4F9BB

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Cell division cycle 7-related protein kinase
total genus 16
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9bB02
4F9AB 4F9BB 4F9CB
chains in the Genus database with same CATH superfamily
5AC5A 2V87A 2LV2A 4WYQB 2RSIA 1T39A 1IQSA 3J80C 2FTXB 4DR1E 3QG5C 2YTGA 1WRJA 2L8TA 2H36X 2ODRC 3EPJA 1LLMC 2LBSB 2EMFA 1DI2A 2YTQA 2BB8A 4WXDA 2I9IA 2RS7A 4LF6E 1IMUA 2F4VE 3EQ1A 4KZSA 4BBYA 5BR8E 4DV0E 3BBGA 1YFHA 4MLQA 1HR0E 4NXNE 2L6MA 5KL7A 5KL6A 1ZBQA 4O5GA 2VF1A 4K0KE 2UXBE 2EM2A 4DR6E 2L33A 4DV5E 4LFBE 3KZZA 2MDRA 2V85A 4LTYA 4LFAE 4OX9E 3RMPA 2EP3A 2M7QA 2EN7A 4JYAE 4J8ZA 1DQ3A 2EOHA 5CFFE 1XMOE 1A1GA 1X48A 5A6JA 4M0VA 3AV0A 3J7AG 2J7JA 5IT9C 4B3TE 1UN6B 2ELZA 2EM7A 2NUEA 2HGHA 3DF6A 1HNZE 4P78A 3LLHA 4N4RB 4O4KA 4X9JA 1ZBTA 1ZU1A 4KHPE 2EMGA 1J5EE 2FGGA 1QU6A 4BS9A 2NABA 1TF3A 5IV8B 4M9VC 4LF5E 1DGCA 1N32E 4LF8E 4F54A 4DV3E 2YTEA 1A1FA 2B9DA 1PJSA 2EMKA 2UUAE 2CPNA 2EZ6A 3ECRA 2EM9A 2VQEE 2YU8A 2EORA 3IWDA 3THOB 3VYYA 4LFCE 1X6FA 2EQ1A 2EOFA 1T4OA 2R76A 2EE8A 1MGTA 2D9HA 3BF2A 3C6MA 2YU5A 4ZYEA 4HEIA 4YHHE 3T1HE 2DB2A 2VRDA 2WZOA 4I8OA 2EWLA 4RH8A 2EOEA 1JK1A 1GQEA 2ODRD 2Q8UA 1X3CA 2YRKA 1X5WA 4OOGC 2JOBA 4X62E 1I94E 4JI8E 4F6MA 4DUZE 3C6KA 2LTRA 2MKNA 1HNXE 3ADIA 2EOZA 4MLVA 1IBKE 1N36E 2EOMA 1T4LB 4JI2E 2LUPB 2VQFE 3C4TA 5TSEA 2GLIA 2EMCA 2MKDA 2M1SA 2B7VA 1PJQA 3AUZA 2WBTA 2PRTA 5KL5A 1YYWA 4R2AA 2EPCA 1J26A 2EM8A 2YRHA 2V88A 2UXCE 4TUGA 2EMWA 1GZ6A 3VK6A 1T38A 2RSMA 4X66E 2JWOA 5IWAE 2ADRA 4X64E 4R2EA 5KL3A 4DR3E 4P7DA 3JTZA 2E1MA 2B3TB 2JR1A 2EN1A 2CSHA 1Z1BA 3F6HA 1EH7A 4WSGA 4DV2E 2RS6A 5T6JA 3KWRA 3HTXA 4DR7E 2LO3A 3OMLA 2N3GA 1A1LA 4B3RE 1YPNA 5A6BA 1KJKA 2EN6A 4F2JC 4BHCA 1A1IA 1YUIA 2MDGA 1N3GA 1SFEA 2EPRA 2LTSA 5A2QC 2CT1A 3ADJA 3F6GA 4JV5E 1BB8A 4YY3E 3HPZA 5FLXC 4R2QA 2EOXA 2EN8A 4JI7E 2YTIA 2DIXA 2YTFA 2EM0A 1NEIA 4DV4E 1AAYA 2VE7C 2L2KB 3ZOQB 2EPMX 3IWBA 2ENCA 1IBLE 1T4NA 2YTDA 2EMBA 3HXLA 2MC5A 1A1JA 4IJDA 4DMIA 1KYQA 2LCEA 4JI0E 3ADLA 