4F9BB

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
90
Chain Sequence
b'RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 16
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9bB02
4F9BB 4F9AB 4F9CB
chains in the Genus database with same CATH superfamily
4F6NA 4DR5E 1AAYA 1YUIA 5ADZA 1YYWA 4FK5C 4MLQA 2B7TA 4M2ZA 3H09A 1WRJA 2V86A 2Q8UA 1BB8A 1PJTA 1EH8A 3EPJA 1DGCA 2YWQA 1A1FA 5KL6A 4R2SA 2L2NA 3KZZA 2L3JA 1IMUA 4O4KA 3ADGA 1XMOE 4RH8A 2EOQA 2J7JA 2NABA 2N3HA 2YSPA 4I8OA 4DV3E 4MLVA 5CFFE 3AUZA 2EPUA 2M1SA 2EOFA 4DV4E 2B7VA 4NHRA 4LF7E 2EOSA 2MDRA 1WHQA 2EQ3A 5AE1A 2V89A 1WXRA 2L92A 5LMNE 2K4VA 1UILA 1N34E 4F9BB 2EM4A 3J7Yp 2YU5A 2JWOA 1WJPA 2FV4B 1YYKA 2GPIA 4O43A 4J8ZA 2WBSA 2EPLX 2VF1A 2RQLA 2BBGA 2YTDA 3FIGA 5KL2A 2UU9E 2RS6A 2I9IA 2DLQA 4P78A 1ZR9A 3EPHA 4LU9A 1A1JA 2EMLA 5KL4A 5LMUE 3ADLA 2V88A 2D9HA 4IJDA 5DNYA 5FLXC 1KYQA 1J26A 2JYAA 4Q28A 1G2DC 1MEYC 4BC9A 2ODRD 3M99B 2JOBA 4BBYA 3KZYA 1YFHA 3DF6A 2B9DA 2EPNA 2YRHA 3T1YE 4JI3E 2EPCA 2EL6A 4R2AA 2YTNA 2EN6A 3OMLA 4OX9E 1SR9A 5IT9C 4DV6E 3HPSA 3VYXA 1LLMC 1YSAC 2NUGA 2EOHA 1X49A 2GHFA 2MC6A 4HTGA 2ENCA 2RSIA 4ZYHA 2EOIA 4X62E 2ADRA 3ADJA 4LFAE 4JI6E 1IBKE 1UBDC 4LF8E 2WBTA 2VQFE 3IWBA 1HNZE 2R76A 5AC4A 1N36E 2EJ4A 3EPKA 2K7IA 2N8XA 2EOMA 4BC7A 4KHPE 3HXLA 1G2FC 2DIXA 2IHR1 2EMIA 4L8NA 1ZU1A 2B3TB 2UUAE 1YPNA 1T4NA 4GEQB 2VQEE 1A1KA 3T1HE 1IBME 4BS9A 3J81C 2EMCA 3C6MA 4LFCE 1XNRE 3C6KA 2YTOA 2EMFA 3J80C 3VYYA 4R2QA 2DRPA 2EP3A 4DR4E 2YTJA 5A6KA 1N3GA 1X47A 3THOB 2EE8A 4JI4E 2LJUA 1RMDA 2YZTA 2YRMA 5F3WA 2YTIA 2RTXA 1X6EA 2ENHA 5KL3A 4LF9E 2LMZA 3MSWA 2L33A 5T6JA 5AE3A 2E5LE 4O24A 4X8WA 2M9AA 3L00A 2CPNA 2EOXA 1X6HA 2DMYA 3BIDA 4M9VC 4DR1E 2G7HA 2DLKA 3K6QA 4WSGA 4NZVA 4B3ME 2EM0A 3HQ1A 4F54A 4N4RB 5LL6R 2EM3A 2EMWA 2EPKX 4DV2E 5A6BD 2MKDA 3P1XA 1TN9A 1BBOA 2EOEA 2LO3A 2EPRA 3JU0A 1PDAA 2EZ6A 4R03A 4LF6E 2L3CA 1F2IG 1ZBQA 1ZAAC 2YRKA 2LUPB 4R2PA 2WZOA 1O0WA 4DMIA 2MC5A 2LVHA 1YYOA 4Q35B 1I94E 4X64E 2EQ1A 5AE2A 5IV8B 1AH5A 1X6FA 2VRDA 1YUJA 