2RQLA

Solution structure of the e. coli ribosome hibernation promoting factor hpf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
b'MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable sigma-54 modulation protein
publication title Solution structure of the E. coli ribosome hibernation promoting factor HPF: Implications for the relationship between structure and function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2rqlA00
1N3GA 1IMUA 2RQLA 2YWQA 1L4SA 4HEIA 3TQMA
chains in the Genus database with same CATH superfamily
1AH5A 1KYQA 4JI8E 2NUFA 2EM0A 3MSWA 4BBYA 2UU9E 4DR4E 1X6EA 3K6QA 4JV5E 1EH6A 2UXDE 2EPPA 1TN9A 2YTPA 1BBGA 2UUAE 2HJJA 2LTSA 2EL4A 1BBOA 4JI1E 3LMLA 1A1JA 1RQ0A 1SR9A 4DR2E 4DV3E 2YTIA 1NEIA 4B3RE 2EWLA 4HTGA 2YU5A 3VYYA 4J8ZA 2EMXA 3ADLA 3DJWA 4X9JA 3VHTB 2EL6A 3RMPA 1UILA 2ENCA 2EOXA 4TUIA 2YWQA 3KZYA 3ECRA 3UK3C 4F9CB 4R2AA 2YU8A 2RS6A 1JK2A 2JVAA 4DR5E 1GZ6A 3T1YE 2EMAA 4YHHE 1XNQE 2DSYA 2ADRA 2L92A 1Z1BA 1T39A 1A1KA 2I13A 2J7JA 1TF3A 4F9AB 4R2CA 2HGHA 4JI6E 3KZZA 3HQ1A 3T1HE 4X64E 1X49A 2MKDA 2EJ4A 2YTFA 2EQ3A 2E72A 1T4NA 5AASA 1J26A 2EPZA 2NA2A 2V83A 2YRKA 3C4TA 1P47A 1IBKE 5A6BD 3AUZA 4BC9A 4B3SE 1PJTA 2G7HA 4R2PA 2UXCE 4X62E 2JWOA 2LVHA 4M9VC 4DV1E 2EMHA 2YTNA 4AQYE 2LRSA 2M4IA 1PKPA 4B3TE 2YTGA 4DV2E 3BIDA 2YZTA 2B7VA 4BC7A 5A6JA 1YYOA 2LUPB 1N34E 2EMGA 4WXDA 1ZBTA 4BMJA 1WRJA 3IWBA 1UN6B 2LV2A 1T4OA 2N3GA 2YT4A 2NUGA 2ENAA 3VYXA 3OMLA 3FIGA 1EH7A 5BR8E 2EPXA 4WSGA 4R2SA 5ADZA 1FJGE 2MDGA 1IQOA 2EN2A 2LJHA 2VQFE 2CSHA 2FGGA 2LJUA 5DNYA 4WXCA 2UUCE 4JYAE 2YRMA 4IJDA 2EPCA 2N8XA 2EPKX 2DIXA 2DMIA 2YTEA 1PDAA 4I8OA 4LTYA 2VQEE 4DKKA 5CFFE 5AC4A 4WFTA 1L4SA 2F8BA 4FK5C 1IMUA 2EMLA 2L3JA 3C6MA 2LT7A 3F6GA 4ZYHA 4K0KE 4WX9A 1KJKA 4JI0E 1WHNA 5IT9C 1HNZE 2BBGA 4L8NA 4DMIA 2EQ0A 4MLVA 2LO3A 4ZYDA 2M7QA 4F2JC 1UBDC 2EMWA 1X6HA 1X6FA 2EOIA 1N36E 4P7DA 2R1FA 4BCAA 2EPLX 4RHBB 4O4KA 2M1SA 1WJPA 1A1GA 2ENHA 2EQ1A 1HNXE 5F3WA 1LLMC 2NUEA 2L33A 2VRDA 3HXLA 4LFCE 2EMKA 