2NUGA 1PKPA 2EMZA 3H09A 5ADZA 1EH6A 1O0WA 2DMYA 2N3HA 2EJ4A 1STUA 2EL6A 4LF4E 1X49A 2GPIA 2L3CA 4B3ME 2EOQA 4ZYDA 4WFTA 1FJGE 2EPXA 4TUIA 4DV1E 4DR2E 4Q35B 4X65E 2LT7A 1UBDC 4Q28A 1YZ9A 2UXDE 2WBUA 2YRMA 2CTDA 2JVAA 2YTPA 4B3SE 4M2ZA 3J81C 4R2PA 2L92A 2M9AA 2JYAA 3L00A 2EM5A 1NCSA 2F8BA 1WXRA 2EMIA 4DR4E 5F3WA 3MHSC 2L2MA 2NA2A 4GZNC 2EM3A 1XNRE 2V86A 3C4BA 4BMJA 3VHTB 1N33E 2ZM6E 1B69A 5LLQA 2YTJA 2EL4A 5LMUE 2EOSA 1TN9A 2EM6A 2NUFA 2KHXA 1ZR9A 2K7IA 2YSOA 3EPLA 1A1HA 4JI6E 2EQ3A 4DR5E 1MEYC 2YPNA 2L2NA 1X47A 4BC7A 2WCC3 4AQYE 2B7TA 2R1FA 2WBSA 4IS1C 1YUJA 3J7Yp 2EQ0A 2LJUA 2FV4B 2EMYA 2LRSA 2RTXA 4R2DA 2JP9A 4JI1E 4NZVA 2EMXA 2UU9E 5AASA 2UUBE 4LF9E 2KOUA 1WJPA 3HPSA 3DJWA 2LVHA 2V89A 1FKAE 4JI5E 1F2IG 4RHBB 4WPYA 5AE1A 2M4IA 4NHRA 4GKJE 3EPHA 1A1KA 4HTGA 1P47A 2EPLX 1EKZA 1TF6A 2EOJA 4L8NA 5DNYA 4DKKA 4WSPA 3JAMC 2LMZA 2EOYA 2EPKX 5LL6R 5IXMB 2DMIA 2YWQA 3MSWA 2LJHA 4WXCA 2L3JA 2DLQA 2GHFA 4LF7E 4R03A 2JY9A 2EOIA 1BBGA 2EL5A 3UK3C 1RQ0A 5AE3A 4M30A 3JU0A 1WHQA 2EOOA 2HHHE 2RPCA 2I13A 3THNA 2UUCE 4WX9A 2RQLA 5A6AA 4DV6E 2EN2A 2E72A 1JK2A 1L4SA 2EPPA 2EN4A 4LU9A 2V8QB 2EPNA 2YT4A 3IWCA 4BCAA 2YZTA 4JI3E 1HNWE 4GEQB 2N8XA 4BC9A 2BBGA 4R2RA 1X6EA 2YTOA 1IQOA 5KL2A 4R2SA 5KL4A 4KWYA 1G2DC 4R2CA 2JOXA 2JXPA 3MHHC 1N34E 1YSAC 4L5NC 2EM4A 2EMLA 1PJTA 1EH8A 4R8OA 1BBOA 2DLKA 5A6KA 3TQMA 4DV7E 2EMAA 2DRPA 5A69A 3BGHA 3M99B 5AC4A 1RMDA 2MC6A 4DUYE 2EPAA 1QNTA 2EPUA 2ENAA 1YYOA 1UILA 3FIGA 4F6NA 1UHZA 2HC5A 5AE2A 5A6BD 1XNQE 4BHBA 4NXME 2IHR1 1AH5A 1WHNA 1XMQE 2LUQA 4GKKE 1X6HA 2A25A 1SR9A 4FK5C 4O24A 1GTKA 3OTOE 2EN3A 1RC7A 4ZYHA 3P1XA 2DGCA 1ZAAC 2DSYA 4F9CB 2E5LE 3EPKA 2YSPA 2EPOA 2YTNA 3K6QA 1YYKA 3HQ1A 4JI4E 2ELYA 2V83A 2LE2A 3LMLA 4ZYGA 4O43A 4F9AB 3BIDA 2EMHA 2EPZA 3KZYA 1G2FC 3ADGA 4X8WA 1IBME 2HJJA 5LMNE 2KONA 4F9BB 2JPAA 2ENHA 1PDAA 3T1YE 2G7HA 3VYXA 2K4VA
chains in the Genus database with same CATH topology
