2YU5A

Solution structure of the zf-c2h2 domain (669-699aa) in zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGAGENPFKCSKCDRVFTQRNYLVQHERTHARKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the zf-C2H2 domain (669-699AA) in zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Zinc finger protein 473
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu5A00
2EMIA 2R1FA 3M99B 3EPKA 2EOIA 2YSPA 2YTIA 4F6NA 2PRTA 3VHTB 2LT7A 2JP9A 4M9VC 2YRMA 2ENCA 1YUJA 2A25A 1A1JA 2LCEA 2EM0A 2EOSA 2YTNA 2GLIA 2EOXA 1DGCA 2WCC3 2EPCA 4R2CA 4X9JA 2EN3A 1A1IA 2EN8A 2YU8A 2YTOA 1Z1BA 1TN9A 2EJ4A 1X6HA 1JK2A 2EE8A 2EM6A 2EQ0A 2BB8A 2EPZA 2EM5A 2GHFA 2EL5A 4F2JC 2WBTA 5KL6A 1G2FC 2EMBA 2EMWA 1X3CA 3EPHA 2DGCA 1MEYC 4R2PA 1G2DC 2ENHA 2EM3A 2YTQA 2EN2A 5KL2A 2ELYA 2EPUA 2YTGA 1A1FA 2YRHA 1NCSA 4F6MA 2YTJA 2EOZA 1BB8A 2YRKA 2EMYA 4IS1C 4GZNC 4R2AA 1A1HA 2EMCA 2RSIA 4R2RA 1F2IG 2EN6A 1X6EA 2ELZA 2EQ1A 2EMLA 2EM7A 5KL3A 2EMXA 5KL4A 1A1LA 2EMAA 2EM8A 2E72A 2EM9A 2HGHA 2EPRA 2LO3A 2WBSA 4WSGA 1X6FA 1RMDA 2D9HA 2EN7A 1ZU1A 2DRPA 1WJPA 2EOQA 2EPPA 1TF3A 2DLQA 2YTFA 2EL6A 4R2QA 1LLMC 2EN1A 3MHSC 2EPXA 2DLKA 2YTEA 2NABA 2EOMA 2LVHA 2YSOA 2JPAA 2MKDA 4IJDA 4R2DA 2CSHA 2ADRA 4R2EA 1B69A 1A1GA 2ENAA 2MDGA 2J7JA 1ZAAC 2DMIA 3MHHC 2EMZA 2EORA 2EOOA 5KL7A 2EOEA 4R2SA 3EPJA 2M9AA 1BBOA 2EMFA 2EOJA 2EMGA 1TF6A 1YUIA 2EL4A 2MKNA 2WBUA 2CTDA 2EM4A 2EPAA 3EPLA 2EM2A 2EQ3A 2YTDA 5KL5A 1X5WA 2EMKA 3UK3C 1UBDC 1P47A 2EN4A 1ZR9A 2EOFA 2EOYA 2LV2A 2VRDA 1UN6B 1AAYA 2CT1A 1JK1A 2RPCA 2I13A 1KJKA 2YU5A 1A1KA 1YSAC 2EMHA 2EP3A 2EOHA 2YTPA 4FK5C
chains in the Genus database with same CATH superfamily
2R1FA 4DV4E 2KHXA 3M99B 2EOIA 1UHZA 4M9VC 1A1JA 4LF9E 2V89A 2N3HA 4DR4E 4JI4E 1PJTA 4X9JA 4GKKE 2K7IA 5A2QC 4O4KA 1Z1BA 2DMYA 2VF1A 3KWRA 2V8QB 3LLHA 2EM6A 2NA2A 1GZ6A 2MC6A 4F2JC 1IQOA 4K0KE 5KL6A 4LFAE 3JTZA 2RS7A 4ZYGA 5CFFE 5A6KA 2VQFE 4TUIA 2L2KB 1XMOE 4R2PA 1G2DC 1YYOA 4N4RB 3BIDA 4JI8E 2EPKX 3VYXA 