4F9BB

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 16
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9bB02
4F9BB 4F9AB 4F9CB
chains in the Genus database with same CATH superfamily
1EH8A 2IHR1 2EN8A 4F54A 2EPLX 1KJKA 4ZYGA 3THNA 4TUGA 2JP9A 3AUZA 5T6JA 3DF6A 4DV4E 2YTGA 1GTKA 3L00A 4B3SE 3HPSA 2WZOA 5IT9C 2HGHA 2ADRA 3MHSC 4JI7E 4LF9E 2EOHA 2EPRA 5A6JA 1A1GA 2YPNA 3K6QA 4GEQB 2EMFA 4DV1E 2K7IA 2EPPA 2LV2A 4DV5E 3EPJA 5A6BD 2EMHA 1Z1BA 5DNYA 5ADZA 2I9IA 2CTDA 1XNRE 2LVHA 2EN1A 4OOGC 3ADJA 3P1XA 2EM0A 2DMYA 4DR2E 3VK6A 3F6HA 1PJTA 2EMWA 2EZ6A 2EOXA 2JY9A 1X47A 2RTXA 4DMIA 4K0KE 2RSIA 2ZM6E 3BF2A 2WCC3 2YTNA 3HTXA 2Q8UA 2VF1A 4NXNE 4L8NA 2EMIA 1PDAA 1J5EE 3FIGA 1UN6B 4DR6E 3H09A 5AE3A 2LUPB 4I8OA 4DV0E 2EM6A 5AE1A 1IBKE 2GPIA 4O43A 2WBSA 4WXDA 5AE2A 2B3TB 2L3CA 3HXLA 5AASA 4DV6E 5F3WA 2H36X 1XMQE 4M9VC 4BC9A 2NA2A 1YYKA 3J80C 5IWAE 4DR1E 2NABA 3J7AG 3VHTB 2EMBA 3C6MA 4HEIA 2EPAA 2JR1A 3EQ1A 2V83A 2JPAA 1WJPA 1YYOA 1X6FA 5AC5A 2EMKA 2YZTA 3T1YE 4M30A 2UUAE 2EM9A 2EM5A 2M7QA 4BMJA 4DR7E 5LL6R 2V85A 1SFEA 2LRSA 2MKDA 4LF5E 1YUIA 4JYAE 2WBTA 1F2IG 2WBUA 2KOUA 3C6KA 2L3JA 1T4LB 1N32E 2N8XA 2YRMA 2HJJA 4BHCA 3ADLA 4O5GA 4R2DA 4IS1C 2V86A 2EQ0A 1IBLE 1AAYA 4Q28A 4LF8E 4DR3E 2EMAA 1BBOA 2EOYA 4WXCA 4ZYEA 3BBGA 2V87A 2EPNA 3T1HE 1UBDC 5AC4A 1QU6A 1JK1A 2KONA 5A6KA 1TN9A 1AH5A 5KL3A 4DV7E 1GQEA 5LMNE 4R03A 1TF6A 2NUEA 1X6EA 5A6AA 3C4TA 1DQ3A 1RC7A 1PJQA 2RSMA 2EOFA 2YTQA 4DV3E 1WHQA 2EOQA 2DGCA 4M2ZA 2MC6A 1UILA 5LMUE 1X49A 2I13A 4JI5E 2EMCA 2JWOA 2ELYA 1EH7A 4DUYE 2EOMA 2LJHA 2EP3A 1A1KA 2CT1A 2DB2A 2EQ1A 1T38A 2GHFA 4R2AA 4BCAA 1IMUA 2VE7C 2YTIA 2G7HA 3EPKA 5BR8E 2ELZA 3MSWA 2FGGA 1WRJA 2DSYA 4LF6E 2EPOA 5KL5A 2EOIA 2A25A 2V89A 1ZR9A 1DGCA 1QNTA 3JAMC 4BS9A 1X6HA 4O4KA 4J8ZA 4BC7A 1YUJA 1YPNA 1EH6A 5CFFE 4LFAE 2EPZA 3F6GA 2UU9E 2N3HA 1J26A 4RH8A 1N36E 2MDGA 2EPUA 4GKJE 3JTZA 4NZVA 1A1IA 4DR4E 2L8TA 1ZBQA 2UUCE 2EOSA 2L2KB 3MHHC 4R2EA 2DRPA 1O0WA 2YTJA 4WFTA 2MDRA 2KHXA 4OX9E 1T4NA 2EOOA 1WXRA 4LTYA 