1UN6B 3EPLA 2YTGA 1EH6A 2EMAA 2JXPA 1X48A 2LTRA 2GLIA 2JP9A 2EPZA 2NA2A 4YY3E 2PRTA 2JOXA 4R8OA 4JI7E 4R2EA 2ODRC 1T4OA 2HGHA 2LT7A 1N32E 5LLQA 4JI1E 1GTKA 2KHXA 1STUA 3THNA 2EMYA 2E72A 1PJSA 4LF4E 2R1FA 2EN3A 1KJKA 1EH7A 1PKPA 4TUIA 4B3TE 1YZ9A 2EM6A 1UHZA 4DUZE 2V87A 1HR0E 2EOZA 2UUBE 2KONA 5BR8E 2EN7A 5IXMB 3J7AG 2BB8A 2EN1A 1JK2A 1NEIA 4K0KE 4ZYEA 2EWLA 2LBSB 2EOJA 5KL7A 4DR6E 3DJWA 3C4TA 2EMHA 1P47A 4YHHE 4BCAA 4R2DA 3MHHC 5AASA 1NCSA 2ENAA 2MDGA 5A69A 2VE7C 2DGCA 2EM7A 2NUFA 4LTYA 2LE2A 1T4LB 4AQYE 3JAMC 5KL5A 4BHCA 1QNTA 2KOUA 4JV5E 2EMZA 3ADIA 2CSHA 4DV5E 2EOOA 4TUGA 3QG5C 4KWYA 4X65E 4GKKE 4P7DA 4DV0E 2JPAA 1A1GA 2FGGA 4IS1C 4F2JC 2LJHA 1QU6A 1JK1A 4GKJE 2LRSA 4R2CA 5IWAE 4DV1E 3KWRA 2L6MA 2EPPA 1X5WA 2NUEA 1EKZA 2EM2A 2FTXB 2V8QB 2MKNA 3C4BA 3F6HA 2H36X 1IBLE 4DUYE 4WPYA 4B3RE 2YTPA 2A25A 3UK3C 2UXDE 2EL4A 2EM9A 2F4VE 2ZM6E 1PJQA 2YTQA 2ELZA 1B69A 2M4IA 4R2RA 2EMKA 2LTSA 1TF3A 2EM5A 1XMQE 1DI2A 4DV7E 2L2KB 1IQSA 2EPAA 3OTOE 4DR3E 5A6BA 2DSYA 2UUCE 4JI8E 2YPNA 4X66E 1TF6A 1A1IA 3ECRA 4WXDA 1FKAE 2EMGA 2EMXA 4WSPA 2EPMX 2YT4A 4F9CB 1IQOA 4RHBB 5A6AA 5TSEA 2LV2A 2HHHE 3BBGA 2N3GA 3JTZA 1RQ0A 4X9JA 3BGHA 2HC5A 2V85A 4LFBE 2LCEA 1T38A 1HNWE 2EMBA 4F9AB 4DKKA 2EORA 4NXME 2M7QA 2EN2A 2RPCA 4JI0E 2JY9A 3TQMA 4B3SE 2WBUA 2RS7A 4KZSA 3ZOQB 3VK6A 1GQEA 3IWCA 1X3CA 1ZBTA 2EOYA 4ZYDA 4F6MA 1A1HA 2EPXA 4GZNC 3VHTB 1J5EE 2CTDA 4HEIA 1N33E 3HPZA 2EN4A 1L4SA 4WX9A 1RC7A 5A2QC 2UXCE 2JVAA 4DR7E 1A1LA 4BHBA 2EL5A 1DQ3A 1MGTA 4M30A 2DMIA 2HJJA 1T39A 4M0VA 2L2MA 2LUQA 1WHNA 2YTEA 3IWDA 4JI5E 2EPOA 4JI2E 1SFEA 1FJGE 3AV0A 1Z1BA 4DR2E 4WXCA 3BF2A 4L5NC 3HTXA 1HNXE 2I13A 4NXNE 3LLHA 2DB2A 2F8BA 1BBGA 4ZYGA 2EM8A 4OOGC 2L8TA 2ELYA 4WYQB 5A6JA 4JYAE 4WFTA 2EN8A 2RSMA 4BMJA 3MHSC 2CT1A 1XNQE 1GZ6A 5AC5A 2YU8A 4O5GA 2YSOA 3LMLA 2YTFA 2EQ0A 3EQ1A 4LF5E 2E1MA 3RMPA 2WCC3 2UXBE 3F6GA 2V83A 2JR1A
chains in the Genus database with same CATH topology
