4N3ZA

Crystal structure of rabex-5delta and rabaptin-5c21 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
290
structure length
238
Chain Sequence
EFIEFLKTHKTGQEIYKQTFLEGMHYKRDLIEEQSECAQDFYHNVEKIMDQIEKYIMTRLDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5
pubmed doi rcsb
molecule keywords Rab5 GDP/GTP exchange factor
molecule tags Endocytosis
source organism Homo sapiens
total genus 74
structure length 238
sequence length 290
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4n3zA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4n3zA02
2EFCA 4N3ZA 2EFEA 2EFDA 1TXUA 2EFHA 2OT3A 4G01A
chains in the Genus database with same CATH superfamily
4F5SA 4BVXB 1PL2A 2IMKA 4E8HA 4TQ0A 3KJYA 2PERA 2LJRA 3CRUA 1PA3A 1GSSA 1E7FA 6GSUA 1GSQA 3NVKA 3ECPA 4LUHA 2VO4A 5IFOA 4N0VA 4F0BA 4HOJA 3LYKA 2XMOA 4Q5NA 4LB2A 3G7JA 3B9MA 1BG5A 4IVFA 5J5NA 5J4UA 1HA2A 5DBYA 1PD21 2QM6A 2VCWA 2HRAA 3QR6A 2QMCA 4E8EA 2LOQA 1K3YA 4BL7B 2R3XA 3DD3A 2VCTA 12GSA 2A2SA 1V2AA 5AISA 2YCDA 2AAWA 4F5VA 1GLPA 1TW9A 5ECHB 5FUOA 1EV4A 4KDXA 2VUEA 4AKHA 4I9OA 2O5VA 4ISDA 5GINA 4ZBDA 1MIWA 2HSNB 2CAQA 4OFTA 3CRTA 6GSXA 5B5TA 2HQTA 3P90A 4RI7A 1GNEA 1V40A 2WVXB 2H1LA 2PGTA 1C72A 1JLWA 2WDUA 3ERFA 3LXTA 4HGMB 3CWGA 3HMJG 2WB9A 5DQFA 4GCIA 2DSAA 4MZWA 3A75A 3H3AA 4D7XA 2C3NA 1E7GA 2R6KA 4K0GA 4L8EA 3LU6A 4IKHA 4KSMA 5D9VA 4S1YA 3GUSA 5DDLA 5DALA 4NAXA 4W66A 1AW9A 2C4JA 3JRYA 6GSTA 4L5LA 2CA8A 1GTAA 2BXAA 2X64A 1S4BP 4GF0A 5AN1A 1K0CA 1MTCA 2BXCA 2WVZA 2KWFA 1K0BA 4F0CA 1XW6A 4TQ1A 3EE2A 4HZ4A 4PGTA 1KXPD 5ECMB 5AGYA 1AQVA 3C8EA 3CSIA 3CBUA 2V36A 2C3TA 4PHZC 1ZL9A 3V09A 1PMTA 4QQ7A 5GZZB 4BVXA 4AKIA 3F6DA 1JZRA 5FHIA 2BXKA 1E7BA 2E0XA 5GIOA 4BVYB 3FWCC 5IIUA 2O36A 4AGSA 3TGZA 1VF1A 3PGTA 1OE8A 4JBBA 1XWGA 5A5HB 1M99A 1BF5A 1USBA 1Y6EA 3LFLA 4YAPA 4KAEA 4OFNA 1M9AA 4YQMA 14GSA 5JCWA 5D7GA 5IJFA 3PPUA 3WHRA 3QAGA 5F06A 1BYEA 5ECRB 4FIPB 2WW2A 4JK4A 4ZB6A 2EFDA 4GTUA 2I2ZA 4GLTA 3BBYA 4IQ1A 4GDLB 1K3OA 1GULA 5GSSA 2DBWA 4BL7A 4Z9OA 3IE3A 1LBKA 5ELGA 2CVDA 4JEDA 4USSA 5F8BA 3SWLA 3ZFBA 4AKXB 5A5KA 3SQJA 3DGQA 1K0DA 2JL4A 2HSNA 3KMOA 3KXOA 3LJRA 4KX4A 4N0UD 3WHSA 1KBNA 4ZCGA 5DALB 4I97A 2PVQA 4MP4A 1GTBA 3FYGA 4PX1A 3WD6A 3IBHA 1MD4A 1GSUA 1F3AA 2BXFA 1OYJA 2R5GA 4NHZA 1GNWA 3FR6A 3O76A 1BKEA 1H9ZA 3G9KD 3M8NA 3O3TA 3LG6A 1GSDA 4RI6A 3U6VA 5HFKA 4ID0A 2O3EA 1U87A 5J4YA 1UORA 2KBZA 4BY9C 2NQOA 5LCZA 4GG2A 5IQYA 1EV9A 13GSA 1GNJA 2XVWA 3RGBC 17GSA 5IJEA 5D9TA 2WS2A 4PURA 3GA9L 1RK4A 1MUSA 2DYMA 1E7EA 4M70B 2GSSA 2NTOA 2WRTA 1GSEA 1ZGNA 2VCQA 5ECPB 4N3ZA 2IMIA 4EC0A 5DAKB 3W1SA 4HGKA 4BVYA 4G01A 2WVYA 1IJGA 3VK9A 1KW2A 2XVUA 5HOZA 1AQWA 3MDKA 5A5HA 4L9KA 4LUFA 3Q74A 2IL3A 1GWCA 4FXYP 4DM0A 5ECIB 4J2VA 3ZFLA 1MUHA 4NHWA 2UV8G 2DC5A 4MK3A 1TXUA 4OTTA 1I1IP 4ZBAA 3TOUA 5EVOA 2VUFA 1H5WA 2BXMA 4PNGA 4L5OA 1SB0A 3IK9A 3JQZA 1YQ1A 3HJMA 4K2CA 4OR0A 2WW0A 3QAWA 4PQIA 2A2RA 5A1NB 4MPFA 4EE0A 3FNMA 8GSSA 1K0MA 1E7CA 3Q19A 2GSRA 2YDFA 1LJRA 1HK2A 5FT3A 1GLQA 2BXNA 1AXDA 1EEMA 6GSSA 1PGTA 2XSIA 1E78A 5ELAA 3PR8A 2GSTA 4ZUXV 2BXLA 1M0UA 3ISOA 1BAYA 1YDKA 5JCUA 3GH6A 3N5OA 1LNSA 1VF4A 3LU8A 2XW0A 4GSNA 5G5FA 2EFCA 5GSTA 3R2QA 3I6AA 3CSHA 2BXEA 4MPGA 3WHQA 4TOPA 4ZC6A 1G6WA 4BKEA 3BPJA 4PO0A 1VF2A 4O7HA 4ZB7A 4YQVA 4C31B 5AIXA 5B7CA 2LXSA 3M1GA 5D73A 2ON5A 3M3MA 1NT2B 2UZ8A 1N2AA 3F63A 4WR5A 1J7EA 