2YU5A

Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the zf-C2H2 domain (669-699AA) in zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu5A00
1X6EA 2EOSA 2LVHA 2NABA 2EOEA 1YUJA 2EMXA 1A1LA 2DLKA 4R2RA 2LCEA 2YTNA 2EJ4A 2EOHA 2EL6A 3M99B 1A1IA 2J7JA 4R2SA 2EMWA 2ENCA 1TN9A 2HGHA 2EN4A 2EOJA 1P47A 5KL3A 2I13A 4F2JC 2EMAA 2VRDA 2YTDA 1G2DC 4FK5C 3EPLA 2DGCA 1ZU1A 2EMZA 3UK3C 1JK1A 1A1GA 4R2QA 4WSGA 2YTEA 2EOIA 1JK2A 2WBTA 1A1HA 2M9AA 1TF6A 2LV2A 5KL7A 1Z1BA 1BBOA 2MDGA 2EL5A 2EOXA 2DMIA 2EMLA 2EN6A 2RPCA 1X5WA 4GZNC 2ADRA 2EQ1A 2RSIA 2EL4A 2EORA 2EPPA 2EOZA 2BB8A 4R2AA 2YRMA 2EN3A 4R2CA 3MHSC 2JPAA 2EPUA 2WBUA 1G2FC 1KJKA 4IS1C 1MEYC 2EM4A 1YUIA 2R1FA 2EPRA 2EM2A 2EMIA 2WBSA 2GLIA 1A1KA 2EMGA 5KL6A 2EOOA 2EMCA 2EMYA 2CT1A 2ELYA 1YSAC 2EOQA 4R2PA 1X6HA 2CSHA 2EN2A 5KL2A 2ENAA 1A1JA 2EMFA 2LO3A 2EM5A 1BB8A 2YTFA 2DLQA 1ZR9A 5KL5A 2YTQA 2EPCA 2EMKA 2EP3A 2ENHA 4F6MA 1F2IG 2JP9A 2EN1A 1UN6B 2EM8A 2LT7A 2E72A 4F6NA 2YRHA 1RMDA 1DGCA 2EPAA 3EPJA 1B69A 2EM7A 1X6FA 2PRTA 3VHTB 2D9HA 2YSPA 2EM9A 2EN7A 2WCC3 1WJPA 2YRKA 4M9VC 2MKDA 1TF3A 2EMBA 1AAYA 2EQ0A 5KL4A 2EM6A 2DRPA 2YTOA 2EOFA 2YSOA 1A1FA 2GHFA 2YTJA 3MHHC 2YTPA 4R2DA 1LLMC 2EPZA 4X9JA 2EN8A 1NCSA 2EMHA 2EOYA 1UBDC 2CTDA 2EM0A 2EQ3A 3EPKA 4R2EA 2A25A 2YTGA 2EPXA 4IJDA 2YTIA 2MKNA 1X3CA 2YU5A 2ELZA 1ZAAC 2EE8A 2EOMA 2EM3A 3EPHA 2YU8A
chains in the Genus database with same CATH superfamily
1GTKA 1X6EA 5LMUE 4DR2E 2EOEA 1HNWE 1YUJA 1IMUA 1A1LA 4BS9A 4P78A 4X8WA 4LFCE 4JI4E 4R2RA 3IWCA 4R03A 3L00A 3JAMC 4J8ZA 2EJ4A 4M2ZA 4WSPA 2EOHA 2YPNA 1N32E 2J7JA 2LBSB 3FIGA 5AE1A 1TN9A 4DV1E 3DF6A 5KL3A 2YTDA 1QNTA 4FK5C 1I94E 2EOIA 2V87A 2M9AA 2N3HA 2NUFA 4LF9E 1Z1BA 2MDGA 4F9AB 2EOXA 2HJJA 1HR0E 2EORA 2EOZA 3TQMA 4R2AA 2UXDE 3MSWA 4NXME 2JPAA 2EPUA 3BF2A 4X65E 4BMJA 1T4LB 2GLIA 5IV8B 1WXRA 2EMGA 5KL6A 2EOOA 4DR7E 1PJSA 1GZ6A 2EMYA 2CT1A 4YY3E 3IWDA 4NHRA 3KZYA 2YWQA 2M1SA 2EMFA 2KOUA 2R76A 3C6KA 