2RQLA

Solution structure of the e. coli ribosome hibernation promoting factor hpf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E. coli ribosome hibernation promoting factor HPF: Implications for the relationship between structure and function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords Probable sigma-54 modulation protein
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2rqlA00
2RQLA 1IMUA 2YWQA 1L4SA 4HEIA 3TQMA 1N3GA
chains in the Genus database with same CATH superfamily
1G2FC 2EN7A 1DI2A 3OMLA 2EN6A 4O4KA 1AH5A 4HTGA 2EOMA 2EMHA 3UK3C 1A1GA 5AC5A 4RHBB 3ADLA 2EPPA 2D9HA 1ZBTA 4LFBE 2EL6A 2EPZA 2L3CA 2UXBE 3F6HA 5A6JA 1YYWA 4NHRA 1BBOA 1YYOA 2ELYA 3C4TA 2EMIA 2NABA 4TUGA 4BS9A 3IWBA 2DIXA 2YTNA 1ZU1A 2R76A 4DV1E 2RS7A 2EMLA 4DR6E 5F3WA 2EL5A 2ADRA 3ADIA 2N8XA 2YTEA 4M30A 1STUA 4KZSA 2EPRA 3P1XA 3THOB 4X64E 2RTXA 2EMAA 1MGTA 1KYQA 1X6HA 1N3GA 2WZOA 4R2DA 2JWOA 1WJPA 1IBLE 1G2DC 1NCSA 2F4VE 2B7VA 3AV0A 1EH7A 3M99B 5AE3A 4DR2E 2EQ1A 4DV4E 4WX9A 4OX9E 4DUYE 1YYKA 2EMZA 3AUZA 3HTXA 2V88A 5AE2A 4M2ZA 1X49A 1A1HA 4HEIA 2L33A 2WBSA 2UUCE 1TF6A 2MDGA 2YTOA 1YFHA 2EPAA 2V87A 1ZBQA 2ENHA 2M7QA 3EPKA 2EN2A 3ECRA 3J7AG 4JV5E 5IV8B 2EMXA 4GEQB 4LF8E 1IQOA 1PJTA 2KONA 2Q8UA 2KHXA 1N36E 2E72A 2L2MA 4WSPA 5BR8E 2EMGA 1WHQA 4JI6E 2M9AA 2EZ6A 1A1JA 2MKDA 1L4SA 2EOSA 1YSAC 2LMZA 1YUIA 4DV7E 3HPZA 2N3HA 1UHZA 3DJWA 4DR5E 1HNXE 1HNWE 3T1HE 2HJJA 5KL6A 1TN9A 2PRTA 2LUPB 4R2QA 3LMLA 4X66E 4JYAE 4ZYGA 4X8WA 1ZR9A 2CT1A 2EM2A 2EM9A 2EP3A 2EQ0A 2LTSA 3JAMC 2L2KB 4DUZE 2EN8A 3HPSA 4P78A 2EM7A 4F9CB 1LLMC 2L8TA 2EMKA 4L5NC 4P7DA 3J80C 2EL4A 5TSEA 4LF7E 1WHNA 4B3RE 1PJSA 2EPNA 4GZNC 5IT9C 2VQFE 2WCC3 3VYYA 1QU6A 4M9VC 5A6BA 1BB8A 3C6MA 3MHSC 4LF9E 3VK6A 4LF6E 2V89A 2EM3A 3L00A 1O0WA 4M0VA 2EJ4A 2FGGA 4JI2E 2YRMA 3FIGA 4F9BB 4GKKE 1IBME 2EOXA 3K6QA 4DR1E 3HQ1A 2VF1A 1A1LA 1EH8A 2JY9A 2NUEA 2B7TA 4RH8A 1T39A 5DNYA 4R2RA 4IJDA 2DGCA 2EOQA 4R2AA 2UXDE 2UXCE 2EPKX 2V83A 2DB2A 1IQSA 4DKKA 2EMCA 3IWCA 