2RQLA

Solution structure of the e. coli ribosome hibernation promoting factor hpf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable sigma-54 modulation protein
publication title Solution structure of the E. coli ribosome hibernation promoting factor HPF: Implications for the relationship between structure and function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2rqlA00
1IMUA 4HEIA 1L4SA 3TQMA 1N3GA 2YWQA 2RQLA
chains in the Genus database with same CATH superfamily
4RHBB 2H36X 1TN9A 4LF4E 1HR0E 2EOFA 2EMXA 1ZU1A 3LLHA 3BGHA 2JXPA 3J81C 2EOOA 1YYWA 1YZ9A 2DSYA 3ADIA 4NXNE 4I8OA 4M2ZA 4DV0E 2KOUA 4HTGA 5T6JA 3J7AG 1YUJA 4KZSA 2EOHA 2LV2A 4R2RA 2L33A 2EL5A 4WX9A 1A1GA 2WBUA 4X9JA 4F9BB 4F9AB 4DR4E 2DRPA 4P78A 1FKAE 2EMHA 1AH5A 1STUA 4X65E 2LUPB 2DGCA 2EMCA 2VE7C 2M7QA 4DV2E 3J80C 4WXDA 4DR1E 2L2KB 1P47A 4Q35B 5A6BA 2EMKA 2JYAA 4R2QA 2V83A 2L2NA 2EM6A 2EL6A 4LFBE 4O43A 3THOB 4R2PA 3M99B 2M9AA 1QNTA 2EWLA 3HTXA 4LF5E 2EMIA 2I13A 1G2DC 4F54A 2ENHA 1BBOA 2EOXA 2YSOA 2HGHA 1ZR9A 4O24A 2MKNA 2EOYA 2EM0A 1YFHA 2EMWA 4ZYHA 4B3TE 2YSPA 2LRSA 4JI7E 2V86A 2EMBA 4DKKA 1PDAA 2JPAA 2ELZA 1X6EA 1T4NA 2B9DA 3C4TA 4M30A 2JR1A 4F6NA 1ZBQA 4WPYA 3OTOE 2GLIA 1X49A 2VQEE 2RS6A 2EPUA 1GQEA 2LBSB 3OMLA 4DV5E 2WCC3 1X47A 2V8QB 4LU9A 2EN1A 2EPXA 4JI6E 1NCSA 4WYQB 1YPNA 3BF2A 2M1SA 2LVHA 2HHHE 3HQ1A 1DQ3A 4MLQA 2VRDA 2JWOA 2V87A 2EORA 2G7HA 1IBME 3IWCA 5IXMB 1TF6A 5IT9C 1ZBTA 3JU0A 4KHPE 4R2DA 3EPLA 2JVAA 1HNXE 3HXLA 1GZ6A 1F2IG 4BMJA 1PJQA 3ADLA 3HPSA 3EPHA 2FGGA 1XNRE 2LE2A 2I9IA 1SFEA 1RMDA 2GPIA 2EMFA 2EN8A 3JTZA 4RH8A 2UUBE 2E1MA 5A6AA 2GHFA 4OX9E 4WXCA 4DV3E 4F2JC 1QU6A 1T38A 2CSHA 2YTIA 2DLKA 3EQ1A 1RC7A 5AE2A 1X48A 1B69A 3BIDA 1N32E 2R76A 2KHXA 5KL5A 1WHQA 1MEYC 5AC5A 3RMPA 2RSIA 3L00A 2YTFA 2VF1A 5A6JA 1AAYA 2RTXA 5LMUE 1BB8A 4DR2E 3EPKA 1T4OA 2D9HA 4B3ME 2ODRD 4R8OA 2LO3A 2DIXA 2EM7A 4LF9E 5LMNE 2YRHA 2J7JA 2EMYA 2NUEA 4F6MA 2YPNA 3MSWA 1JK1A 3MHSC 3THNA 4JI0E 2UU9E 4B3RE 3BBGA 1RQ0A 3AUZA 