4F9BB

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9bB02
4F9BB 4F9CB 4F9AB
chains in the Genus database with same CATH superfamily
2IHR1 2GLIA 3J81C 3MHSC 2EN7A 4WSPA 4MLVA 2DB2A 1DQ3A 3EPLA 2B3TB 1YUJA 3IWCA 2YZTA 4DR6E 2I9IA 4DR5E 4JV5E 2BBGA 2NABA 2A25A 2DIXA 2E1MA 1PDAA 4DUZE 4I8OA 2MC6A 2WZOA 2EN1A 4NZVA 4ZYHA 3J7AG 3L00A 2EPKX 5A6JA 2DGCA 3EPKA 2LJHA 2EL5A 3BF2A 3T1HE 3JTZA 4RH8A 2K7IA 4DV4E 4JI0E 2ENCA 1X6HA 4M0VA 1UILA 4X65E 4X66E 1A1IA 2UXDE 4X8WA 1KYQA 3EPHA 2EM9A 4LTYA 2EM6A 2M1SA 5AC5A 2HC5A 2JR1A 2V83A 1N34E 2EORA 5KL7A 2EMZA 3RMPA 2YU8A 2EWLA 3LMLA 4DV0E 2JXPA 1IQSA 1UN6B 4F9AB 2EJ4A 1IBLE 4NXNE 3ECRA 1PJQA 2KHXA 1Z1BA 3TQMA 3H09A 2LRSA 2E72A 1TN9A 4WX9A 2R76A 4P7DA 4R2RA 1N36E 3F6GA 2B7VA 2V88A 2YTGA 1LLMC 3JU0A 4M9VC 5ADZA 2DSYA 4LF7E 1N33E 1ZR9A 1IMUA 2HHHE 2KONA 4LU9A 3IWDA 1A1KA 5LLQA 2EQ0A 2EMWA 2EM2A 2EMFA 5A2QC 1T4OA 4HTGA 2LTSA 4MLQA 3C4BA 2WCC3 2EOEA 1X6EA 2K4VA 2N3GA 1IQOA 1B69A 3BIDA 1DGCA 2DLKA 1JK1A 2EMAA 4DV7E 2Q8UA 2E5LE 2L3JA 1ZBTA 2YSPA 1ZU1A 2EPZA 4R03A 1A1LA 5AE1A 2B7TA 2V89A 3J80C 4O43A 2UU9E 4R2PA 2ODRC 5KL4A 1QU6A 4IJDA 4LF9E 3QG5C 2EPMX 1PJSA 4R8OA 1YZ9A 2YSOA 2YTQA 1XNQE 4LFBE 2EOFA 4WYQB 2WBUA 2LJUA 2I13A 1HR0E 2PRTA 2LBSB 2EMYA 1YSAC 5A6KA 2R1FA 4K0KE 5TSEA 2LO3A 3AUZA 3VK6A 3HPZA 2FGGA 2RQLA 4DV6E 2EN6A 2EE8A 1X49A 2EMCA 3C6MA 3K6QA 2EL6A 1FJGE 2BB8A 2EL4A 4BC9A 2DLQA 1EKZA 5LMNE 2EMKA 1G2DC 2FTXB 3VYXA 1MEYC 1J26A 2D9HA 4LF6E 2YTDA 2CPNA 4BMJA 2HJJA 2EMGA 2EMIA 2ENAA 2MDGA 1PKPA 2ELZA 2M9AA 4R2EA 2EP3A 4WFTA 2JVAA 2H36X 2EM0A 3C4TA 2L6MA 4YY3E 3J7Yp 3ADGA 1X47A 2YRKA 1PJTA 1MGTA 2M7QA 1HNXE 2FV4B 4NXME 3VHTB 4GEQB 1A1JA 4R2CA 2JPAA 3THOB 4R2SA 2B9DA 2EPRA 2EOHA 2RTXA 1SR9A 2EOOA 2NUFA 2LT7A 4M2ZA 3HPSA 2EOQA 1BBGA 2EN4A 2DRPA 2EQ3A 4LFAE 2CSHA 5KL5A 1G2FC 2JP9A 3KZYA 4DMIA 5A6AA 5IXMB 2CTDA 3MHHC 1IBKE 1YYWA 4L5NC 5IWAE 1X3CA 4J8ZA 1WHNA 2N8XA 1P47A 4JI3E 2WBSA 4ZYEA 2GPIA 2JY9A 1NEIA 1RMDA 2YTIA 1YYKA 2M4IA 4R2AA 2EPUA 3P1XA 4P78A 4WXCA 4F2JC 