2I9IA 2YTIA 2KOUA 2EPUA 3J7Yp 2EM0A 4J8ZA 5T6JA 2EE8A 3ADJA 1X6EA 2EQ3A 2MC5A 2V85A 4GKJE 1J26A 4L8NA 2G7HA 5KL2A 1UBDC 3BF2A 2EWLA 4LTYA 2I13A 5CFFE 3H09A 1N34E 1AAYA 2DLQA 2YU5A 4BMJA 3C6KA 4R2PA 4O43A 4WYQB 2ODRC 2JP9A 1SFEA 2VE7C 1Z1BA 2LJUA 1RC7A 2EPXA 1SR9A 3HXLA 5KL5A 2LO3A 4DR3E 2B3TB 3EQ1A 2L92A 4DV0E 2YTPA 2H36X 2EOHA 2L2NA 5LL6R 3DF6A 2F8BA 2RQLA 1P47A 3KZYA 1RMDA 5LLQA 2EOYA 4YHHE 1FJGE 1WXRA 2EOEA 5KL4A 4ZYEA 2LCEA 2RSIA 2LBSB 2YZTA 2ELZA 5FLXC 3C4BA 2YSPA 1PDAA 1QNTA 1X47A 2FV4B 4F2JC 4O5GA 2HC5A 1T4LB 1HR0E 5IXMB 4YY3E 2WBTA 4R2CA 2WBUA 2GLIA 2EPLX 2JR1A 2YPNA 1I94E 1GZ6A 2HGHA 4NZVA 4O24A 2DLKA 4ZYHA 4FK5C 4WXCA 2JPAA 2UU9E 3ZOQB 2YTQA 2YTFA 2EOZA 2VQEE 5IWAE 2BB8A 1ZAAC 2MDRA 2EM6A 4ZYDA 1GTKA 1UILA 1EKZA 2YU8A 2GPIA 3QG5C 4X9JA 2EMFA 4KWYA 2L3JA 4NXME 2K4VA 3MHHC 2CSHA 1T4OA 2ZM6E 2V8QB 2EM4A 5A6BD 4TUIA 2NA2A 2UUBE 2MKNA 2EOFA 3EPJA 2LE2A 1HNZE 4X62E 1F2IG 2YTDA 4JI5E 3LLHA 2MC6A 3KZZA 1NEIA 4JI8E 3MSWA 3OTOE 4F54A 1BBGA 3BBGA 1DGCA 1MEYC 3IWDA 4R03A 4BBYA 2HHHE 4DV6E 1N33E 4KHPE 4WSGA 2LJHA 2BBGA 4Q35B 4LFCE 4LF5E 1IBKE 1UN6B 2EPMX 4BCAA 1RQ0A 5ADZA 2LRSA 3BGHA 1JK1A 1T38A 4I8OA 3T1YE 4MLQA 1X3CA 3VHTB 2JOXA 4BHBA 4JI0E 2JYAA 1YPNA 3KWRA 2IHR1 2CPNA 5AASA 2LVHA 1PJQA 5LMUE 3JTZA 1FKAE 4JI7E 5LMNE 2EPCA 2E5LE 2K7IA 3F6GA 4LU9A 2EORA 2B9DA 2E1MA 4R2EA 3THNA 4Q28A 4LFAE 2LTRA 2M1SA 4DV5E 2RPCA 2EMBA 4R2SA 2EN3A 4F6NA 4DR7E 4DV2E 1YZ9A 2EMYA 1A1FA 1J5EE 1A1KA 4MLVA 2YTJA 1XNQE 4LF4E 2YWQA 2EOIA 1GQEA 2GHFA 1TF3A 4R8OA 2M4IA 5A2QC 2L6MA 3BIDA 5A69A 2N3GA 5KL3A 5AC4A 1DQ3A 2FTXB 4NXNE 5AE1A 4BC7A 3RMPA 2UUAE 2EM5A 2YRKA 2JVAA 2RSMA 4BC9A 1T4NA 2R1FA 4AQYE 1X48A 3EPLA 2DSYA 3J81C 1XMOE 2A25A 2LT7A 4IS1C 2ENAA 2YSOA 2EMWA 1A1IA 1EH6A 1XNRE 2EN4A 1X6FA 4B3ME 1PKPA 2RS6A 2CTDA 1B69A 2LUQA 3VYXA 4WXDA 4JI1E 1XMQE 1WRJA 1N32E 3EPHA 2VRDA 4B3TE 2EOJA 3ADGA 1IMUA 5A6KA 2NUFA 4JI4E 2DMIA 4BHCA 5A6AA 4B3SE 2DMYA 2YRHA 2EM8A 4DR4E 2NUGA 4WPYA 2JXPA 3JU0A 5KL7A 3TQMA 4OOGC 4X65E 4DV3E 4F6MA 1KJKA 4JI3E 2YTGA 2EPOA 4DMIA 2JOBA 2DRPA 2YT4A 1JK2A 1YUJA 1X5WA 4WFTA 2EOOA 2LV2A 2ODRD 2EN1A 4N4RB 2J7JA 4F9AB 2V86A 4K0KE 2ENCA