4AI6A 3TDLA 2I30A 4WR4A 2PMTA 1TF0A 3ERGA 1MA9A 2BX8A 5GIPA 2GDRA 3RBTA 4ECBA 2CKXA 3UVHA 1JNBA 4Q5RA 3NVMA 1G6YA 1PX7A 2GLRA 4PQHA 1FHEA 4IGJA 2OACA 3GQUA 4PI0C 2DG5A 4DEJA 1MIVA 1OE7A 20GSA 5DAKA 5J4VA 3IC8A 5FWGA 3LU7A 1SVOA 1K0OA 4HZ2A 4Q5FA 2Z8KA 4PI2C 4IW1A 1EOGA 4ZXGA 2WJUA 2VCVA 3AY8A 1AQXA 5F07A 1GSYA 5J47A 3L0HA 5D9WA 1AO6A 4W4UB 5BPKA 5EL8A 2QHBA 3UBKA 3V03A 3V08A 2OZBB 2YV7A 1G7OA 1HK4A 22GSA 4K71A 4ZBQA 3IK7A 5A1NA 3VQIA 2F8FA 2HRKB 4G0LA 1TU7A 4AKGA 4QMKA 5ECLB 2FNOA 1R5AA 3VWXA 1GUKA 3MAKA 2EFHA 3Q18A 4PNFA 3ZMKA 6GSYA 1BX9A 3CX9A 2VDBA 4L9QA 1GNIA 10GSA 1EOHA 2V6KA 1HNAA 3FR9A 4PUAA 3N9JA 1BG1A 1JLVA 2BXGA 4EXJA 1UA5A 1KDXA 2OT3A 2HNLA 1VZSA 4MDCA 4IELA 1TU8A 3CHXC 2HSMB 3I69A 4MF7A 3CSJA 5IIXA 4KDUA 5F05A 4MF5A 2OA7A 3KTLA 4G0KA 1FW1A 1MIYA 2WW3A 3LXZA 2LQHA 5J40A 3A73A 5G5EA 3UAPA 5KEJA 4G0IA 3WYWA 1GTUA 5ECQB 4PTSA 3UIVA 1DUGA 4Z69A 3NIVA 2C8UA 2BXPA 4F5UA 1Q4JA 4G19A 5A4UA 1M9BA 4LMWA 4MF6A 4ACSA 4LA0A 3HKRA 5ECNB 3D0ZA 3VI7A 4CHSA 2DBXA 1GUHA 1PL1A 1LOTA 3HJOA 1MM8A 4IQAA 5DQSA 4WA6B 1NHYA 2GTUA 4OT2A 3F6FA 19GSA 9GSSA 4IW9A 4ZBRA 2VD1A 4KH7A 3NVIA 4GDXA 1F2EA 1Y1UA 4G04A 4FQUA 1GUMA 2E0YA 2BXBA 1E7IA 2J9HA 3PLAA 2VKZG 2NNWA 5A4VA 2AGHB 3KIKA 2XW1A 5D9XA 5ECOB 1E7HA 3KJLA 1K0NA 5F0GA 1PKWA 4ECCA 3GURA 2N5FA 1U3IA 3M99C 2VCXA 3EINA 4OFMA 3W8SA 1HK3A 1SVMA 2BXHA 3UBLA 2Z8JA 3H37A 5ECSA 6GSVA 2EFEA 1GSFA 1SVLA 2HRKA 3LQ7A 4IBPA 4K0NA 5AIVA 3LSZA 2K0NA 3SIUB 5A34B 3H1NA 4PXOA 4ECJA 5DJMA 3UARA 2PBJA 4J2FA 4GSTA 3RFRC 1PN9A 5IJ5A 3IR4A 4GSSA 2BXQA 4O92A 1E6BA 2XVVA 4Q5QA 1XWKA 11GSA 2VCZA 4GDKB 4E99A 3FWBC 1IYIA 1PX6A 5J41A 1YJ6A 2CZ3A 2VD0A 3R3EA 3GX0A 4F5TA 3GTUA 5BMUB 2HSMA 4GDFA 16GSA 5EY6A 1K3LA 4JZQA 2GUTA 5LD0A 4G9HA 1B4PA 18GSA 4ZBKA 5DCGA 1FOUA 2CZ2A 2F3MA 2AB6A 1HK5A 2XVQA 3SIVB 2DBUA 1A0FA 1E7AA 4EDYA 3GSTA 3B9LA 3MHSB 4IJIA 3VI5A 1B48A 4MBEC 3VLNA 4KF9A 3KMNA 2Z8IA 4LB9A 1N5UA 4DHXB 3FRCA 5IIHA 4ECIA 1TDIA 5ID9A 2WW1A 3VPQA 1VF3A 3VPTA 4ZB9A 1B8XA 4ZB8A 5DJLA 1HK1A 1HNCA 2FHEA 1YKCA 4ZBBA 3MHHB 4IS0A 4IW2A 2ON7A 3KM6A 3QAVA 2OADA 2ROHA 4YH2A 1XW5A 4L8UA 1VFIA 4N0FD 4E68A 3G7IA 3FR3A 2WZSA 4HI7A 4HJ2A 2AHEA 3P8WA 2CAIA 4G10A 4G03A 1O9XA 4YAVA 4FJCB 1Z9HA 3ICXA 1J78A 4KGIA 3NMUA 1MD3A 4F03A 5A34A 4NAWB 1K0AA 2GSQA 3LYPA 3GSSA 3ZMLA 4FK5B 1YVLA 4OMVA 2BXIA 2JUHA 2C3QA 1YY7A 2BXDA 1ML6A 3FY7A 4KDYA 2R4VA 1HQOA 3GTUB 3TOTA 4EDZA 2AJEA 1PKZA 3TU3B 2BXOA 7GSSA 4LMVA 1BJ5A 5GHKA 1YEWC 3M0FA 2WVXA 5ECKB 1N25A 4EMXA 2LQIA 1F3BA 4KE3A 1IYHA 5BMUA 2LXTA 2DYOA 1OKTA 2YV9A 1GTIA 5A4WA 2D2ZA 1BM0A 3GQXA 4YQUA 5ID7A 4OTUA 6GSWA 2C80A 1HNBA 3VURA 1U88A
chains in the Genus database with same CATH topology
4F5SA 4BVXB 1PL2A 2IMKA 4E8HA 4TQ0A 3KJYA 2PERA 2LJRA 3CRUA 1PA3A 1GSSA 1E7FA 6GSUA 1GSQA 3NVKA 4LUHA 2VO4A 5IFOA 4N0VA 4F0BA 4HOJA 3LYKA 2XMOA 4Q5NA 4LB2A 3G7JA 3B9MA 1BG5A 4IVFA 5J5NA 5J4UA 1HA2A 5DBYA 1PD21 2QM6A 2VCWA 2HRAA 3QR6A 2QMCA 4E8EA 2LOQA 1K3YA 4BL7B 2R3XA 3DD3A 2VCTA 12GSA 2A2SA 1V2AA 5AISA 2YCDA 2AAWA 4F5VA 1GLPA 1TW9A 5ECHB 5FUOA 1EV4A 4KDXA 2VUEA 4AKHA 2O5VA 4ISDA 5GINA 4ZBDA 1MIWA 2HSNB 2CAQA 4OFTA 3CRTA 6GSXA 5B5TA 2HQTA 3P90A 4RI7A 1GNEA 1V40A 2H1LA 2PGTA 1C72A 1JLWA 2WDUA 3ERFA 3LXTA 4HGMB 3CWGA 3HMJG 2WB9A 5DQFA 4GCIA 2DSAA 4MZWA 3A75A 3H3AA 2C3NA 2R6KA 1E7GA 4K0GA 4L8EA 3LU6A 4IKHA 4KSMA 5D9VA 4S1YA 3GUSA 5DDLA 5DALA 