4F9BB

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 16
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9bB02
4F9BB 4F9CB 4F9AB
chains in the Genus database with same CATH superfamily
4RH8A 4B3SE 2WZOA 2EN7A 2BBGA 1NCSA 3F6GA 3KWRA 1DQ3A 5AC4A 4KWYA 2EMZA 5KL5A 2EOJA 4NXNE 1IQSA 4WPYA 1SR9A 1AAYA 3TQMA 2EZ6A 2YTQA 1DI2A 2LE2A 4M2ZA 4K0KE 3EPKA 3J80C 2YTFA 2M7QA 2KOUA 2DMYA 3LMLA 5A6BA 3VHTB 1N32E 2L3JA 2D9HA 2E72A 4DR7E 3OTOE 4LF9E 2B3TB 4GZNC 4DV5E 3C6KA 5KL4A 5CFFE 3C4TA 2L92A 2LMZA 1RMDA 2V87A 3HXLA 4DV4E 4JI2E 1HNWE 4ZYDA 4O4KA 4O24A 4TUIA 2K4VA 1A1KA 2EMAA 2V88A 2EMXA 2YRMA 2B9DA 2EOMA 4GKKE 3MHSC 4R2RA 2JOXA 2LJUA 4F54A 2EM2A 1PJQA 2EPCA 1Z1BA 2RS6A 4DV6E 2EPRA 2EPUA 4BBYA 1X5WA 2EOIA 2UXDE 5IV8B 2M1SA 1T38A 4DKKA 4R2DA 4X65E 2UUBE 4MLQA 2LBSB 2DIXA 2DLKA 2EM8A 4BC7A 2NA2A 4M9VC 4R2QA 3J81C 3EPHA 4MLVA 4F9CB 2FTXB 1WHQA 2EPKX 2YRHA 1J5EE 3EQ1A 4R2AA 1O0WA 2EMCA 1ZBTA 4F6NA 1G2FC 2EPPA 3DJWA 2EPNA 2M9AA 3M99B 3ADLA 4WXCA 2JWOA 2V8QB 1F2IG 2LTSA 1X48A 2F4VE 3P1XA 1WHNA 2EMBA 4OX9E 3BIDA 4ZYGA 1PJTA 2MDGA 4X8WA 2A25A 2EOHA 5TSEA 1BBGA 1IBKE 5KL3A 4J8ZA 2GLIA 2CPNA 3JTZA 2EMLA 2R1FA 1HNXE 4B3ME 1BB8A 2VQEE 2V83A 2YSOA 4M30A 2EMIA 2HJJA 4NZVA 1JK1A 2E1MA 1ZBQA 2JP9A 1XNQE 2EM7A 4DR5E 4WFTA 1UN6B 4IJDA 3HQ1A 1WXRA 2YSPA 3EPLA 4F2JC 4JI6E 2V86A 4R03A 4DR3E 1PDAA 4WYQB 2NUEA 2EMKA 1EKZA 5A6AA 4JI0E 4ZYEA 2YZTA 5A69A 2ELYA 5FLXC 1EH8A 2EM0A 2DMIA 2N3HA 4WSPA 2JOBA 1T4NA 1N3GA 2YWQA 4N4RB 2DGCA 3L00A 1BBOA 2EMHA 4HTGA 1YYWA 5AE2A 1AH5A 2EL5A 2EOQA 5A2QC 2N8XA 1ZR9A 4WSGA 1SFEA 4WX9A 3K6QA 4YY3E 1NEIA 3J7Yp 2EMGA 2MKDA 5T6JA 4IS1C 2WBSA 1IQOA 1HR0E 3J7AG 4KZSA 4X9JA 1N34E 3QG5C 2UUAE 1T4OA 2FV4B 1A1IA 2L2NA 4DV1E 2VQFE 4JI5E 2YTPA 2ZM6E 4L5NC 2UU9E 2RS7A 2LVHA 4AQYE 3IWDA 5AE3A 4LFBE 2VF1A 2VRDA 5ADZA 3BBGA 1YZ9A 2EN4A 2YTGA 2EM5A 2GPIA 1GZ6A 2YTNA 2EPMX 2EQ1A 2JXPA 5F3WA 1L4SA 2ENAA 2KHXA 2WBUA 1GQEA 3T1HE 4M0VA 2NABA 3RMPA 1A1FA 2YTJA 3ECRA 4OOGC 3AV0A 2WCC3 2LJHA 2K7IA 1EH7A 2GHFA 5A6BD 4DV2E 