2MC6A 2M4IA 2NA2A 4DR5E 4YY3E 4X62E 2LTSA 3ADJA 1XMQE 4LFAE 2JOXA 5ADZA 4JI6E 4R8OA 4JI7E 1IBKE 2ODRC 4DV7E 1YYWA 1DI2A 2L2KB 1T4OA 4LF8E 3OTOE 2VQFE 4DR3E 2B7TA 4M2ZA 3H09A 3IWBA 1HNZE 2DSYA 1N32E 1N36E 2V86A 4BC7A 4JI8E 4X66E 2UUCE 4KHPE 4JI1E 2KHXA 1STUA 3HXLA 2DIXA 2IHR1 1FKAE 4L8NA 4WSPA 4LF4E 2YT4A 2B3TB 2L2NA 4F9CB 2L3JA 2UUAE 1PKPA 1T4NA 4GEQB 4TUIA 2VQEE 2N3GA 3JTZA 2HHHE 3T1HE 1UHZA 4DUZE 3ADGA 1XMOE 1RQ0A 2V87A 1IBME 1HR0E 4BS9A 3J81C 2V85A 2UUBE 4LFCE 1XNRE 2KONA 2N3HA 4I8OA 5BR8E 4LFBE 3J80C 3J7AG 3VYYA 1HNWE 4DV3E 4F9AB 4DR4E 4DKKA 4NXME 2M7QA 5CFFE 4JI0E 1X47A 2JY9A 3AUZA 4JI4E 2M1SA 4B3SE 4K0KE 1YZ9A 2EWLA 2YZTA 2RS7A 4KZSA 2LBSB 3ZOQB 2B7VA 1GQEA 3VK6A 4DV4E 5F3WA 4DR6E 3DJWA 4LF7E 2RTXA 1ZBTA 3IWCA 3C4TA 1J5EE 2MDRA 4YHHE 4BCAA 1WHQA 5AE1A 1N33E 2V89A 3HPZA 1WXRA 2L92A 4LF9E 4B3TE 5AASA 5LMNE 1RC7A 2LMZA 2K4VA 1UILA 3MSWA 1N34E 2VE7C 4F9BB 5A2QC 2L33A 5T6JA 2UXCE 5AE3A 3J7Yp 2E5LE 4LTYA 2NUFA 2JWOA 2LE2A 4X8WA 4AQYE 2FV4B 1T4LB 1YYKA 2JVAA 4DR7E 3JAMC 2CPNA 4J8ZA 2DMYA 1DQ3A 2VF1A 2ZM6E 4M30A 2KOUA 2G7HA 4DR1E 4JV5E 4M0VA 2L2MA 3K6QA 2LUQA 3FIGA 3ADIA 1WHNA 4DV5E 2RS6A 3IWDA 2UU9E 4JI5E 4P78A 4B3ME 4TUGA 4JI2E 1FJGE 4LU9A 3AV0A 4P7DA 4X65E 4GKKE 4DV0E 4DR2E 3HQ1A 4F54A 4JYAE 4L5NC 5LL6R 2FGGA 5LMUE 3HTXA 4DV2E 1HNXE 3ADLA 2V88A 4NXNE 2LJHA 5DNYA 5FLXC 3LLHA 3P1XA 4LF6E 1QU6A 2DB2A 2F8BA 4GKJE 1J26A 2LRSA 3JU0A 4Q28A 4OOGC 2L8TA 2EZ6A 4R03A 4WYQB 4BC9A 5IWAE 2L3CA 2ODRD 1ZBQA 4WFTA 4DV1E 2JOBA 2L6MA 3KWRA 4BBYA 2LUPB 2WZOA 1O0WA 4DMIA 2MC5A 2RSMA 1YYOA 1EKZA 2NUEA 2FTXB 2V8QB 4BMJA 3DF6A 2B9DA 4X64E 1I94E 1XNQE 3C4BA 3T1YE 4JI3E 1GZ6A 5AE2A 3F6HA 2H36X 3LMLA 1IBLE 4DUYE 3OMLA 4WPYA 4B3RE 4OX9E 1SR9A 5IT9C 2UXDE 4DV6E 3HPSA 2F4VE 4LF5E 3VYXA 2E1MA 3RMPA 2NUGA 2UXBE 3F6GA 2V83A 2JR1A 1X48A 1X49A 2LTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9A B;  4F9C B; 
#chains in the Genus database with same CATH topology