4NAXA 4W66A 1AW9A 2C4JA 3JRYA 6GSTA 4L5LA 2CA8A 1GTAA 2BXAA 2X64A 4GF0A 5AN1A 1K0CA 1MTCA 2BXCA 1K0BA 4F0CA 1XW6A 4TQ1A 3EE2A 4HZ4A 4PGTA 1KXPD 5ECMB 5AGYA 1AQVA 3C8EA 3CSIA 3CBUA 2V36A 2C3TA 1ZL9A 3V09A 1PMTA 4QQ7A 5GZZB 4BVXA 4AKIA 3F6DA 1JZRA 5FHIA 2BXKA 1E7BA 2E0XA 5GIOA 4BVYB 3FWCC 5IIUA 4AGSA 3TGZA 1VF1A 3PGTA 1OE8A 4JBBA 1XWGA 5A5HB 1M99A 1BF5A 1USBA 1Y6EA 3LFLA 4YAPA 4KAEA 4OFNA 1M9AA 4YQMA 14GSA 5JCWA 5D7GA 5IJFA 3PPUA 3WHRA 3QAGA 5F06A 1BYEA 5ECRB 4FIPB 4JK4A 4ZB6A 2EFDA 4GTUA 2I2ZA 4GLTA 3BBYA 4IQ1A 4GDLB 1K3OA 1GULA 5GSSA 2DBWA 4BL7A 4Z9OA 3IE3A 1LBKA 5ELGA 2CVDA 4JEDA 4USSA 5F8BA 3SWLA 3ZFBA 4AKXB 5A5KA 3SQJA 3DGQA 1K0DA 2JL4A 2HSNA 3KMOA 3KXOA 3LJRA 4KX4A 4N0UD 3WHSA 1KBNA 4ZCGA 5DALB 4I97A 2PVQA 4MP4A 1GTBA 3FYGA 4PX1A 3WD6A 3IBHA 1MD4A 1GSUA 1F3AA 2BXFA 1OYJA 2R5GA 4NHZA 1GNWA 3FR6A 3O76A 1BKEA 1H9ZA 3G9KD 3M8NA 3O3TA 3LG6A 1GSDA 4RI6A 3U6VA 5HFKA 4ID0A 1U87A 5J4YA 1UORA 2KBZA 4BY9C 2NQOA 5LCZA 4GG2A 5IQYA 1EV9A 13GSA 1GNJA 2XVWA 17GSA 5IJEA 5D9TA 2WS2A 4PURA 3GA9L 1RK4A 2DYMA 1E7EA 4M70B 2GSSA 2NTOA 2WRTA 1GSEA 1ZGNA 2VCQA 5ECPB 4N3ZA 2IMIA 4EC0A 5DAKB 3W1SA 4HGKA 4BVYA 4G01A 1IJGA 3VK9A 1KW2A 2XVUA 5HOZA 1AQWA 3MDKA 5A5HA 4L9KA 4LUFA 3Q74A 2IL3A 1GWCA 5ECIB 4J2VA 3ZFLA 4NHWA 2UV8G 2DC5A 4MK3A 1TXUA 4OTTA 4ZBAA 3TOUA 5EVOA 2VUFA 1H5WA 2BXMA 4PNGA 4L5OA 3IK9A 3JQZA 1YQ1A 3HJMA 4K2CA 4OR0A 3QAWA 4PQIA 2A2RA 5A1NB 4MPFA 4EE0A 3FNMA 8GSSA 1K0MA 1E7CA 3Q19A 2GSRA 2YDFA 1LJRA 1HK2A 5FT3A 1GLQA 2BXNA 1AXDA 1EEMA 6GSSA 1PGTA 2XSIA 1E78A 5ELAA 3PR8A 2GSTA 4ZUXV 2BXLA 1M0UA 3ISOA 1BAYA 1YDKA 5JCUA 3GH6A 3N5OA 1LNSA 1VF4A 3LU8A 2XW0A 4GSNA 5G5FA 2EFCA 5GSTA 3R2QA 3I6AA 3CSHA 2BXEA 4MPGA 3WHQA 4TOPA 4ZC6A 1G6WA 4BKEA 4PO0A 1VF2A 4O7HA 4ZB7A 4YQVA 4C31B 5AIXA 5B7CA 3M1GA 5D73A 2ON5A 3M3MA 1NT2B 2UZ8A 1N2AA 3F63A 4WR5A 1J7EA 4AI6A 3TDLA 2I30A 4WR4A 2PMTA 1TF0A 3ERGA 1MA9A 2BX8A 5GIPA 2GDRA 3RBTA 4ECBA 2CKXA 3UVHA 1JNBA 4Q5RA 3NVMA 1G6YA 1PX7A 2GLRA 4PQHA 1FHEA 4IGJA 2OACA 3GQUA 2DG5A 4DEJA 1MIVA 1OE7A 20GSA 5DAKA 5J4VA 3IC8A 5FWGA 3LU7A 1SVOA 1K0OA 4HZ2A 4Q5FA 2Z8KA 4IW1A 1EOGA 4ZXGA 2WJUA 2VCVA 3AY8A 1AQXA 5F07A 1GSYA 5J47A 3L0HA 5D9WA 1AO6A 4W4UB 5BPKA 5EL8A 2QHBA 3UBKA 3V03A 3V08A 2OZBB 2YV7A 1G7OA 1HK4A 22GSA 4K71A 4ZBQA 3IK7A 5A1NA 3VQIA 2F8FA 2HRKB 4G0LA 1TU7A 4AKGA 4QMKA 5ECLB 2FNOA 1R5AA 3VWXA 1GUKA 3MAKA 2EFHA 3Q18A 4PNFA 3ZMKA 6GSYA 1BX9A 3CX9A 2VDBA 4L9QA 1GNIA 10GSA 1EOHA 2V6KA 1HNAA 3FR9A 4PUAA 3N9JA 1BG1A 1JLVA 2BXGA 4EXJA 1UA5A 2OT3A 2HNLA 1VZSA 4MDCA 4IELA 1TU8A 2HSMB 3I69A 4MF7A 3CSJA 5IIXA 4KDUA 5F05A 4MF5A 2OA7A 3KTLA 4G0KA 1FW1A 1MIYA 3LXZA 5J40A 3A73A 5G5EA 3UAPA 5KEJA 4G0IA 3WYWA 1GTUA 5ECQB 4PTSA 3UIVA 1DUGA 4Z69A 3NIVA 2C8UA 2BXPA 4F5UA 1Q4JA 4G19A 5A4UA 1M9BA 4LMWA 4MF6A 4ACSA 4LA0A 3HKRA 5ECNB 3D0ZA 3VI7A 4CHSA 2DBXA 1GUHA 1PL1A 1LOTA 3HJOA 4IQAA 5DQSA 4WA6B 1NHYA 2GTUA 4OT2A 3F6FA 19GSA 9GSSA 4IW9A 4ZBRA 2VD1A 4KH7A 3NVIA 4GDXA 1F2EA 1Y1UA 4G04A 4FQUA 1GUMA 2E0YA 2BXBA 1E7IA 2J9HA 3PLAA 2VKZG 2NNWA 5A4VA 3KIKA 2XW1A 5D9XA 5ECOB 1E7HA 3KJLA 1K0NA 5F0GA 1PKWA 4ECCA 3GURA 2N5FA 1U3IA 3M99C 2VCXA 3EINA 4OFMA 3W8SA 1HK3A 1SVMA 2BXHA 3UBLA 2Z8JA 3H37A 5ECSA 6GSVA 2EFEA 1GSFA 1SVLA 2HRKA 3LQ7A 4IBPA 4K0NA 5AIVA 3LSZA 3SIUB 5A34B 3H1NA 4PXOA 4ECJA 5DJMA 3UARA 2PBJA 4J2FA 4GSTA 1PN9A 5IJ5A 3IR4A 4GSSA 2BXQA 4O92A 1E6BA 2XVVA 