5LMNE 2WZOA 2I9IA 2LE2A 2UXBE 2MC5A 3IWDA 1DGCA 4Q35B 1X5WA 2EMFA 4O5GA 4NHRA 4TUGA 2LBSB 2EM9A 2DLQA 2UUBE 2K4VA 2NABA 2YSPA 4R2EA 4X66E 3H09A 2EPRA 2EL5A 3ADJA 3M99B 5A6KA 3MHHC 3L00A 5A6BA 1QNTA 4P78A 4DR1E 1EKZA 3C4BA 4O24A 2EOQA 2EPMX 4JI3E 4M0VA 2EMZA 2MC6A 3HTXA 1X47A 2BB8A 2K7IA 5KL3A 1F2IG 1IBME 2YTOA 3C6KA 5KL2A 2EMIA 2EPAA 2WBUA 3JTZA 2RSIA 4DR6E 2Q8UA 2DLKA 2PRTA 2EM3A 2L2NA 4JI7E 2ELZA 4O43A 2EOSA 4OOGC 3BBGA 2EZ6A 2YTQA 4DUYE 4ZYEA 2IHR1 1N33E 4WPYA 1N3GA 2LMZA 4JI2E 1STUA 1XNRE 2JXPA 4X65E 4MLQA 2ODRC 3TQMA 3EPJA 3ADIA 5LMUE 4F54A 3THNA 5IXMB 2L8TA 4LFBE 5AE2A 1ZU1A 4WSPA 1YYWA 2B9DA 5IWAE 4F6NA 4NZVA 2EM2A 2A25A 2E1MA 3QG5C 4DV7E 3LLHA 2DB2A 1G2DC 4R2QA 1I94E 2EN8A 1IBLE 1A1FA 4DUZE 2YPNA 3THOB 2L2MA 2LUQA 1HNWE 3ZOQB 4LF9E 2JOBA 1MGTA 4F6MA 2EM6A 1XMQE 2EM5A 2RS7A 2EOEA 3EPLA 2EN7A 5KL6A 2EOMA 2EE8A 4LU9A 1X3CA 1EH8A 2V8QB 2CPNA 2L6MA 4GKKE 4DV0E 2B7TA 2B3TB 3HPZA 2HC5A 4ZYGA 4LF4E 2YRHA 2EPNA 1YUJA 3JAMC 3VK6A 2EMBA 2KHXA 4N4RB 2DGCA 1O0WA 5T6JA 2V89A 2YTDA 4DV6E 4OX9E 3OTOE 3F6HA 1B69A 5IV8B 3ADGA 1UHZA 2N3HA 2HHHE 4LF5E 2DMYA 1GTKA 2FV4B 2ELYA 1FKAE 2RSMA 4BS9A 2JY9A 1YZ9A 2EPUA 2EPOA 2D9HA 2EP3A 4R03A 4IS1C 1A1HA 4DR7E 3P1XA 2FTXB 2EMYA 2EMCA 1WHQA 4KHPE 1DI2A 2KOUA 4KZSA 3KWRA 1A1IA 5A6AA 2VF1A 4B3ME 2GLIA 4M2ZA 5AE1A 1TF6A 1ZBQA 2YSOA 1YUIA 2CTDA 1JK1A 2EN4A 2ZM6E 2RTXA 4YY3E 2RPCA 1SFEA 4GKJE 3BF2A 2EN1A 3HPSA 2M9AA 5KL5A 2R76A 4KWYA 1AAYA 5TSEA 1DQ3A 1RMDA 2EM7A 1XMOE 2WCC3 3JU0A 4LF6E 1J5EE 4JI4E 1PJQA 4LFAE 1YYKA 1YSAC 1PJSA 1QU6A 2EOJA 4R2RA 2EOOA 2WBTA 1BB8A 1MEYC 2JPAA 3IWCA 3MHSC 2JYAA 4F9BB 1N32E 3J80C 4NXME 3J81C 3DF6A 1A1LA 1RC7A 1T38A 4DV5E 5A69A 2MDRA 5LL6R 4R8OA 2KONA 3J7AG 2EM8A 4M30A 2WBSA 5KL7A 4L5NC 2EOYA 2F4VE 2L3CA 2V88A 1YFHA 3EPKA 2LCEA 2L2KB 2E5LE 3J7Yp 1GQEA 1HR0E 2V86A 2RQLA 2YTJA 1ZAAC 4GZNC 2MKNA 4LF8E 1T4LB 4BHBA 1G2FC 3AV0A 4WYQB 3EQ1A 5AE3A 4DR3E 4DV4E 2EOFA 2JOXA 4R2DA 2EM4A 4JI5E 2JP9A 2EORA 2JR1A 4NXNE 4HEIA 3EPHA 3BGHA 4GEQB 2GPIA 4Q28A 2V85A 5AC5A 4BHCA 2CT1A 2EOHA 1YPNA 1IQSA 5A2QC 2LTRA 2EOZA 1X48A 1ZR9A 2EN3A 4LF7E 2EN6A 5FLXC 1NCSA 2VE7C 2ODRD 4RH8A 2GHFA 5KL4A 1WXRA 2DRPA 2H36X 4X8WA 5LLQA 2V87A