 4F6N A;  4DR5 E;  1AAY A;  1YUI A;  5ADZ A;  1YYW A;  4FK5 C;  4MLQ A;  2B7T A;  4M2Z A;  3H09 A;  1WRJ A;  2V86 A;  2Q8U A;  1BB8 A;  1PJT A;  1EH8 A;  3EPJ A;  1DGC A;  2YWQ A;  1A1F A;  5KL6 A;  4R2S A;  2L2N A;  3KZZ A;  2L3J A;  1IMU A;  4O4K A;  3ADG A;  1XMO E;  4RH8 A;  2EOQ A;  2J7J A;  2NAB A;  2N3H A;  2YSP A;  4I8O A;  4DV3 E;  4MLV A;  5CFF E;  3AUZ A;  2EPU A;  2M1S A;  2EOF A;  4DV4 E;  2B7V A;  4NHR A;  4LF7 E;  2EOS A;  2MDR A;  1WHQ A;  2EQ3 A;  5AE1 A;  2V89 A;  1WXR A;  2L92 A;  5LMN E;  2K4V A;  1UIL A;  1N34 E;  4F9B B;  2EM4 A;  3J7Y p;  2YU5 A;  2JWO A;  1WJP A;  2FV4 B;  1YYK A;  2GPI A;  4O43 A;  4J8Z A;  2WBS A;  2EPL X;  2VF1 A;  2RQL A;  2BBG A;  2YTD A;  3FIG A;  5KL2 A;  2UU9 E;  2RS6 A;  2I9I A;  2DLQ A;  4P78 A;  1ZR9 A;  3EPH A;  4LU9 A;  1A1J A;  2EML A;  5KL4 A;  5LMU E;  3ADL A;  2V88 A;  2D9H A;  4IJD A;  5DNY A;  5FLX C;  1KYQ A;  1J26 A;  2JYA A;  4Q28 A;  1G2D C;  1MEY C;  4BC9 A;  2ODR D;  3M99 B;  2JOB A;  4BBY A;  3KZY A;  1YFH A;  3DF6 A;  2B9D A;  2EPN A;  2YRH A;  3T1Y E;  4JI3 E;  2EPC A;  2EL6 A;  4R2A A;  2YTN A;  2EN6 A;  3OML A;  4OX9 E;  1SR9 A;  5IT9 C;  4DV6 E;  3HPS A;  3VYX A;  1LLM C;  1YSA C;  2NUG A;  2EOH A;  1X49 A;  2GHF A;  2MC6 A;  4HTG A;  2ENC A;  2RSI A;  4ZYH A;  2EOI A;  4X62 E;  2ADR A;  3ADJ A;  4LFA E;  4JI6 E;  1IBK E;  1UBD C;  4LF8 E;  2WBT A;  2VQF E;  3IWB A;  1HNZ E;  2R76 A;  5AC4 A;  1N36 E;  2EJ4 A;  3EPK A;  2K7I A;  2N8X A;  2EOM A;  4BC7 A;  4KHP E;  3HXL A;  1G2F C;  2DIX A;  2IHR 1;  2EMI A;  4L8N A;  1ZU1 A;  2B3T B;  2UUA E;  1YPN A;  1T4N A;  4GEQ B;  2VQE E;  1A1K A;  3T1H E;  1IBM E;  4BS9 A;  3J81 C;  2EMC A;  3C6M A;  4LFC E;  1XNR E;  3C6K A;  2YTO A;  2EMF A;  3J80 C;  3VYY A;  4R2Q A;  2DRP A;  2EP3 A;  4DR4 E;  2YTJ A;  5A6K A;  1N3G A;  1X47 A;  3THO B;  2EE8 A;  4JI4 E;  2LJU A;  1RMD A;  2YZT A;  2YRM A;  5F3W A;  2YTI A;  2RTX A;  1X6E A;  2ENH A;  5KL3 A;  4LF9 E;  2LMZ A;  3MSW A;  2L33 A;  5T6J A;  5AE3 A;  2E5L E;  4O24 A;  4X8W A;  2M9A A;  3L00 A;  2CPN A;  2EOX A;  1X6H A;  2DMY A;  3BID A;  4M9V C;  4DR1 E;  2G7H A;  2DLK A;  3K6Q A;  4WSG A;  4NZV A;  4B3M E;  2EM0 