1FJGE 2EM5A 4M0VA 4DR4E 3HPSA 2M7QA 4TUGA 4JV5E 2DMYA 3OTOE 1F2IG 4WFTA 2EN1A 1UN6B 1XNQE 5IXMB 4JI2E 4F9CB 2UUAE 3RMPA 2EPAA 3EPJA 1RQ0A 4L5NC 3ZOQB 2D9HA 2YSPA 2YRKA 1ZBQA 2ODRC 3ADIA 2UXCE 4ZYGA 2FGGA 1N3GA 3ECRA 2DRPA 4X64E 2V89A 3J81C 1PJQA 1WHNA 4O43A 1EH8A 1UILA 2JYAA 2E1MA 1T4NA 2HHHE 2RS6A 4LFAE 1NCSA 1YZ9A 4KZSA 2EOYA 1WRJA 2EWLA 1N36E 2DSYA 1T38A 2EPXA 4O5GA 2V8QB 2MKNA 4Q28A 2LJUA 1ZAAC 4F54A 2EM3A 3EPHA 2YU8A 2EOSA 2LVHA 2NABA 2L6MA 3DJWA 2DLKA 2LCEA 4DR6E 4B3RE 5A6JA 4ZYDA 5LL6R 4DUYE 4N4RB 2LMZA 4DV7E 2EMWA 4DMIA 2HGHA 2UUBE 2I13A 1PJTA 1XMQE 2L33A 1ZU1A 1SR9A 4WSGA 2YTEA 4ZYEA 4LF5E 2L2KB 3QG5C 1WHQA 2LV2A 5KL7A 3HQ1A 3J7Yp 2VQEE 4X62E 1XNRE 4DV6E 2EMLA 2RPCA 1X5WA 5F3WA 4B3ME 1N33E 2ADRA 2RSIA 2EL4A 4JI7E 3HPZA 2JXPA 2K7IA 4JI8E 3THOB 1G2FC 1MEYC 2R1FA 5A6KA 1IBME 4L8NA 1A1KA 2V86A 2UXBE 2LJHA 4BCAA 4Q35B 4B3TE 3F6GA 4HTGA 2CSHA 2JOBA 2LO3A 2YTFA 4TUIA 1X47A 2RTXA 5TSEA 2N3GA 3BGHA 4O24A 2EP3A 2EMKA 2VF1A 2ENHA 4F6MA 2EM8A 2E72A 4P7DA 4F6NA 1L4SA 2KHXA 5A6BA 2EM7A 4F9BB 4GKJE 5AE3A 1WJPA 3C6MA 1IBLE 2RQLA 5AASA 2MKDA 3T1YE 1AAYA 1TF3A 5KL4A 1O0WA 2EOFA 4RHBB 2YTJA 4RH8A 4R2DA 2YTPA 1T39A 4NXNE 1DI2A 2EPZA 3H09A 5AC4A 4X9JA 2YT4A 4BHBA 1YPNA 2EQ3A 3BBGA 1X48A 3AUZA 2A25A 4MLQA 4WXCA 2EPMX 2YTIA 1YYOA 1J5EE 2YU5A 2EOMA 4DV2E 1T4OA 4BC7A 1SFEA 2EMXA 2YZTA 2DIXA 5A69A 2I9IA 2RS7A 1STUA 2EL6A 1A1IA 5IT9C 4R2SA 4DR1E 2ENCA 2DB2A 2EOJA 1P47A 1X49A 2VRDA 3ADLA 3HXLA 4BBYA 4KHPE 3IWBA 3EPLA 2DGCA 2EPNA 2IHR1 3AV0A 1JK1A 3KZZA 1RC7A 2WBTA 1YYWA 1PKPA 1TF6A 2RSMA 3VK6A 3C4BA 1BBOA 2DMIA 3J7AG 5IWAE 1EH7A 4HEIA 2EN6A 4GEQB 1N34E 2LTSA 4GZNC 4DV3E 1AH5A 1QU6A 2EPPA 4O4KA 4I8OA 3LMLA 3THNA 4LF8E 2LUQA 3J80C 4DV5E 2H36X 4R2CA 2WBUA 4LFBE 2JVAA 1YUIA 2EPRA 4WX9A 4DV4E 2WBSA 4BHCA 4BC9A 3ADGA 2MC6A 4DUZE 2MC5A 2ELYA 1YSAC 1X6HA 2EN2A 3F6HA 2EPKX 1GQEA 5AC5A 2B3TB 2NA2A 3VYYA 2GPIA 1YYKA 3EQ1A 5KL5A 2YTQA 5A6AA 2EPCA 2K4VA 2JP9A 2B7VA 