5BR8E 1WHQA 2EPPA 2DMIA 2F8BA 2YTPA 4BS9A 2UUCE 2EN3A 5AE2A 2G7HA 2RPCA 4R2DA 4JYAE 2UXCE 3KZZA 4BBYA 2ODRD 1EH7A 3DF6A 3HXLA 2EOZA 5AE3A 4DV2E 3ADIA 4DV5E 2EMXA 2LUPB 4BHBA 1X48A 1BB8A 1EH6A 4O5GA 2VQEE 5A6BD 1A1HA 4Q35B 1YUIA 2V85A 2V8QB 3ADLA 4B3ME 3DJWA 5KL3A 1YFHA 3BBGA 2YTOA 2EOIA 5AASA 2EOSA 1WRJA 2V87A 2LTRA 3OMLA 2EMBA 2RSMA 4JI8E 4RHBB 3IWBA 2JOBA 2HGHA 2L8TA 4TUIA 1I94E 4JI5E 1AAYA 2MDRA 4JI6E 3ADJA 2EPXA 5LL6R 4HEIA 3JAMC 5AC4A 2KOUA 2EPAA 4X62E 1GZ6A 1O0WA 2EM3A 1HNZE 4BCAA 5IT9C 1WJPA 4DR2E 2UXBE 2YU5A 1GQEA 2F4VE 2EN2A 2VRDA 2JYAA 2EOXA 4BC7A 2EPNA 1UHZA 4YHHE 4DKKA 1RC7A 2EM5A 2YTEA 2JOXA 2DMYA 4LFCE 1F2IG 2EPOA 4L8NA 1UBDC 2YRHA 1YPNA 2MKDA 2NA2A 2YTJA 1XMOE 2YRMA 1X5WA 2L2NA 2LVHA 1T4LB 5IV8B 2UUBE 4X9JA 2EM7A 2RS7A 4IS1C 1TF3A 1RQ0A 1T4NA 4TUGA 3M99B 4X64E 4GZNC 2YT4A 4KZSA 1ZBQA 4WXDA 4B3TE 2NUEA 3T1YE 1EH8A 2EOMA 4WSGA 2YPNA 4DR3E 1L4SA 4ZYGA 3MSWA 3OTOE 5FLXC 4OOGC 5A6BA 5F3WA 4B3RE 2LV2A 4F9CB 4OX9E 3EPJA 3LLHA 1FKAE 1T39A 1BBOA 2YTNA 2L92A 2UUAE 3KWRA 2YTFA 4DR4E 4DR1E 4Q28A 4F6MA 2V86A 3C6KA 3EQ1A 4JI2E 2EMHA 2ELYA 2MC5A 2L33A 1AH5A 3UK3C 1WXRA 2VF1A 1KJKA 1SFEA 4N4RB 2RSIA 1TF6A 4KHPE 1NCSA 4ZYDA 2J7JA 1YYOA 1XNRE 2NUGA 4KWYA 5KL2A 2L3CA 1DI2A 5DNYA 4LF5E 4AQYE 2EPLX 2RS6A 2EZ6A 1ZAAC 1X6FA 3ZOQB 1JK2A 4GKKE 5KL6A 3AV0A 4WPYA 4DR7E 2EM4A 4JI1E 4DUYE 3FIGA 1A1GA 2L2MA 2LCEA 4R2QA 4JI4E 1T38A 1GTKA 2N3HA 2VQFE 2JWOA 2EOJA 4F9BB 4F54A 2VE7C 5LMUE 4DV1E 2EM8A 4LF8E 2LE2A 2ZM6E 4FK5C 3HTXA 2EMLA 4GKJE 1J5EE 2GHFA 2EOYA 2CT1A 2L2KB 5A69A 1STUA 2MKNA 4JI7E 2LMZA 3BGHA 4B3SE 4LF4E 1QNTA 2EQ1A 3THNA 2EN8A 3HQ1A 5T6JA 1N3GA 1XMQE 4M30A 1A1FA 4NHRA 5CFFE 4O24A 2YWQA 3F6HA 4BHCA 2LUQA 4O4KA 3VYYA 1IBME 1HNWE 2EPCA 1N32E 2WBTA 4F6NA 4DV3E 2ENHA 2ADRA
chains in the Genus database with same CATH topology