A;  3HQ1 A;  4F54 A;  4N4R B;  5LL6 R;  2EM3 A;  2EMW A;  2EPK X;  4DV2 E;  5A6B D;  2MKD A;  3P1X A;  1TN9 A;  1BBO A;  2EOE A;  2LO3 A;  2EPR A;  3JU0 A;  1PDA A;  2EZ6 A;  4R03 A;  4LF6 E;  2L3C A;  1F2I G;  1ZBQ A;  1ZAA C;  2YRK A;  2LUP B;  4R2P A;  2WZO A;  1O0W A;  4DMI A;  2MC5 A;  2LVH A;  1YYO A;  4Q35 B;  1I94 E;  4X64 E;  2EQ1 A;  5AE2 A;  5IV8 B;  1AH5 A;  1X6F A;  2VRD A;  1YUJ A;  1UN6 B;  3EPL A;  2YTG A;  1EH6 A;  2EMA A;  2JXP A;  1X48 A;  2LTR A;  2GLI A;  2JP9 A;  2EPZ A;  2NA2 A;  4YY3 E;  2PRT A;  2JOX A;  4R8O A;  4JI7 E;  4R2E A;  2ODR C;  1T4O A;  2HGH A;  2LT7 A;  1N32 E;  5LLQ A;  4JI1 E;  1GTK A;  2KHX A;  1STU A;  3THN A;  2EMY A;  2E72 A;  1PJS A;  4LF4 E;  2R1F A;  2EN3 A;  1KJK A;  1EH7 A;  1PKP A;  4TUI A;  4B3T E;  1YZ9 A;  2EM6 A;  1UHZ A;  4DUZ E;  2V87 A;  1HR0 E;  2EOZ A;  2UUB E;  2KON A;  5BR8 E;  2EN7 A;  5IXM B;  3J7A G;  2BB8 A;  2EN1 A;  1JK2 A;  1NEI A;  4K0K E;  4ZYE A;  2EWL A;  2LBS B;  2EOJ A;  5KL7 A;  4DR6 E;  3DJW A;  3C4T A;  2EMH A;  1P47 A;  4YHH E;  4BCA A;  4R2D A;  3MHH C;  5AAS A;  1NCS A;  2ENA A;  2MDG A;  5A69 A;  2VE7 C;  2DGC A;  2EM7 A;  2NUF A;  4LTY A;  2LE2 A;  1T4L B;  4AQY E;  3JAM C;  5KL5 A;  4BHC A;  1QNT A;  2KOU A;  4JV5 E;  2EMZ A;  3ADI A;  2CSH A;  4DV5 E;  2EOO A;  4TUG A;  3QG5 C;  4KWY A;  4X65 E;  4GKK E;  4P7D A;  4DV0 E;  2JPA A;  1A1G A;  2FGG A;  4IS1 C;  4F2J C;  2LJH A;  1QU6 A;  1JK1 A;  4GKJ E;  2LRS A;  4R2C A;  5IWA E;  4DV1 E;  3KWR A;  2L6M A;  2EPP A;  1X5W A;  2NUE A;  1EKZ A;  2EM2 A;  2FTX B;  2V8Q B;  2MKN A;  3C4B A;  3F6H A;  2H36 X;  1IBL E;  4DUY E;  4WPY A;  4B3R E;  2YTP A;  2A25 A;  3UK3 C;  2UXD E;  2EL4 A;  2EM9 A;  2F4V E;  2ZM6 E;  1PJQ A;  2YTQ A;  2ELZ A;  1B69 A;  2M4I A;  4R2R A;  2EMK A;  2LTS A;  1TF3 A;  2EM5 A;  1XMQ E;  1DI2 A;  4DV7 E;  2L2K B;  1IQS A;  2EPA A;  3OTO E;  4DR3 E;  5A6B A;  2DSY A;  2UUC E;  4JI8 E;  2YPN A;  4X66 E;  1TF6 A;  1A1I A;  3ECR A;  4WXD A;  1FKA E;  2EMG A;  2EMX