1PKPA 4DUZE 3H09A 5ADZA 2V87A 2LTRA 1HNXE 3ADIA 1O0WA 2DMYA 2N3HA 1RQ0A 4WYQB 5AE3A 1IBKE 1STUA 3JU0A 1WHQA 4M30A 1N36E 2HHHE 4LF4E 1T4LB 4JI2E 3J80C 2LUPB 2FTXB 2UUCE 1X49A 2VQFE 2L3CA 4DV6E 4B3ME 3C4TA 4DR1E 4WFTA 2M1SA 1FJGE 2B7VA 2L8TA 4TUIA 4LU9A 2H36X 2V8QB 2YT4A 2ODRC 3AUZA 3IWCA 4DV1E 4DR2E 4X65E 2LBSB 2UXDE 4Q28A 4BCAA 1YZ9A 1DI2A 1YYWA 2YZTA 4B3SE 2JVAA 4JI3E 4GEQB 4M2ZA 4BC9A 3J81C 1HNWE 1J26A 2RS7A 4LF6E 2L92A 2F4VE 2V88A 2UXCE 4TUGA 2F8BA 4KZSA 4BBYA 1GZ6A 5BR8E 1WXRA 4DV0E 3VK6A 4DR4E 5F3WA 2JOXA 2RSMA 4X66E 2JWOA 1HR0E 4NXNE 2L6MA 5IWAE 2L2MA 2NA2A 4X64E 1ZBQA 1N34E 2VF1A 1XNRE 4K0KE 4L5NC 2UXBE 2V86A 3C4BA 4BMJA 4R8OA 4P7DA 4DR3E 4DR6E 1N33E 3JTZA 2L33A 2ZM6E 4DV5E 4LFBE 2V85A 2MDRA 4LTYA 4LFAE 2E1MA 4DV7E 4OX9E 5LMUE 3RMPA 2B3TB 2JR1A 2NUFA 2KHXA 2M7QA 3F6HA 4JYAE 4J8ZA 1DQ3A 4DV2E 2RS6A 5T6JA 5CFFE 1XMOE 4JI6E 2MC6A 4DR5E 1X48A 3KWRA 4DUYE 3HTXA 4M0VA 3AV0A 3J7AG 5IT9C 4B3TE 1YYOA 1UILA 3FIGA 4DR7E 2L2NA 1X47A 1UHZA 4BC7A 5AE2A 4AQYE 1XNQE 2NUEA 3OMLA 2B7TA 2N3GA 4NXME 2IHR1 3DF6A 1HNZE 4P78A 4B3RE 3J7Yp 3LLHA 1WHNA 2FV4B 1XMQE 2LRSA 2LUQA 1ZBTA 4KHPE 4GKKE 2RTXA 1J5EE 1SR9A 2LTSA 2FGGA 4JI1E 1QU6A 4BS9A 5A2QC 3OTOE 1IBLE 2UU9E 5AASA 2UUBE 3ADJA 4LF5E 1N32E 4LF8E 3F6GA 4F54A 1RC7A 4DV3E 2KOUA 4YY3E 4LF9E 4JV5E 3P1XA 3HPZA 2B9DA 3HPSA 2UUAE 2DSYA 2CPNA 5FLXC 4F9CB 2EZ6A 2VQEE 2NUGA 3DJWA 2E5LE 3IWDA 4JI7E 3VYYA 4LFCE 2V89A 1FKAE 3K6QA 4JI5E 2DIXA 1YYKA 3HQ1A 4JI4E 4WPYA 5AE1A 2M4IA 2V83A 4DV4E 1T4OA 2LE2A 3LMLA 2VE7C 2L2KB 3ZOQB 4GKJE 4F9AB 3IWBA 4YHHE 3T1HE 1EKZA 2DB2A 4L8NA 5DNYA 1T4NA 4DKKA 3ADGA 4WSPA 3HXLA 2WZOA 2LMZA 4I8OA 4X8WA 3JAMC 2MC5A 2EWLA 5LL6R 1IBME 5LMNE 4DMIA 3MSWA 2KONA 4F9BB 2LJHA 1GQEA 2L3JA 3T1YE 2ODRD 4JI0E 1I94E 4LF7E 3ADLA 4R03A 2JY9A 4OOGC 2G7HA 2JOBA 4X62E 3VYXA 2K4VA 4JI8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9A B;  4F9B B;  4F9C B; 
#chains in the Genus database with same CATH topology