4Q5QA 1XWKA 11GSA 2VCZA 4GDKB 4E99A 3FWBC 1IYIA 1PX6A 5J41A 1YJ6A 2CZ3A 2VD0A 3R3EA 3GX0A 4F5TA 3GTUA 5BMUB 2HSMA 4GDFA 16GSA 5EY6A 1K3LA 4JZQA 5LD0A 4G9HA 1B4PA 18GSA 4ZBKA 5DCGA 1FOUA 2CZ2A 2F3MA 2AB6A 1HK5A 2XVQA 3SIVB 2DBUA 1A0FA 1E7AA 4EDYA 3GSTA 3B9LA 3MHSB 4IJIA 3VI5A 1B48A 4MBEC 3VLNA 4KF9A 3KMNA 2Z8IA 4LB9A 1N5UA 4DHXB 3FRCA 5IIHA 4ECIA 1TDIA 5ID9A 3VPQA 1VF3A 3VPTA 4ZB9A 1B8XA 4ZB8A 5DJLA 1HK1A 1HNCA 2FHEA 1YKCA 4ZBBA 3MHHB 4IS0A 4IW2A 2ON7A 3KM6A 3QAVA 2OADA 2ROHA 4YH2A 1XW5A 4L8UA 1VFIA 4N0FD 4E68A 3G7IA 3FR3A 4HI7A 4HJ2A 2AHEA 3P8WA 2CAIA 4G10A 4G03A 1O9XA 4YAVA 4FJCB 1Z9HA 3ICXA 1J78A 4KGIA 3NMUA 1MD3A 4F03A 5A34A 4NAWB 1K0AA 2GSQA 3LYPA 3GSSA 3ZMLA 4FK5B 1YVLA 4OMVA 2BXIA 2JUHA 2C3QA 1YY7A 2BXDA 1ML6A 3FY7A 4KDYA 2R4VA 1HQOA 3GTUB 3TOTA 4EDZA 2AJEA 1PKZA 3TU3B 2BXOA 7GSSA 4LMVA 1BJ5A 5GHKA 3M0FA 5ECKB 1N25A 4EMXA 1F3BA 4KE3A 1IYHA 5BMUA 2DYOA 1OKTA 2YV9A 1GTIA 5A4WA 2D2ZA 1BM0A 3GQXA 4YQUA 5ID7A 4OTUA 6GSWA 2C80A 1HNBA 3VURA 1U88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFC A;  4N3Z A;  2EFE A;  2EFD A;  1TXU A;  2EFH A;  2OT3 A;  4G01 A; 
#chains in the Genus database with same CATH topology
 4F5S A;  4BVX B;  1PL2 A;  2IMK A;  4E8H A;  4TQ0 A;  3KJY A;  2PER A;  2LJR A;  3CRU A;  1PA3 A;  1GSS A;  1E7F A;  6GSU A;  1GSQ A;  3NVK A;  3ECP A;  4LUH A;  2VO4 A;  5IFO A;  4N0V A;  4F0B A;  4HOJ A;  3LYK A;  2XMO A;  4Q5N A;  4LB2 A;  3G7J A;  3B9M A;  1BG5 A;  4IVF A;  5J5N A;  5J4U A;  1HA2 A;  5DBY A;  1PD2 1;  2QM6 A;  2VCW A;  2HRA A;  3QR6 A;  2QMC A;  4E8E A;  2LOQ A;  1K3Y A;  4BL7 B;  2R3X A;  3DD3 A;  2VCT A;  12GS A;  2A2S A;  1V2A A;  5AIS A;  2YCD A;  2AAW A;  4F5V A;  1GLP A;  1TW9 A;  5ECH B;  5FUO A;  1EV4 A;  4KDX A;  2VUE A;  4AKH A;  4I9O A;  2O5V A;  4ISD A;  5GIN A;  4ZBD A;  1MIW A;  2HSN B;  2CAQ A;  4OFT A;  3CRT A;  6GSX A;  5B5T A;  2HQT A;  3P90 A;  4RI7 A;  1GNE A;  1V40 A;  2WVX B;  2H1L A;  2PGT A;  1C72 A;  1JLW A;  2WDU A;  3ERF A;  3LXT A;  4HGM B;  3CWG A;  3HMJ G;  2WB9 A;  5DQF A;  4GCI A;  2DSA A;  4MZW A;  3A75 A;  3H3A A;  4D7X A;  2C3N A;  1E7G A;  2R6K A;  4K0G A;  4L8E A;  3LU6 A;  4IKH A;  4KSM A;  5D9V A;  4S1Y A;  3GUS A;  5DDL A;  5DAL A;  4NAX A;  4W66 A;  1AW9 A;  2C4J A;  3JRY A;  6GST A;  4L5L A;  2CA8 A;  1GTA A;  2BXA A;  2X64 A;  1S4B P;  4GF0 A;  5AN1 A;  1K0C A;  1MTC A;  2BXC A;  2WVZ A;  2KWF A;  1K0B A;  4F0C A;  1XW6 A;  4TQ1 A;  3EE2 A;  4HZ4 A;  4PGT A;  1KXP D;  5ECM B;  5AGY A;  1AQV A;  3C8E A;  3CSI A;  3CBU A;  2V36 A;  2C3T A;  4PHZ C;  1ZL9 A;  3V09 A;  1PMT A;  4QQ7 A;  5GZZ B;  4BVX A;  4AKI A;  3F6D A;  1JZR A;  5FHI A;  2BXK A;  1E7B A;  2E0X A;  5GIO A;  4BVY B;  3FWC C;  5IIU A;  2O36 A;  4AGS A;  3TGZ A;  1VF1 A;  3PGT A;  1OE8 A;  4JBB A;  1XWG A;  5A5H B;  1M99 A;  1BF5 A;  1USB A;  1Y6E A;  3LFL A;  4YAP A;  4KAE A;  4OFN A;  1M9A A;  4YQM A;  14GS A;  5JCW A;  5D7G A;  5IJF A;  3PPU A;  3WHR A;  3QAG A;  5F06 A;  1BYE A;  5ECR B;  4FIP B;  2WW2 A;  4JK4 A;  4ZB6 A;  2EFD A;  4GTU A;  2I2Z A;  4GLT A;  3BBY A;  4IQ1 A;  4GDL B;  1K3O A;  1GUL A;  5GSS A;  2DBW A;  4BL7 A;  4Z9O A;  3IE3 A;  1LBK A;  5ELG A;  2CVD A;  4JED A;  4USS A;  5F8B A;  3SWL A;  3ZFB A;  4AKX B;  5A5K A;  3SQJ A;  3DGQ A;  1K0D A;  2JL4 A;  2HSN A;  3KMO A;  3KXO A;  3LJR A;  