3K6QA 1HNZE 1PDAA 5LMNE 2EPOA 1RMDA 4AQYE 3KWRA 4ZYHA 1B69A 2PRTA 1X6FA 3LLHA 4DR5E 2VE7C 2EN7A 2WZOA 4LTYA 2EQ0A 1UHZA 2YTOA 2YSOA 1KYQA 3MHHC 2GHFA 2HC5A 2UUCE 4KWYA 2ZM6E 2JOXA 3C4TA 2UU9E 4B3SE 4LF6E 3EPKA 2YTGA 2EZ6A 3BIDA 4IJDA 2M4IA 2ELZA 4JI5E 2EE8A 2BBGA 2NUGA 2LUPB 1HNXE 2N8XA 2V83A 5LLQA 1MGTA 4JI3E 2L8TA 4LU9A 1EH6A 4JI6E 2YTNA 1IQOA 2Q8UA 3M99B 1EKZA 1YFHA 4JI1E 3JU0A 4DKKA 3P1XA 2EN4A 5A2QC 4DV0E 4F2JC 2EMAA 3T1HE 4LF4E 4OX9E 1G2DC 2V85A 2EMZA 3UK3C 1A1GA 4R2QA 2JR1A 1JK2A 1A1HA 2CPNA 2EPLX 2JY9A 4LF7E 2EL5A 4DR3E 2B7TA 2EQ1A 5AE2A 4WYQB 2BB8A 4OOGC 3ADJA 5BR8E 2YRMA 2B9DA 2EN3A 3MHSC 1DQ3A 4M30A 5ADZA 1IQSA 1KJKA 4IS1C 2EM4A 4YHHE 2EM2A 2EMIA 4X66E 4K0KE 5A6BD 2L3CA 2EMCA 4JYAE 1ZBTA 2L2MA 2EOQA 4R2PA 5KL2A 3HTXA 2ENAA 2FTXB 1A1JA 1J26A 1BB8A 3VYXA 2DLQA 1ZR9A 2FV4B 2VQFE 2JWOA 2LE2A 1IBKE 2LT7A 2ODRD 2YRHA 1DGCA 1FKAE 2L3JA 4WPYA 3VHTB 2KONA 5CFFE 2EM9A 2WCC3 5T6JA 3JTZA 4M9VC 2LTRA 2G7HA 3OMLA 2EMBA 2EM6A 2E5LE 1A1FA 1BBGA 2F8BA 1LLMC 1XMOE 4JI0E 2EN8A 4MLVA 2EMHA 5DNYA 2MDRA 2LRSA 4NZVA 1UBDC 2CTDA 2EM0A 2NUEA 1NEIA 4R2EA 2F4VE 5FLXC 4R8OA 2L92A 1X3CA 4GKKE 2L2NA 2V88A 4WXDA
chains in the Genus database with same CATH topology
1X6EA 2EOSA 2LVHA 2NABA 2EOEA 1YUJA 2EMXA 1A1LA 2DLKA 4R2RA 2LCEA 2YTNA 2EJ4A 2EOHA 2EL6A 3M99B 1A1IA 2J7JA 4R2SA 2EMWA 2ENCA 1TN9A 2HGHA 2EN4A 2EOJA 1P47A 5KL3A 2I13A 4F2JC 2EMAA 2VRDA 2YTDA 1G2DC 4FK5C 3EPLA 2DGCA 1ZU1A 2EMZA 3UK3C 1JK1A 1A1GA 4R2QA 4WSGA 2YTEA 2EOIA 1JK2A 2WBTA 1A1HA 2M9AA 1TF6A 2LV2A 5KL7A 1Z1BA 1BBOA 2MDGA 2EL5A 2EOXA 2DMIA 2EMLA 2EN6A 2RPCA 1X5WA 4GZNC 2ADRA 2EQ1A 2RSIA 2EL4A 2EORA 2EPPA 2EOZA 2BB8A 4R2AA 2YRMA 2EN3A 4R2CA 3MHSC 2JPAA 2EPUA 2WBUA 1G2FC 1KJKA 4IS1C 1MEYC 2EM4A 1YUIA 2R1FA 2EPRA 2EM2A 2EMIA 2WBSA 2GLIA 1A1KA 2EMGA 5KL6A 2EOOA 2EMCA 2EMYA 2CT1A 2ELYA 1YSAC 2EOQA 4R2PA 1X6HA 2CSHA 2EN2A 5KL2A 2ENAA 1A1JA 2EMFA 2LO3A 2EM5A 1BB8A 2YTFA 2DLQA 1ZR9A 5KL5A 2YTQA 2EPCA 