2HC5A 4WYQB 4DR3E 2EN2A 2MDRA 3J7AG 4YY3E 4AQYE 4JI2E 2YTGA 1PJQA 4WPYA 5BR8E 1A1FA 4NXNE 4F6MA 2FTXB 2EZ6A 2YTJA 4P7DA 2UXDE 2YRKA 2EMYA 1J5EE 4IS1C 2L92A 2RSIA 2L6MA 2FV4B 1X6EA 2N3GA 2LBSB 2M1SA 5AC5A 5FLXC 1EH6A 2VE7C 1IBME 4WSPA 4JYAE 2E72A 2HGHA 2LO3A 4DR5E 5AE3A 4WSGA 1X6FA 4WFTA 1TF3A 1SFEA 4R2QA 2EN1A 2V88A 3J7Yp 2LUQA 4LF8E 4BC9A 5IXMB 2KOUA 2YTEA 4KWYA 3ECRA 2YSOA 4J8ZA 4BMJA 4JI1E 4IJDA 2Q8UA 4RH8A 3IWDA 1HNWE 3TQMA 3F6GA 1X49A 4M0VA 2RQLA 2I9IA 2DMIA 3HTXA 2EOOA 1BBGA 1YFHA 2EPMX 3HQ1A 3THOB 4OOGC 2M9AA 2UUAE 2EL4A 3HPSA 2LTRA 2EPAA 2EM2A 2EWLA 2EQ3A 5KL5A 2LRSA 2UUCE 4R8OA 2KONA 5A69A 4WXCA 1UBDC 2EN4A 2YPNA 1ZR9A 2L33A 3H09A 2LV2A 2UU9E 1UN6B 2CT1A 5IV8B 1KJKA 5AE1A 2EMHA 1YSAC 4ZYHA 4X8WA 4DV0E 3AUZA 1XNRE 2YTIA 1T39A 2L8TA 2CPNA 4ZYDA 4JI5E 2A25A 1FKAE 4R03A 2LCEA 3LMLA 1DGCA 1ZBQA 2WCC3 2EPCA 4R2CA 2EN3A 2JR1A 1A1IA 3C6KA 2EN8A 2YU8A 2YTOA 3JU0A 4JV5E 4I8OA 4MLVA 4BHBA 2HHHE 1WXRA 2GHFA 2WBTA 1PKPA 2EMBA 3C4TA 5DNYA 2L2NA 1X3CA 1IQSA 2G7HA 4WXDA 4JI3E 2M7QA 5IWAE 4DUZE 4LTYA 2EM3A 2YTQA 2ELYA 2EPUA 3HXLA 3IWCA 5TSEA 2EOZA 4L8NA 1BB8A 4DV2E 5LL6R 4GZNC 2EMCA 2L3JA 2JOXA 5KL3A 4DV7E 2ZM6E 4DV3E 5KL4A 2B7TA 2JWOA 1QNTA 2D9HA 1RMDA 2EN7A 1XMQE 5A6JA 4NZVA 1WRJA 2EPPA 3T1YE 2E5LE 4B3SE 3MHSC 5T6JA 4F9CB 1YPNA 2NABA 4R2DA 2HJJA 1XNQE 4BCAA 2RTXA 2JY9A 2EPNA 2MDGA 2LTSA 3MHHC 2EORA 4RHBB 4M30A 5LLQA 4R2SA 2LMZA 1O0WA 2EOJA 1YUIA 4LFBE 3ADLA 2EM4A 2ODRC 3EPLA 2LJUA 3VK6A 3QG5C 2YTDA 4JI7E 1I94E 3L00A 3ZOQB 5AASA 2DSYA 3UK3C 5IT9C 2EOYA 5LMNE 2ODRD 1X47A 4DUYE 1DI2A 1AAYA 3HPZA 1JK1A 2RPCA 4LF7E 1J26A 1HR0E 2JOBA 2EMIA 2L2MA 4O43A 3VHTB 2JP9A 2YRMA 1YUJA 3BGHA 2GLIA 3P1XA 4BC7A 3JAMC 3MSWA 2BBGA 2EPOA 3AV0A 4DR1E 4X66E 4BHCA 2LE2A 1X6HA 2NUEA 2JXPA 2BB8A 2V83A 1N32E 2RS6A 2V87A 2DIXA 2EMWA 2H36X 5ADZA 4JI6E 1YYWA 4YHHE 2N8XA 2UXBE 4WX9A 4HTGA 5KL2A 1N33E 1DQ3A 2FGGA 1T4LB 4JI0E 1NCSA 1UILA 2DB2A 4ZYEA 4DV6E 4X65E 4KZSA 4DR6E 3ADGA 4DMIA 3ADIA 2L3CA 2JVAA 