2EM9A 1YSAC 2UUCE 3QG5C 2EOMA 1YYKA 1YUIA 4O5GA 2M4IA 2F4VE 2MC6A 1TF3A 5AE3A 2EP3A 5AE1A 4TUIA 5FLXC 2EOJA 3KZZA 2YTJA 2EMZA 4JV5E 1UILA 4OOGC 2BBGA 2EPZA 3VHTB 5KL4A 2DB2A 4DV1E 2E72A 1A1IA 2V89A 1Z1BA 1A1KA 2K7IA 4NZVA 1UBDC 1X6FA 1G2FC 4JI3E 4R2EA 4LF7E 2EN2A 3C6MA 2V88A 2LTRA 2ODRC 1HNZE 3VYXA 4P7DA 3IWDA 4BBYA 2EM5A 2EL4A 5LL6R 2EM8A 5IWAE 1WRJA 4DV4E 1HNWE 3F6HA 2FTXB 4JI1E 2EPNA 4B3SE 2L3JA 4DR3E 1IBKE 4DUYE 4MLVA 2YRKA 1J26A 4YHHE 2WZOA 2RPCA 2YTDA 2EMGA 4GKJE 1N36E 2YZTA 4DR5E 3ADGA 2EOZA 4L5NC 2ZM6E 2MC5A 2L6MA 4JI8E 3HPZA 3VK6A 1O0WA 2EOIA 3JAMC 4KWYA 1XMOE 1WXRA 2EM3A 2EPRA 2HJJA 3C4BA 5TSEA 2EQ3A 1IMUA 3AV0A 4ZYEA 2MDRA 1KJKA 4IJDA 4TUGA 2R1FA 5KL6A 2EPAA 2B3TB 2FV4B 1EH8A 4R2AA 2EMAA 1DI2A 1J5EE 4X62E 2YTNA 4N4RB 1N3GA 2CTDA 4BC9A 1UHZA 1DGCA 2EPPA 1T4LB 3ADJA 4X66E 3H09A 2CPNA 1N34E 2DMYA 4Q28A 2YRMA 2EN4A 5A6KA 2YTEA 4LFAE 1IQOA 2EQ1A 1ZAAC 1X5WA 2DMIA 1EH6A 2V85A 1WHNA 1MGTA 1X3CA 1PJTA 4BHCA 4IS1C 2L8TA 3C6KA 2MKDA 2ELYA 2HC5A 2IHR1 2KONA 2EOQA 2LJHA 4BC7A 4DR6E 2NABA 2EM2A 1N33E 1EH7A 4LFCE 3DF6A 4GKKE 5CFFE 3IWBA 2WBSA 2EOEA 2LUQA 1JK2A 2ENAA 4NHRA 2UXDE 5A2QC 5KL2A 4JI2E 3KZYA 4X8WA 3ECRA 2NUFA 4X64E 2RS7A 1YYOA 2LJUA 2EMLA 2YTOA 2YU8A 2ADRA 2N3GA 4BCAA 1LLMC 2L2MA 5IV8B 2VQFE 1L4SA 4ZYGA 4LF8E 5BR8E 4DMIA 3T1HE 4M9VC 1I94E 1BBGA 1XMQE 2YTQA 2RQLA 2L3CA 2JOXA 5ADZA 5A6BD 2EPCA 3LMLA 1A1JA 2JOBA 1IBLE 1XNQE 3TQMA 2F8BA 2EQ0A 4BHBA 2EE8A 2EPOA 4HEIA 3T1YE 2YTPA 2B7TA 3K6QA 1X6HA 2DLQA 4ZYDA 1PJSA 4GEQB 2EJ4A 2LTSA 2K4VA 2JY9A 2UUAE 2ENCA 1A1LA 4WFTA 3P1XA 5AC4A 2LMZA 3FIGA 4R03A 2EM4A 4NXME 1KYQA 4R2CA 3DJWA 2WBTA 4K0KE 2PRTA 2UXCE 2EPLX 4LF6E 4JYAE 2N3HA 1A1FA 3KWRA 5DNYA 4DV7E 1FJGE 4R2SA 1GTKA 2EOSA 2Q8UA 2EPKX 4F9CB 5A69A 4GZNC 1IQSA 2E5LE 4YY3E 5KL7A 1PKPA 4FK5C 4WSGA 2EZ6A 2EN6A 4WSPA 2EN7A 4JI5E 2A25A 2JP9A 4DUZE 4BS9A 1UN6B 5LLQA 3MHHC 4M0VA 1A1HA 2L92A 4DV6E 1T39A 2NA2A 2EPMX 2BB8A 1EKZA 1WJPA 2YTGA 4L8NA 2LT7A 1NEIA 4LTYA 2EN3A 5KL3A 5F3WA 3J7Yp 4AQYE 5AASA 4JI4E 2N8XA 2YWQA 3EPJA 4DR7E 2RSMA 3UK3C 4J8ZA 3ZOQB 2CT1A 2NUGA 2LCEA 2B7VA 2MDGA 2YT4A 2YU5A 1SR9A 3VYYA 3F6GA 2UXBE 4O4KA