2EMKA 2EP3A 2ENHA 4F6MA 1F2IG 2JP9A 2EN1A 1UN6B 2EM8A 2LT7A 2E72A 4F6NA 2YRHA 1RMDA 1DGCA 2EPAA 3EPJA 1B69A 2EM7A 1X6FA 2PRTA 3VHTB 2D9HA 2YSPA 2EM9A 2EN7A 2WCC3 1WJPA 2YRKA 4M9VC 2MKDA 1TF3A 2EMBA 1AAYA 2EQ0A 5KL4A 2EM6A 2DRPA 2YTOA 2EOFA 2YSOA 1A1FA 2GHFA 2YTJA 3MHHC 2YTPA 4R2DA 1LLMC 2EPZA 4X9JA 2EN8A 1NCSA 2EMHA 2EOYA 1UBDC 2CTDA 2EM0A 2EQ3A 3EPKA 4R2EA 2A25A 2YTGA 2EPXA 4IJDA 2YTIA 2MKNA 1X3CA 2YU5A 2ELZA 1ZAAC 2EE8A 2EOMA 2EM3A 3EPHA 2YU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6E A;  2EOS A;  2LVH A;  2NAB A;  2EOE A;  1YUJ A;  2EMX A;  1A1L A;  2DLK A;  4R2R A;  2LCE A;  2YTN A;  2EJ4 A;  2EOH A;  2EL6 A;  3M99 B;  1A1I A;  2J7J A;  4R2S A;  2EMW A;  2ENC A;  1TN9 A;  2HGH A;  2EN4 A;  2EOJ A;  1P47 A;  5KL3 A;  2I13 A;  4F2J C;  2EMA A;  2VRD A;  2YTD A;  1G2D C;  4FK5 C;  3EPL A;  2DGC A;  1ZU1 A;  2EMZ A;  3UK3 C;  1JK1 A;  1A1G A;  4R2Q A;  4WSG A;  2YTE A;  2EOI A;  1JK2 A;  2WBT A;  1A1H A;  2M9A A;  1TF6 A;  2LV2 A;  5KL7 A;  1Z1B A;  1BBO A;  2MDG A;  2EL5 A;  2EOX A;  2DMI A;  2EML A;  2EN6 A;  2RPC A;  1X5W A;  4GZN C;  2ADR A;  2EQ1 A;  2RSI A;  2EL4 A;  2EOR A;  2EPP A;  2EOZ A;  2BB8 A;  4R2A A;  2YRM A;  2EN3 A;  4R2C A;  3MHS C;  2JPA A;  2EPU A;  2WBU A;  1G2F C;  1KJK A;  4IS1 C;  1MEY C;  2EM4 A;  1YUI A;  2R1F A;  2EPR A;  2EM2 A;  2EMI A;  2WBS A;  2GLI A;  1A1K A;  2EMG A;  5KL6 A;  2EOO A;  2EMC A;  2EMY A;  2CT1 A;  2ELY A;  1YSA C;  2EOQ A;  4R2P A;  1X6H A;  2CSH A;  2EN2 A;  5KL2 A;  2ENA A;  1A1J A;  2EMF A;  2LO3 A;  2EM5 A;  1BB8 A;  2YTF A;  2DLQ A;  1ZR9 A;  5KL5 A;  2YTQ A;  2EPC A;  2EMK A;  2EP3 A;  2ENH A;  4F6M A;  1F2I G;  2JP9 A;  2EN1 A;  1UN6 B;  2EM8 A;  2LT7 A;  2E72 A;  4F6N A;  2YRH A;  1RMD A;  1DGC A;  2EPA A;  3EPJ A;  1B69 A;  2EM7 A;  1X6F A;  2PRT A;  3VHT B;  2D9H A;  2YSP A;  2EM9 A;  2EN7 A;  2WCC 3;  1WJP A;  2YRK A;  4M9V C;  2MKD A;  1TF3 A;  2EMB A;  1AAY A;  2EQ0 