4DKKA 3UK3C 3TQMA 2CPNA 1B69A 3KWRA 2FTXB 2M9AA 4KHPE 2BB8A 3LLHA 4LF7E 2LMZA 1WHNA 2YU5A 2DLKA 3RMPA 1T4OA 3J81C 3AV0A 2CSHA 2L92A 2NUFA 2YT4A 2EL5A 4GKKE 4R2SA 2UXDE 4NXME 1T39A 1ZU1A 2EM2A 2HHHE 1X5WA 2YTEA 4N4RB 2L33A 4IJDA 1RMDA 1LLMC 4DUZE 2L6MA 1STUA 2JXPA 2EOJA 4O24A 1YZ9A 1PJSA 4B3RE 2UXCE 2EN4A 2EOEA 1DI2A 2YU8A 2VRDA 3KZYA 5FLXC 2JYAA 3KZZA 2ENCA 4HTGA 3EPLA 1X3CA 1I94E 4DV2E 1FJGE 1YYWA 4F6MA 2LTSA 2HC5A 4B3ME 1X48A 4JI1E 1P47A 2EN2A 2EN7A 4WPYA 2EL4A 2MKNA 4F9AB 4JV5E 2E72A 2EMXA 3BGHA 4WX9A 2EM8A 1XMOE 2R1FA 1NCSA 4X9JA 4FK5C 2VQEE 2RPCA 2F8BA 4X64E 1HNWE 2EN3A 1HR0E 1TF3A 4KWYA 1IQSA 2EM3A 3HPZA 2YSOA 2JOXA 2YTDA 2EM4A 4WSPA 4YHHE 4JI0E 3VYXA 1MGTA 4Q35B 2R76A 4L5NC 4WYQB 4JI3E 1ZBTA 2RS6A 4JI2E 1A1HA 1SR9A 1UHZA 2EL6A 2LT7A 2ENHA 2J7JA 2NUGA 4R2PA 1N3GA 2B7TA 2EE8A 3ZOQB 2EN6A 4AQYE 2ODRC 3ADIA 2VQFE 1BB8A 2FV4B 4B3TE 2EPMX 2LCEA 4LFCE 4MLQA 2DMIA 3OMLA 2YRKA 2LJUA 2EMZA 2DLQA 1HNXE 1BBGA 4BHBA 5IXMB 3J7Yp 2PRTA 2ODRD 4WSGA 2RQLA 2LUQA 1PKPA 1RQ0A 2JOBA 2DIXA 2F4VE 4BBYA 5TSEA 2V8QB 4DR5E 2V88A 3ADGA 4JI8E 2EM7A 2RS7A 2L2NA 1N33E 2M1SA 3QG5C 4ZYHA 2E5LE 2JVAA 2D9HA 1GZ6A 4X8WA 4P78A 2UUBE 4F9BB 2YRHA 4LFBE 2EMYA 2EPCA 3BIDA 5KL6A 5KL2A 2LO3A 2EMGA 2L2MA 1A1LA 1HNZE 2EWLA 2E1MA 4M0VA 2YTPA 2LTRA 1IBME 2ENAA 2YTFA 4YY3E 3ECRA 4KZSA 3THOB 4GZNC 4R2RA 2LE2A 3OTOE 1YSAC 5IV8B 5KL7A 4F2JC 3C4BA 4F9CB 4RHBB 2K4VA 3IWDA 2YWQA 4TUIA 3EPHA 1YFHA 2EMLA 2B7VA 2GLIA 4LU9A 2M4IA 4X62E 4R2CA 4ZYDA 5A2QC 5A69A 2LBSB 4R8OA 4NHRA 1L4SA 4MLVA 2EPKX 3VYYA 2N3GA 3DJWA 1IQOA 5KL4A 1NEIA 4F6NA 5LLQA 1MEYC 5A6BA 1G2DC 1JK2A 2EQ3A 1A1FA 4R2QA 1FKAE 1G2FC 1ZAAC 3IWBA 3IWCA 4JI4E 2YTOA 4JI6E 2EPXA 1EKZA 4LF4E 2EOZA 1N34E 4X65E 2EORA 1XNQE 2B9DA 3HQ1A 1KYQA 3LMLA 3JU0A 1A1JA 2UXBE 4X66E 2EJ4A 4P7DA 2MC5A 2YSPA 2BBGA 3M99B
chains in the Genus database with same CATH topology