4GKJE 3HPSA 4WXDA 2CTDA 2V89A 5AE1A 1X49A 1EH6A 1YYOA 3KZYA 4BS9A 2JYAA 2J7JA 2EWLA 4DUZE 4JI3E 2KONA 4LF7E 2MC5A 2EORA 3THNA 3JAMC 1IMUA 1UHZA 2M4IA 4BCAA 1PKPA 4R8OA 4F9AB 2EOOA 2ENHA 4DR2E 4LF6E 2N3GA 4FK5C 2EL6A 2WBTA 1XMOE 4BHCA 2BB8A 4X62E 1QNTA 2CSHA 5KL7A 2RQLA 4X64E 3BGHA 4BMJA 1YSAC 3FIGA 2DB2A 4LU9A 4YHHE 1J26A 1B69A 2EN8A 4JYAE 1MEYC 4DR6E 5IXMB 2EMWA 4JV5E 2YRKA 2YT4A 2I9IA 1UBDC 2MDRA 5IWAE 1YUIA 1RC7A 4ZYHA 1A1HA 4B3TE 4R2PA 3EPJA 4LFAE 2EPAA 2JPAA 2NUGA 2IHR1 4P78A 4LF8E 1FJGE 3HTXA 4DUYE 2ELZA 1TN9A 1XMQE 1P47A 1TF3A 2L2KB 4DV0E 3HPZA 2EPOA 2DLQA 2JR1A 4DV7E 2EN6A 2CT1A 2EMYA 2VE7C 1WJPA 2L33A 1DGCA 4B3RE 3IWCA 2EOFA 2YPNA 2EQ3A 5LLQA 4LF4E 2H36X 4LFCE 2ODRD 1IBLE 5LMUE 1KJKA 2R76A 1IBME 1T4LB 4L8NA 2EOEA 2HGHA 1ZU1A 4O5GA 3IWBA 1X6EA 2HHHE 2RPCA 2RSIA 2YTEA 3H09A 5A6KA 2EM3A 5KL6A 1I94E 5A6JA 2EN1A 2LRSA 4I8OA 1YYKA 4LF5E 1A1JA 3ADJA 2EOXA 2UXCE 2EPXA 3BF2A 1UILA 2LV2A 2Q8UA 2EPLX 3OMLA 2EN2A 4JI4E 4R2CA 1JK2A 4DR1E 5LMNE 2LO3A 1X3CA 2LTRA 2EOYA 2E5LE 4DV3E 2L6MA 2EL4A 3F6HA 2PRTA 4DR4E 4O43A 2ENCA 2EPZA 2YTOA 3ADGA 4GEQB 4NHRA 4R2EA 3C6MA 2LCEA 4DMIA 1YPNA 4Q28A 4KHPE 1N36E 4LTYA 3ZOQB 2EOZA 2L3CA 4HEIA 2F8BA 4JI8E 2YTDA 4NXME 4BC9A 1RQ0A 1WRJA 1FKAE 2MC6A 1XNRE 5BR8E 2EM6A 1STUA 4JI7E 2EN3A 2L8TA 2B7TA 2ODRC 1A1LA 3VYXA 1N33E 2LUPB 4P7DA 2RSMA 3THOB 2DRPA 2I13A 5KL2A 3DF6A 2JVAA 2EM4A 3AUZA 2V85A 1KYQA 1PJSA 2HC5A 2EOSA 4Q35B 5IT9C 1X6FA 1T39A 5AC5A 1LLMC 2MKNA 4F6MA 3KZZA 3MHHC 2YU8A 2B7VA 1HNZE 1X6HA 3MSWA 5AASA 2EE8A 2EP3A 3C4BA 2UUCE 3VK6A 3VYYA 1QU6A 1X47A 4BHBA 1TF6A 1YFHA 1MGTA 2NUFA 2ADRA 5DNYA 4RHBB 2JY9A 2EQ0A 2DSYA 2EMFA 2LUQA 2RTXA 3JU0A 1G2DC 4X66E 2UXBE 3LLHA 2FGGA 1GTKA 1YUJA 4R2SA 4JI1E 2G7HA 3UK3C 2L2MA 2YTIA 3ADIA 4F9BB 5LL6R 1A1GA 2LT7A 2EM9A 3T1YE 4TUGA 2YU5A 1ZAAC 2EJ4A
chains in the Genus database with same CATH topology