4KX4 A;  4N0U D;  3WHS A;  1KBN A;  4ZCG A;  5DAL B;  4I97 A;  2PVQ A;  4MP4 A;  1GTB A;  3FYG A;  4PX1 A;  3WD6 A;  3IBH A;  1MD4 A;  1GSU A;  1F3A A;  2BXF A;  1OYJ A;  2R5G A;  4NHZ A;  1GNW A;  3FR6 A;  3O76 A;  1BKE A;  1H9Z A;  3G9K D;  3M8N A;  3O3T A;  3LG6 A;  1GSD A;  4RI6 A;  3U6V A;  5HFK A;  4ID0 A;  2O3E A;  1U87 A;  5J4Y A;  1UOR A;  2KBZ A;  4BY9 C;  2NQO A;  5LCZ A;  4GG2 A;  5IQY A;  1EV9 A;  13GS A;  1GNJ A;  2XVW A;  3RGB C;  17GS A;  5IJE A;  5D9T A;  2WS2 A;  4PUR A;  3GA9 L;  1RK4 A;  1MUS A;  2DYM A;  1E7E A;  4M70 B;  2GSS A;  2NTO A;  2WRT A;  1GSE A;  1ZGN A;  2VCQ A;  5ECP B;  4N3Z A;  2IMI A;  4EC0 A;  5DAK B;  3W1S A;  4HGK A;  4BVY A;  4G01 A;  2WVY A;  1IJG A;  3VK9 A;  1KW2 A;  2XVU A;  5HOZ A;  1AQW A;  3MDK A;  5A5H A;  4L9K A;  4LUF A;  3Q74 A;  2IL3 A;  1GWC A;  4FXY P;  4DM0 A;  5ECI B;  4J2V A;  3ZFL A;  1MUH A;  4NHW A;  2UV8 G;  2DC5 A;  4MK3 A;  1TXU A;  4OTT A;  1I1I P;  4ZBA A;  3TOU A;  5EVO A;  2VUF A;  1H5W A;  2BXM A;  4PNG A;  4L5O A;  1SB0 A;  3IK9 A;  3JQZ A;  1YQ1 A;  3HJM A;  4K2C A;  4OR0 A;  2WW0 A;  3QAW A;  4PQI A;  2A2R A;  5A1N B;  4MPF A;  4EE0 A;  3FNM A;  8GSS A;  1K0M A;  1E7C A;  3Q19 A;  2GSR A;  2YDF A;  1LJR A;  1HK2 A;  5FT3 A;  1GLQ A;  2BXN A;  1AXD A;  1EEM A;  6GSS A;  1PGT A;  2XSI A;  1E78 A;  5ELA A;  3PR8 A;  2GST A;  4ZUX V;  2BXL A;  1M0U A;  3ISO A;  1BAY A;  1YDK A;  5JCU A;  3GH6 A;  3N5O A;  1LNS A;  1VF4 A;  3LU8 A;  2XW0 A;  4GSN A;  5G5F A;  2EFC A;  5GST A;  3R2Q A;  3I6A A;  3CSH A;  2BXE A;  4MPG A;  3WHQ A;  4TOP A;  4ZC6 A;  1G6W A;  4BKE A;  3BPJ A;  4PO0 A;  1VF2 A;  4O7H A;  4ZB7 A;  4YQV A;  4C31 B;  5AIX A;  5B7C A;  2LXS A;  3M1G A;  5D73 A;  2ON5 A;  3M3M A;  1NT2 B;  2UZ8 A;  1N2A A;  3F63 A;  4WR5 A;  1J7E A;  4AI6 A;  3TDL A;  2I30 A;  4WR4 A;  2PMT A;  1TF0 A;  3ERG A;  1MA9 A;  2BX8 A;  5GIP A;  2GDR A;  3RBT A;  4ECB A;  2CKX A;  3UVH A;  1JNB A;  4Q5R A;  3NVM A;  1G6Y A;  1PX7 A;  2GLR A;  4PQH A;  1FHE A;  4IGJ A;  2OAC A;  3GQU A;  4PI0 C;  2DG5 A;  4DEJ A;  1MIV A;  1OE7 A;  20GS A;  5DAK A;  5J4V A;  3IC8 A;  5FWG A;  3LU7 A;  1SVO A;  1K0O A;  4HZ2 A;  4Q5F A;  2Z8K A;  4PI2 C;  4IW1 A;  1EOG A;  4ZXG A;  2WJU A;  2VCV A;  3AY8 A;  1AQX A;  5F07 A;  1GSY A;  5J47 A;  3L0H A;  5D9W A;  1AO6 A;  4W4U B;  5BPK A;  5EL8 A;  2QHB A;  3UBK A;  3V03 A;  3V08 A;  2OZB B;  2YV7 A;  1G7O A;  1HK4 A;  22GS A;  4K71 A;  4ZBQ A;  3IK7 A;  5A1N A;  3VQI A;  2F8F A;  2HRK B;  4G0L A;  1TU7 A;  4AKG A;  4QMK A;  5ECL B;  2FNO A;  1R5A A;  3VWX A;  1GUK A;  3MAK A;  2EFH A;  3Q18 A;  4PNF A;  3ZMK A;  6GSY A;  1BX9 A;  3CX9 A;  2VDB A;  4L9Q A;  1GNI A;  10GS A;  1EOH A;  2V6K A;  1HNA A;  3FR9 A;  4PUA A;  3N9J A;  1BG1 A;  1JLV A;  2BXG A;  4EXJ A;  1UA5 A;  1KDX A;  2OT3 A;  2HNL A;  1VZS A;  4MDC A;  4IEL A;  1TU8 A;  3CHX C;  2HSM B;  3I69 A;  4MF7 A;  3CSJ A;  5IIX A;  4KDU A;  5F05 A;  4MF5 A;  2OA7 A;  3KTL A;  4G0K A;  1FW1 A;  1MIY A;  2WW3 A;  3LXZ A;  2LQH A;  5J40 A;  3A73 A;  5G5E A;  3UAP A;  5KEJ A;  4G0I A;  3WYW A;  1GTU A;  5ECQ B;  4PTS A;  3UIV A;  1DUG A;  4Z69 A;  3NIV A;  2C8U A;  2BXP A;  4F5U A;  1Q4J A;  4G19 A;  5A4U A;  1M9B A;  4LMW A;  4MF6 A;  4ACS A;  4LA0 A;  3HKR A;  5ECN B;  3D0Z A;  3VI7 A;  4CHS A;  2DBX A;  1GUH A;  