2R76A 2YWQA 2F8BA 4R2AA 1WHNA 4R2RA 1F2IG 3ADJA 2EN6A 2EMLA 2EM7A 2F4VE 2RSMA 1N36E 1N3GA 3BBGA 1QU6A 4TUGA 3F6HA 1A1LA 2EM8A 4BS9A 1PDAA 2DRPA 1WJPA 2EOQA 1FJGE 2YTFA 2EL6A 4NHRA 4KHPE 4LF5E 4DR2E 4MLQA 2EPXA 2DLKA 2M4IA 2B9DA 2LVHA 3THNA 2JPAA 4M2ZA 4LF6E 2MC5A 2ADRA 1B69A 2J7JA 1ZAAC 2EMZA 3J80C 4DV5E 3OMLA 5KL7A 4LFCE 2EOEA 1BBOA 2EMFA 2EMGA 1TF6A 1MGTA 2WBUA 2MKNA 1T4NA 4GEQB 4Q35B 2K4VA 1X5WA 2EMKA 2GPIA 3VYYA 1P47A 5A6AA 1PJSA 2YZTA 3J81C 2I13A 2YU5A 1GQEA 2VQEE 4O24A 1A1KA 2EP3A 2EOHA 3BF2A 2YTPA 1N34E 3EPKA 2YSPA 1X48A 3T1HE 2UXCE 4F54A 2YT4A 2PRTA 4F6NA 2LT7A 5LMUE 2ENCA 2V86A 2LJHA 2EM0A 2EOSA 2YTNA 2B7VA 2EOXA 1NEIA 3OTOE 1HNZE 1STUA 1TN9A 1ZBTA 4F9AB 1SR9A 2EJ4A 4X62E 4P78A 4B3TE 1JK2A 2EE8A 5AE2A 2EPLX 2EQ0A 4LF4E 4B3ME 2EPZA 2EM5A 2EL5A 4DR7E 1G2FC 2V85A 4Q28A 2NUGA 3EPHA 3EQ1A 1MEYC 2DGCA 4X64E 2ENHA 2E1MA 1YYKA 1HNXE 4LU9A 1EKZA 3KZZA 5A6BA 1IBLE 1KYQA 1T4OA 1YZ9A 2YRHA 3IWBA 4O5GA 1WHQA 1IBKE 4DV1E 1EH8A 5F3WA 1A1HA 4NXME 2ELZA 2EQ1A 2EMXA 4F9BB 3DF6A 2EMAA 2EM9A 2EPRA 2IHR1 2WBSA 3KZYA 1ZU1A 1GTKA 4HEIA 2DLQA 1LLMC 5AC4A 1T38A 2LUPB 1RQ0A 2UUBE 4L5NC 4GKJE 2EOMA 4BBYA 2MKDA 1L4SA 3RMPA 1RC7A 2CSHA 4R2EA 1A1GA 2ENAA 4OX9E 1AH5A 5A6BD 3EPJA 4DKKA 2WZOA 2CTDA 3FIGA 3C4BA 1IMUA 3C6MA 2NUFA 2EOFA 3K6QA 2VRDA 2JYAA 1EH7A 4B3RE 3DJWA 2B3TB 4FK5C
chains in the Genus database with same CATH topology
2EMIA 2R1FA 3M99B 3EPKA 2EOIA 2YSPA 2YTIA 4F6NA 2PRTA 3VHTB 2LT7A 2JP9A 4M9VC 2YRMA 2ENCA 1YUJA 2A25A 1A1JA 2LCEA 2EM0A 2EOSA 2YTNA 2GLIA 2EOXA 1DGCA 2WCC3 2EPCA 4R2CA 4X9JA 2EN3A 1A1IA 2EN8A 2YU8A 2YTOA 1Z1BA 1TN9A 2EJ4A 1X6HA 1JK2A 2EE8A 2EM6A 2EQ0A 2BB8A 2EPZA 2EM5A 2GHFA 2EL5A 4F2JC 2WBTA 5KL6A 1G2FC 2EMBA 2EMWA 1X3CA 3EPHA 2DGCA 1MEYC 4R2PA 1G2DC 2ENHA 2EM3A 2YTQA 2EN2A 5KL2A 2ELYA 2EPUA 2YTGA 1A1FA 2YRHA 1NCSA 4F6MA 2YTJA 2EOZA 1BB8A 2YRKA 2EMYA 4IS1C 4GZNC 4R2AA 1A1HA 2EMCA 2RSIA 4R2RA 1F2IG 2EN6A 1X6EA 2ELZA 2EQ1A 2EMLA 2EM7A 5KL3A 2EMXA 5KL4A 1A1LA 