4B3SE 2CPNA 2WZOA 3JTZA 5LMNE 4DR1E 1HNXE 4B3ME 1YYOA 2VQEE 3F6GA 2V83A 3KWRA 1DQ3A 4BS9A 4M30A 4DUZE 2EWLA 4JI3E 2KONA 2E1MA 2LTRA 4LF7E 1ZBQA 2MC5A 2E5LE 1XNQE 4NXNE 4DV3E 4DR5E 4WFTA 3JAMC 4WPYA 1SR9A 2L6MA 1UHZA 2M4IA 3F6HA 4BCAA 2EZ6A 1PKPA 2LE2A 3HQ1A 4R8OA 1WXRA 4F9AB 4M2ZA 4K0KE 4JI6E 2V86A 4R03A 4DR3E 3J80C 4DR4E 4GEQB 4DR2E 3ADGA 4WYQB 4LF6E 4DMIA 2NUEA 2N3GA 2M7QA 4Q28A 1EKZA 4JI0E 4KHPE 2KOUA 2DMYA 3LMLA 2YZTA 5FLXC 1XMOE 4X62E 1N36E 1N32E 2L3JA 4LTYA 3ZOQB 4DR7E 3OTOE 2N3HA 4X64E 4LF9E 4WSPA 2JOBA 1T4NA 2L3CA 2B3TB 4BMJA 3FIGA 2DB2A 4DV5E 1DI2A 4LU9A 5CFFE 3C4TA 4YHHE 1YYWA 2F8BA 2L92A 4JI8E 1J26A 4JYAE 2LMZA 4NXME 4BC9A 2V87A 3HXLA 4DV4E 1RQ0A 4JI2E 4DR6E 5AE2A 4JV5E 2YT4A 1FKAE 1HNWE 2MC6A 2MDRA 5A2QC 5BR8E 5IWAE 4TUIA 1XNRE 2K4VA 5AE1A 1RC7A 4B3TE 2V88A 1STUA 3K6QA 4JI7E 2B9DA 4YY3E 4LFAE 2L8TA 2B7TA 3J7Yp 2ODRC 3VYXA 4GKKE 1N33E 2JOXA 2NUGA 2IHR1 5T6JA 4P78A 4P7DA 4F54A 2LUPB 4DUYE 4LF8E 2RS6A 1FJGE 3HTXA 2RSMA 4DV6E 4BBYA 1XMQE 1HR0E 2UXDE 3DF6A 3J7AG 4KZSA 2L2KB 4DV0E 2JVAA 1N34E 2M1SA 2UUAE 3HPZA 1T4OA 4DKKA 4DV7E 2JR1A 4X65E 3AUZA 2FV4B 2UUBE 2V85A 2L2NA 4DV1E 2VE7C 2DIXA 2VQFE 2LBSB 5IT9C 2L33A 4JI5E 4BC7A 2NA2A 4B3RE 3IWCA 2ZM6E 3J81C 4L5NC 2UU9E 2B7VA 2RS7A 4AQYE 1HNZE 3MSWA 3IWDA 4LF4E 5AASA 2H36X 4F9CB 4LFCE 5AE3A 2ODRD 3C4BA 2FTXB 1IBLE 2UUCE 1WHQA 3VK6A 5LMUE 1J5EE 3VYYA 1IBME 1T4LB 4L8NA 4LFBE 1QU6A 1X47A 2VF1A 2NUFA 5ADZA 5DNYA 1O0WA 1YZ9A 3IWBA 1ZBTA 2JY9A 3DJWA 1GZ6A 2DSYA 2LUQA 2RTXA 3JU0A 3ADLA 2HHHE 4X66E 2UXBE 3LLHA 2JWOA 2V8QB 3H09A 5F3WA 2FGGA 2LTSA 1X48A 2KHXA 1I94E 3P1XA 2G7HA 4JI1E 2F4VE 2LRSA 4I8OA 1GQEA 4LF5E 1YYKA 3T1HE 1WHNA 4M0VA 4OX9E 3RMPA 4OOGC 2L2MA 3AV0A 3ADIA 4F9BB 4X8WA 2LJHA 3ADJA 5LL6R 2UXCE 4DV2E 4GKJE 1UILA 3HPSA 3OMLA 4TUGA 3T1YE 1IBKE 4JI4E 2V89A 4J8ZA 1X49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9C B;  4F9A B; 
#chains in the Genus database with same CATH topology