chains in the Genus database with same CATH topology
2RQLA 1IMUA 2YWQA 1L4SA 4HEIA 3TQMA 1N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQL A;  1IMU A;  2YWQ A;  1L4S A;  4HEI A;  3TQM A;  1N3G A; 
#chains in the Genus database with same CATH topology
 1G2F C;  2EN7 A;  1DI2 A;  3OML A;  2EN6 A;  4O4K A;  1AH5 A;  4HTG A;  2EOM A;  2EMH A;  3UK3 C;  1A1G A;  5AC5 A;  4RHB B;  3ADL A;  2EPP A;  2D9H A;  1ZBT A;  4LFB E;  2EL6 A;  2EPZ A;  2L3C A;  2UXB E;  3F6H A;  5A6J A;  1YYW A;  4NHR A;  1BBO A;  1YYO A;  2ELY A;  3C4T A;  2EMI A;  2NAB A;  4TUG A;  4BS9 A;  3IWB A;  2DIX A;  2YTN A;  1ZU1 A;  2R76 A;  4DV1 E;  2RS7 A;  2EML A;  4DR6 E;  5F3W A;  2EL5 A;  2ADR A;  3ADI A;  2N8X A;  2YTE A;  4M30 A;  1STU A;  4KZS A;  2EPR A;  3P1X A;  3THO B;  4X64 E;  2RTX A;  2EMA A;  1MGT A;  1KYQ A;  1X6H A;  1N3G A;  2WZO A;  4R2D A;  2JWO A;  1WJP A;  1IBL E;  1G2D C;  1NCS A;  2F4V E;  2B7V A;  3AV0 A;  1EH7 A;  3M99 B;  5AE3 A;  4DR2 E;  2EQ1 A;  4DV4 E;  4WX9 A;  4OX9 E;  4DUY E;  1YYK A;  2EMZ A;  3AUZ A;  3HTX A;  2V88 A;  5AE2 A;  4M2Z A;  1X49 A;  1A1H A;  4HEI A;  2L33 A;  2WBS A;  2UUC E;  1TF6 A;  2MDG A;  2YTO A;  1YFH A;  2EPA A;  2V87 A;  1ZBQ A;  2ENH A;  2M7Q A;  3EPK A;  2EN2 A;  3ECR A;  3J7A G;  4JV5 E;  5IV8 B;  2EMX A;  4GEQ B;  4LF8 E;  1IQO A;  1PJT A;  2KON A;  2Q8U A;  2KHX A;  1N36 E;  2E72 A;  2L2M A;  4WSP A;  5BR8 E;  2EMG A;  1WHQ A;  4JI6 E;  2M9A A;  2EZ6 A;  1A1J A;  2MKD A;  1L4S A;  2EOS A;  1YSA C;  2LMZ A;  1YUI A;  4DV7 E;  3HPZ A;  2N3H A;  1UHZ A;  3DJW A;  4DR5 E;  1HNX E;  1HNW E;  3T1H E;  2HJJ A;  5KL6 A;  1TN9 A;  2PRT A;  2LUP B;  4R2Q A;  3LML A;  4X66 E;  4JYA E;  4ZYG A;  4X8W A;  1ZR9 A;  2CT1 A;  2EM2 A;  2EM9 A;  2EP3 A;  2EQ0 A;  2LTS A;  3JAM C;  2L2K B;  4DUZ E;  2EN8 A;  3HPS A;  4P78 A;  2EM7 A;  4F9C B;  1LLM