1HNXE 1WXRA 4LTYA 4DKKA 3J7Yp 2IHR1 4F54A 2ODRD 3ADLA 3KWRA 2LUQA 4TUGA 1PKPA 2V86A 2FTXB 1RQ0A 2NUFA 3AUZA 1IBLE 5T6JA 2JOBA 4Q28A 3DF6A 4DV4E 3LLHA 4DR3E 4LF7E 4LF8E 4KHPE 2LMZA 1WHNA 2DIXA 4BBYA 2F4VE 2V87A 2V8QB 4DR5E 2V88A 3RMPA 1T4OA 3ADGA 3AV0A 2L92A 3HPSA 3J81C 2WZOA 3T1HE 5IT9C 2YT4A 1QU6A 4JI8E 2RS7A 2KONA 4GKKE 2L2NA 1N33E 2M1SA 4JI7E 4NXME 4LF9E 2UXDE 4DV7E 1GQEA 5LMNE 2E5LE 2HHHE 2JVAA 4R03A 3K6QA 4GEQB 2NUEA 1GZ6A 4X8WA 4P78A 2L33A 4DV1E 4DV5E 2UUBE 4F9BB 4LFBE 3C4TA 1DQ3A 5DNYA 5ADZA 4DUZE 2L6MA 2RSMA 1RC7A 1STUA 4DV3E 1WHQA 1XNRE 1YZ9A 2L2MA 4B3RE 4OOGC 2UXCE 4M2ZA 3ADJA 2EWLA 2MC6A 1UILA 3P1XA 1HNZE 5LMUE 2DMYA 1DI2A 4DR2E 1X49A 3VK6A 3F6HA 2E1MA 4JI5E 4M0VA 2EZ6A 2LTRA 2JY9A 5FLXC 1X47A 1IBME 2JWOA 2RTXA 4YY3E 2MC5A 4KZSA 4DUYE 2LJHA 2LE2A 3OTOE 1I94E 4DMIA 4DV2E 4K0KE 2ZM6E 2DB2A 3C4BA 3HTXA 1FJGE 1YYWA 2LTSA 4B3SE 2VF1A 4F9CB 1X48A 4BCAA 4L8NA 2VE7C 4B3ME 4NXNE 2K4VA 4JI1E 1J5EE 3FIGA 2G7HA 3IWDA 5BR8E 4WPYA 3MSWA 4TUIA 2FGGA 4F9AB 4DR6E 4JV5E 2DSYA 3H09A 5AE3A 4LF6E 2LUPB 4I8OA 2V89A 2B7VA 4DV0E 5AE1A 1XMOE 1IBKE 4LU9A 2VQEE 2F8BA 3JAMC 2M4IA 5AE2A 2B3TB 4X62E 3HXLA 4X64E 4BS9A 5A2QC 2L3CA 5AASA 1HNWE 4DV6E 1HR0E 5F3WA 2H36X 4J8ZA 4R8OA 4BC7A 2LBSB 4BC9A 1XMQE 3HPZA 2JOXA 2NA2A 4WSPA 3J80C 1YYKA 4YHHE 3VYYA 5IWAE 2N3GA 3DJWA 5CFFE 4JI0E 4LFAE 4DR1E 3F6GA 3VYXA 4WYQB 4L5NC 4JI2E 4JI3E 1ZBTA 2RS6A 2UU9E 2N3HA 3J7AG 1J26A 1FKAE 1N36E 2JR1A 1SR9A 1UHZA 2V83A 3IWBA 3IWCA 4JI4E 4GKJE 3JTZA 2NUGA 1YYOA 2B7TA 3ZOQB 4JI6E 4DR4E 2L8TA 1EKZA 2UUAE 4AQYE 2YZTA 3T1YE 1ZBQA 2ODRC 4M30A 3ADIA 4LF4E 2UUCE 2M7QA 2L2KB 4BMJA 4DR7E 5LL6R 2VQFE 2V85A 2LRSA 1N34E 4X65E 1O0WA 1XNQE 2FV4B 2B9DA 3HQ1A 4LF5E 4B3TE 4WFTA 4JYAE 3LMLA 2MDRA 2KHXA 2KOUA 3JU0A 2L3JA 4LFCE 1T4NA 3OMLA 4X66E 1T4LB 4P7DA 4OX9E 1N32E 2UXBE 2CPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9A B;  4F9C B; 
#chains in the Genus database with same CATH topology