chains in the Genus database with same CATH topology
1N3GA 1IMUA 2RQLA 2YWQA 1L4SA 4HEIA 3TQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3G A;  1IMU A;  2RQL A;  2YWQ A;  1L4S A;  4HEI A;  3TQM A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  1KYQ A;  4JI8 E;  2NUF A;  2EM0 A;  3MSW A;  4BBY A;  2UU9 E;  4DR4 E;  1X6E A;  3K6Q A;  4JV5 E;  1EH6 A;  2UXD E;  2EPP A;  1TN9 A;  2YTP A;  1BBG A;  2UUA E;  2HJJ A;  2LTS A;  2EL4 A;  1BBO A;  4JI1 E;  3LML A;  1A1J A;  1RQ0 A;  1SR9 A;  4DR2 E;  4DV3 E;  2YTI A;  1NEI A;  4B3R E;  2EWL A;  4HTG A;  2YU5 A;  3VYY A;  4J8Z A;  2EMX A;  3ADL A;  3DJW A;  4X9J A;  3VHT B;  2EL6 A;  3RMP A;  1UIL A;  2ENC A;  2EOX A;  4TUI A;  2YWQ A;  3KZY A;  3ECR A;  3UK3 C;  4F9C B;  4R2A A;  2YU8 A;  2RS6 A;  1JK2 A;  2JVA A;  4DR5 E;  1GZ6 A;  3T1Y E;  2EMA A;  4YHH E;  1XNQ E;  2DSY A;  2ADR A;  2L92 A;  1Z1B A;  1T39 A;  1A1K A;  2I13 A;  2J7J A;  1TF3 A;  4F9A B;  4R2C A;  2HGH A;  4JI6 E;  3KZZ A;  3HQ1 A;  3T1H E;  4X64 E;  1X49 A;  2MKD A;  2EJ4 A;  2YTF A;  2EQ3 A;  2E72 A;  1T4N A;  5AAS A;  1J26 A;  2EPZ A;  2NA2 A;  2V83 A;  2YRK A;  3C4T A;  1P47 A;  1IBK E;  5A6B D;  3AUZ A;  4BC9 A;  4B3S E;  1PJT A;  2G7H A;  4R2P A;  2UXC E;  4X62 E;  2JWO A;  2LVH A;  4M9V C;  4DV1 E;  2EMH A;  2YTN A;  4AQY E;  2LRS A;  2M4I A;  1PKP A;  4B3T E;  2YTG A;  4DV2 E;  3BID A;  2YZT A;  2B7V A;  4BC7 A;  5A6J A;  1YYO A;  2LUP B;  1N34 E;  2EMG A;  4WXD A;  1ZBT A;  4BMJ A;  1WRJ A;  3IWB A;  1UN6 B;  2LV2 A;  1T4O A;  2N3G A;  2YT4 A;  2NUG A;  2ENA A;  3VYX A;  3OML A;  3FIG A;  1EH7 A;  5BR8 E;  2EPX A;  4WSG A;  4R2S A;  5ADZ A;  1FJG E;  2MDG A;  1IQO A;  2EN2 A;  2LJH A;  2VQF E;  2CSH A;  2FGG A;  2LJU A;  5DNY A;  4WXC A;  2UUC E;  4JYA E;  2YRM A;  4IJD A;  2EPC A;  2N8X A;  2EPK X;  2DIX A;  2DMI