 4RH8 A;  4B3S E;  2WZO A;  2EN7 A;  2BBG A;  1NCS A;  3F6G A;  3KWR A;  1DQ3 A;  5AC4 A;  4KWY A;  2EMZ A;  5KL5 A;  2EOJ A;  4NXN E;  1IQS A;  4WPY A;  1SR9 A;  1AAY A;  3TQM A;  2EZ6 A;  2YTQ A;  1DI2 A;  2LE2 A;  4M2Z A;  4K0K E;  3EPK A;  3J80 C;  2YTF A;  2M7Q A;  2KOU A;  2DMY A;  3LML A;  5A6B A;  3VHT B;  1N32 E;  2L3J A;  2D9H A;  2E72 A;  4DR7 E;  3OTO E;  4LF9 E;  2B3T B;  4GZN C;  4DV5 E;  3C6K A;  5KL4 A;  5CFF E;  3C4T A;  2L92 A;  2LMZ A;  1RMD A;  2V87 A;  3HXL A;  4DV4 E;  4JI2 E;  1HNW E;  4ZYD A;  4O4K A;  4O24 A;  4TUI A;  2K4V A;  1A1K A;  2EMA A;  2V88 A;  2EMX A;  2YRM A;  2B9D A;  2EOM A;  4GKK E;  3MHS C;  4R2R A;  2JOX A;  2LJU A;  4F54 A;  2EM2 A;  1PJQ A;  2EPC A;  1Z1B A;  2RS6 A;  4DV6 E;  2EPR A;  2EPU A;  4BBY A;  1X5W A;  2EOI A;  2UXD E;  5IV8 B;  2M1S A;  1T38 A;  4DKK A;  4R2D A;  4X65 E;  2UUB E;  4MLQ A;  2LBS B;  2DIX A;  2DLK A;  2EM8 A;  4BC7 A;  2NA2 A;  4M9V C;  4R2Q A;  3J81 C;  3EPH A;  4MLV A;  4F9C B;  2FTX B;  1WHQ A;  2EPK X;  2YRH A;  1J5E E;  3EQ1 A;  4R2A A;  1O0W A;  2EMC A;  1ZBT A;  4F6N A;  1G2F C;  2EPP A;  3DJW A;  2EPN A;  2M9A A;  3M99 B;  3ADL A;  4WXC A;  2JWO A;  2V8Q B;  1F2I G;  2LTS A;  1X48 A;  2F4V E;  3P1X A;  1WHN A;  2EMB A;  4OX9 E;  3BID A;  4ZYG A;  1PJT A;  2MDG A;  4X8W A;  2A25 A;  2EOH A;  5TSE A;  1BBG A;  1IBK E;  5KL3 A;  4J8Z A;  2GLI A;  2CPN A;  3JTZ A;  2EML A;  2R1F A;  1HNX E;  4B3M E;  1BB8 A;  2VQE E;  2V83 A;  2YSO A;  4M30 A;  2EMI A;  2HJJ A;  4NZV A;  1JK1 A;  2E1M A;  1ZBQ A;  2JP9 A;  1XNQ E;  2EM7 A;  4DR5 E;  4WFT A;  1UN6 B;  4IJD A;  3HQ1 A;  1WXR A;  2YSP A;  3EPL A;  4F2J C;  4JI6 E;  2V86 A;  4R03 A;  4DR3 E;  1PDA A;  4WYQ B;  2NUE A;  2EMK A;  1EKZ A;  5A6A A;  4JI0 E;  4ZYE A;  2YZT A;  5A69 A;  2ELY A;  5FLX C;  1EH8 A;  2EM0 A;  2DMI A;  2N3H A;  4WSP A;  2JOB A;  1T4N A;  1N3G A;  2YWQ A;  4N4R B;  2DGC A;  3L00 A;  1BBO A;  2EMH A;  4HTG A;  1YYW A;  5AE2 A;  1AH5 A;  2EL5 A;  2EOQ A;  5A2Q C;  2N8X A;  1ZR9 A;  4WSG A;  1SFE A;  4WX9 A;  3K6Q A;  4YY3 E;  1NEI A;  3J7Y p;  2EMG A;  2MKD A;  5T6J A;  4IS1 C;  2WBS A;  1IQO A;  1HR0 E;  3J7A G;  4KZS A;  4X9J A;  1N34 E;  3QG5 C;  2UUA E;  1T4O A;  