 1EH8 A;  2IHR 1;  2EN8 A;  4F54 A;  2EPL X;  1KJK A;  4ZYG A;  3THN A;  4TUG A;  2JP9 A;  3AUZ A;  5T6J A;  3DF6 A;  4DV4 E;  2YTG A;  1GTK A;  3L00 A;  4B3S E;  3HPS A;  2WZO A;  5IT9 C;  2HGH A;  2ADR A;  3MHS C;  4JI7 E;  4LF9 E;  2EOH A;  2EPR A;  5A6J A;  1A1G A;  2YPN A;  3K6Q A;  4GEQ B;  2EMF A;  4DV1 E;  2K7I A;  2EPP A;  2LV2 A;  4DV5 E;  3EPJ A;  5A6B D;  2EMH A;  1Z1B A;  5DNY A;  5ADZ A;  2I9I A;  2CTD A;  1XNR E;  2LVH A;  2EN1 A;  4OOG C;  3ADJ A;  3P1X A;  2EM0 A;  2DMY A;  4DR2 E;  3VK6 A;  3F6H A;  1PJT A;  2EMW A;  2EZ6 A;  2EOX A;  2JY9 A;  1X47 A;  2RTX A;  4DMI A;  4K0K E;  2RSI A;  2ZM6 E;  3BF2 A;  2WCC 3;  2YTN A;  3HTX A;  2Q8U A;  2VF1 A;  4NXN E;  4L8N A;  2EMI A;  1PDA A;  1J5E E;  3FIG A;  1UN6 B;  4DR6 E;  3H09 A;  5AE3 A;  2LUP B;  4I8O A;  4DV0 E;  2EM6 A;  5AE1 A;  1IBK E;  2GPI A;  4O43 A;  2WBS A;  4WXD A;  5AE2 A;  2B3T B;  2L3C A;  3HXL A;  5AAS A;  4DV6 E;  5F3W A;  2H36 X;  1XMQ E;  4M9V C;  4BC9 A;  2NA2 A;  1YYK A;  3J80 C;  5IWA E;  4DR1 E;  2NAB A;  3J7A G;  3VHT B;  2EMB A;  3C6M A;  4HEI A;  2EPA A;  2JR1 A;  3EQ1 A;  2V83 A;  2JPA A;  1WJP A;  1YYO A;  1X6F A;  5AC5 A;  2EMK A;  2YZT A;  3T1Y E;  4M30 A;  2UUA E;  2EM9 A;  2EM5 A;  2M7Q A;  4BMJ A;  4DR7 E;  5LL6 R;  2V85 A;  1SFE A;  2LRS A;  2MKD A;  4LF5 E;  1YUI A;  4JYA E;  2WBT A;  1F2I G;  2WBU A;  2KOU A;  3C6K A;  2L3J A;  1T4L B;  1N32 E;  2N8X A;  2YRM A;  2HJJ A;  4BHC A;  3ADL A;  4O5G A;  4R2D A;  4IS1 C;  2V86 A;  2EQ0 A;  1IBL E;  1AAY A;  4Q28 A;  4LF8 E;  4DR3 E;  2EMA A;  1BBO A;  2EOY A;  4WXC A;  4ZYE A;  3BBG A;  2V87 A;  2EPN A;  3T1H E;  1UBD C;  5AC4 A;  1QU6 A;  1JK1 A;  2KON A;  5A6K A;  1TN9 A;  1AH5 A;  5KL3 A;  4DV7 E;  1GQE A;  5LMN E;  4R03 A;  1TF6 A;  2NUE A;  1X6E A;  5A6A A;  3C4T A;  1DQ3 A;  1RC7 A;  1PJQ A;  2RSM A;  2EOF A;  2YTQ A;  4DV3 E;  1WHQ A;  2EOQ A;  2DGC A;  4M2Z A;  2MC6 A;  1UIL A;  5LMU E;  1X49 A;  2I13 A;  4JI5 E;  2EMC A;  2JWO A;  2ELY A;  1EH7 A;  4DUY E;  2EOM A;  2LJH A;  2EP3 A;  1A1K A;  2CT1 A;  2DB2 A;  2EQ1 A;  1T38 A;  2GHF A;  4R2A A;  4BCA A;  1IMU A;  2VE7 C;  2YTI A;  2G7H A;  3EPK A;  5BR8 E;  2ELZ A;  3MSW A;  2FGG A;  1WRJ A;  2DSY A;  