1PL1 A;  1LOT A;  3HJO A;  1MM8 A;  4IQA A;  5DQS A;  4WA6 B;  1NHY A;  2GTU A;  4OT2 A;  3F6F A;  19GS A;  9GSS A;  4IW9 A;  4ZBR A;  2VD1 A;  4KH7 A;  3NVI A;  4GDX A;  1F2E A;  1Y1U A;  4G04 A;  4FQU A;  1GUM A;  2E0Y A;  2BXB A;  1E7I A;  2J9H A;  3PLA A;  2VKZ G;  2NNW A;  5A4V A;  2AGH B;  3KIK A;  2XW1 A;  5D9X A;  5ECO B;  1E7H A;  3KJL A;  1K0N A;  5F0G A;  1PKW A;  4ECC A;  3GUR A;  2N5F A;  1U3I A;  3M99 C;  2VCX A;  3EIN A;  4OFM A;  3W8S A;  1HK3 A;  1SVM A;  2BXH A;  3UBL A;  2Z8J A;  3H37 A;  5ECS A;  6GSV A;  2EFE A;  1GSF A;  1SVL A;  2HRK A;  3LQ7 A;  4IBP A;  4K0N A;  5AIV A;  3LSZ A;  2K0N A;  3SIU B;  5A34 B;  3H1N A;  4PXO A;  4ECJ A;  5DJM A;  3UAR A;  2PBJ A;  4J2F A;  4GST A;  3RFR C;  1PN9 A;  5IJ5 A;  3IR4 A;  4GSS A;  2BXQ A;  4O92 A;  1E6B A;  2XVV A;  4Q5Q A;  1XWK A;  11GS A;  2VCZ A;  4GDK B;  4E99 A;  3FWB C;  1IYI A;  1PX6 A;  5J41 A;  1YJ6 A;  2CZ3 A;  2VD0 A;  3R3E A;  3GX0 A;  4F5T A;  3GTU A;  5BMU B;  2HSM A;  4GDF A;  16GS A;  5EY6 A;  1K3L A;  4JZQ A;  2GUT A;  5LD0 A;  4G9H A;  1B4P A;  18GS A;  4ZBK A;  5DCG A;  1FOU A;  2CZ2 A;  2F3M A;  2AB6 A;  1HK5 A;  2XVQ A;  3SIV B;  2DBU A;  1A0F A;  1E7A A;  4EDY A;  3GST A;  3B9L A;  3MHS B;  4IJI A;  3VI5 A;  1B48 A;  4MBE C;  3VLN A;  4KF9 A;  3KMN A;  2Z8I A;  4LB9 A;  1N5U A;  4DHX B;  3FRC A;  5IIH A;  4ECI A;  1TDI A;  5ID9 A;  2WW1 A;  3VPQ A;  1VF3 A;  3VPT A;  4ZB9 A;  1B8X A;  4ZB8 A;  5DJL A;  1HK1 A;  1HNC A;  2FHE A;  1YKC A;  4ZBB A;  3MHH B;  4IS0 A;  4IW2 A;  2ON7 A;  3KM6 A;  3QAV A;  2OAD A;  2ROH A;  4YH2 A;  1XW5 A;  4L8U A;  1VFI A;  4N0F D;  4E68 A;  3G7I A;  3FR3 A;  2WZS A;  4HI7 A;  4HJ2 A;  2AHE A;  3P8W A;  2CAI A;  4G10 A;  4G03 A;  1O9X A;  4YAV A;  4FJC B;  1Z9H A;  3ICX A;  1J78 A;  4KGI A;  3NMU A;  1MD3 A;  4F03 A;  5A34 A;  4NAW B;  1K0A A;  2GSQ A;  3LYP A;  3GSS A;  3ZML A;  4FK5 B;  1YVL A;  4OMV A;  2BXI A;  2JUH A;  2C3Q A;  1YY7 A;  2BXD A;  1ML6 A;  3FY7 A;  4KDY A;  2R4V A;  1HQO A;  3GTU B;  3TOT A;  4EDZ A;  2AJE A;  1PKZ A;  3TU3 B;  2BXO A;  7GSS A;  4LMV A;  1BJ5 A;  5GHK A;  1YEW C;  3M0F A;  2WVX A;  5ECK B;  1N25 A;  4EMX A;  2LQI A;  1F3B A;  4KE3 A;  1IYH A;  5BMU A;  2LXT A;  2DYO A;  1OKT A;  2YV9 A;  1GTI A;  5A4W A;  2D2Z A;  1BM0 A;  3GQX A;  4YQU A;  5ID7 A;  4OTU A;  6GSW A;  2C80 A;  1HNB A;  3VUR A;  1U88 A; 
#chains in the Genus database with same CATH homology
 4F5S A;  4BVX B;  1PL2 A;  2IMK A;  4E8H A;  4TQ0 A;  3KJY A;  2PER A;  2LJR A;  3CRU A;  1PA3 A;  1GSS A;  1E7F A;  6GSU A;  1GSQ A;  3NVK A;  4LUH A;  2VO4 A;  5IFO A;  4N0V A;  4F0B A;  4HOJ A;  3LYK A;  2XMO A;  4Q5N A;  4LB2 A;  3G7J A;  3B9M A;  1BG5 A;  4IVF A;  5J5N A;  5J4U A;  1HA2 A;  5DBY A;  1PD2 1;  2QM6 A;  2VCW A;  2HRA A;  3QR6 A;  2QMC A;  4E8E A;  2LOQ A;  1K3Y A;  4BL7 B;  2R3X A;  3DD3 A;  2VCT A;  12GS A;  2A2S A;  1V2A A;  5AIS A;  2YCD A;  2AAW A;  4F5V A;  1GLP A;  1TW9 A;  5ECH B;  5FUO A;  1EV4 A;  4KDX A;  2VUE A;  4AKH A;  2O5V A;  4ISD A;  5GIN A;  4ZBD A;  1MIW A;  2HSN B;  2CAQ A;  4OFT A;  3CRT A;  6GSX A;  5B5T A;  2HQT A;  3P90 A;  4RI7 A;  1GNE A;  1V40 A;  2H1L A;  2PGT A;  1C72 A;  1JLW A;  2WDU A;  3ERF A;  3LXT A;  4HGM B;  3CWG A;  3HMJ G;  2WB9 A;  5DQF A;  4GCI A;  2DSA A;  4MZW A;  3A75 A;  3H3A A;  