2FV4 B;  1A1I A;  2L2N A;  4DV1 E;  2VQF E;  4JI5 E;  2YTP A;  2ZM6 E;  4L5N C;  2UU9 E;  2RS7 A;  2LVH A;  4AQY E;  3IWD A;  5AE3 A;  4LFB E;  2VF1 A;  2VRD A;  5ADZ A;  3BBG A;  1YZ9 A;  2EN4 A;  2YTG A;  2EM5 A;  2GPI A;  1GZ6 A;  2YTN A;  2EPM X;  2EQ1 A;  2JXP A;  5F3W A;  1L4S A;  2ENA A;  2KHX A;  2WBU A;  1GQE A;  3T1H E;  4M0V A;  2NAB A;  3RMP A;  1A1F A;  2YTJ A;  3ECR A;  4OOG C;  3AV0 A;  2WCC 3;  2LJH A;  2K7I A;  1EH7 A;  2GHF A;  5A6B D;  4DV2 E;  4GKJ E;  3HPS A;  4WXD A;  2CTD A;  2V89 A;  5AE1 A;  1X49 A;  1EH6 A;  1YYO A;  3KZY A;  4BS9 A;  2JYA A;  2J7J A;  2EWL A;  4DUZ E;  4JI3 E;  2KON A;  4LF7 E;  2MC5 A;  2EOR A;  3THN A;  3JAM C;  1IMU A;  1UHZ A;  2M4I A;  4BCA A;  1PKP A;  4R8O A;  4F9A B;  2EOO A;  2ENH A;  4DR2 E;  4LF6 E;  2N3G A;  4FK5 C;  2EL6 A;  2WBT A;  1XMO E;  4BHC A;  2BB8 A;  4X62 E;  1QNT A;  2CSH A;  5KL7 A;  2RQL A;  4X64 E;  3BGH A;  4BMJ A;  1YSA C;  3FIG A;  2DB2 A;  4LU9 A;  4YHH E;  1J26 A;  1B69 A;  2EN8 A;  4JYA E;  1MEY C;  4DR6 E;  5IXM B;  2EMW A;  4JV5 E;  2YRK A;  2YT4 A;  2I9I A;  1UBD C;  2MDR A;  5IWA E;  1YUI A;  1RC7 A;  4ZYH A;  1A1H A;  4B3T E;  4R2P A;  3EPJ A;  4LFA E;  2EPA A;  2JPA A;  2NUG A;  2IHR 1;  4P78 A;  4LF8 E;  1FJG E;  3HTX A;  4DUY E;  2ELZ A;  1TN9 A;  1XMQ E;  1P47 A;  1TF3 A;  2L2K B;  4DV0 E;  3HPZ A;  2EPO A;  2DLQ A;  2JR1 A;  4DV7 E;  2EN6 A;  2CT1 A;  2EMY A;  2VE7 C;  1WJP A;  2L33 A;  1DGC A;  4B3R E;  3IWC A;  2EOF A;  2YPN A;  2EQ3 A;  5LLQ A;  4LF4 E;  2H36 X;  4LFC E;  2ODR D;  1IBL E;  5LMU E;  1KJK A;  2R76 A;  1IBM E;  1T4L B;  4L8N A;  2EOE A;  2HGH A;  1ZU1 A;  4O5G A;  3IWB A;  1X6E A;  2HHH E;  2RPC A;  2RSI A;  2YTE A;  3H09 A;  5A6K A;  2EM3 A;  5KL6 A;  1I94 E;  5A6J A;  2EN1 A;  2LRS A;  4I8O A;  1YYK A;  4LF5 E;  1A1J A;  3ADJ A;  2EOX A;  2UXC E;  2EPX A;  3BF2 A;  1UIL A;  2LV2 A;  2Q8U A;  2EPL X;  3OML A;  2EN2 A;  4JI4 E;  4R2C A;  1JK2 A;  4DR1 E;  5LMN E;  2LO3 A;  1X3C A;  2LTR A;  2EOY A;  