2EMAA 2EM8A 2E72A 2EM9A 2HGHA 2EPRA 2LO3A 2WBSA 4WSGA 1X6FA 1RMDA 2D9HA 2EN7A 1ZU1A 2DRPA 1WJPA 2EOQA 2EPPA 1TF3A 2DLQA 2YTFA 2EL6A 4R2QA 1LLMC 2EN1A 3MHSC 2EPXA 2DLKA 2YTEA 2NABA 2EOMA 2LVHA 2YSOA 2JPAA 2MKDA 4IJDA 4R2DA 2CSHA 2ADRA 4R2EA 1B69A 1A1GA 2ENAA 2MDGA 2J7JA 1ZAAC 2DMIA 3MHHC 2EMZA 2EORA 2EOOA 5KL7A 2EOEA 4R2SA 3EPJA 2M9AA 1BBOA 2EMFA 2EOJA 2EMGA 1TF6A 1YUIA 2EL4A 2MKNA 2WBUA 2CTDA 2EM4A 2EPAA 3EPLA 2EM2A 2EQ3A 2YTDA 5KL5A 1X5WA 2EMKA 3UK3C 1UBDC 1P47A 2EN4A 1ZR9A 2EOFA 2EOYA 2LV2A 2VRDA 1UN6B 1AAYA 2CT1A 1JK1A 2RPCA 2I13A 1KJKA 2YU5A 1A1KA 1YSAC 2EMHA 2EP3A 2EOHA 2YTPA 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMI A;  2R1F A;  3M99 B;  3EPK A;  2EOI A;  2YSP A;  2YTI A;  4F6N A;  2PRT A;  3VHT B;  2LT7 A;  2JP9 A;  4M9V C;  2YRM A;  2ENC A;  1YUJ A;  2A25 A;  1A1J A;  2LCE A;  2EM0 A;  2EOS A;  2YTN A;  2GLI A;  2EOX A;  1DGC A;  2WCC 3;  2EPC A;  4R2C A;  4X9J A;  2EN3 A;  1A1I A;  2EN8 A;  2YU8 A;  2YTO A;  1Z1B A;  1TN9 A;  2EJ4 A;  1X6H A;  1JK2 A;  2EE8 A;  2EM6 A;  2EQ0 A;  2BB8 A;  2EPZ A;  2EM5 A;  2GHF A;  2EL5 A;  4F2J C;  2WBT A;  5KL6 A;  1G2F C;  2EMB A;  2EMW A;  1X3C A;  3EPH A;  2DGC A;  1MEY C;  4R2P A;  1G2D C;  2ENH A;  2EM3 A;  2YTQ A;  2EN2 A;  5KL2 A;  2ELY A;  2EPU A;  2YTG A;  1A1F A;  2YRH A;  1NCS A;  4F6M A;  2YTJ A;  2EOZ A;  1BB8 A;  2YRK A;  2EMY A;  4IS1 C;  4GZN C;  4R2A A;  1A1H A;  2EMC A;  2RSI A;  4R2R A;  1F2I G;  2EN6 A;  1X6E A;  2ELZ A;  2EQ1 A;  2EML A;  2EM7 A;  5KL3 A;  2EMX A;  5KL4 A;  1A1L A;  2EMA A;  2EM8 A;  2E72 A;  2EM9 A;  2HGH A;  2EPR A;  2LO3 A;  2WBS A;  4WSG A;  1X6F A;  1RMD A;  2D9H A;  2EN7 A;  1ZU1 A;  2DRP A;  1WJP A;  2EOQ A;  2EPP A;  1TF3 A;  2DLQ A;  2YTF A;  2EL6 A;  4R2Q A;  1LLM C;  2EN1 A;  3MHS C;  2EPX A;  2DLK A;  2YTE A;  2NAB A;  2EOM A;  2LVH A;  2YSO A;  2JPA A;  2MKD A;  4IJD A;  4R2D A;  2CSH A;  2ADR A;  4R2E A;  1B69 A;  1A1G A;  2ENA A;  2MDG A;  2J7J A;  1ZAA