2C3N A;  2R6K A;  1E7G A;  4K0G A;  4L8E A;  3LU6 A;  4IKH A;  4KSM A;  5D9V A;  4S1Y A;  3GUS A;  5DDL A;  5DAL A;  4NAX A;  4W66 A;  1AW9 A;  2C4J A;  3JRY A;  6GST A;  4L5L A;  2CA8 A;  1GTA A;  2BXA A;  2X64 A;  4GF0 A;  5AN1 A;  1K0C A;  1MTC A;  2BXC A;  1K0B A;  4F0C A;  1XW6 A;  4TQ1 A;  3EE2 A;  4HZ4 A;  4PGT A;  1KXP D;  5ECM B;  5AGY A;  1AQV A;  3C8E A;  3CSI A;  3CBU A;  2V36 A;  2C3T A;  1ZL9 A;  3V09 A;  1PMT A;  4QQ7 A;  5GZZ B;  4BVX A;  4AKI A;  3F6D A;  1JZR A;  5FHI A;  2BXK A;  1E7B A;  2E0X A;  5GIO A;  4BVY B;  3FWC C;  5IIU A;  4AGS A;  3TGZ A;  1VF1 A;  3PGT A;  1OE8 A;  4JBB A;  1XWG A;  5A5H B;  1M99 A;  1BF5 A;  1USB A;  1Y6E A;  3LFL A;  4YAP A;  4KAE A;  4OFN A;  1M9A A;  4YQM A;  14GS A;  5JCW A;  5D7G A;  5IJF A;  3PPU A;  3WHR A;  3QAG A;  5F06 A;  1BYE A;  5ECR B;  4FIP B;  4JK4 A;  4ZB6 A;  2EFD A;  4GTU A;  2I2Z A;  4GLT A;  3BBY A;  4IQ1 A;  4GDL B;  1K3O A;  1GUL A;  5GSS A;  2DBW A;  4BL7 A;  4Z9O A;  3IE3 A;  1LBK A;  5ELG A;  2CVD A;  4JED A;  4USS A;  5F8B A;  3SWL A;  3ZFB A;  4AKX B;  5A5K A;  3SQJ A;  3DGQ A;  1K0D A;  2JL4 A;  2HSN A;  3KMO A;  3KXO A;  3LJR A;  4KX4 A;  4N0U D;  3WHS A;  1KBN A;  4ZCG A;  5DAL B;  4I97 A;  2PVQ A;  4MP4 A;  1GTB A;  3FYG A;  4PX1 A;  3WD6 A;  3IBH A;  1MD4 A;  1GSU A;  1F3A A;  2BXF A;  1OYJ A;  2R5G A;  4NHZ A;  1GNW A;  3FR6 A;  3O76 A;  1BKE A;  1H9Z A;  3G9K D;  3M8N A;  3O3T A;  3LG6 A;  1GSD A;  4RI6 A;  3U6V A;  5HFK A;  4ID0 A;  1U87 A;  5J4Y A;  1UOR A;  2KBZ A;  4BY9 C;  2NQO A;  5LCZ A;  4GG2 A;  5IQY A;  1EV9 A;  13GS A;  1GNJ A;  2XVW A;  17GS A;  5IJE A;  5D9T A;  2WS2 A;  4PUR A;  3GA9 L;  1RK4 A;  2DYM A;  1E7E A;  4M70 B;  2GSS A;  2NTO A;  2WRT A;  1GSE A;  1ZGN A;  2VCQ A;  5ECP B;  4N3Z A;  2IMI A;  4EC0 A;  5DAK B;  3W1S A;  4HGK A;  4BVY A;  4G01 A;  1IJG A;  3VK9 A;  1KW2 A;  2XVU A;  5HOZ A;  1AQW A;  3MDK A;  5A5H A;  4L9K A;  4LUF A;  3Q74 A;  2IL3 A;  1GWC A;  5ECI B;  4J2V A;  3ZFL A;  4NHW A;  2UV8 G;  2DC5 A;  4MK3 A;  1TXU A;  4OTT A;  4ZBA A;  3TOU A;  5EVO A;  2VUF A;  1H5W A;  2BXM A;  4PNG A;  4L5O A;  3IK9 A;  3JQZ A;  1YQ1 A;  3HJM A;  4K2C A;  4OR0 A;  3QAW A;  4PQI A;  2A2R A;  5A1N B;  4MPF A;  4EE0 A;  3FNM A;  8GSS A;  1K0M A;  1E7C A;  3Q19 A;  2GSR A;  2YDF A;  1LJR A;  1HK2 A;  5FT3 A;  1GLQ A;  2BXN A;  1AXD A;  1EEM A;  6GSS A;  1PGT A;  2XSI A;  1E78 A;  5ELA A;  3PR8 A;  2GST A;  4ZUX V;  2BXL A;  1M0U A;  3ISO A;  1BAY A;  1YDK A;  5JCU A;  3GH6 A;  3N5O A;  1LNS A;  1VF4 A;  3LU8 A;  2XW0 A;  4GSN A;  5G5F A;  2EFC A;  5GST A;  3R2Q A;  3I6A A;  3CSH A;  2BXE A;  4MPG A;  3WHQ A;  4TOP A;  4ZC6 A;  1G6W A;  4BKE A;  4PO0 A;  1VF2 A;  4O7H A;  4ZB7 A;  4YQV A;  4C31 B;  5AIX A;  5B7C A;  3M1G A;  5D73 A;  2ON5 A;  3M3M A;  1NT2 B;  2UZ8 A;  1N2A A;  3F63 A;  4WR5 A;  1J7E A;  4AI6 A;  3TDL A;  2I30 A;  4WR4 A;  2PMT A;  1TF0 A;  3ERG A;  1MA9 A;  2BX8 A;  5GIP A;  2GDR A;  3RBT A;  4ECB A;  2CKX A;  3UVH A;  1JNB A;  4Q5R A;  3NVM A;  1G6Y A;  1PX7 A;  2GLR A;  4PQH A;  1FHE A;  4IGJ A;  2OAC A;  3GQU A;  2DG5 A;  4DEJ A;  1MIV A;  1OE7 A;  20GS A;  5DAK A;  5J4V A;  3IC8 A;  5FWG A;  3LU7 A;  1SVO A;  1K0O A;  4HZ2 A;  4Q5F A;  2Z8K A;  4IW1 A;  1EOG A;  4ZXG A;  2WJU A;  2VCV A;  3AY8 A;  1AQX A;  5F07 A;  1GSY A;  5J47 