 5AC5 A;  2V87 A;  2LV2 A;  4WYQ B;  2RSI A;  1T39 A;  1IQS A;  3J80 C;  2FTX B;  4DR1 E;  3QG5 C;  2YTG A;  1WRJ A;  2L8T A;  2H36 X;  2ODR C;  3EPJ A;  1LLM C;  2LBS B;  2EMF A;  1DI2 A;  2YTQ A;  2BB8 A;  4WXD A;  2I9I A;  2RS7 A;  4LF6 E;  1IMU A;  2F4V E;  3EQ1 A;  4KZS A;  4BBY A;  5BR8 E;  4DV0 E;  3BBG A;  1YFH A;  4MLQ A;  1HR0 E;  4NXN E;  2L6M A;  5KL7 A;  5KL6 A;  1ZBQ A;  4O5G A;  2VF1 A;  4K0K E;  2UXB E;  2EM2 A;  4DR6 E;  2L33 A;  4DV5 E;  4LFB E;  3KZZ A;  2MDR A;  2V85 A;  4LTY A;  4LFA E;  4OX9 E;  3RMP A;  2EP3 A;  2M7Q A;  2EN7 A;  4JYA E;  4J8Z A;  1DQ3 A;  2EOH A;  5CFF E;  1XMO E;  1A1G A;  1X48 A;  5A6J A;  4M0V A;  3AV0 A;  3J7A G;  2J7J A;  5IT9 C;  4B3T E;  1UN6 B;  2ELZ A;  2EM7 A;  2NUE A;  2HGH A;  3DF6 A;  1HNZ E;  4P78 A;  3LLH A;  4N4R B;  4O4K A;  4X9J A;  1ZBT A;  1ZU1 A;  4KHP E;  2EMG A;  1J5E E;  2FGG A;  1QU6 A;  4BS9 A;  2NAB A;  1TF3 A;  5IV8 B;  4M9V C;  4LF5 E;  1DGC A;  1N32 E;  4LF8 E;  4F54 A;  4DV3 E;  2YTE A;  1A1F A;  2B9D A;  1PJS A;  2EMK A;  2UUA E;  2CPN A;  2EZ6 A;  3ECR A;  2EM9 A;  2VQE E;  2YU8 A;  2EOR A;  3IWD A;  3THO B;  3VYY A;  4LFC E;  1X6F A;  2EQ1 A;  2EOF A;  1T4O A;  2R76 A;  2EE8 A;  1MGT A;  2D9H A;  3BF2 A;  3C6M A;  2YU5 A;  4ZYE A;  4HEI A;  4YHH E;  3T1H E;  2DB2 A;  2VRD A;  2WZO A;  4I8O A;  2EWL A;  4RH8 A;  2EOE A;  1JK1 A;  1GQE A;  2ODR D;  2Q8U A;  1X3C A;  2YRK A;  1X5W A;  4OOG C;  2JOB A;  4X62 E;  1I94 E;  4JI8 E;  4F6M A;  4DUZ E;  3C6K A;  2LTR A;  2MKN A;  1HNX E;  3ADI A;  2EOZ A;  4MLV A;  1IBK E;  1N36 E;  2EOM A;  1T4L B;  4JI2 E;  2LUP B;  2VQF E;  3C4T A;  5TSE A;  2GLI A;  2EMC A;  2MKD A;  2M1S A;  2B7V A;  1PJQ A;  3AUZ A;  2WBT A;  2PRT A;  5KL5 A;  1YYW A;  4R2A A;  2EPC A;  1J26 A;  2EM8 A;  2YRH A;  2V88 A;  2UXC E;  4TUG A;  2EMW A;  1GZ6 A;  3VK6 A;  1T38 A;  2RSM A;  4X66 E;  2JWO A;  5IWA E;  2ADR A;  4X64 E;  4R2E A;  5KL3 A;  4DR3 E;  4P7D A;  3JTZ A;  2E1M A;  2B3T B;  2JR1 A;  2EN1 A;  2CSH A;  1Z1B A;  3F6H A;  1EH7 A;  4WSG A;  4DV2 E;  2RS6 A;  5T6J A;  3KWR A;  3HTX A;  4DR7 E;  2LO3 A;  3OML A;  2N3G A;  1A1L A;  4B3R E;  1YPN A;  5A6B A;  1KJK A;  2EN6 A;  4F2J