C;  2L8T A;  2EMK A;  4L5N C;  4P7D A;  3J80 C;  2EL4 A;  5TSE A;  4LF7 E;  1WHN A;  4B3R E;  1PJS A;  2EPN A;  4GZN C;  5IT9 C;  2VQF E;  2WCC 3;  3VYY A;  1QU6 A;  4M9V C;  5A6B A;  1BB8 A;  3C6M A;  3MHS C;  4LF9 E;  3VK6 A;  4LF6 E;  2V89 A;  2EM3 A;  3L00 A;  1O0W A;  4M0V A;  2EJ4 A;  2FGG A;  4JI2 E;  2YRM A;  3FIG A;  4F9B B;  4GKK E;  1IBM E;  2EOX A;  3K6Q A;  4DR1 E;  3HQ1 A;  2VF1 A;  1A1L A;  1EH8 A;  2JY9 A;  2NUE A;  2B7T A;  4RH8 A;  1T39 A;  5DNY A;  4R2R A;  4IJD A;  2DGC A;  2EOQ A;  4R2A A;  2UXD E;  2UXC E;  2EPK X;  2V83 A;  2DB2 A;  1IQS A;  4DKK A;  2EMC A;  3IWC A;  2I9I A;  2YTI A;  2KOU A;  2EPU A;  3J7Y p;  2EM0 A;  4J8Z A;  5T6J A;  2EE8 A;  3ADJ A;  1X6E A;  2EQ3 A;  2MC5 A;  2V85 A;  4GKJ E;  1J26 A;  4L8N A;  2G7H A;  5KL2 A;  1UBD C;  3BF2 A;  2EWL A;  4LTY A;  2I13 A;  5CFF E;  3H09 A;  1N34 E;  1AAY A;  2DLQ A;  2YU5 A;  4BMJ A;  3C6K A;  4R2P A;  4O43 A;  4WYQ B;  2ODR C;  2JP9 A;  1SFE A;  2VE7 C;  1Z1B A;  2LJU A;  1RC7 A;  2EPX A;  1SR9 A;  3HXL A;  5KL5 A;  2LO3 A;  4DR3 E;  2B3T B;  3EQ1 A;  2L92 A;  4DV0 E;  2YTP A;  2H36 X;  2EOH A;  2L2N A;  5LL6 R;  3DF6 A;  2F8B A;  2RQL A;  1P47 A;  3KZY A;  1RMD A;  5LLQ A;  2EOY A;  4YHH E;  1FJG E;  1WXR A;  2EOE A;  5KL4 A;  4ZYE A;  2LCE A;  2RSI A;  2LBS B;  2YZT A;  2ELZ A;  5FLX C;  3C4B A;  2YSP A;  1PDA A;  1QNT A;  1X47 A;  2FV4 B;  4F2J C;  4O5G A;  2HC5 A;  1T4L B;  1HR0 E;  5IXM B;  4YY3 E;  2WBT A;  4R2C A;  2WBU A;  2GLI A;  2EPL X;  2JR1 A;  2YPN A;  1I94 E;  1GZ6 A;  2HGH A;  4NZV A;  4O24 A;  2DLK A;  4ZYH A;  4FK5 C;  4WXC A;  2JPA A;  2UU9 E;  3ZOQ B;  2YTQ A;  2YTF A;  2EOZ A;  2VQE E;  5IWA E;  2BB8 A;  1ZAA C;  2MDR A;  2EM6 A;  4ZYD A;  1GTK A;  1UIL A;  1EKZ A;  2YU8 A;  2GPI A;  3QG5 C;  4X9J A;  2EMF A;  4KWY A;  2L3J A;  4NXM E;  2K4V A;  3MHH C;  2CSH A;  1T4O A;  2ZM6 E;  2V8Q B;  2EM4 A;  5A6B D;  4TUI A;  2NA2 A;  2UUB E;  2MKN A;  2EOF A;  3EPJ A;  2LE2 A;  1HNZ E;  4X62 E;  1F2I