C;  2DMI A;  3MHH C;  2EMZ A;  2EOR A;  2EOO A;  5KL7 A;  2EOE A;  4R2S A;  3EPJ A;  2M9A A;  1BBO A;  2EMF A;  2EOJ A;  2EMG A;  1TF6 A;  1YUI A;  2EL4 A;  2MKN A;  2WBU A;  2CTD A;  2EM4 A;  2EPA A;  3EPL A;  2EM2 A;  2EQ3 A;  2YTD A;  5KL5 A;  1X5W A;  2EMK A;  3UK3 C;  1UBD C;  1P47 A;  2EN4 A;  1ZR9 A;  2EOF A;  2EOY A;  2LV2 A;  2VRD A;  1UN6 B;  1AAY A;  2CT1 A;  1JK1 A;  2RPC A;  2I13 A;  1KJK A;  2YU5 A;  1A1K A;  1YSA C;  2EMH A;  2EP3 A;  2EOH A;  2YTP A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 2R1F A;  4DV4 E;  2KHX A;  3M99 B;  2EOI A;  1UHZ A;  4M9V C;  1A1J A;  4LF9 E;  2V89 A;  2N3H A;  4DR4 E;  4JI4 E;  1PJT A;  4X9J A;  4GKK E;  2K7I A;  5A2Q C;  4O4K A;  1Z1B A;  2DMY A;  2VF1 A;  3KWR A;  2V8Q B;  3LLH A;  2EM6 A;  2NA2 A;  1GZ6 A;  2MC6 A;  4F2J C;  1IQO A;  4K0K E;  5KL6 A;  4LFA E;  3JTZ A;  2RS7 A;  4ZYG A;  5CFF E;  5A6K A;  2VQF E;  4TUI A;  2L2K B;  1XMO E;  4R2P A;  1G2D C;  1YYO A;  4N4R B;  3BID A;  4JI8 E;  2EPK X;  3VYX A;  2HC5 A;  4WYQ B;  4DR3 E;  2EN2 A;  2MDR A;  3J7A G;  4YY3 E;  4AQY E;  4JI2 E;  2YTG A;  1PJQ A;  4WPY A;  5BR8 E;  1A1F A;  4NXN E;  4F6M A;  2FTX B;  2EZ6 A;  2YTJ A;  4P7D A;  2UXD E;  2YRK A;  2EMY A;  1J5E E;  4IS1 C;  2L92 A;  2RSI A;  2L6M A;  2FV4 B;  1X6E A;  2N3G A;  2LBS B;  2M1S A;  5AC5 A;  5FLX C;  1EH6 A;  2VE7 C;  1IBM E;  4WSP A;  4JYA E;  2E72 A;  2HGH A;  2LO3 A;  4DR5 E;  5AE3 A;  4WSG A;  1X6F A;  4WFT A;  1TF3 A;  1SFE A;  4R2Q A;  2EN1 A;  2V88 A;  3J7Y p;  2LUQ A;  4LF8 E;  4BC9 A;  5IXM B;  2KOU A;  2YTE A;  4KWY A;  3ECR A;  2YSO A;  4J8Z A;  4BMJ A;  4JI1 E;  4IJD A;  2Q8U A;  4RH8 A;  3IWD A;  1HNW E;  3TQM A;  3F6G A;  1X49 A;  4M0V A;  2RQL A;  2I9I A;  2DMI A;  3HTX A;  2EOO A;  1BBG A;  1YFH A;  2EPM X;  3HQ1 A;  3THO B;  4OOG C;  2M9A A;  2UUA E;  2EL4 A;  3HPS A;  2LTR A;  2EPA A;  2EM2 A;  2EWL A;  2EQ3 A;  5KL5 A;  2LRS A;  2UUC E;  4R8O A;  2KON A;  5A69 A;  4WXC