C;  4BHC A;  1A1I A;  1YUI A;  2MDG A;  1N3G A;  1SFE A;  2EPR A;  2LTS A;  5A2Q C;  2CT1 A;  3ADJ A;  3F6G A;  4JV5 E;  1BB8 A;  4YY3 E;  3HPZ A;  5FLX C;  4R2Q A;  2EOX A;  2EN8 A;  4JI7 E;  2YTI A;  2DIX A;  2YTF A;  2EM0 A;  1NEI A;  4DV4 E;  1AAY A;  2VE7 C;  2L2K B;  3ZOQ B;  2EPM X;  3IWB A;  2ENC A;  1IBL E;  1T4N A;  2YTD A;  2EMB A;  3HXL A;  2MC5 A;  1A1J A;  4IJD A;  4DMI A;  1KYQ A;  2LCE A;  4JI0 E;  3ADL A;  2NUG A;  1PKP A;  2EMZ A;  3H09 A;  5ADZ A;  1EH6 A;  1O0W A;  2DMY A;  2N3H A;  2EJ4 A;  1STU A;  2EL6 A;  4LF4 E;  1X49 A;  2GPI A;  2L3C A;  4B3M E;  2EOQ A;  4ZYD A;  4WFT A;  1FJG E;  2EPX A;  4TUI A;  4DV1 E;  4DR2 E;  4Q35 B;  4X65 E;  2LT7 A;  1UBD C;  4Q28 A;  1YZ9 A;  2UXD E;  2WBU A;  2YRM A;  2CTD A;  2JVA A;  2YTP A;  4B3S E;  4M2Z A;  3J81 C;  4R2P A;  2L92 A;  2M9A A;  2JYA A;  3L00 A;  2EM5 A;  1NCS A;  2F8B A;  1WXR A;  2EMI A;  4DR4 E;  5F3W A;  3MHS C;  2L2M A;  2NA2 A;  4GZN C;  2EM3 A;  1XNR E;  2V86 A;  3C4B A;  4BMJ A;  3VHT B;  1N33 E;  2ZM6 E;  1B69 A;  5LLQ A;  2YTJ A;  2EL4 A;  5LMU E;  2EOS A;  1TN9 A;  2EM6 A;  2NUF A;  2KHX A;  1ZR9 A;  2K7I A;  2YSO A;  3EPL A;  1A1H A;  4JI6 E;  2EQ3 A;  4DR5 E;  1MEY C;  2YPN A;  2L2N A;  1X47 A;  4BC7 A;  2WCC 3;  4AQY E;  2B7T A;  2R1F A;  2WBS A;  4IS1 C;  1YUJ A;  3J7Y p;  2EQ0 A;  2LJU A;  2FV4 B;  2EMY A;  2LRS A;  2RTX A;  4R2D A;  2JP9 A;  4JI1 E;  4NZV A;  2EMX A;  2UU9 E;  5AAS A;  2UUB E;  4LF9 E;  2KOU A;  1WJP A;  3HPS A;  3DJW A;  2LVH A;  2V89 A;  1FKA E;  4JI5 E;  1F2I G;  4RHB B;  4WPY A;  5AE1 A;  2M4I A;  4NHR A;  4GKJ E;  3EPH A;  1A1K A;  4HTG A;  1P47 A;  2EPL X;  1EKZ A;  1TF6 A;  2EOJ A;  4L8N A;  5DNY A;  4DKK A;  4WSP A;  3JAM C;  2LMZ A;  2EOY A;  2EPK X;  5LL6 R;  5IXM B;  2DMI A;  2YWQ A;  3MSW A;  2LJH A;  4WXC A;  2L3J A;  2DLQ A;  2GHF A;  4LF7 E;  4R03 A;  2JY9 A;  2EOI A;  1BBG A;  2EL5 A;  3UK3 C;  1RQ0 A;  5AE3 A;  4M30 A;  3JU0 A;  1WHQ A;  2EOO A;  2HHH E;  2RPC A;  2I13 A;  3THN A;  2UUC