2JOXA 2DMYA 4LFCE 1IBKE 2IHR1 1YYWA 4L8NA 4DV7E 3J81C 2E5LE 2L3JA 1ZBTA 4L5NC 2NA2A 1XMOE 5IWAE 4R03A 4WSPA 4J8ZA 2L2NA 1WHNA 2DB2A 1DQ3A 5AE1A 1T4LB 2B7TA 2B3TB 2UUBE 2V89A 4JI3E 3IWCA 2RS7A 2YZTA 3J80C 4DR6E 1RQ0A 2UU9E 1T4NA 4TUGA 2JY9A 2ODRC 4DR5E 1QU6A 4X64E 4JV5E 2YT4A 4KZSA 4LF9E 1ZBQA 4R8OA 4B3TE 1YZ9A 1XNQE 1YYKA 4LFBE 2M4IA 2DIXA 2E1MA 4WYQB 2NUEA 3T1YE 4DUZE 3P1XA 4I8OA 4DR3E 2MC6A 1HR0E 2WZOA 2LBSB 3J7AG 3MSWA 4P78A 5FLXC 4OOGC 3OTOE 5F3WA 4K0KE 4B3RE 4F9CB 4OX9E 3LLHA 1FKAE 3AUZA 5BR8E 2L92A 2LJHA 2UUAE 1WHQA 3KWRA 3VK6A 2F8BA 3HPZA 3JTZA 2FGGA 4BS9A 4DR1E 3T1HE 4Q28A 4DV4E 4JI0E 4DR4E 4DV6E 2UUCE 5AE2A 2G7HA 2V86A 4JYAE 4JI2E 2UXCE 4BBYA 2ODRD 1X49A 3K6QA 4M0VA 3DF6A 3HXLA 1FJGE 2MC5A 1UILA 2L33A 4X65E 4X66E 2UXDE 4BC9A 5AE3A 4X8WA 1WXRA 4DV2E 3ADIA 4DV5E 2VF1A 5LMNE 1EKZA 2LUPB 2FTXB 1X48A 4LTYA 2VQEE 4KHPE 2M1SA 2JR1A 3VYXA 2V83A 1YYOA 1N34E 1XNRE 2NUGA 1J26A 2L3CA 2V85A 2V8QB 3RMPA 1DI2A 3ADLA 5DNYA 4B3ME 3DJWA 4LF6E 2EWLA 3LMLA 4LF5E 4AQYE 2RS6A 4DV0E 2EZ6A 2CPNA 4BMJA 5AASA 3ZOQB 2V87A 2LTRA 4GKKE 3AV0A 4WPYA 3OMLA 4F9AB 1PKPA 1IBLE 4NXNE 4DR7E 4JI1E 2KHXA 4WFTA 2RSMA 4JI8E 3FIGA 4DUYE 2L2MA 2LRSA 3H09A 4JI4E 2JVAA 2H36X 2N3HA 3IWBA 2VQFE 2JOBA 2JWOA 3C4TA 2L6MA 2L8TA 4F9BB 4F54A 4P7DA 4YY3E 2VE7C 4TUIA 5LMUE 3J7Yp 4DV1E 1I94E 2LE2A 3ADGA 4JI5E 2ZM6E 4LF8E 1X47A 2MDRA 3F6GA 1N36E 4JI6E 3HTXA 2V88A 2B7VA 3ADJA 5LL6R 3JU0A 3JAMC 1J5EE 4GKJE 2M7QA 2DSYA 5ADZA 1HNXE 4LF7E 2FV4B 1N33E 4NXME 2KOUA 4GEQB 2HHHE 2KONA 2L2KB 4X62E 1GZ6A 1O0WA 1STUA 4LU9A 3IWDA 1HNZE 2B9DA 4JI7E 2LMZA 4BCAA 4B3SE 2RTXA 4LF4E 5IT9C 1SR9A 3HQ1A 5T6JA 1XMQE 4M30A 2NUFA 4DR2E 2UXBE 5CFFE 4M2ZA 1GQEA 2F4VE 3HPSA 3F6HA 5A2QC 2LUQA 3VYYA 1IBME 1T4OA 2LTSA 1HNWE 3C4BA 4LFAE 1N32E 4BC7A 2K4VA 4DV3E 2N3GA 1UHZA 4YHHE 4DKKA 1RC7A 4DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9C B;  4F9A B; 
#chains in the Genus database with same CATH topology