chains in the Genus database with same CATH topology
1IMUA 4HEIA 1L4SA 3TQMA 1N3GA 2YWQA 2RQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMU A;  4HEI A;  1L4S A;  3TQM A;  1N3G A;  2YWQ A;  2RQL A; 
#chains in the Genus database with same CATH topology
 4RHB B;  2H36 X;  1TN9 A;  4LF4 E;  1HR0 E;  2EOF A;  2EMX A;  1ZU1 A;  3LLH A;  3BGH A;  2JXP A;  3J81 C;  2EOO A;  1YYW A;  1YZ9 A;  2DSY A;  3ADI A;  4NXN E;  4I8O A;  4M2Z A;  4DV0 E;  2KOU A;  4HTG A;  5T6J A;  3J7A G;  1YUJ A;  4KZS A;  2EOH A;  2LV2 A;  4R2R A;  2L33 A;  2EL5 A;  4WX9 A;  1A1G A;  2WBU A;  4X9J A;  4F9B B;  4F9A B;  4DR4 E;  2DRP A;  4P78 A;  1FKA E;  2EMH A;  1AH5 A;  1STU A;  4X65 E;  2LUP B;  2DGC A;  2EMC A;  2VE7 C;  2M7Q A;  4DV2 E;  3J80 C;  4WXD A;  4DR1 E;  2L2K B;  1P47 A;  4Q35 B;  5A6B A;  2EMK A;  2JYA A;  4R2Q A;  2V83 A;  2L2N A;  2EM6 A;  2EL6 A;  4LFB E;  4O43 A;  3THO B;  4R2P A;  3M99 B;  2M9A A;  1QNT A;  2EWL A;  3HTX A;  4LF5 E;  2EMI A;  2I13 A;  1G2D C;  4F54 A;  2ENH A;  1BBO A;  2EOX A;  2YSO A;  2HGH A;  1ZR9 A;  4O24 A;  2MKN A;  2EOY A;  2EM0 A;  1YFH A;  2EMW A;  4ZYH A;  4B3T E;  2YSP A;  2LRS A;  4JI7 E;  2V86 A;  2EMB A;  4DKK A;  1PDA A;  2JPA A;  2ELZ A;  1X6E A;  1T4N A;  2B9D A;  3C4T A;  4M30 A;  2JR1 A;  4F6N A;  1ZBQ A;  4WPY A;  3OTO E;  2GLI A;  1X49 A;  2VQE E;  2RS6 A;  2EPU A;  1GQE A;  2LBS B;  3OML A;  4DV5 E;  2WCC 3;  1X47 A;  2V8Q B;  4LU9 A;  2EN1 A;  2EPX A;  4JI6 E;  1NCS A;  4WYQ B;  1YPN A;  3BF2 A;  2M1S A;  2LVH A;  2HHH E;  3HQ1 A;  1DQ3 A;  4MLQ A;  2VRD A;  2JWO A;  2V87 A;  2EOR A;  2G7H A;  1IBM E;  3IWC A;  5IXM B;  1TF6 A;  5IT9 C;  1ZBT A;  3JU0 A;  4KHP E;  4R2D A;  3EPL A;  2JVA A;  1HNX E;  3HXL A;  1GZ6 A;  1F2I G;  4BMJ A;  1PJQ A;  3ADL A;  3HPS A;  3EPH A;  2FGG A;  1XNR E;  2LE2 A;  2I9I A;  1SFE A;  1RMD A;  2GPI A;  2EMF