A;  4WSP A;  2EPM X;  2YT4 A;  4F9C B;  1IQO A;  4RHB B;  5A6A A;  5TSE A;  2LV2 A;  2HHH E;  3BBG A;  2N3G A;  3JTZ A;  1RQ0 A;  4X9J A;  3BGH A;  2HC5 A;  2V85 A;  4LFB E;  2LCE A;  1T38 A;  1HNW E;  2EMB A;  4F9A B;  4DKK A;  2EOR A;  4NXM E;  2M7Q A;  2EN2 A;  2RPC A;  4JI0 E;  2JY9 A;  3TQM A;  4B3S E;  2WBU A;  2RS7 A;  4KZS A;  3ZOQ B;  3VK6 A;  1GQE A;  3IWC A;  1X3C A;  1ZBT A;  2EOY A;  4ZYD A;  4F6M A;  1A1H A;  2EPX A;  4GZN C;  3VHT B;  1J5E E;  2CTD A;  4HEI A;  1N33 E;  3HPZ A;  2EN4 A;  1L4S A;  4WX9 A;  1RC7 A;  5A2Q C;  2UXC E;  2JVA A;  4DR7 E;  1A1L A;  4BHB A;  2EL5 A;  1DQ3 A;  1MGT A;  4M30 A;  2DMI A;  2HJJ A;  1T39 A;  4M0V A;  2L2M A;  2LUQ A;  1WHN A;  2YTE A;  3IWD A;  4JI5 E;  2EPO A;  4JI2 E;  1SFE A;  1FJG E;  3AV0 A;  1Z1B A;  4DR2 E;  4WXC A;  3BF2 A;  4L5N C;  3HTX A;  1HNX E;  2I13 A;  4NXN E;  3LLH A;  2DB2 A;  2F8B A;  1BBG A;  4ZYG A;  2EM8 A;  4OOG C;  2L8T A;  2ELY A;  4WYQ B;  5A6J A;  4JYA E;  4WFT A;  2EN8 A;  2RSM A;  4BMJ A;  3MHS C;  2CT1 A;  1XNQ E;  1GZ6 A;  5AC5 A;  2YU8 A;  4O5G A;  2YSO A;  3LML A;  2YTF A;  2EQ0 A;  3EQ1 A;  4LF5 E;  2E1M A;  3RMP A;  2WCC 3;  2UXB E;  3F6G A;  2V83 A;  2JR1 A; 
#chains in the Genus database with same CATH homology
 2MC6 A;  2M4I A;  2NA2 A;  4DR5 E;  4YY3 E;  4X62 E;  2LTS A;  3ADJ A;  1XMQ E;  4LFA E;  2JOX A;  5ADZ A;  4JI6 E;  4R8O A;  4JI7 E;  1IBK E;  2ODR C;  4DV7 E;  1YYW A;  1DI2 A;  2L2K B;  1T4O A;  4LF8 E;  3OTO E;  2VQF E;  4DR3 E;  2B7T A;  4M2Z A;  3H09 A;  3IWB A;  1HNZ E;  2DSY A;  1N32 E;  1N36 E;  2V86 A;  4BC7 A;  4JI8 E;  4X66 E;  2UUC E;  4KHP E;  4JI1 E;  2KHX A;  1STU A;  3HXL A;  2DIX A;  2IHR 1;  1FKA E;  4L8N A;  4WSP A;  4LF4 E;  2YT4 A;  2B3T B;  2L2N A;  4F9C B;  2L3J A;  2UUA E;  1PKP A;  1T4N A;  4GEQ B;  4TUI A;  2VQE E;  2N3G A;  3JTZ A;  2HHH E;  3T1H E;  1UHZ A;  4DUZ E;  3ADG A;  1XMO E;  1RQ0 A;  2V87 A;  1IBM E;  1HR0 E;  4BS9 A;  3J81 C;  2V85 A;  2UUB E;  4LFC E;  1XNR E;  2KON A;  2N3H