E;  4WX9 A;  2RQL A;  5A6A A;  4DV6 E;  2EN2 A;  2E72 A;  1JK2 A;  1L4S A;  2EPP A;  2EN4 A;  4LU9 A;  2V8Q B;  2EPN A;  2YT4 A;  3IWC A;  4BCA A;  2YZT A;  4JI3 E;  1HNW E;  4GEQ B;  2N8X A;  4BC9 A;  2BBG A;  4R2R A;  1X6E A;  2YTO A;  1IQO A;  5KL2 A;  4R2S A;  5KL4 A;  4KWY A;  1G2D C;  4R2C A;  2JOX A;  2JXP A;  3MHH C;  1N34 E;  1YSA C;  4L5N C;  2EM4 A;  2EML A;  1PJT A;  1EH8 A;  4R8O A;  1BBO A;  2DLK A;  5A6K A;  3TQM A;  4DV7 E;  2EMA A;  2DRP A;  5A69 A;  3BGH A;  3M99 B;  5AC4 A;  1RMD A;  2MC6 A;  4DUY E;  2EPA A;  1QNT A;  2EPU A;  2ENA A;  1YYO A;  1UIL A;  3FIG A;  4F6N A;  1UHZ A;  2HC5 A;  5AE2 A;  5A6B D;  1XNQ E;  4BHB A;  4NXM E;  2IHR 1;  1AH5 A;  1WHN A;  1XMQ E;  2LUQ A;  4GKK E;  1X6H A;  2A25 A;  1SR9 A;  4FK5 C;  4O24 A;  1GTK A;  3OTO E;  2EN3 A;  1RC7 A;  4ZYH A;  3P1X A;  2DGC A;  1ZAA C;  2DSY A;  4F9C B;  2E5L E;  3EPK A;  2YSP A;  2EPO A;  2YTN A;  3K6Q A;  1YYK A;  3HQ1 A;  4JI4 E;  2ELY A;  2V83 A;  2LE2 A;  3LML A;  4ZYG A;  4O43 A;  4F9A B;  3BID A;  2EMH A;  2EPZ A;  3KZY A;  1G2F C;  3ADG A;  4X8W A;  1IBM E;  2HJJ A;  5LMN E;  2KON A;  4F9B B;  2JPA A;  2ENH A;  1PDA A;  3T1Y E;  2G7H A;  3VYX A;  2K4V A; 
#chains in the Genus database with same CATH homology
 1PKP A;  4DUZ E;  3H09 A;  5ADZ A;  2V87 A;  2LTR A;  1HNX E;  3ADI A;  1O0W A;  2DMY A;  2N3H A;  1RQ0 A;  4WYQ B;  5AE3 A;  1IBK E;  1STU A;  3JU0 A;  1WHQ A;  4M30 A;  1N36 E;  2HHH E;  4LF4 E;  1T4L B;  4JI2 E;  3J80 C;  2LUP B;  2FTX B;  2UUC E;  1X49 A;  2VQF E;  2L3C A;  4DV6 E;  4B3M E;  3C4T A;  4DR1 E;  4WFT A;  2M1S A;  1FJG E;  2B7V A;  2L8T A;  4TUI A;  4LU9 A;  2H36 X;  2V8Q B;  2YT4 A;  2ODR C;  3AUZ A;  3IWC A;  4DV1 E;  4DR2 E;  4X65 E;  2LBS B;  2UXD E;  4Q28 A;  4BCA A;  1YZ9 A;  1DI2 A;  1YYW A;  2YZT A;  4B3S E;  2JVA A;  4JI3 E;  4GEQ B;  4M2Z A;  4BC9 A;  3J81 C;  1HNW E;  1J26 A;  2RS7 A;  4LF6 E;  2L92 A;  2F4V E;  2V88 A;  2UXC E;  4TUG A;  2F8B A;  4KZS A;  4BBY A;  1GZ6 A;  5BR8 E;  1WXR