2RQLA

Solution structure of the e. coli ribosome hibernation promoting factor hpf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable sigma-54 modulation protein
publication title Solution structure of the E. coli ribosome hibernation promoting factor HPF: Implications for the relationship between structure and function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2rqlA00
2YWQA 4HEIA 3TQMA 2RQLA 1IMUA 1L4SA 1N3GA
chains in the Genus database with same CATH superfamily
1LLMC 1DI2A 2LO3A 5A6JA 5LMNE 3K6QA 2EOFA 2N3GA 1A1KA 1UN6B 4R2CA 4JI5E 2YSPA 2EM5A 2EMFA 2JOXA 2EN2A 2EMIA 2EOMA 4MLQA 2YTJA 2EQ1A 2YRKA 5AC4A 4LFBE 2B7TA 2EPPA 2G7HA 4LF7E 4R2SA 4DV1E 1UBDC 4DV0E 4LU9A 3DF6A 2EWLA 1IBLE 2UUBE 2MC6A 4GKKE 3THOB 2HC5A 1A1IA 2R1FA 1X49A 2EQ0A 2D9HA 4RH8A 4LF9E 4WSGA 2YRMA 1YZ9A 1DQ3A 4ZYHA 4FK5C 5AC5A 4BS9A 2H36X 4I8OA 2V87A 4P7DA 4R2QA 2UXCE 3C6KA 1JK1A 3MHHC 2EMGA 2Q8UA 5A6AA 4F54A 1YUJA 2JOBA 4BMJA 1T4NA 4JI1E 2LMZA 4DR2E 4Q28A 1IQOA 3ADJA 2DMYA 1GZ6A 1GTKA 1HR0E 2B3TB 2M7QA 2LT7A 3MSWA 3RMPA 4BCAA 2LUPB 2EQ3A 2DRPA 2RQLA 3L00A 2YU8A 2VF1A 1X5WA 2YTIA 4R03A 4F6MA 1RQ0A 2GPIA 2A25A 2EMAA 3HXLA 3HPZA 2L3CA 2YTFA 3ZOQB 2EMBA 3THNA 2EM9A 1ZBQA 2YPNA 4LF5E 2IHR1 5TSEA 2EMYA 2M4IA 3LMLA 4ZYDA 4R2RA 1G2FC 4R2AA 2EMXA 2LRSA 1PDAA 4LTYA 4YHHE 2JWOA 2V88A 2EM8A 4LF6E 3J81C 2EN7A 3UK3C 2EM0A 3VK6A 2VQFE 5F3WA 4DV2E 4DUYE 1IQSA 2YRHA 2YTQA 5A2QC 2EMHA 2WCC3 1YSAC 1ZBTA 4NHRA 5KL5A 3EPHA 4WXDA 1XNQE 4F2JC 2BBGA 4O43A 4F9BB 2ENAA 1YYWA 4WPYA 2NABA 2EN4A 2EJ4A 3OTOE 3JU0A 1Z1BA 4DUZE 4Q35B 1N3GA 2R76A 2YZTA 3JAMC 5AE1A 4DV6E 5KL3A 2KOUA 5KL6A 2DIXA 3J7Yp 4F6NA 2JP9A 5IV8B 2L2NA 4R2PA 4J8ZA 1XMOE 1N34E 2YTEA 4IS1C 4F9CB 2F8BA 1X6FA 1KYQA 5LMUE 3TQMA 4DV3E 2YTNA 1EH6A 1P47A 2EN8A 3KWRA 2L33A 2EOZA 2LTSA 4X65E 2JR1A 4OOGC 4JI4E 2NA2A 4JYAE 2EN1A 3EQ1A 4WYQB 1YFHA 2EZ6A 4X8WA 2E72A 2LCEA 4HTGA 1PKPA 2V86A 4M9VC 3ADGA 4BC9A 2RS6A 4DR3E 1BBGA 4ZYEA 2EMWA 2FGGA 5A6BA 2EN3A 5KL7A 2CT1A 2EPMX 4X64E 1XMQE 5IT9C 1SFEA 2LTRA 2YTPA 1JK2A 1IBME 2YSOA 1FJGE 3HTXA 2EP3A 3EPLA 2N3HA 5IXMB 1X6HA 2EOOA 3MHSC 2LE2A 1X48A 2VE7C 4KHPE 4O4KA 1STUA 2RS7A 5T6JA 4BC7A 4M2ZA 4R2DA 1YPNA 2B9DA 2ODRD 1YUIA 4JI3E 2EMZA 2EORA 3C4TA 2YU5A 2EOHA 5BR8E 2MKDA 3IWBA 1EKZA 2JY9A 2E5LE 1T4LB 1KJKA 2FV4B 2V8QB 1YYKA 1B69A 2LV2A 3VYXA 4ZYGA 3AV0A 4RHBB 2EL6A 2L3JA 1ZU1A 2EM4A 2WBTA 4DR7E 4GKJE 3F6HA 2EOYA 4DMIA 4DR5E 1RMDA 3HQ1A 2EPLX 1L4SA 2ZM6E 2EPCA 4BHCA 2HGHA 4IJDA 1A1FA 4B3TE 1TF6A 4TUGA 4F9AB 1BB8A 2J7JA 1O0WA 4NXNE 1QU6A 1UILA 2UU9E 5KL4A 2EOIA 3OMLA 2V83A 3H09A 1A1HA 4K0KE 2VRDA 2UUCE 4JI0E 2EMCA 2DLQA 2NUGA 1J5EE 1J26A 2L92A 5A6KA 4JV5E 1DGCA 1TN9A 2E1MA 2PRTA 2RSIA 4LFAE 4LFCE 4DR4E 2M9AA 3M99B 2YWQA 1AAYA 2WBUA 4LF4E 4DV4E 2L8TA 3EPJA 2V85A 2LJHA 2GLIA 2HJJA 4OX9E 2DMIA 3BBGA 4JI2E 3C4BA 4DKKA 5ADZA 3FIGA 3ECRA 2F4VE 4YY3E 4WX9A 2EM7A 3ADIA 4BBYA 4DR1E 1QNTA 1TF3A 2KONA 2RSMA 1G2DC 2K7IA 2UUAE 2ENHA 5LLQA 1X6EA 2JVAA 5CFFE 2JYAA 1MEYC 3ADLA 5AE2A 2EPOA 2EPZA 2YTGA 4B3RE 2EOXA 2EL4A 1T39A 4B3ME 4TUIA 1T4OA 2I9IA 1IBKE 1ZR9A 2V89A 2M1SA 4KWYA 4GZNC 5FLXC 3BIDA 3T1YE 1WRJA 2MDRA 1NEIA 4N4RB 2MDGA 3IWDA 4R8OA 4DR6E 3KZZA 2L2MA 2ELZA 2WZOA 2DLKA 5LL6R 3P1XA 2EE8A 3BF2A 2L6MA 2EM3A 2ADRA 4NXME 4KZSA 4R2EA 2NUFA 1A1LA 4GEQB 3DJWA 2B7VA 1FKAE 1SR9A 1NCSA 2LBSB 1MGTA 4JI8E 3QG5C 4O24A 4MLVA 2EL5A 4JI6E 2WBSA 1N33E 2JXPA 2CSHA 4L5NC 4BHBA 1EH7A 2DGCA 5A6BD 2EM2A 1HNXE 2LVHA 2KHXA 2EPUA 2GHFA 2EOJA 2EPRA 2EPNA 2LJUA 2I13A 1IMUA 1A1GA 2EOEA 2VQEE 2RPCA 4L8NA 2YTDA 1HNZE 3VYYA 1N36E 5IWAE 4AQYE 2MC5A 1F2IG 1YYOA 2LUQA 2EOSA 3LLHA 4WFTA 1BBOA 1AH5A 2ENCA 5A69A 1GQEA 4X9JA 3EPKA 3VHTB 4WXCA 3C6MA 1I94E 1PJQA 1WXRA 3BGHA 3J80C 2EPKX 1RC7A 2EN6A 2FTXB 5KL2A 2EMLA 2HHHE 3JTZA 4WSPA 2ODRC 2EOQA 4HEIA 2DSYA 3IWCA 4DV7E 2NUEA 4M30A 1XNRE 2N8XA 2JPAA 2UXDE 4DV5E 4O5GA 1N32E 4LF8E 2RTXA 2CTDA 2EMKA 1T38A 2BB8A 1X47A 1WHNA 1PJSA 1A1JA 3KZYA 4B3SE 2DB2A 1PJTA 5DNYA 4X62E 2ELYA 1X3CA 4M0VA 1EH8A 1HNWE 2EM6A 4NZVA 2UXBE 2MKNA 4JI7E 2EPAA 2EPXA 5AE3A 2K4VA 2CPNA 3T1HE 2YTOA 3AUZA 4P78A 3J7AG 1WJPA 5AASA 4X66E 1UHZA 1WHQA 2YT4A 3HPSA 2L2KB 1ZAAC 3F6GA