4LF6 E;  2EPO A;  5KL5 A;  2EOI A;  2A25 A;  2V89 A;  1ZR9 A;  1DGC A;  1QNT A;  3JAM C;  4BS9 A;  1X6H A;  4O4K A;  4J8Z A;  4BC7 A;  1YUJ A;  1YPN A;  1EH6 A;  5CFF E;  4LFA E;  2EPZ A;  3F6G A;  2UU9 E;  2N3H A;  1J26 A;  4RH8 A;  1N36 E;  2MDG A;  2EPU A;  4GKJ E;  3JTZ A;  4NZV A;  1A1I A;  4DR4 E;  2L8T A;  1ZBQ A;  2UUC E;  2EOS A;  2L2K B;  3MHH C;  4R2E A;  2DRP A;  1O0W A;  2YTJ A;  4WFT A;  2MDR A;  2KHX A;  4OX9 E;  1T4N A;  2EOO A;  1WXR A;  4LTY A;  4DKK A;  3UK3 C;  3TQM A;  2CPN A;  1B69 A;  3KWR A;  2FTX B;  2M9A A;  4KHP E;  2BB8 A;  3LLH A;  4LF7 E;  2LMZ A;  1WHN A;  2YU5 A;  2DLK A;  3RMP A;  1T4O A;  3J81 C;  3AV0 A;  2CSH A;  2L92 A;  2NUF A;  2YT4 A;  2EL5 A;  4GKK E;  4R2S A;  2UXD E;  4NXM E;  1T39 A;  1ZU1 A;  2EM2 A;  2HHH E;  1X5W A;  2YTE A;  4N4R B;  2L33 A;  4IJD A;  1RMD A;  1LLM C;  4DUZ E;  2L6M A;  1STU A;  2JXP A;  2EOJ A;  4O24 A;  1YZ9 A;  1PJS A;  4B3R E;  2UXC E;  2EN4 A;  2EOE A;  1DI2 A;  2YU8 A;  2VRD A;  3KZY A;  5FLX C;  2JYA A;  3KZZ A;  2ENC A;  4HTG A;  3EPL A;  1X3C A;  1I94 E;  4DV2 E;  1FJG E;  1YYW A;  4F6M A;  2LTS A;  2HC5 A;  4B3M E;  1X48 A;  4JI1 E;  1P47 A;  2EN2 A;  2EN7 A;  4WPY A;  2EL4 A;  2MKN A;  4F9A B;  4JV5 E;  2E72 A;  2EMX A;  3BGH A;  4WX9 A;  2EM8 A;  1XMO E;  2R1F A;  1NCS A;  4X9J A;  4FK5 C;  2VQE E;  2RPC A;  2F8B A;  4X64 E;  1HNW E;  2EN3 A;  1HR0 E;  1TF3 A;  4KWY A;  1IQS A;  2EM3 A;  3HPZ A;  2YSO A;  2JOX A;  2YTD A;  2EM4 A;  4WSP A;  4YHH E;  4JI0 E;  3VYX A;  1MGT A;  4Q35 B;  2R76 A;  4L5N C;  4WYQ B;  4JI3 E;  1ZBT A;  2RS6 A;  4JI2 E;  1A1H A;  1SR9 A;  1UHZ A;  2EL6 A;  2LT7 A;  2ENH A;  2J7J A;  2NUG A;  4R2P A;  1N3G A;  2B7T A;  2EE8 A;  3ZOQ B;  2EN6 A;  4AQY E;  2ODR C;  3ADI A;  2VQF E;  1BB8 A;  2FV4 B;  4B3T E;  2EPM X;  2LCE A;  4LFC E;  4MLQ A;  2DMI A;  3OML A;  2YRK A;  2LJU A;  2EMZ A;  2DLQ A;  1HNX E;  1BBG A;  4BHB A;  5IXM B;  3J7Y p;  2PRT A;  2ODR D;  4WSG A;  2RQL A;  2LUQ A;  1PKP A;  1RQ0 A;  