A;  2YTE A;  1PDA A;  4I8O A;  4LTY A;  2VQE E;  4DKK A;  5CFF E;  5AC4 A;  4WFT A;  1L4S A;  2F8B A;  4FK5 C;  1IMU A;  2EML A;  2L3J A;  3C6M A;  2LT7 A;  3F6G A;  4ZYH A;  4K0K E;  4WX9 A;  1KJK A;  4JI0 E;  1WHN A;  5IT9 C;  1HNZ E;  2BBG A;  4L8N A;  4DMI A;  2EQ0 A;  4MLV A;  2LO3 A;  4ZYD A;  2M7Q A;  4F2J C;  1UBD C;  2EMW A;  1X6H A;  1X6F A;  2EOI A;  1N36 E;  4P7D A;  2R1F A;  4BCA A;  2EPL X;  4RHB B;  4O4K A;  2M1S A;  1WJP A;  1A1G A;  2ENH A;  2EQ1 A;  1HNX E;  5F3W A;  1LLM C;  2NUE A;  2L33 A;  2VRD A;  3HXL A;  4LFC E;  2EMK A;  5LMN E;  2WZO A;  2I9I A;  2LE2 A;  2UXB E;  2MC5 A;  3IWD A;  1DGC A;  4Q35 B;  1X5W A;  2EMF A;  4O5G A;  4NHR A;  4TUG A;  2LBS B;  2EM9 A;  2DLQ A;  2UUB E;  2K4V A;  2NAB A;  2YSP A;  4R2E A;  4X66 E;  3H09 A;  2EPR A;  2EL5 A;  3ADJ A;  3M99 B;  5A6K A;  3MHH C;  3L00 A;  5A6B A;  1QNT A;  4P78 A;  4DR1 E;  1EKZ A;  3C4B A;  4O24 A;  2EOQ A;  2EPM X;  4JI3 E;  4M0V A;  2EMZ A;  2MC6 A;  3HTX A;  1X47 A;  2BB8 A;  2K7I A;  5KL3 A;  1F2I G;  1IBM E;  2YTO A;  3C6K A;  5KL2 A;  2EMI A;  2EPA A;  2WBU A;  3JTZ A;  2RSI A;  4DR6 E;  2Q8U A;  2DLK A;  2PRT A;  2EM3 A;  2L2N A;  4JI7 E;  2ELZ A;  4O43 A;  2EOS A;  4OOG C;  3BBG A;  2EZ6 A;  2YTQ A;  4DUY E;  4ZYE A;  2IHR 1;  1N33 E;  4WPY A;  1N3G A;  2LMZ A;  4JI2 E;  1STU A;  1XNR E;  2JXP A;  4X65 E;  4MLQ A;  2ODR C;  3TQM A;  3EPJ A;  3ADI A;  5LMU E;  4F54 A;  3THN A;  5IXM B;  2L8T A;  4LFB E;  5AE2 A;  1ZU1 A;  4WSP A;  1YYW A;  2B9D A;  5IWA E;  4F6N A;  4NZV A;  2EM2 A;  2A25 A;  2E1M A;  3QG5 C;  4DV7 E;  3LLH A;  2DB2 A;  1G2D C;  4R2Q A;  1I94 E;  2EN8 A;  1IBL E;  1A1F A;  4DUZ E;  2YPN A;  3THO B;  2L2M A;  2LUQ A;  1HNW E;  3ZOQ B;  4LF9 E;  2JOB A;  1MGT A;  4F6M A;  2EM6 A;  1XMQ E;  2EM5 A;  2RS7 A;  2EOE A;  3EPL A;  2EN7 A;  5KL6 A;  2EOM A;  2EE8 A;  4LU9 A;  1X3C A;  1EH8 A;  2V8Q B;  2CPN A;  2L6M A;  4GKK E;  4DV0 E;  2B7T A;  2B3T B;  3HPZ A;  2HC5 A;  4ZYG A;  4LF4 E;  2YRH A;  