2E5L E;  4DV3 E;  2L6M A;  2EL4 A;  3F6H A;  2PRT A;  4DR4 E;  4O43 A;  2ENC A;  2EPZ A;  2YTO A;  3ADG A;  4GEQ B;  4NHR A;  4R2E A;  3C6M A;  2LCE A;  4DMI A;  1YPN A;  4Q28 A;  4KHP E;  1N36 E;  4LTY A;  3ZOQ B;  2EOZ A;  2L3C A;  4HEI A;  2F8B A;  4JI8 E;  2YTD A;  4NXM E;  4BC9 A;  1RQ0 A;  1WRJ A;  1FKA E;  2MC6 A;  1XNR E;  5BR8 E;  2EM6 A;  1STU A;  4JI7 E;  2EN3 A;  2L8T A;  2B7T A;  2ODR C;  1A1L A;  3VYX A;  1N33 E;  2LUP B;  4P7D A;  2RSM A;  3THO B;  2DRP A;  2I13 A;  5KL2 A;  3DF6 A;  2JVA A;  2EM4 A;  3AUZ A;  2V85 A;  1KYQ A;  1PJS A;  2HC5 A;  2EOS A;  4Q35 B;  5IT9 C;  1X6F A;  1T39 A;  5AC5 A;  1LLM C;  2MKN A;  4F6M A;  3KZZ A;  3MHH C;  2YU8 A;  2B7V A;  1HNZ E;  1X6H A;  3MSW A;  5AAS A;  2EE8 A;  2EP3 A;  3C4B A;  2UUC E;  3VK6 A;  3VYY A;  1QU6 A;  1X47 A;  4BHB A;  1TF6 A;  1YFH A;  1MGT A;  2NUF A;  2ADR A;  5DNY A;  4RHB B;  2JY9 A;  2EQ0 A;  2DSY A;  2EMF A;  2LUQ A;  2RTX A;  3JU0 A;  1G2D C;  4X66 E;  2UXB E;  3LLH A;  2FGG A;  1GTK A;  1YUJ A;  4R2S A;  4JI1 E;  2G7H A;  3UK3 C;  2L2M A;  2YTI A;  3ADI A;  4F9B B;  5LL6 R;  1A1G A;  2LT7 A;  2EM9 A;  3T1Y E;  4TUG A;  2YU5 A;  1ZAA C;  2EJ4 A; 
#chains in the Genus database with same CATH homology
 4B3S E;  2CPN A;  2WZO A;  3JTZ A;  5LMN E;  4DR1 E;  1HNX E;  4B3M E;  1YYO A;  2VQE E;  3F6G A;  2V83 A;  3KWR A;  1DQ3 A;  4BS9 A;  4M30 A;  4DUZ E;  2EWL A;  4JI3 E;  2KON A;  2E1M A;  2LTR A;  4LF7 E;  1ZBQ A;  2MC5 A;  2E5L E;  1XNQ E;  4NXN E;  4DV3 E;  4DR5 E;  4WFT A;  3JAM C;  4WPY A;  1SR9 A;  2L6M A;  1UHZ A;  2M4I A;  3F6H A;  4BCA A;  2EZ6 A;  1PKP A;  2LE2 A;  3HQ1 A;  4R8O A;  1WXR A;  4F9A B;  4M2Z A;  4K0K E;  4JI6 E;  2V86 A;  4R03 A;  4DR3 E;  3J80 C;  4DR4 E;  4GEQ B;  4DR2 E;  3ADG A;  4WYQ B;  4LF6 E;  4DMI A;  2NUE A;  2N3G A;  2M7Q A;  4Q28 A;  1EKZ A;  4JI0 E;  4KHP E;  2KOU A;  2DMY A;  3LML A;  2YZT A;  5FLX C;  1XMO E;  4X62 E;  1N36 E;  1N32 E;  2L3J A;  4LTY A;  3ZOQ B;  4DR7 E;  3OTO E;  2N3H