A;  5KL4 A;  2EM6 A;  2DRP A;  2YTO A;  2EOF A;  2YSO A;  1A1F A;  2GHF A;  2YTJ A;  3MHH C;  2YTP A;  4R2D A;  1LLM C;  2EPZ A;  4X9J A;  2EN8 A;  1NCS A;  2EMH A;  2EOY A;  1UBD C;  2CTD A;  2EM0 A;  2EQ3 A;  3EPK A;  4R2E A;  2A25 A;  2YTG A;  2EPX A;  4IJD A;  2YTI A;  2MKN A;  1X3C A;  2YU5 A;  2ELZ A;  1ZAA C;  2EE8 A;  2EOM A;  2EM3 A;  3EPH A;  2YU8 A; 
#chains in the Genus database with same CATH topology
 1GTK A;  1X6E A;  5LMU E;  4DR2 E;  2EOE A;  1HNW E;  1YUJ A;  1IMU A;  1A1L A;  4BS9 A;  4P78 A;  4X8W A;  4LFC E;  4JI4 E;  4R2R A;  3IWC A;  4R03 A;  3L00 A;  3JAM C;  4J8Z A;  2EJ4 A;  4M2Z A;  4WSP A;  2EOH A;  2YPN A;  1N32 E;  2J7J A;  2LBS B;  3FIG A;  5AE1 A;  1TN9 A;  4DV1 E;  3DF6 A;  5KL3 A;  2YTD A;  1QNT A;  4FK5 C;  1I94 E;  2EOI A;  2V87 A;  2M9A A;  2N3H A;  2NUF A;  4LF9 E;  1Z1B A;  2MDG A;  4F9A B;  2EOX A;  2HJJ A;  1HR0 E;  2EOR A;  2EOZ A;  3TQM A;  4R2A A;  2UXD E;  3MSW A;  4NXM E;  2JPA A;  2EPU A;  3BF2 A;  4X65 E;  4BMJ A;  1T4L B;  2GLI A;  5IV8 B;  1WXR A;  2EMG A;  5KL6 A;  2EOO A;  4DR7 E;  1PJS A;  1GZ6 A;  2EMY A;  2CT1 A;  4YY3 E;  3IWD A;  4NHR A;  3KZY A;  2YWQ A;  2M1S A;  2EMF A;  2KOU A;  2R76 A;  3C6K A;  1FJG E;  2EM5 A;  4M0V A;  4DR4 E;  3HPS A;  2M7Q A;  4TUG A;  4JV5 E;  2DMY A;  3OTO E;  1F2I G;  4WFT A;  2EN1 A;  1UN6 B;  1XNQ E;  5IXM B;  4JI2 E;  4F9C B;  2UUA E;  3RMP A;  2EPA A;  3EPJ A;  1RQ0 A;  4L5N C;  3ZOQ B;  2D9H A;  2YSP A;  2YRK A;  1ZBQ A;  2ODR C;  3ADI A;  2UXC E;  4ZYG A;  2FGG A;  1N3G A;  3ECR A;  2DRP A;  4X64 E;  2V89 A;  3J81 C;  1PJQ A;  1WHN A;  4O43 A;  1EH8 A;  1UIL A;  2JYA A;  2E1M A;  1T4N A;  2HHH E;  2RS6 A;  4LFA E;  1NCS A;  1YZ9 A;  4KZS A;  2EOY A;  1WRJ A;  2EWL A;  1N36 E;  2DSY A;  1T38 A;  2EPX A;  4O5G A;  2V8Q B;  2MKN A;  4Q28 A;  2LJU A;  1ZAA C;  4F54 A;  2EM3 A;  3EPH A;  2YU8 A;  2EOS A;  2LVH A;  2NAB A;  2L6M A;  3DJW A;  2DLK A;  2LCE