A;  1UBD C;  2EN4 A;  2YPN A;  1ZR9 A;  2L33 A;  3H09 A;  2LV2 A;  2UU9 E;  1UN6 B;  2CT1 A;  5IV8 B;  1KJK A;  5AE1 A;  2EMH A;  1YSA C;  4ZYH A;  4X8W A;  4DV0 E;  3AUZ A;  1XNR E;  2YTI A;  1T39 A;  2L8T A;  2CPN A;  4ZYD A;  4JI5 E;  2A25 A;  1FKA E;  4R03 A;  2LCE A;  3LML A;  1DGC A;  1ZBQ A;  2WCC 3;  2EPC A;  4R2C A;  2EN3 A;  2JR1 A;  1A1I A;  3C6K A;  2EN8 A;  2YU8 A;  2YTO A;  3JU0 A;  4JV5 E;  4I8O A;  4MLV A;  4BHB A;  2HHH E;  1WXR A;  2GHF A;  2WBT A;  1PKP A;  2EMB A;  3C4T A;  5DNY A;  2L2N A;  1X3C A;  1IQS A;  2G7H A;  4WXD A;  4JI3 E;  2M7Q A;  5IWA E;  4DUZ E;  4LTY A;  2EM3 A;  2YTQ A;  2ELY A;  2EPU A;  3HXL A;  3IWC A;  5TSE A;  2EOZ A;  4L8N A;  1BB8 A;  4DV2 E;  5LL6 R;  4GZN C;  2EMC A;  2L3J A;  2JOX A;  5KL3 A;  4DV7 E;  2ZM6 E;  4DV3 E;  5KL4 A;  2B7T A;  2JWO A;  1QNT A;  2D9H A;  1RMD A;  2EN7 A;  1XMQ E;  5A6J A;  4NZV A;  1WRJ A;  2EPP A;  3T1Y E;  2E5L E;  4B3S E;  3MHS C;  5T6J A;  4F9C B;  1YPN A;  2NAB A;  4R2D A;  2HJJ A;  1XNQ E;  4BCA A;  2RTX A;  2JY9 A;  2EPN A;  2MDG A;  2LTS A;  3MHH C;  2EOR A;  4RHB B;  4M30 A;  5LLQ A;  4R2S A;  2LMZ A;  1O0W A;  2EOJ A;  1YUI A;  4LFB E;  3ADL A;  2EM4 A;  2ODR C;  3EPL A;  2LJU A;  3VK6 A;  3QG5 C;  2YTD A;  4JI7 E;  1I94 E;  3L00 A;  3ZOQ B;  5AAS A;  2DSY A;  3UK3 C;  5IT9 C;  2EOY A;  5LMN E;  2ODR D;  1X47 A;  4DUY E;  1DI2 A;  1AAY A;  3HPZ A;  1JK1 A;  2RPC A;  4LF7 E;  1J26 A;  1HR0 E;  2JOB A;  2EMI A;  2L2M A;  4O43 A;  3VHT B;  2JP9 A;  2YRM A;  1YUJ A;  3BGH A;  2GLI A;  3P1X A;  4BC7 A;  3JAM C;  3MSW A;  2BBG A;  2EPO A;  3AV0 A;  4DR1 E;  4X66 E;  4BHC A;  2LE2 A;  1X6H A;  2NUE A;  2JXP A;  2BB8 A;  2V83 A;  1N32 E;  2RS6 A;  2V87 A;  2DIX A;  2EMW A;  2H36 X;  5ADZ A;  4JI6 E;  1YYW A;  4YHH E;  2N8X A;  2UXB E;  4WX9 A;  4HTG A;  5KL2 A;  1N33 E;  1DQ3 A;  2FGG A;  1T4L B;  4JI0 E;  1NCS A;  1UIL A;  2DB2 A;  4ZYE A;  4DV6 E;  4X65 E;  4KZS A;  4DR6 E;  3ADG A;  