 2IHR 1;  2GLI A;  3J81 C;  3MHS C;  2EN7 A;  4WSP A;  4MLV A;  2DB2 A;  1DQ3 A;  3EPL A;  2B3T B;  1YUJ A;  3IWC A;  2YZT A;  4DR6 E;  2I9I A;  4DR5 E;  4JV5 E;  2BBG A;  2NAB A;  2A25 A;  2DIX A;  2E1M A;  1PDA A;  4DUZ E;  4I8O A;  2MC6 A;  2WZO A;  2EN1 A;  4NZV A;  4ZYH A;  3J7A G;  3L00 A;  2EPK X;  5A6J A;  2DGC A;  3EPK A;  2LJH A;  2EL5 A;  3BF2 A;  3T1H E;  3JTZ A;  4RH8 A;  2K7I A;  4DV4 E;  4JI0 E;  2ENC A;  1X6H A;  4M0V A;  1UIL A;  4X65 E;  4X66 E;  1A1I A;  2UXD E;  4X8W A;  1KYQ A;  3EPH A;  2EM9 A;  4LTY A;  2EM6 A;  2M1S A;  5AC5 A;  2HC5 A;  2JR1 A;  2V83 A;  1N34 E;  2EOR A;  5KL7 A;  2EMZ A;  3RMP A;  2YU8 A;  2EWL A;  3LML A;  4DV0 E;  2JXP A;  1IQS A;  1UN6 B;  4F9A B;  2EJ4 A;  1IBL E;  4NXN E;  3ECR A;  1PJQ A;  2KHX A;  1Z1B A;  3TQM A;  3H09 A;  2LRS A;  2E72 A;  1TN9 A;  4WX9 A;  2R76 A;  4P7D A;  4R2R A;  1N36 E;  3F6G A;  2B7V A;  2V88 A;  2YTG A;  1LLM C;  3JU0 A;  4M9V C;  5ADZ A;  2DSY A;  4LF7 E;  1N33 E;  1ZR9 A;  1IMU A;  2HHH E;  2KON A;  4LU9 A;  3IWD A;  1A1K A;  5LLQ A;  2EQ0 A;  2EMW A;  2EM2 A;  2EMF A;  5A2Q C;  1T4O A;  4HTG A;  2LTS A;  4MLQ A;  3C4B A;  2WCC 3;  2EOE A;  1X6E A;  2K4V A;  2N3G A;  1IQO A;  1B69 A;  3BID A;  1DGC A;  2DLK A;  1JK1 A;  2EMA A;  4DV7 E;  2Q8U A;  2E5L E;  2L3J A;  1ZBT A;  2YSP A;  1ZU1 A;  2EPZ A;  4R03 A;  1A1L A;  5AE1 A;  2B7T A;  2V89 A;  3J80 C;  4O43 A;  2UU9 E;  4R2P A;  2ODR C;  5KL4 A;  1QU6 A;  4IJD A;  4LF9 E;  3QG5 C;  2EPM X;  1PJS A;  4R8O A;  1YZ9 A;  2YSO A;  2YTQ A;  1XNQ E;  4LFB E;  2EOF A;  4WYQ B;  2WBU A;  2LJU A;  2I13 A;  1HR0 E;  2PRT A;  2LBS B;  2EMY A;  1YSA C;  5A6K A;  2R1F A;  4K0K E;  5TSE A;  2LO3 A;  3AUZ A;  3VK6 A;  3HPZ A;  2FGG A;  2RQL A;  4DV6 E;  2EN6 A;  2EE8 A;  1X49 A;  2EMC A;  3C6M A;  3K6Q A;  2EL6 A;  1FJG E;  2BB8 A;  2EL4 A;  4BC9 A;  2DLQ A;  1EKZ A;  5LMN E;  2EMK A;  1G2D C;  2FTX B;  3VYX A;  1MEY C;  1J26 A;  2D9H A;  4LF6 E;  2YTD A;  2CPN A;  4BMJ A;  2HJJ A;  2EMG A;  2EMI A;  2ENA A;  2MDG A;  1PKP A;  2ELZ A;  2M9A A;  4R2E A;  2EP3 A;  4WFT A;  2JVA A;  2H36 X;  2EM0 A;  3C4T A;  2L6M A;  4YY3 E;  3J7Y p;  3ADG A;  1X47 A;  2YRK A;  1PJT A;  1MGT A;  2M7Q A;  1HNX E;  2FV4 B;  4NXM E;  3VHT