A;  4DR6 E;  4B3R E;  5A6J A;  4ZYD A;  5LL6 R;  4DUY E;  4N4R B;  2LMZ A;  4DV7 E;  2EMW A;  4DMI A;  2HGH A;  2UUB E;  2I13 A;  1PJT A;  1XMQ E;  2L33 A;  1ZU1 A;  1SR9 A;  4WSG A;  2YTE A;  4ZYE A;  4LF5 E;  2L2K B;  3QG5 C;  1WHQ A;  2LV2 A;  5KL7 A;  3HQ1 A;  3J7Y p;  2VQE E;  4X62 E;  1XNR E;  4DV6 E;  2EML A;  2RPC A;  1X5W A;  5F3W A;  4B3M E;  1N33 E;  2ADR A;  2RSI A;  2EL4 A;  4JI7 E;  3HPZ A;  2JXP A;  2K7I A;  4JI8 E;  3THO B;  1G2F C;  1MEY C;  2R1F A;  5A6K A;  1IBM E;  4L8N A;  1A1K A;  2V86 A;  2UXB E;  2LJH A;  4BCA A;  4Q35 B;  4B3T E;  3F6G A;  4HTG A;  2CSH A;  2JOB A;  2LO3 A;  2YTF A;  4TUI A;  1X47 A;  2RTX A;  5TSE A;  2N3G A;  3BGH A;  4O24 A;  2EP3 A;  2EMK A;  2VF1 A;  2ENH A;  4F6M A;  2EM8 A;  2E72 A;  4P7D A;  4F6N A;  1L4S A;  2KHX A;  5A6B A;  2EM7 A;  4F9B B;  4GKJ E;  5AE3 A;  1WJP A;  3C6M A;  1IBL E;  2RQL A;  5AAS A;  2MKD A;  3T1Y E;  1AAY A;  1TF3 A;  5KL4 A;  1O0W A;  2EOF A;  4RHB B;  2YTJ A;  4RH8 A;  4R2D A;  2YTP A;  1T39 A;  4NXN E;  1DI2 A;  2EPZ A;  3H09 A;  5AC4 A;  4X9J A;  2YT4 A;  4BHB A;  1YPN A;  2EQ3 A;  3BBG A;  1X48 A;  3AUZ A;  2A25 A;  4MLQ A;  4WXC A;  2EPM X;  2YTI A;  1YYO A;  1J5E E;  2YU5 A;  2EOM A;  4DV2 E;  1T4O A;  4BC7 A;  1SFE A;  2EMX A;  2YZT A;  2DIX A;  5A69 A;  2I9I A;  2RS7 A;  1STU A;  2EL6 A;  1A1I A;  5IT9 C;  4R2S A;  4DR1 E;  2ENC A;  2DB2 A;  2EOJ A;  1P47 A;  1X49 A;  2VRD A;  3ADL A;  3HXL A;  4BBY A;  4KHP E;  3IWB A;  3EPL A;  2DGC A;  2EPN A;  2IHR 1;  3AV0 A;  1JK1 A;  3KZZ A;  1RC7 A;  2WBT A;  1YYW A;  1PKP A;  1TF6 A;  2RSM A;  3VK6 A;  3C4B A;  1BBO A;  2DMI A;  3J7A G;  5IWA E;  1EH7 A;  4HEI A;  2EN6 A;  4GEQ B;  1N34 E;  2LTS A;  4GZN C;  4DV3 E;  1AH5 A;  1QU6 A;  2EPP A;  4O4K A;  4I8O A;  3LML A;  3THN A;  4LF8 E;  2LUQ A;  3J80 C;  4DV5 E;  2H36 X;  4R2C A;  2WBU A;  4LFB E;  2JVA A;  1YUI A;  2EPR A;  4WX9 A;  4DV4 E;  2WBS A;  4BHC A;  4BC9 A;  3ADG A;  2MC6 A;  4DUZ E;  2MC5 A;  2ELY A;  1YSA C;  1X6H A;  2EN2 A;  3F6H A;  2EPK X;  1GQE A;  5AC5 A;  2B3T B;  2NA2 A;  3VYY A;  2GPI A;  1YYK A;  3EQ1 A;  5KL5 A;  2YTQ A;  5A6A A;  2EPC A;  2K4V A;  2JP9 A;  2B7V A;  3K6Q A;  1HNZ E;  1PDA A;  5LMN E;  2EPO A;  1RMD A;  4AQY E;  3KWR A;  4ZYH A;  1B69 A;  2PRT A;  1X6F A;  3LLH A;  4DR5 E;  2VE7 C;  2EN7 A;  2WZO A;  4LTY A;  2EQ0 A;  1UHZ A;  2YTO A;  2YSO A;  1KYQ A;  3MHH C;  2GHF A;  2HC5 A;  2UUC E;  4KWY A;  2ZM6 E;  2JOX A;  3C4T A;  2UU9 E;  4B3S E;  4LF6 E;  3EPK A;  2YTG A;  2EZ6 A;  3BID A;  4IJD A;  2M4I A;  2ELZ A;  4JI5 E;  2EE8 A;  2BBG A;  2NUG A;  2LUP B;  1HNX E;  2N8X A;  2V83 A;  5LLQ A;  1MGT A;  4JI3 E;  2L8T A;  4LU9 A;  1EH6 A;  4JI6 E;  2YTN A;  1IQO A;  2Q8U A;  3M99 B;  1EKZ A;  1YFH A;  4JI1 E;  3JU0 A;  4DKK A;  3P1X A;  2EN4 A;  5A2Q C;  4DV0 E;  4F2J C;  2EMA A;  3T1H E;  4LF4 E;  4OX9 E;  1G2D C;  2V85 A;  2EMZ A;  3UK3 C;  1A1G A;  4R2Q A;  2JR1 A;  1JK2 A;  1A1H A;  2CPN A;  2EPL X;  2JY9 A;  4LF7 E;  2EL5 A;  4DR3 E;  2B7T A;  2EQ1 A;  5AE2 A;  4WYQ B;  2BB8 A;  4OOG C;  3ADJ A;  5BR8 E;  2YRM A;  2B9D A;  2EN3 A;  3MHS C;  1DQ3 A;  4M30 A;  5ADZ A;  1IQS A;  1KJK A;  4IS1 C;  2EM4 A;  4YHH E;  2EM2 A;  2EMI A;  4X66 E;  4K0K E;  5A6B D;  2L3C A;  2EMC A;  4JYA E;  1ZBT A;  2L2M A;  2EOQ A;  4R2P A;  5KL2 A;  3HTX A;  2ENA A;  2FTX B;  1A1J A;  1J26 A;  1BB8 A;  3VYX A;  2DLQ A;  1ZR9 A;  2FV4 B;  2VQF E;  2JWO A;  2LE2 A;  1IBK E;  2LT7 A;  2ODR D;  2YRH A;  1DGC A;  1FKA E;  2L3J A;  4WPY A;  3VHT B;  2KON A;  5CFF E;  2EM9 A;  2WCC 3;  5T6J A;  3JTZ A;  4M9V C;  2LTR A;  2G7H A;  3OML A;  2EMB A;  2EM6 A;  2E5L E;  1A1F A;  1BBG A;  2F8B A;  1LLM C;  1XMO E;  4JI0 E;  2EN8 A;  4MLV A;  2EMH A;  5DNY A;  2MDR A;  2LRS A;  4NZV A;  1UBD C;  2CTD A;  2EM0 A;  2NUE A;  1NEI A;  4R2E A;  2F4V E;  5FLX C;  4R8O A;  2L92 A;  1X3C A;  4GKK E;  2L2N A;  2V88 A;  4WXD A; 