A;  3L0H A;  5D9W A;  1AO6 A;  4W4U B;  5BPK A;  5EL8 A;  2QHB A;  3UBK A;  3V03 A;  3V08 A;  2OZB B;  2YV7 A;  1G7O A;  1HK4 A;  22GS A;  4K71 A;  4ZBQ A;  3IK7 A;  5A1N A;  3VQI A;  2F8F A;  2HRK B;  4G0L A;  1TU7 A;  4AKG A;  4QMK A;  5ECL B;  2FNO A;  1R5A A;  3VWX A;  1GUK A;  3MAK A;  2EFH A;  3Q18 A;  4PNF A;  3ZMK A;  6GSY A;  1BX9 A;  3CX9 A;  2VDB A;  4L9Q A;  1GNI A;  10GS A;  1EOH A;  2V6K A;  1HNA A;  3FR9 A;  4PUA A;  3N9J A;  1BG1 A;  1JLV A;  2BXG A;  4EXJ A;  1UA5 A;  2OT3 A;  2HNL A;  1VZS A;  4MDC A;  4IEL A;  1TU8 A;  2HSM B;  3I69 A;  4MF7 A;  3CSJ A;  5IIX A;  4KDU A;  5F05 A;  4MF5 A;  2OA7 A;  3KTL A;  4G0K A;  1FW1 A;  1MIY A;  3LXZ A;  5J40 A;  3A73 A;  5G5E A;  3UAP A;  5KEJ A;  4G0I A;  3WYW A;  1GTU A;  5ECQ B;  4PTS A;  3UIV A;  1DUG A;  4Z69 A;  3NIV A;  2C8U A;  2BXP A;  4F5U A;  1Q4J A;  4G19 A;  5A4U A;  1M9B A;  4LMW A;  4MF6 A;  4ACS A;  4LA0 A;  3HKR A;  5ECN B;  3D0Z A;  3VI7 A;  4CHS A;  2DBX A;  1GUH A;  1PL1 A;  1LOT A;  3HJO A;  4IQA A;  5DQS A;  4WA6 B;  1NHY A;  2GTU A;  4OT2 A;  3F6F A;  19GS A;  9GSS A;  4IW9 A;  4ZBR A;  2VD1 A;  4KH7 A;  3NVI A;  4GDX A;  1F2E A;  1Y1U A;  4G04 A;  4FQU A;  1GUM A;  2E0Y A;  2BXB A;  1E7I A;  2J9H A;  3PLA A;  2VKZ G;  2NNW A;  5A4V A;  3KIK A;  2XW1 A;  5D9X A;  5ECO B;  1E7H A;  3KJL A;  1K0N A;  5F0G A;  1PKW A;  4ECC A;  3GUR A;  2N5F A;  1U3I A;  3M99 C;  2VCX A;  3EIN A;  4OFM A;  3W8S A;  1HK3 A;  1SVM A;  2BXH A;  3UBL A;  2Z8J A;  3H37 A;  5ECS A;  6GSV A;  2EFE A;  1GSF A;  1SVL A;  2HRK A;  3LQ7 A;  4IBP A;  4K0N A;  5AIV A;  3LSZ A;  3SIU B;  5A34 B;  3H1N A;  4PXO A;  4ECJ A;  5DJM A;  3UAR A;  2PBJ A;  4J2F A;  4GST A;  1PN9 A;  5IJ5 A;  3IR4 A;  4GSS A;  2BXQ A;  4O92 A;  1E6B A;  2XVV A;  4Q5Q A;  1XWK A;  11GS A;  2VCZ A;  4GDK B;  4E99 A;  3FWB C;  1IYI A;  1PX6 A;  5J41 A;  1YJ6 A;  2CZ3 A;  2VD0 A;  3R3E A;  3GX0 A;  4F5T A;  3GTU A;  5BMU B;  2HSM A;  4GDF A;  16GS A;  5EY6 A;  1K3L A;  4JZQ A;  5LD0 A;  4G9H A;  1B4P A;  18GS A;  4ZBK A;  5DCG A;  1FOU A;  2CZ2 A;  2F3M A;  2AB6 A;  1HK5 A;  2XVQ A;  3SIV B;  2DBU A;  1A0F A;  1E7A A;  4EDY A;  3GST A;  3B9L A;  3MHS B;  4IJI A;  3VI5 A;  1B48 A;  4MBE C;  3VLN A;  4KF9 A;  3KMN A;  2Z8I A;  4LB9 A;  1N5U A;  4DHX B;  3FRC A;  5IIH A;  4ECI A;  1TDI A;  5ID9 A;  3VPQ A;  1VF3 A;  3VPT A;  4ZB9 A;  1B8X A;  4ZB8 A;  5DJL A;  1HK1 A;  1HNC A;  2FHE A;  1YKC A;  4ZBB A;  3MHH B;  4IS0 A;  4IW2 A;  2ON7 A;  3KM6 A;  3QAV A;  2OAD A;  2ROH A;  4YH2 A;  1XW5 A;  4L8U A;  1VFI A;  4N0F D;  4E68 A;  3G7I A;  3FR3 A;  4HI7 A;  4HJ2 A;  2AHE A;  3P8W A;  2CAI A;  4G10 A;  4G03 A;  1O9X A;  4YAV A;  4FJC B;  1Z9H A;  3ICX A;  1J78 A;  4KGI A;  3NMU A;  1MD3 A;  4F03 A;  5A34 A;  4NAW B;  1K0A A;  2GSQ A;  3LYP A;  3GSS A;  3ZML A;  4FK5 B;  1YVL A;  4OMV A;  2BXI A;  2JUH A;  2C3Q A;  1YY7 A;  2BXD A;  1ML6 A;  3FY7 A;  4KDY A;  2R4V A;  1HQO A;  3GTU B;  3TOT A;  4EDZ A;  2AJE A;  1PKZ A;  3TU3 B;  2BXO A;  7GSS A;  4LMV A;  1BJ5 A;  5GHK A;  3M0F A;  5ECK B;  1N25 A;  4EMX A;  1F3B A;  4KE3 A;  1IYH A;  5BMU A;  2DYO A;  1OKT A;  2YV9 A;  1GTI A;  5A4W A;  2D2Z A;  1BM0 A;  3GQX A;  4YQU A;  5ID7 A;  4OTU A;  6GSW A;  2C80 A;  1HNB A;  3VUR A;  1U88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...