A;  4DV0 E;  3VK6 A;  4DR4 E;  5F3W A;  2JOX A;  2RSM A;  4X66 E;  2JWO A;  1HR0 E;  4NXN E;  2L6M A;  5IWA E;  2L2M A;  2NA2 A;  4X64 E;  1ZBQ A;  1N34 E;  2VF1 A;  1XNR E;  4K0K E;  4L5N C;  2UXB E;  2V86 A;  3C4B A;  4BMJ A;  4R8O A;  4P7D A;  4DR3 E;  4DR6 E;  1N33 E;  3JTZ A;  2L33 A;  2ZM6 E;  4DV5 E;  4LFB E;  2V85 A;  2MDR A;  4LTY A;  4LFA E;  2E1M A;  4DV7 E;  4OX9 E;  5LMU E;  3RMP A;  2B3T B;  2JR1 A;  2NUF A;  2KHX A;  2M7Q A;  3F6H A;  4JYA E;  4J8Z A;  1DQ3 A;  4DV2 E;  2RS6 A;  5T6J A;  5CFF E;  1XMO E;  4JI6 E;  2MC6 A;  4DR5 E;  1X48 A;  3KWR A;  4DUY E;  3HTX A;  4M0V A;  3AV0 A;  3J7A G;  5IT9 C;  4B3T E;  1YYO A;  1UIL A;  3FIG A;  4DR7 E;  2L2N A;  1X47 A;  1UHZ A;  4BC7 A;  5AE2 A;  4AQY E;  1XNQ E;  2NUE A;  3OML A;  2B7T A;  2N3G A;  4NXM E;  2IHR 1;  3DF6 A;  1HNZ E;  4P78 A;  4B3R E;  3J7Y p;  3LLH A;  1WHN A;  2FV4 B;  1XMQ E;  2LRS A;  2LUQ A;  1ZBT A;  4KHP E;  4GKK E;  2RTX A;  1J5E E;  1SR9 A;  2LTS A;  2FGG A;  4JI1 E;  1QU6 A;  4BS9 A;  5A2Q C;  3OTO E;  1IBL E;  2UU9 E;  5AAS A;  2UUB E;  3ADJ A;  4LF5 E;  1N32 E;  4LF8 E;  3F6G A;  4F54 A;  1RC7 A;  4DV3 E;  2KOU A;  4YY3 E;  4LF9 E;  4JV5 E;  3P1X A;  3HPZ A;  2B9D A;  3HPS A;  2UUA E;  2DSY A;  2CPN A;  5FLX C;  4F9C B;  2EZ6 A;  2VQE E;  2NUG A;  3DJW A;  2E5L E;  3IWD A;  4JI7 E;  3VYY A;  4LFC E;  2V89 A;  1FKA E;  3K6Q A;  4JI5 E;  2DIX A;  1YYK A;  3HQ1 A;  4JI4 E;  4WPY A;  5AE1 A;  2M4I A;  2V83 A;  4DV4 E;  1T4O A;  2LE2 A;  3LML A;  2VE7 C;  2L2K B;  3ZOQ B;  4GKJ E;  4F9A B;  3IWB A;  4YHH E;  3T1H E;  1EKZ A;  2DB2 A;  4L8N A;  5DNY A;  1T4N A;  4DKK A;  3ADG A;  4WSP A;  3HXL A;  2WZO A;  2LMZ A;  4I8O A;  4X8W A;  3JAM C;  2MC5 A;  2EWL A;  5LL6 R;  1IBM E;  5LMN E;  4DMI A;  3MSW A;  2KON A;  4F9B B;  2LJH A;  1GQE A;  2L3J A;  3T1Y E;  2ODR D;  4JI0 E;  1I94 E;  4LF7 E;  3ADL A;  4R03 A;  2JY9 A;  4OOG C;  2G7H A;  2JOB A;  4X62 E;  3VYX A;  2K4V A;  4JI8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...