B;  4GEQ B;  1A1J A;  4R2C A;  2JPA A;  3THO B;  4R2S A;  2B9D A;  2EPR A;  2EOH A;  2RTX A;  1SR9 A;  2EOO A;  2NUF A;  2LT7 A;  4M2Z A;  3HPS A;  2EOQ A;  1BBG A;  2EN4 A;  2DRP A;  2EQ3 A;  4LFA E;  2CSH A;  5KL5 A;  1G2F C;  2JP9 A;  3KZY A;  4DMI A;  5A6A A;  5IXM B;  2CTD A;  3MHH C;  1IBK E;  1YYW A;  4L5N C;  5IWA E;  1X3C A;  4J8Z A;  1WHN A;  2N8X A;  1P47 A;  4JI3 E;  2WBS A;  4ZYE A;  2GPI A;  2JY9 A;  1NEI A;  1RMD A;  2YTI A;  1YYK A;  2M4I A;  4R2A A;  2EPU A;  3P1X A;  4P78 A;  4WXC A;  4F2J C;  5BR8 E;  1WHQ A;  2EPP A;  2DMI A;  2F8B A;  2YTP A;  4BS9 A;  2UUC E;  2EN3 A;  5AE2 A;  2G7H A;  2RPC A;  4R2D A;  4JYA E;  2UXC E;  3KZZ A;  4BBY A;  2ODR D;  1EH7 A;  3DF6 A;  3HXL A;  2EOZ A;  5AE3 A;  4DV2 E;  3ADI A;  4DV5 E;  2EMX A;  2LUP B;  4BHB A;  1X48 A;  1BB8 A;  1EH6 A;  4O5G A;  2VQE E;  5A6B D;  1A1H A;  4Q35 B;  1YUI A;  2V85 A;  2V8Q B;  3ADL A;  4B3M E;  3DJW A;  5KL3 A;  1YFH A;  3BBG A;  2YTO A;  2EOI A;  5AAS A;  2EOS A;  1WRJ A;  2V87 A;  2LTR A;  3OML A;  2EMB A;  2RSM A;  4JI8 E;  4RHB B;  3IWB A;  2JOB A;  2HGH A;  2L8T A;  4TUI A;  1I94 E;  4JI5 E;  1AAY A;  2MDR A;  4JI6 E;  3ADJ A;  2EPX A;  5LL6 R;  4HEI A;  3JAM C;  5AC4 A;  2KOU A;  2EPA A;  4X62 E;  1GZ6 A;  1O0W A;  2EM3 A;  1HNZ E;  4BCA A;  5IT9 C;  1WJP A;  4DR2 E;  2UXB E;  2YU5 A;  1GQE A;  2F4V E;  2EN2 A;  2VRD A;  2JYA A;  2EOX A;  4BC7 A;  2EPN A;  1UHZ A;  4YHH E;  4DKK A;  1RC7 A;  2EM5 A;  2YTE A;  2JOX A;  2DMY A;  4LFC E;  1F2I G;  2EPO A;  4L8N A;  1UBD C;  2YRH A;  1YPN A;  2MKD A;  2NA2 A;  2YTJ A;  1XMO E;  2YRM A;  1X5W A;  2L2N A;  2LVH A;  1T4L B;  5IV8 B;  2UUB E;  4X9J A;  2EM7 A;  2RS7 A;  4IS1 C;  1TF3 A;  1RQ0 A;  1T4N A;  4TUG A;  3M99 B;  4X64 E;  4GZN C;  2YT4 A;  4KZS A;  1ZBQ A;  4WXD A;  4B3T E;  2NUE A;  3T1Y E;  1EH8 A;  2EOM A;  4WSG A;  2YPN A;  4DR3 E;  1L4S A;  4ZYG A;  3MSW A;  3OTO E;  5FLX C;  4OOG C;  5A6B A;  5F3W A;  4B3R E;  2LV2 A;  4F9C B;  4OX9 E;  3EPJ A;  3LLH A;  1FKA E;  1T39 A;  1BBO A;  2YTN A;  2L92 A;  2UUA E;  3KWR A;  2YTF A;  4DR4 E;  4DR1 E;  4Q28 A;  4F6M A;  2V86 A;  3C6K A;  3EQ1 A;  4JI2 E;  2EMH A;  2ELY A;  2MC5 A;  2L33 A;  1AH5 A;  3UK3 C;  1WXR A;  2VF1 A;  1KJK A;  1SFE A;  4N4R B;  2RSI A;  1TF6 A;  4KHP E;  1NCS A;  4ZYD A;  2J7J A;  1YYO A;  1XNR E;  2NUG A;  4KWY A;  5KL2 A;  2L3C A;  1DI2 A;  5DNY A;  4LF5 E;  4AQY E;  2EPL X;  2RS6 A;  2EZ6 A;  1ZAA C;  1X6F A;  3ZOQ B;  1JK2 A;  4GKK E;  5KL6 A;  3AV0 A;  4WPY A;  4DR7 E;  2EM4 A;  4JI1 E;  4DUY E;  3FIG A;  1A1G A;  2L2M A;  2LCE A;  4R2Q A;  4JI4 E;  1T38 A;  1GTK A;  2N3H A;  2VQF E;  2JWO A;  2EOJ A;  4F9B B;  4F54 A;  2VE7 C;  5LMU E;  4DV1 E;  2EM8 A;  4LF8 E;  2LE2 A;  2ZM6 E;  4FK5 C;  3HTX A;  2EML A;  4GKJ E;  1J5E E;  2GHF A;  2EOY A;  2CT1 A;  2L2K B;  5A69 A;  1STU A;  2MKN A;  4JI7 E;  2LMZ A;  3BGH A;  4B3S E;  4LF4 E;  1QNT A;  2EQ1 A;  3THN A;  2EN8 A;  3HQ1 A;  5T6J A;  1N3G A;  1XMQ E;  4M30 A;  1A1F A;  4NHR A;  5CFF E;  4O24 A;  2YWQ A;  3F6H A;  4BHC A;  2LUQ A;  4O4K A;  3VYY A;  1IBM E;  1HNW E;  2EPC A;  1N32 E;  2WBT A;  4F6N A;  4DV3 E;  2ENH A;  2ADR A; 
#chains in the Genus database with same CATH homology
 2JOX A;  2DMY A;  4LFC E;  1IBK E;  2IHR 1;  1YYW A;  4L8N A;  4DV7 E;  3J81 C;  2E5L E;  2L3J A;  1ZBT A;  4L5N C;  2NA2 A;  1XMO E;  5IWA E;  4R03 A;  4WSP A;  4J8Z A;  2L2N A;  1WHN A;  2DB2 A;  1DQ3 A;  5AE1 A;  1T4L B;  2B7T A;  2B3T B;  2UUB E;  2V89 A;  4JI3 E;  3IWC A;  2RS7 A;  2YZT A;  3J80 C;  4DR6 E;  1RQ0 A;  2UU9 E;  1T4N A;  4TUG A;  2JY9 A;  2ODR C;  4DR5 E;  1QU6 A;  4X64 E;  4JV5 E;  2YT4 A;  4KZS A;  4LF9 E;  1ZBQ A;  4R8O A;  4B3T E;  1YZ9 A;  1XNQ E;  1YYK A;  4LFB E;  2M4I A;  2DIX A;  2E1M A;  4WYQ B;  2NUE A;  3T1Y E;  4DUZ E;  3P1X A;  4I8O A;  4DR3 E;  2MC6 A;  1HR0 E;  2WZO A;  2LBS B;  3J7A G;  3MSW A;  4P78 A;  5FLX C;  4OOG C;  3OTO E;  5F3W A;  4K0K E;  4B3R E;  4F9C B;  4OX9 E;  3LLH A;  1FKA E;  3AUZ A;  5BR8 E;  2L92 A;  2LJH A;  2UUA E;  1WHQ A;  3KWR A;  3VK6 A;  2F8B A;  3HPZ A;  3JTZ A;  2FGG A;  4BS9 A;  4DR1 E;  3T1H E;  4Q28 A;  4DV4 E;  4JI0 E;  4DR4 E;  4DV6 E;  2UUC E;  5AE2 A;  2G7H A;  2V86 A;  4JYA E;  4JI2 E;  2UXC E;  4BBY A;  2ODR D;  1X49 A;  3K6Q A;  4M0V A;  3DF6 A;  3HXL A;  1FJG E;  2MC5 A;  1UIL A;  2L33 A;  4X65 E;  4X66 E;  2UXD E;  4BC9 A;  5AE3 A;  4X8W A;  1WXR A;  4DV2 E;  3ADI A;  4DV5 E;  2VF1 A;  5LMN E;  1EKZ A;  2LUP B;  2FTX B;  1X48 A;  4LTY A;  2VQE E;  4KHP E;  2M1S A;  2JR1 A;  3VYX A;  2V83 A;  1YYO A;  1N34 E;  1XNR E;  2NUG A;  1J26 A;  2L3C A;  2V85 A;  2V8Q B;  3RMP A;  1DI2 A;  3ADL A;  5DNY A;  4B3M E;  3DJW A;  4LF6 E;  2EWL A;  3LML A;  4LF5 E;  4AQY E;  2RS6 A;  4DV0 E;  2EZ6 A;  2CPN A;  4BMJ A;  5AAS A;  3ZOQ B;  2V87 A;  2LTR A;  4GKK E;  3AV0 A;  4WPY A;  3OML A;  4F9A B;  1PKP A;  1IBL E;  4NXN E;  4DR7 E;  4JI1 E;  2KHX A;  4WFT A;  2RSM A;  4JI8 E;  3FIG A;  4DUY E;  2L2M A;  2LRS A;  3H09 A;  4JI4 E;  2JVA A;  2H36 X;  2N3H A;  3IWB A;  2VQF E;  2JOB A;  2JWO A;  3C4T A;  2L6M A;  2L8T A;  4F9B B;  4F54 A;  4P7D A;  4YY3 E;  2VE7 C;  4TUI A;  5LMU E;  3J7Y p;  4DV1 E;  1I94 E;  2LE2 A;  3ADG A;  4JI5 E;  2ZM6 E;  4LF8 E;  1X47 A;  2MDR A;  3F6G A;  1N36 E;  4JI6 E;  3HTX A;  2V88 A;  2B7V A;  3ADJ A;  5LL6 R;  3JU0 A;  3JAM C;  1J5E E;  4GKJ E;  2M7Q A;  2DSY A;  5ADZ A;  1HNX E;  4LF7 E;  2FV4 B;  1N33 E;  4NXM E;  2KOU A;  4GEQ B;  2HHH E;  2KON A;  2L2K B;  4X62 E;  1GZ6 A;  1O0W A;  1STU A;  4LU9 A;  3IWD A;  1HNZ E;  2B9D A;  4JI7 E;  2LMZ A;  4BCA A;  4B3S E;  2RTX A;  4LF4 E;  5IT9 C;  1SR9 A;  3HQ1 A;  5T6J A;  1XMQ E;  4M30 A;  2NUF A;  4DR2 E;  2UXB E;  5CFF E;  4M2Z A;  1GQE A;  2F4V E;  3HPS A;  3F6H A;  5A2Q C;  2LUQ A;  3VYY A;  1IBM E;  1T4O A;  2LTS A;  1HNW E;  3C4B A;  4LFA E;  1N32 E;  4BC7 A;  2K4V A;  4DV3 E;  2N3G A;  1UHZ A;  4YHH E;  4DKK A;  1RC7 A;  4DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...