4DMI A;  3ADI A;  2L3C A;  2JVA A;  2R76 A;  2YWQ A;  2F8B A;  4R2A A;  1WHN A;  4R2R A;  1F2I G;  3ADJ A;  2EN6 A;  2EML A;  2EM7 A;  2F4V E;  2RSM A;  1N36 E;  1N3G A;  3BBG A;  1QU6 A;  4TUG A;  3F6H A;  1A1L A;  2EM8 A;  4BS9 A;  1PDA A;  2DRP A;  1WJP A;  2EOQ A;  1FJG E;  2YTF A;  2EL6 A;  4NHR A;  4KHP E;  4LF5 E;  4DR2 E;  4MLQ A;  2EPX A;  2DLK A;  2M4I A;  2B9D A;  2LVH A;  3THN A;  2JPA A;  4M2Z A;  4LF6 E;  2MC5 A;  2ADR A;  1B69 A;  2J7J A;  1ZAA C;  2EMZ A;  3J80 C;  4DV5 E;  3OML A;  5KL7 A;  4LFC E;  2EOE A;  1BBO A;  2EMF A;  2EMG A;  1TF6 A;  1MGT A;  2WBU A;  2MKN A;  1T4N A;  4GEQ B;  4Q35 B;  2K4V A;  1X5W A;  2EMK A;  2GPI A;  3VYY A;  1P47 A;  5A6A A;  1PJS A;  2YZT A;  3J81 C;  2I13 A;  2YU5 A;  1GQE A;  2VQE E;  4O24 A;  1A1K A;  2EP3 A;  2EOH A;  3BF2 A;  2YTP A;  1N34 E;  3EPK A;  2YSP A;  1X48 A;  3T1H E;  2UXC E;  4F54 A;  2YT4 A;  2PRT A;  4F6N A;  2LT7 A;  5LMU E;  2ENC A;  2V86 A;  2LJH A;  2EM0 A;  2EOS A;  2YTN A;  2B7V A;  2EOX A;  1NEI A;  3OTO E;  1HNZ E;  1STU A;  1TN9 A;  1ZBT A;  4F9A B;  1SR9 A;  2EJ4 A;  4X62 E;  4P78 A;  4B3T E;  1JK2 A;  2EE8 A;  5AE2 A;  2EPL X;  2EQ0 A;  4LF4 E;  4B3M E;  2EPZ A;  2EM5 A;  2EL5 A;  4DR7 E;  1G2F C;  2V85 A;  4Q28 A;  2NUG A;  3EPH A;  3EQ1 A;  1MEY C;  2DGC A;  4X64 E;  2ENH A;  2E1M A;  1YYK A;  1HNX E;  4LU9 A;  1EKZ A;  3KZZ A;  5A6B A;  1IBL E;  1KYQ A;  1T4O A;  1YZ9 A;  2YRH A;  3IWB A;  4O5G A;  1WHQ A;  1IBK E;  4DV1 E;  1EH8 A;  5F3W A;  1A1H A;  4NXM E;  2ELZ A;  2EQ1 A;  2EMX A;  4F9B B;  3DF6 A;  2EMA A;  2EM9 A;  2EPR A;  2IHR 1;  2WBS A;  3KZY A;  1ZU1 A;  1GTK A;  4HEI A;  2DLQ A;  1LLM C;  5AC4 A;  1T38 A;  2LUP B;  1RQ0 A;  2UUB E;  4L5N C;  4GKJ E;  2EOM A;  4BBY A;  2MKD A;  1L4S A;  3RMP A;  1RC7 A;  2CSH A;  4R2E A;  1A1G A;  2ENA A;  4OX9 E;  1AH5 A;  5A6B D;  3EPJ A;  4DKK A;  2WZO A;  2CTD A;  3FIG A;  3C4B A;  1IMU A;  3C6M A;  2NUF A;  2EOF A;  3K6Q A;  2VRD A;  2JYA A;  1EH7 A;  4B3R E;  3DJW A;  2B3T B;  4FK5 C; 