chains in the Genus database with same CATH topology
2YWQA 4HEIA 3TQMA 2RQLA 1IMUA 1L4SA 1N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWQ A;  4HEI A;  3TQM A;  2RQL A;  1IMU A;  1L4S A;  1N3G A; 
#chains in the Genus database with same CATH topology
 1LLM C;  1DI2 A;  2LO3 A;  5A6J A;  5LMN E;  3K6Q A;  2EOF A;  2N3G A;  1A1K A;  1UN6 B;  4R2C A;  4JI5 E;  2YSP A;  2EM5 A;  2EMF A;  2JOX A;  2EN2 A;  2EMI A;  2EOM A;  4MLQ A;  2YTJ A;  2EQ1 A;  2YRK A;  5AC4 A;  4LFB E;  2B7T A;  2EPP A;  2G7H A;  4LF7 E;  4R2S A;  4DV1 E;  1UBD C;  4DV0 E;  4LU9 A;  3DF6 A;  2EWL A;  1IBL E;  2UUB E;  2MC6 A;  4GKK E;  3THO B;  2HC5 A;  1A1I A;  2R1F A;  1X49 A;  2EQ0 A;  2D9H A;  4RH8 A;  4LF9 E;  4WSG A;  2YRM A;  1YZ9 A;  1DQ3 A;  4ZYH A;  4FK5 C;  5AC5 A;  4BS9 A;  2H36 X;  4I8O A;  2V87 A;  4P7D A;  4R2Q A;  2UXC E;  3C6K A;  1JK1 A;  3MHH C;  2EMG A;  2Q8U A;  5A6A A;  4F54 A;  1YUJ A;  2JOB A;  4BMJ A;  1T4N A;  4JI1 E;  2LMZ A;  4DR2 E;  4Q28 A;  1IQO A;  3ADJ A;  2DMY A;  1GZ6 A;  1GTK A;  1HR0 E;  2B3T B;  2M7Q A;  2LT7 A;  3MSW A;  3RMP A;  4BCA A;  2LUP B;  2EQ3 A;  2DRP A;  2RQL A;  3L00 A;  2YU8 A;  2VF1 A;  1X5W A;  2YTI A;  4R03 A;  4F6M A;  1RQ0 A;  2GPI A;  2A25 A;  2EMA A;  3HXL A;  3HPZ A;  2L3C A;  2YTF A;  3ZOQ B;  2EMB A;  3THN A;  2EM9 A;  1ZBQ A;  2YPN A;  4LF5 E;  2IHR 1;  5TSE A;  2EMY A;  2M4I A;  3LML A;  4ZYD A;  4R2R A;  1G2F C;  4R2A A;  2EMX A;  2LRS A;  1PDA A;  4LTY A;  4YHH E;  2JWO A;  2V88 A;  2EM8 A;  4LF6 E;  3J81 C;  2EN7 A;  3UK3 C;  2EM0 A;  3VK6 A;  2VQF E;  5F3W A;  4DV2 E;  4DUY E;  1IQS A;  2YRH A;  2YTQ A;  5A2Q C;  2EMH A;  2WCC 3;  1YSA C;  1ZBT A;  4NHR A;  5KL5 A;  3EPH A;  4WXD A;  1XNQ E;  4F2J C;  2BBG A;  4O43 A;  4F9B B;  2ENA A;  1YYW A;  4WPY A;  2NAB A;  2EN4 A;  2EJ4 A;  3OTO E;  3JU0 A;  1Z1B A;  4DUZ E;  4Q35 B;  1N3G