2EPN A;  1YUJ A;  3JAM C;  3VK6 A;  2EMB A;  2KHX A;  4N4R B;  2DGC A;  1O0W A;  5T6J A;  2V89 A;  2YTD A;  4DV6 E;  4OX9 E;  3OTO E;  3F6H A;  1B69 A;  5IV8 B;  3ADG A;  1UHZ A;  2N3H A;  2HHH E;  4LF5 E;  2DMY A;  1GTK A;  2FV4 B;  2ELY A;  1FKA E;  2RSM A;  4BS9 A;  2JY9 A;  1YZ9 A;  2EPU A;  2EPO A;  2D9H A;  2EP3 A;  4R03 A;  4IS1 C;  1A1H A;  4DR7 E;  3P1X A;  2FTX B;  2EMY A;  2EMC A;  1WHQ A;  4KHP E;  1DI2 A;  2KOU A;  4KZS A;  3KWR A;  1A1I A;  5A6A A;  2VF1 A;  4B3M E;  2GLI A;  4M2Z A;  5AE1 A;  1TF6 A;  1ZBQ A;  2YSO A;  1YUI A;  2CTD A;  1JK1 A;  2EN4 A;  2ZM6 E;  2RTX A;  4YY3 E;  2RPC A;  1SFE A;  4GKJ E;  3BF2 A;  2EN1 A;  3HPS A;  2M9A A;  5KL5 A;  2R76 A;  4KWY A;  1AAY A;  5TSE A;  1DQ3 A;  1RMD A;  2EM7 A;  1XMO E;  2WCC 3;  3JU0 A;  4LF6 E;  1J5E E;  4JI4 E;  1PJQ A;  4LFA E;  1YYK A;  1YSA C;  1PJS A;  1QU6 A;  2EOJ A;  4R2R A;  2EOO A;  2WBT A;  1BB8 A;  1MEY C;  2JPA A;  3IWC A;  3MHS C;  2JYA A;  4F9B B;  1N32 E;  3J80 C;  4NXM E;  3J81 C;  3DF6 A;  1A1L A;  1RC7 A;  1T38 A;  4DV5 E;  5A69 A;  2MDR A;  5LL6 R;  4R8O A;  2KON A;  3J7A G;  2EM8 A;  4M30 A;  2WBS A;  5KL7 A;  4L5N C;  2EOY A;  2F4V E;  2L3C A;  2V88 A;  1YFH A;  3EPK A;  2LCE A;  2L2K B;  2E5L E;  3J7Y p;  1GQE A;  1HR0 E;  2V86 A;  2RQL A;  2YTJ A;  1ZAA C;  4GZN C;  2MKN A;  4LF8 E;  1T4L B;  4BHB A;  1G2F C;  3AV0 A;  4WYQ B;  3EQ1 A;  5AE3 A;  4DR3 E;  4DV4 E;  2EOF A;  2JOX A;  4R2D A;  2EM4 A;  4JI5 E;  2JP9 A;  2EOR A;  2JR1 A;  4NXN E;  4HEI A;  3EPH A;  3BGH A;  4GEQ B;  2GPI A;  4Q28 A;  2V85 A;  5AC5 A;  4BHC A;  2CT1 A;  2EOH A;  1YPN A;  1IQS A;  5A2Q C;  2LTR A;  2EOZ A;  1X48 A;  1ZR9 A;  2EN3 A;  4LF7 E;  2EN6 A;  5FLX C;  1NCS A;  2VE7 C;  2ODR D;  4RH8 A;  2GHF A;  5KL4 A;  1WXR A;  2DRP A;  2H36 X;  4X8W A;  5LLQ A;  2V87 A; 
#chains in the Genus database with same CATH homology
 1N3G A;  1IMU A;  2RQL A;  2YWQ A;  1L4S A;  4HEI A;  3TQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...