2JOB A;  2DIX A;  2F4V E;  4BBY A;  5TSE A;  2V8Q B;  4DR5 E;  2V88 A;  3ADG A;  4JI8 E;  2EM7 A;  2RS7 A;  2L2N A;  1N33 E;  2M1S A;  3QG5 C;  4ZYH A;  2E5L E;  2JVA A;  2D9H A;  1GZ6 A;  4X8W A;  4P78 A;  2UUB E;  4F9B B;  2YRH A;  4LFB E;  2EMY A;  2EPC A;  3BID A;  5KL6 A;  5KL2 A;  2LO3 A;  2EMG A;  2L2M A;  1A1L A;  1HNZ E;  2EWL A;  2E1M A;  4M0V A;  2YTP A;  2LTR A;  1IBM E;  2ENA A;  2YTF A;  4YY3 E;  3ECR A;  4KZS A;  3THO B;  4GZN C;  4R2R A;  2LE2 A;  3OTO E;  1YSA C;  5IV8 B;  5KL7 A;  4F2J C;  3C4B A;  4F9C B;  4RHB B;  2K4V A;  3IWD A;  2YWQ A;  4TUI A;  3EPH A;  1YFH A;  2EML A;  2B7V A;  2GLI A;  4LU9 A;  2M4I A;  4X62 E;  4R2C A;  4ZYD A;  5A2Q C;  5A69 A;  2LBS B;  4R8O A;  4NHR A;  1L4S A;  4MLV A;  2EPK X;  3VYY A;  2N3G A;  3DJW A;  1IQO A;  5KL4 A;  1NEI A;  4F6N A;  5LLQ A;  1MEY C;  5A6B A;  1G2D C;  1JK2 A;  2EQ3 A;  1A1F A;  4R2Q A;  1FKA E;  1G2F C;  1ZAA C;  3IWB A;  3IWC A;  4JI4 E;  2YTO A;  4JI6 E;  2EPX A;  1EKZ A;  4LF4 E;  2EOZ A;  1N34 E;  4X65 E;  2EOR A;  1XNQ E;  2B9D A;  3HQ1 A;  1KYQ A;  3LML A;  3JU0 A;  1A1J A;  2UXB E;  4X66 E;  2EJ4 A;  4P7D A;  2MC5 A;  2YSP A;  2BBG A;  3M99 B; 
#chains in the Genus database with same CATH homology
 1HNX E;  1WXR A;  4LTY A;  4DKK A;  3J7Y p;  2IHR 1;  4F54 A;  2ODR D;  3ADL A;  3KWR A;  2LUQ A;  4TUG A;  1PKP A;  2V86 A;  2FTX B;  1RQ0 A;  2NUF A;  3AUZ A;  1IBL E;  5T6J A;  2JOB A;  4Q28 A;  3DF6 A;  4DV4 E;  3LLH A;  4DR3 E;  4LF7 E;  4LF8 E;  4KHP E;  2LMZ A;  1WHN A;  2DIX A;  4BBY A;  2F4V E;  2V87 A;  2V8Q B;  4DR5 E;  2V88 A;  3RMP A;  1T4O A;  3ADG A;  3AV0 A;  2L92 A;  3HPS A;  3J81 C;  2WZO A;  3T1H E;  5IT9 C;  2YT4 A;  1QU6 A;  4JI8 E;  2RS7 A;  2KON A;  4GKK E;  2L2N A;  1N33 E;  2M1S A;  4JI7 E;  4NXM E;  4LF9 E;  2UXD E;  4DV7 E;  1GQE A;  5LMN E;  2E5L E;  2HHH E;  2JVA A;  4R03 A;  3K6Q A;  4GEQ B;  2NUE A;  1GZ6 A;  4X8W A;  4P78 A;  2L33 A;  4DV1 E;  4DV5 E;  2UUB E;  4F9B B;  4LFB E;  3C4T A;  1DQ3 