#chains in the Genus database with same CATH homology
 1X6E A;  2EOS A;  2LVH A;  2NAB A;  2EOE A;  1YUJ A;  2EMX A;  1A1L A;  2DLK A;  4R2R A;  2LCE A;  2YTN A;  2EJ4 A;  2EOH A;  2EL6 A;  3M99 B;  1A1I A;  2J7J A;  4R2S A;  2EMW A;  2ENC A;  1TN9 A;  2HGH A;  2EN4 A;  2EOJ A;  1P47 A;  5KL3 A;  2I13 A;  4F2J C;  2EMA A;  2VRD A;  2YTD A;  1G2D C;  4FK5 C;  3EPL A;  2DGC A;  1ZU1 A;  2EMZ A;  3UK3 C;  1JK1 A;  1A1G A;  4R2Q A;  4WSG A;  2YTE A;  2EOI A;  1JK2 A;  2WBT A;  1A1H A;  2M9A A;  1TF6 A;  2LV2 A;  5KL7 A;  1Z1B A;  1BBO A;  2MDG A;  2EL5 A;  2EOX A;  2DMI A;  2EML A;  2EN6 A;  2RPC A;  1X5W A;  4GZN C;  2ADR A;  2EQ1 A;  2RSI A;  2EL4 A;  2EOR A;  2EPP A;  2EOZ A;  2BB8 A;  4R2A A;  2YRM A;  2EN3 A;  4R2C A;  3MHS C;  2JPA A;  2EPU A;  2WBU A;  1G2F C;  1KJK A;  4IS1 C;  1MEY C;  2EM4 A;  1YUI A;  2R1F A;  2EPR A;  2EM2 A;  2EMI A;  2WBS A;  2GLI A;  1A1K A;  2EMG A;  5KL6 A;  2EOO A;  2EMC A;  2EMY A;  2CT1 A;  2ELY A;  1YSA C;  2EOQ A;  4R2P A;  1X6H A;  2CSH A;  2EN2 A;  5KL2 A;  2ENA A;  1A1J A;  2EMF A;  2LO3 A;  2EM5 A;  1BB8 A;  2YTF A;  2DLQ A;  1ZR9 A;  5KL5 A;  2YTQ A;  2EPC A;  2EMK A;  2EP3 A;  2ENH A;  4F6M A;  1F2I G;  2JP9 A;  2EN1 A;  1UN6 B;  2EM8 A;  2LT7 A;  2E72 A;  4F6N A;  2YRH A;  1RMD A;  1DGC A;  2EPA A;  3EPJ A;  1B69 A;  2EM7 A;  1X6F A;  2PRT A;  3VHT B;  2D9H A;  2YSP A;  2EM9 A;  2EN7 A;  2WCC 3;  1WJP A;  2YRK A;  4M9V C;  2MKD A;  1TF3 A;  2EMB A;  1AAY A;  2EQ0 A;  5KL4 A;  2EM6 A;  2DRP A;  2YTO A;  2EOF A;  2YSO A;  1A1F A;  2GHF A;  2YTJ A;  3MHH C;  2YTP A;  4R2D A;  1LLM C;  2EPZ A;  4X9J A;  2EN8 A;  1NCS A;  2EMH A;  2EOY A;  1UBD C;  2CTD A;  2EM0 A;  2EQ3 A;  3EPK A;  4R2E A;  2A25 A;  2YTG A;  2EPX A;  4IJD A;  2YTI A;  2MKN A;  1X3C A;  2YU5 A;  2ELZ A;  1ZAA C;  2EE8 A;  2EOM A;  2EM3 A;  3EPH A;  2YU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...