A;  4I8O A;  5BR8 E;  4LFB E;  3J80 C;  3J7A G;  3VYY A;  1HNW E;  4DV3 E;  4F9A B;  4DR4 E;  4DKK A;  4NXM E;  2M7Q A;  5CFF E;  4JI0 E;  1X47 A;  2JY9 A;  3AUZ A;  4JI4 E;  2M1S A;  4B3S E;  4K0K E;  1YZ9 A;  2EWL A;  2YZT A;  2RS7 A;  4KZS A;  2LBS B;  3ZOQ B;  2B7V A;  1GQE A;  3VK6 A;  4DV4 E;  5F3W A;  4DR6 E;  3DJW A;  4LF7 E;  2RTX A;  1ZBT A;  3IWC A;  3C4T A;  1J5E E;  2MDR A;  4YHH E;  4BCA A;  1WHQ A;  5AE1 A;  1N33 E;  2V89 A;  3HPZ A;  1WXR A;  2L92 A;  4LF9 E;  4B3T E;  5AAS A;  5LMN E;  1RC7 A;  2LMZ A;  2K4V A;  1UIL A;  3MSW A;  1N34 E;  2VE7 C;  4F9B B;  5A2Q C;  2L33 A;  5T6J A;  2UXC E;  5AE3 A;  3J7Y p;  2E5L E;  4LTY A;  2NUF A;  2JWO A;  2LE2 A;  4X8W A;  4AQY E;  2FV4 B;  1T4L B;  1YYK A;  2JVA A;  4DR7 E;  3JAM C;  2CPN A;  4J8Z A;  2DMY A;  1DQ3 A;  2VF1 A;  2ZM6 E;  4M30 A;  2KOU A;  2G7H A;  4DR1 E;  4JV5 E;  4M0V A;  2L2M A;  3K6Q A;  2LUQ A;  3FIG A;  3ADI A;  1WHN A;  4DV5 E;  2RS6 A;  3IWD A;  2UU9 E;  4JI5 E;  4P78 A;  4B3M E;  4TUG A;  4JI2 E;  1FJG E;  4LU9 A;  3AV0 A;  4P7D A;  4X65 E;  4GKK E;  4DV0 E;  4DR2 E;  3HQ1 A;  4F54 A;  4JYA E;  4L5N C;  5LL6 R;  2FGG A;  5LMU E;  3HTX A;  4DV2 E;  1HNX E;  3ADL A;  2V88 A;  4NXN E;  2LJH A;  5DNY A;  5FLX C;  3LLH A;  3P1X A;  4LF6 E;  1QU6 A;  2DB2 A;  2F8B A;  4GKJ E;  1J26 A;  2LRS A;  3JU0 A;  4Q28 A;  4OOG C;  2L8T A;  2EZ6 A;  4R03 A;  4WYQ B;  4BC9 A;  5IWA E;  2L3C A;  2ODR D;  1ZBQ A;  4WFT A;  4DV1 E;  2JOB A;  2L6M A;  3KWR A;  4BBY A;  2LUP B;  2WZO A;  1O0W A;  4DMI A;  2MC5 A;  2RSM A;  1YYO A;  1EKZ A;  2NUE A;  2FTX B;  2V8Q B;  4BMJ A;  3DF6 A;  2B9D A;  4X64 E;  1I94 E;  1XNQ E;  3C4B A;  3T1Y E;  4JI3 E;  1GZ6 A;  5AE2 A;  3F6H A;  2H36 X;  3LML A;  1IBL E;  4DUY E;  3OML A;  4WPY A;  4B3R E;  4OX9 E;  1SR9 A;  5IT9 C;  2UXD E;  4DV6 E;  3HPS A;  2F4V E;  4LF5 E;  3VYX A;  2E1M A;  3RMP A;  2NUG A;  2UXB E;  3F6G A;  2V83 A;  2JR1 A;  1X48 A;  1X49 A;  2LTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...