A;  5DNY A;  5ADZ A;  4DUZ E;  2L6M A;  2RSM A;  1RC7 A;  1STU A;  4DV3 E;  1WHQ A;  1XNR E;  1YZ9 A;  2L2M A;  4B3R E;  4OOG C;  2UXC E;  4M2Z A;  3ADJ A;  2EWL A;  2MC6 A;  1UIL A;  3P1X A;  1HNZ E;  5LMU E;  2DMY A;  1DI2 A;  4DR2 E;  1X49 A;  3VK6 A;  3F6H A;  2E1M A;  4JI5 E;  4M0V A;  2EZ6 A;  2LTR A;  2JY9 A;  5FLX C;  1X47 A;  1IBM E;  2JWO A;  2RTX A;  4YY3 E;  2MC5 A;  4KZS A;  4DUY E;  2LJH A;  2LE2 A;  3OTO E;  1I94 E;  4DMI A;  4DV2 E;  4K0K E;  2ZM6 E;  2DB2 A;  3C4B A;  3HTX A;  1FJG E;  1YYW A;  2LTS A;  4B3S E;  2VF1 A;  4F9C B;  1X48 A;  4BCA A;  4L8N A;  2VE7 C;  4B3M E;  4NXN E;  2K4V A;  4JI1 E;  1J5E E;  3FIG A;  2G7H A;  3IWD A;  5BR8 E;  4WPY A;  3MSW A;  4TUI A;  2FGG A;  4F9A B;  4DR6 E;  4JV5 E;  2DSY A;  3H09 A;  5AE3 A;  4LF6 E;  2LUP B;  4I8O A;  2V89 A;  2B7V A;  4DV0 E;  5AE1 A;  1XMO E;  1IBK E;  4LU9 A;  2VQE E;  2F8B A;  3JAM C;  2M4I A;  5AE2 A;  2B3T B;  4X62 E;  3HXL A;  4X64 E;  4BS9 A;  5A2Q C;  2L3C A;  5AAS A;  1HNW E;  4DV6 E;  1HR0 E;  5F3W A;  2H36 X;  4J8Z A;  4R8O A;  4BC7 A;  2LBS B;  4BC9 A;  1XMQ E;  3HPZ A;  2JOX A;  2NA2 A;  4WSP A;  3J80 C;  1YYK A;  4YHH E;  3VYY A;  5IWA E;  2N3G A;  3DJW A;  5CFF E;  4JI0 E;  4LFA E;  4DR1 E;  3F6G A;  3VYX A;  4WYQ B;  4L5N C;  4JI2 E;  4JI3 E;  1ZBT A;  2RS6 A;  2UU9 E;  2N3H A;  3J7A G;  1J26 A;  1FKA E;  1N36 E;  2JR1 A;  1SR9 A;  1UHZ A;  2V83 A;  3IWB A;  3IWC A;  4JI4 E;  4GKJ E;  3JTZ A;  2NUG A;  1YYO A;  2B7T A;  3ZOQ B;  4JI6 E;  4DR4 E;  2L8T A;  1EKZ A;  2UUA E;  4AQY E;  2YZT A;  3T1Y E;  1ZBQ A;  2ODR C;  4M30 A;  3ADI A;  4LF4 E;  2UUC E;  2M7Q A;  2L2K B;  4BMJ A;  4DR7 E;  5LL6 R;  2VQF E;  2V85 A;  2LRS A;  1N34 E;  4X65 E;  1O0W A;  1XNQ E;  2FV4 B;  2B9D A;  3HQ1 A;  4LF5 E;  4B3T E;  4WFT A;  4JYA E;  3LML A;  2MDR A;  2KHX A;  2KOU A;  3JU0 A;  2L3J A;  4LFC E;  1T4N A;  3OML A;  4X66 E;  1T4L B;  4P7D A;  4OX9 E;  1N32 E;  2UXB E;  2CPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...