 E;  4IS1 C;  4WPY A;  2HC5 A;  4R2A A;  4LF4 E;  2JYA A;  2MKD A;  2YSO A;  1EH8 A;  2CPN A;  5KL6 A;  1IMU A;  2EN4 A;  5F3W A;  5KL7 A;  4B3T E;  4B3M E;  2WBT A;  1A1G A;  2YTQ A;  2ENH A;  2I9I A;  4O4K A;  2UU9 E;  5LMU E;  2YPN A;  3IWB A;  1YYK A;  3KZY A;  1X6F A;  4GKK E;  4WX9 A;  2RSI A;  4WXC A;  1EKZ A;  2CTD A;  4TUG A;  3T1H E;  2RTX A;  1ZBQ A;  1T4L B;  1A1L A;  4O43 A;  4R2E A;  3C4T A;  4BMJ A;  1ZU1 A;  1YYO A;  2MC5 A;  1WHN A;  1ZR9 A;  5KL4 A;  2EOZ A;  3THN A;  3J80 C;  2EN7 A;  3EQ1 A;  4KHP E;  2UUC E;  2JP9 A;  5A6B A;  2LT7 A;  2GHF A;  4YY3 E;  1AH5 A;  4DR4 E;  1X6H A;  4BC7 A;  2ZM6 E;  4ZYH A;  4F54 A;  2YWQ A;  2VQE E;  4DV4 E;  2LVH A;  1X5W A;  1G2D C;  1UHZ A;  2JVA A;  4WFT A;  2V89 A;  4JI0 E;  1IBM E;  4LFB E;  2YTI A;  1YPN A;  2J7J A;  2V8Q B;  3FIG A;  4R2P A;  2EM2 A;  2EM7 A;  4R2R A;  5AE3 A;  2EZ6 A;  4K0K E;  1WXR A;  2LV2 A;  2VF1 A;  2RPC A;  2ENA A;  1X3C A;  4HTG A;  4KWY A;  5A2Q C;  4L8N A;  2LJH A;  2R76 A;  2EJ4 A;  2EL4 A;  5AC5 A;  1JK2 A;  5A69 A;  5KL2 A;  2B3T B;  2LMZ A;  2EPO A;  2L6M A;  2EMC A;  4R8O A;  3ADG A;  3HPS A;  4WSP A;  3K6Q A;  3AUZ A;  4X62 E;  1PJQ A;  2IHR 1;  4Q28 A;  4R03 A;  4JI8 E;  1N3G A;  5ADZ A;  4F9A B;  5LLQ A;  2YRK A;  2EMZ A;  1X49 A;  2CT1 A;  1F2I G;  4R2S A;  2BBG A;  1WRJ A;  2MKN A;  2BB8 A;  1HNX E;  2HGH A;  4DV6 E;  4L5N C;  2JXP A;  2EOR A;  2ADR A;  2EMG A;  2N3G A;  1AAY A;  1PJS A;  1YUI A;  4JI1 E;  2ODR C;  1TN9 A;  2EN6 A;  1HNZ E;  2PRT A;  1P47 A;  4GEQ B;  3C4B A;  3BBG A;  4DMI A; 
#chains in the Genus database with same CATH homology
 2EOE A;  2WBU A;  2EQ1 A;  2EOO A;  2EP3 A;  2R1F A;  4X9J A;  2EOI A;  2YTN A;  2EOM A;  2EQ0 A;  1X6F A;  3UK3 C;  4F2J C;  2WCC 3;  2RSI A;  1A1H A;  2I13 A;  2M9A A;  2YTE A;  2CTD A;  1ZAA C;  1NCS A;  2D9H A;  2CSH A;  1A1L A;  2EN3 A;  3MHS C;  4R2E A;  2DRP A;  4F6N A;  2ENC A;  2GLI A;  5KL3 A;  1ZU1 A;  2DGC A;  2WBS A;  4R2Q A;  3EPL A;  5KL4 A;  1ZR9 A;  2DMI A;  2EOX A;  4R2D A;  2EOZ A;  2YU8 A;  2EN7 A;  2EMI A;  2JP9 A;  3EPH A;  2EE8 A;  2LT7 A;  2EOF A;  2GHF A;  1YSA C;  2EOS A;  2A25 A;  1G2F C;  2EM3 A;  1X6H A;  2EPZ A;  2EPA A;  2EM0 A;  1BB8 A;  2ELZ A;  2EPP A;  2YTO A;  3EPJ A;  2LVH A;  1X5W A;  2EMX A;  1G2D C;  1B69 A;  2EMH A;  2EOQ A;  2ELY A;  2EMW A;  2LO3 A;  2JPA A;  1MEY C;  2EMB A;  2YTI A;  2EMY A;  2EQ3 A;  2J7J A;  2EN8 A;  4R2P A;  4GZN C;  2EPU A;  1A1K A;  2EM2 A;  2EML A;  2EL6 A;  2DLK A;  2EM7 A;  4R2R A;  1JK1 A;  1RMD A;  2EPR A;  1YUJ A;  3MHH C;  2LV2 A;  2EM8 A;  2RPC A;  2ENA A;  2EMF A;  1X3C A;  1A1J A;  2EOY A;  2EJ4 A;  2EL4 A;  2YU5 A;  1JK2 A;  1LLM C;  1X6E A;  4IJD A;  5KL2 A;  2EM4 A;  2YSP A;  2EMC A;  3M99 B;  3EPK A;  2NAB A;  2EOH A;  1UN6 B;  1KJK A;  2DLQ A;  3VHT B;  2EM9 A;  1WJP A;  2EN2 A;  2EPX A;  4F6M A;  2EMA A;  4M9V C;  2EOJ A;  2EN1 A;  1UBD C;  1TF3 A;  2EL5 A;  2YRK A;  2EMZ A;  2EPC A;  2EM6 A;  2YTF A;  4R2C A;  2CT1 A;  1F2I G;  4R2S A;  1TF6 A;  1DGC A;  4IS1 C;  4R2A A;  2MKN A;  2E72 A;  2YRH A;  2BB8 A;  2VRD A;  2MKD A;  2YSO A;  5KL6 A;  2EM5 A;  2HGH A;  2YTP A;  4FK5 C;  2YTJ A;  2EN4 A;  2EOR A;  2ADR A;  5KL7 A;  2EMG A;  1BBO A;  2EMK A;  1AAY A;  1YUI A;  5KL5 A;  1TN9 A;  2MDG A;  2EN6 A;  2LCE A;  1Z1B A;  2PRT A;  4WSG A;  2WBT A;  2YTD A;  1P47 A;  1A1G A;  1A1F A;  2YTG A;  2YTQ A;  2YRM A;  2ENH A;  1A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...