G;  2YTD A;  4JI5 E;  3LLH A;  2MC6 A;  3KZZ A;  1NEI A;  4JI8 E;  3MSW A;  3OTO E;  4F54 A;  1BBG A;  3BBG A;  1DGC A;  1MEY C;  3IWD A;  4R03 A;  4BBY A;  2HHH E;  4DV6 E;  1N33 E;  4KHP E;  4WSG A;  2LJH A;  2BBG A;  4Q35 B;  4LFC E;  4LF5 E;  1IBK E;  1UN6 B;  2EPM X;  4BCA A;  1RQ0 A;  5ADZ A;  2LRS A;  3BGH A;  1JK1 A;  1T38 A;  4I8O A;  3T1Y E;  4MLQ A;  1X3C A;  3VHT B;  2JOX A;  4BHB A;  4JI0 E;  2JYA A;  1YPN A;  3KWR A;  2IHR 1;  2CPN A;  5AAS A;  2LVH A;  1PJQ A;  5LMU E;  3JTZ A;  1FKA E;  4JI7 E;  5LMN E;  2EPC A;  2E5L E;  2K7I A;  3F6G A;  4LU9 A;  2EOR A;  2B9D A;  2E1M A;  4R2E A;  3THN A;  4Q28 A;  4LFA E;  2LTR A;  2M1S A;  4DV5 E;  2RPC A;  2EMB A;  4R2S A;  2EN3 A;  4F6N A;  4DR7 E;  4DV2 E;  1YZ9 A;  2EMY A;  1A1F A;  1J5E E;  1A1K A;  4MLV A;  2YTJ A;  1XNQ E;  4LF4 E;  2YWQ A;  2EOI A;  1GQE A;  2GHF A;  1TF3 A;  4R8O A;  2M4I A;  5A2Q C;  2L6M A;  3BID A;  5A69 A;  2N3G A;  5KL3 A;  5AC4 A;  1DQ3 A;  2FTX B;  4NXN E;  5AE1 A;  4BC7 A;  3RMP A;  2UUA E;  2EM5 A;  2YRK A;  2JVA A;  2RSM A;  4BC9 A;  1T4N A;  2R1F A;  4AQY E;  1X48 A;  3EPL A;  2DSY A;  3J81 C;  1XMO E;  2A25 A;  2LT7 A;  4IS1 C;  2ENA A;  2YSO A;  2EMW A;  1A1I A;  1EH6 A;  1XNR E;  2EN4 A;  1X6F A;  4B3M E;  1PKP A;  2RS6 A;  2CTD A;  1B69 A;  2LUQ A;  3VYX A;  4WXD A;  4JI1 E;  1XMQ E;  1WRJ A;  1N32 E;  3EPH A;  2VRD A;  4B3T E;  2EOJ A;  3ADG A;  1IMU A;  5A6K A;  2NUF A;  4JI4 E;  2DMI A;  4BHC A;  5A6A A;  4B3S E;  2DMY A;  2YRH A;  2EM8 A;  4DR4 E;  2NUG A;  4WPY A;  2JXP A;  3JU0 A;  5KL7 A;  3TQM A;  4OOG C;  4X65 E;  4DV3 E;  4F6M A;  1KJK A;  4JI3 E;  2YTG A;  2EPO A;  4DMI A;  2JOB A;  2DRP A;  2YT4 A;  1JK2 A;  1YUJ A;  1X5W A;  4WFT A;  2EOO A;  2LV2 A;  2ODR D;  2EN1 A;  4N4R B;  2J7J A;  4F9A B;  2V86 A;  4K0K E;  2ENC A; 
#chains in the Genus database with same CATH homology
 2RQL A;  1IMU A;  2YWQ A;  1L4S A;  4HEI A;  3TQM A;  1N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...