A;  2R76 A;  2YZT A;  3JAM C;  5AE1 A;  4DV6 E;  5KL3 A;  2KOU A;  5KL6 A;  2DIX A;  3J7Y p;  4F6N A;  2JP9 A;  5IV8 B;  2L2N A;  4R2P A;  4J8Z A;  1XMO E;  1N34 E;  2YTE A;  4IS1 C;  4F9C B;  2F8B A;  1X6F A;  1KYQ A;  5LMU E;  3TQM A;  4DV3 E;  2YTN A;  1EH6 A;  1P47 A;  2EN8 A;  3KWR A;  2L33 A;  2EOZ A;  2LTS A;  4X65 E;  2JR1 A;  4OOG C;  4JI4 E;  2NA2 A;  4JYA E;  2EN1 A;  3EQ1 A;  4WYQ B;  1YFH A;  2EZ6 A;  4X8W A;  2E72 A;  2LCE A;  4HTG A;  1PKP A;  2V86 A;  4M9V C;  3ADG A;  4BC9 A;  2RS6 A;  4DR3 E;  1BBG A;  4ZYE A;  2EMW A;  2FGG A;  5A6B A;  2EN3 A;  5KL7 A;  2CT1 A;  2EPM X;  4X64 E;  1XMQ E;  5IT9 C;  1SFE A;  2LTR A;  2YTP A;  1JK2 A;  1IBM E;  2YSO A;  1FJG E;  3HTX A;  2EP3 A;  3EPL A;  2N3H A;  5IXM B;  1X6H A;  2EOO A;  3MHS C;  2LE2 A;  1X48 A;  2VE7 C;  4KHP E;  4O4K A;  1STU A;  2RS7 A;  5T6J A;  4BC7 A;  4M2Z A;  4R2D A;  1YPN A;  2B9D A;  2ODR D;  1YUI A;  4JI3 E;  2EMZ A;  2EOR A;  3C4T A;  2YU5 A;  2EOH A;  5BR8 E;  2MKD A;  3IWB A;  1EKZ A;  2JY9 A;  2E5L E;  1T4L B;  1KJK A;  2FV4 B;  2V8Q B;  1YYK A;  1B69 A;  2LV2 A;  3VYX A;  4ZYG A;  3AV0 A;  4RHB B;  2EL6 A;  2L3J A;  1ZU1 A;  2EM4 A;  2WBT A;  4DR7 E;  4GKJ E;  3F6H A;  2EOY A;  4DMI A;  4DR5 E;  1RMD A;  3HQ1 A;  2EPL X;  1L4S A;  2ZM6 E;  2EPC A;  4BHC A;  2HGH A;  4IJD A;  1A1F A;  4B3T E;  1TF6 A;  4TUG A;  4F9A B;  1BB8 A;  2J7J A;  1O0W A;  4NXN E;  1QU6 A;  1UIL A;  2UU9 E;  5KL4 A;  2EOI A;  3OML A;  2V83 A;  3H09 A;  1A1H A;  4K0K E;  2VRD A;  2UUC E;  4JI0 E;  2EMC A;  2DLQ A;  2NUG A;  1J5E E;  1J26 A;  2L92 A;  5A6K A;  4JV5 E;  1DGC A;  1TN9 A;  2E1M A;  2PRT A;  2RSI A;  4LFA E;  4LFC E;  4DR4 E;  2M9A A;  3M99 B;  2YWQ A;  1AAY A;  2WBU A;  4LF4 E;  4DV4 E;  2L8T A;  3EPJ A;  2V85 A;  2LJH A;  2GLI A;  2HJJ A;  4OX9 E;  2DMI A;  3BBG A;  4JI2 E;  3C4B A;  4DKK A;  5ADZ A;  3FIG A;  3ECR A;  2F4V E;  4YY3 E;  4WX9 A;  2EM7 A;  3ADI A;  4BBY A;  4DR1 E;  1QNT A;  1TF3 A;  2KON A;  2RSM A;  