#chains in the Genus database with same CATH homology
 2EMI A;  2R1F A;  3M99 B;  3EPK A;  2EOI A;  2YSP A;  2YTI A;  4F6N A;  2PRT A;  3VHT B;  2LT7 A;  2JP9 A;  4M9V C;  2YRM A;  2ENC A;  1YUJ A;  2A25 A;  1A1J A;  2LCE A;  2EM0 A;  2EOS A;  2YTN A;  2GLI A;  2EOX A;  1DGC A;  2WCC 3;  2EPC A;  4R2C A;  4X9J A;  2EN3 A;  1A1I A;  2EN8 A;  2YU8 A;  2YTO A;  1Z1B A;  1TN9 A;  2EJ4 A;  1X6H A;  1JK2 A;  2EE8 A;  2EM6 A;  2EQ0 A;  2BB8 A;  2EPZ A;  2EM5 A;  2GHF A;  2EL5 A;  4F2J C;  2WBT A;  5KL6 A;  1G2F C;  2EMB A;  2EMW A;  1X3C A;  3EPH A;  2DGC A;  1MEY C;  4R2P A;  1G2D C;  2ENH A;  2EM3 A;  2YTQ A;  2EN2 A;  5KL2 A;  2ELY A;  2EPU A;  2YTG A;  1A1F A;  2YRH A;  1NCS A;  4F6M A;  2YTJ A;  2EOZ A;  1BB8 A;  2YRK A;  2EMY A;  4IS1 C;  4GZN C;  4R2A A;  1A1H A;  2EMC A;  2RSI A;  4R2R A;  1F2I G;  2EN6 A;  1X6E A;  2ELZ A;  2EQ1 A;  2EML A;  2EM7 A;  5KL3 A;  2EMX A;  5KL4 A;  1A1L A;  2EMA A;  2EM8 A;  2E72 A;  2EM9 A;  2HGH A;  2EPR A;  2LO3 A;  2WBS A;  4WSG A;  1X6F A;  1RMD A;  2D9H A;  2EN7 A;  1ZU1 A;  2DRP A;  1WJP A;  2EOQ A;  2EPP A;  1TF3 A;  2DLQ A;  2YTF A;  2EL6 A;  4R2Q A;  1LLM C;  2EN1 A;  3MHS C;  2EPX A;  2DLK A;  2YTE A;  2NAB A;  2EOM A;  2LVH A;  2YSO A;  2JPA A;  2MKD A;  4IJD A;  4R2D A;  2CSH A;  2ADR A;  4R2E A;  1B69 A;  1A1G A;  2ENA A;  2MDG A;  2J7J A;  1ZAA C;  2DMI A;  3MHH C;  2EMZ A;  2EOR A;  2EOO A;  5KL7 A;  2EOE A;  4R2S A;  3EPJ A;  2M9A A;  1BBO A;  2EMF A;  2EOJ A;  2EMG A;  1TF6 A;  1YUI A;  2EL4 A;  2MKN A;  2WBU A;  2CTD A;  2EM4 A;  2EPA A;  3EPL A;  2EM2 A;  2EQ3 A;  2YTD A;  5KL5 A;  1X5W A;  2EMK A;  3UK3 C;  1UBD C;  1P47 A;  2EN4 A;  1ZR9 A;  2EOF A;  2EOY A;  2LV2 A;  2VRD A;  1UN6 B;  1AAY A;  2CT1 A;  1JK1 A;  2RPC A;  2I13 A;  1KJK A;  2YU5 A;  1A1K A;  1YSA C;  2EMH A;  2EP3 A;  2EOH A;  2YTP A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...