A;  4X64 E;  4LF9 E;  4WSP A;  2JOB A;  1T4N A;  2L3C A;  2B3T B;  4BMJ A;  3FIG A;  2DB2 A;  4DV5 E;  1DI2 A;  4LU9 A;  5CFF E;  3C4T A;  4YHH E;  1YYW A;  2F8B A;  2L92 A;  4JI8 E;  1J26 A;  4JYA E;  2LMZ A;  4NXM E;  4BC9 A;  2V87 A;  3HXL A;  4DV4 E;  1RQ0 A;  4JI2 E;  4DR6 E;  5AE2 A;  4JV5 E;  2YT4 A;  1FKA E;  1HNW E;  2MC6 A;  2MDR A;  5A2Q C;  5BR8 E;  5IWA E;  4TUI A;  1XNR E;  2K4V A;  5AE1 A;  1RC7 A;  4B3T E;  2V88 A;  1STU A;  3K6Q A;  4JI7 E;  2B9D A;  4YY3 E;  4LFA E;  2L8T A;  2B7T A;  3J7Y p;  2ODR C;  3VYX A;  4GKK E;  1N33 E;  2JOX A;  2NUG A;  2IHR 1;  5T6J A;  4P78 A;  4P7D A;  4F54 A;  2LUP B;  4DUY E;  4LF8 E;  2RS6 A;  1FJG E;  3HTX A;  2RSM A;  4DV6 E;  4BBY A;  1XMQ E;  1HR0 E;  2UXD E;  3DF6 A;  3J7A G;  4KZS A;  2L2K B;  4DV0 E;  2JVA A;  1N34 E;  2M1S A;  2UUA E;  3HPZ A;  1T4O A;  4DKK A;  4DV7 E;  2JR1 A;  4X65 E;  3AUZ A;  2FV4 B;  2UUB E;  2V85 A;  2L2N A;  4DV1 E;  2VE7 C;  2DIX A;  2VQF E;  2LBS B;  5IT9 C;  2L33 A;  4JI5 E;  4BC7 A;  2NA2 A;  4B3R E;  3IWC A;  2ZM6 E;  3J81 C;  4L5N C;  2UU9 E;  2B7V A;  2RS7 A;  4AQY E;  1HNZ E;  3MSW A;  3IWD A;  4LF4 E;  5AAS A;  2H36 X;  4F9C B;  4LFC E;  5AE3 A;  2ODR D;  3C4B A;  2FTX B;  1IBL E;  2UUC E;  1WHQ A;  3VK6 A;  5LMU E;  1J5E E;  3VYY A;  1IBM E;  1T4L B;  4L8N A;  4LFB E;  1QU6 A;  1X47 A;  2VF1 A;  2NUF A;  5ADZ A;  5DNY A;  1O0W A;  1YZ9 A;  3IWB A;  1ZBT A;  2JY9 A;  3DJW A;  1GZ6 A;  2DSY A;  2LUQ A;  2RTX A;  3JU0 A;  3ADL A;  2HHH E;  4X66 E;  2UXB E;  3LLH A;  2JWO A;  2V8Q B;  3H09 A;  5F3W A;  2FGG A;  2LTS A;  1X48 A;  2KHX A;  1I94 E;  3P1X A;  2G7H A;  4JI1 E;  2F4V E;  2LRS A;  4I8O A;  1GQE A;  4LF5 E;  1YYK A;  3T1H E;  1WHN A;  4M0V A;  4OX9 E;  3RMP A;  4OOG C;  2L2M A;  3AV0 A;  3ADI A;  4F9B B;  4X8W A;  2LJH A;  3ADJ A;  5LL6 R;  2UXC E;  4DV2 E;  4GKJ E;  1UIL A;  3HPS A;  3OML A;  4TUG A;  3T1Y E;  1IBK E;  4JI4 E;  2V89 A;  4J8Z A;  1X49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...