1G2D C;  2K7I A;  2UUA E;  2ENH A;  5LLQ A;  1X6E A;  2JVA A;  5CFF E;  2JYA A;  1MEY C;  3ADL A;  5AE2 A;  2EPO A;  2EPZ A;  2YTG A;  4B3R E;  2EOX A;  2EL4 A;  1T39 A;  4B3M E;  4TUI A;  1T4O A;  2I9I A;  1IBK E;  1ZR9 A;  2V89 A;  2M1S A;  4KWY A;  4GZN C;  5FLX C;  3BID A;  3T1Y E;  1WRJ A;  2MDR A;  1NEI A;  4N4R B;  2MDG A;  3IWD A;  4R8O A;  4DR6 E;  3KZZ A;  2L2M A;  2ELZ A;  2WZO A;  2DLK A;  5LL6 R;  3P1X A;  2EE8 A;  3BF2 A;  2L6M A;  2EM3 A;  2ADR A;  4NXM E;  4KZS A;  4R2E A;  2NUF A;  1A1L A;  4GEQ B;  3DJW A;  2B7V A;  1FKA E;  1SR9 A;  1NCS A;  2LBS B;  1MGT A;  4JI8 E;  3QG5 C;  4O24 A;  4MLV A;  2EL5 A;  4JI6 E;  2WBS A;  1N33 E;  2JXP A;  2CSH A;  4L5N C;  4BHB A;  1EH7 A;  2DGC A;  5A6B D;  2EM2 A;  1HNX E;  2LVH A;  2KHX A;  2EPU A;  2GHF A;  2EOJ A;  2EPR A;  2EPN A;  2LJU A;  2I13 A;  1IMU A;  1A1G A;  2EOE A;  2VQE E;  2RPC A;  4L8N A;  2YTD A;  1HNZ E;  3VYY A;  1N36 E;  5IWA E;  4AQY E;  2MC5 A;  1F2I G;  1YYO A;  2LUQ A;  2EOS A;  3LLH A;  4WFT A;  1BBO A;  1AH5 A;  2ENC A;  5A69 A;  1GQE A;  4X9J A;  3EPK A;  3VHT B;  4WXC A;  3C6M A;  1I94 E;  1PJQ A;  1WXR A;  3BGH A;  3J80 C;  2EPK X;  1RC7 A;  2EN6 A;  2FTX B;  5KL2 A;  2EML A;  2HHH E;  3JTZ A;  4WSP A;  2ODR C;  2EOQ A;  4HEI A;  2DSY A;  3IWC A;  4DV7 E;  2NUE A;  4M30 A;  1XNR E;  2N8X A;  2JPA A;  2UXD E;  4DV5 E;  4O5G A;  1N32 E;  4LF8 E;  2RTX A;  2CTD A;  2EMK A;  1T38 A;  2BB8 A;  1X47 A;  1WHN A;  1PJS A;  1A1J A;  3KZY A;  4B3S E;  2DB2 A;  1PJT A;  5DNY A;  4X62 E;  2ELY A;  1X3C A;  4M0V A;  1EH8 A;  1HNW E;  2EM6 A;  4NZV A;  2UXB E;  2MKN A;  4JI7 E;  2EPA A;  2EPX A;  5AE3 A;  2K4V A;  2CPN A;  3T1H E;  2YTO A;  3AUZ A;  4P78 A;  3J7A G;  1WJP A;  5AAS A;  4X66 E;  1UHZ A;  1WHQ A;  2YT4 A;  3HPS A;  2L2K B;  1ZAA C;  3F6G A; 
#chains in the Genus database with same CATH homology
 2YWQ A;  4HEI A;  3TQM A;  2RQL A;  1IMU A;  1L4S A;  1N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...