A;  2EN8 A;  3JTZ A;  4RH8 A;  2UUB E;  2E1M A;  5A6A A;  2GHF A;  4OX9 E;  4WXC A;  4DV3 E;  4F2J C;  1QU6 A;  1T38 A;  2CSH A;  2YTI A;  2DLK A;  3EQ1 A;  1RC7 A;  5AE2 A;  1X48 A;  1B69 A;  3BID A;  1N32 E;  2R76 A;  2KHX A;  5KL5 A;  1WHQ A;  1MEY C;  5AC5 A;  3RMP A;  2RSI A;  3L00 A;  2YTF A;  2VF1 A;  5A6J A;  1AAY A;  2RTX A;  5LMU E;  1BB8 A;  4DR2 E;  3EPK A;  1T4O A;  2D9H A;  4B3M E;  2ODR D;  4R8O A;  2LO3 A;  2DIX A;  2EM7 A;  4LF9 E;  5LMN E;  2YRH A;  2J7J A;  2EMY A;  2NUE A;  4F6M A;  2YPN A;  3MSW A;  1JK1 A;  3MHS C;  3THN A;  4JI0 E;  2UU9 E;  4B3R E;  3BBG A;  1RQ0 A;  3AUZ A;  2EM9 A;  1YSA C;  2UUC E;  3QG5 C;  2EOM A;  1YYK A;  1YUI A;  4O5G A;  2M4I A;  2F4V E;  2MC6 A;  1TF3 A;  5AE3 A;  2EP3 A;  5AE1 A;  4TUI A;  5FLX C;  2EOJ A;  3KZZ A;  2YTJ A;  2EMZ A;  4JV5 E;  1UIL A;  4OOG C;  2BBG A;  2EPZ A;  3VHT B;  5KL4 A;  2DB2 A;  4DV1 E;  2E72 A;  1A1I A;  2V89 A;  1Z1B A;  1A1K A;  2K7I A;  4NZV A;  1UBD C;  1X6F A;  1G2F C;  4JI3 E;  4R2E A;  4LF7 E;  2EN2 A;  3C6M A;  2V88 A;  2LTR A;  2ODR C;  1HNZ E;  3VYX A;  4P7D A;  3IWD A;  4BBY A;  2EM5 A;  2EL4 A;  5LL6 R;  2EM8 A;  5IWA E;  1WRJ A;  4DV4 E;  1HNW E;  3F6H A;  2FTX B;  4JI1 E;  2EPN A;  4B3S E;  2L3J A;  4DR3 E;  1IBK E;  4DUY E;  4MLV A;  2YRK A;  1J26 A;  4YHH E;  2WZO A;  2RPC A;  2YTD A;  2EMG A;  4GKJ E;  1N36 E;  2YZT A;  4DR5 E;  3ADG A;  2EOZ A;  4L5N C;  2ZM6 E;  2MC5 A;  2L6M A;  4JI8 E;  3HPZ A;  3VK6 A;  1O0W A;  2EOI A;  3JAM C;  4KWY A;  1XMO E;  1WXR A;  2EM3 A;  2EPR A;  2HJJ A;  3C4B A;  5TSE A;  2EQ3 A;  1IMU A;  3AV0 A;  4ZYE A;  2MDR A;  1KJK A;  4IJD A;  4TUG A;  2R1F A;  5KL6 A;  2EPA A;  2B3T B;  2FV4 B;  1EH8 A;  4R2A A;  2EMA A;  1DI2 A;  1J5E E;  4X62 E;  2YTN A;  4N4R B;  1N3G A;  2CTD A;  4BC9 A;  1UHZ A;  1DGC A;  2EPP A;  1T4L B;  3ADJ A;  4X66 E;  3H09 A;  2CPN A;  1N34 E;  2DMY A;  4Q28 A;  2YRM A;  2EN4 A;  5A6K A;  2YTE A;  4LFA E;  1IQO A;  2EQ1 A;  1ZAA C;  1X5W A;  2DMI A;  1EH6 A;  2V85 A;  1WHN A;  1MGT A;  1X3C A;  1PJT A;  4BHC A;  4IS1 C;  2L8T A;  3C6K A;  2MKD A;  2ELY A;  2HC5 A;  2IHR 1;  2KON A;  2EOQ A;  2LJH A;  4BC7 A;  4DR6 E;  2NAB A;  2EM2 A;  1N33 E;  1EH7 A;  4LFC E;  3DF6 A;  4GKK E;  5CFF E;  3IWB A;  2WBS A;  2EOE A;  2LUQ A;  1JK2 A;  2ENA A;  4NHR A;  2UXD E;  5A2Q C;  5KL2 A;  4JI2 E;  3KZY A;  4X8W A;  3ECR A;  2NUF A;  4X64 E;  2RS7 A;  1YYO A;  2LJU A;  2EML A;  2YTO A;  2YU8 A;  2ADR A;  2N3G A;  4BCA A;  1LLM C;  2L2M A;  5IV8 B;  2VQF E;  1L4S A;  4ZYG A;  4LF8 E;  5BR8 E;  4DMI A;  3T1H E;  4M9V C;  1I94 E;  1BBG A;  1XMQ E;  2YTQ A;  2RQL A;  2L3C A;  2JOX A;  5ADZ A;  5A6B D;  2EPC A;  3LML A;  1A1J A;  2JOB A;  1IBL E;  1XNQ E;  3TQM A;  2F8B A;  2EQ0 A;  4BHB A;  2EE8 A;  2EPO A;  4HEI A;  3T1Y E;  2YTP A;  2B7T A;  3K6Q A;  1X6H A;  2DLQ A;  4ZYD A;  1PJS A;  4GEQ B;  2EJ4 A;  2LTS A;  2K4V A;  2JY9 A;  2UUA E;  2ENC A;  1A1L A;  4WFT A;  3P1X A;  5AC4 A;  2LMZ A;  3FIG A;  4R03 A;  2EM4 A;  4NXM E;  1KYQ A;  4R2C A;  3DJW A;  2WBT A;  4K0K E;  2PRT A;  2UXC E;  2EPL X;  4LF6 E;  4JYA E;  2N3H A;  1A1F A;  3KWR A;  5DNY A;  4DV7 E;  1FJG E;  4R2S A;  1GTK A;  2EOS A;  2Q8U A;  2EPK X;  4F9C B;  5A69 A;  4GZN C;  1IQS A;  2E5L E;  4YY3 E;  5KL7 A;  1PKP A;  4FK5 C;  4WSG A;  2EZ6 A;  2EN6 A;  4WSP A;  2EN7 A;  4JI5 E;  2A25 A;  2JP9 A;  4DUZ E;  4BS9 A;  1UN6 B;  5LLQ A;  3MHH C;  4M0V A;  1A1H A;  2L92 A;  4DV6 E;  1T39 A;  2NA2 A;  2EPM X;  2BB8 A;  1EKZ A;  1WJP A;  2YTG A;  4L8N A;  2LT7 A;  1NEI A;  4LTY A;  2EN3 A;  5KL3 A;  5F3W A;  3J7Y p;  4AQY E;  5AAS A;  4JI4 E;  2N8X A;  2YWQ A;  3EPJ A;  4DR7 E;  2RSM A;  3UK3 C;  4J8Z A;  3ZOQ B;  2CT1 A;  2NUG A;  2LCE A;  2B7V A;  2MDG A;  2YT4 A;  2YU5 A;  1SR9 A;  3VYY A;  3F6G A;  2UXB E;  4O4K A; 
#chains in the Genus database with same CATH homology
 1IMU A;  4HEI A;  1L4S A;  3TQM A;  1N3G A;  2YWQ A;  2RQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...