3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
4CNDA 2EGWA 4YQAA 5GMCA 2O3AA 4YVHA 1V6ZA 4YQLA 4X3LA 4YQCA 1J85A 4YVKA 3BBDA 3KNUA 1VHKA 4YQSA 4YQ9A 3OIJA 4JALA 4YQ2A 4YQBA 4X3MA 4YQIA 1ZJRA 4CNGA 4IG6A 2V3KA 4YPYA 3E5YA 4MCBA 3NK7A 2HA8A 4YQGA 4MCCA 1VH0A 1UAJA 1UALA 3L8UA 4YVIA 1Z85A 4YQQA 4RG1A 4YQ6A 3BBEA 4YQRA 3N4KA 3OINA 1MXIA 3KW2A 4CNFA 4FAKA 5CO4A 1UAMA 4YQNA 3KY7A 2QWVA 4YQ8A 1UAKA 3N4JA 5FAIA 4YPWA 3NK6A 5GM8A 4YQ4A 4YQ7A 2CX8A 4PZKA 1OY5A 4JAKA 1IPAA 5D9FA 1GZ0A 2YY8A 1TO0A 1O6DA 3AIAA 4YQ5A 4YPXA 3O7BA 4KGNA 3AI9X 1X7PA 2I6DA 4YQDA 5GMBA 3DCMX 2EGVA 4J3CA 4YQ3A 4H3YA 3IC6A 4YVJA 4L69A 4KDZA 4YQ0A 1VHYA 1P9PA 4H3ZA 4XBOA 3QUVA 2QMMA 3ONPA 4YQOA 1NS5A 3IEFA 4YQPA 1X7OA 4CNEA 3AXZA 3GYQA 4YQKA 3OIIA 2Z0YA 4YQJA 4YQ1A 3BBHA 2V3JA 4YPZA 4E8BA 4MCDA 1K3RA 3KTYA 3ILKA 4YVGA 4YQTA 1NXZA 1V2XA
chains in the Genus database with same CATH superfamily
1V33A 2EGWA 4OVZA 4LFAM 3SHFA 3I4YA 1HQYE 3C9PA 3MHVC 3THGA 2GNOA 2V1CA 3FRIA 1OQYA 4B7HA 1V6ZA 4YQLA 2KNZA 2UXCM 4G6ZA 2KNVA 2C96A 2JY8A 3GLHB 4HEOA 1FNNA 2FFJA 3B9PA 3PNYA 1DO2A 3DA1A 3OTOM 3GLFE 2QENA 4LJ6A 4NL4H 1TGUA 4JV5M 1NSFA 4FD2A 1XXHE 3EIHA 3T1HM 1K82A 3J80S 5F3WA 3HZJA 3FE3A 5JI3E 4AG6A 4X3MA 2I7PA 4IBJA 3M7GA 2ZTDA 2OOBA 1DGBA 3UJNA 2XFSA 2DZLA 4L78A 5KQ8A 3GLIA 4M9ZA 3AV0A 1VEJA 1E32A 1IY2A 3MK6A 3HU2A 1VH0A 3FUWA 1UAJA 3L8UA 2LVQD 1JR3D 1ZV1A 3D8BA 1QANA 5LMNM 3SHGB 1Z85A 4X66M 2LVPC 1GJTA 2CE7A 3HU1A 1J5EM 1PJQA 3TQSA 3R8FA 3GP1A 2CV2A 2A5YB 3A45A 4KHPM 3FTFA 3IHPA 2UUCM 2C5RA 2CRUA 4IBKA 3KW2A 3DFZA 4RKUF 2UUBM 2UU9M 2QBYB 1QZEA 3D8LA 1N32M 4PT5A 4YQNA 3LVWA 3SYKA 3GRUA 3KXEC 1DGGA 1Z5AA 4DR2M 1DGHA 2HKJA 3H4JA 2EKKA 3KFUG 5A2QS 2ZM6M 3SARA 4X64M 4YQ8A 5FSWA 1R4GA 2AHMA 3JR4A 4L8RC 4LJ5A 3EIEA 1EFUB 2ZAOA 5GM8A 5DYIA 3U6CA 3E21A 4YQ4A 4GC9A 3KP1E 3UMMA 3MMPA 1TDHA 1IBLM 4YQ7A 3VDUA 1F4IA 4B08A 1IY1A 5FTKA 2R4JA 4GH9A 4QNRA 4FWHA 2KXEA 3VKGA 1OAOC 2DAGA 2K9DA 3I04M 1IN7A 3K92A 2YR0A 2YY8A 1XHBA 3HJ8A 3KOWE 4IIWA 4JI0M 4D82A 1PJJA 2DXIA 2X49A 4YPXA 1YUBA 1K3XA 4JYAM 3O7BA 3HX3A 2C9OA 4YQDA 2J5YA 5GMBA 3GLIB 5DFLA 4FW9A 4TUWA 3I51A 2EGVA 5EP2A 1HT2E 1SXJB 3IC6A 1PJTA 4L4UA 3UGJA 3U5ZB 3A42A 2Z7JA 2MJ5B 3LW5F 2VQEM 1C1KA 2CHVA 4FCWA 2KNAA 2L6OA 4DV5M 4KDZA 4YQ0A 3VLFB 1X37A 1WGNA 2DVWB 2DZOB 4LF8M 1G4AE 2KA6B 2W82A 4BB9A 4AKGA 3KOYE 1NV9A 4DBGB 2DAEA 3QUVA 3HU3A 3TWMA 4X65M 1XMQM 3HKPA 2J7NA 2V6ZM 3IEFA 4YQPA 2XF3A 1L8QA 2YNMD 3U60A 3CF2A 3W0FA 1G41A 4GITA 1QDTA 2HWJA 4B7FA 4LJ4A 5LMUM 1VEGA 4L15A 1IN8A 3IG5A 2KRUA 4NXMM 4B3MM 1K3RA 4IBDA 3GLFB 4MCDA 3FRHA 1ZQ9A 2OPFA 4MGIE 1GL7A 5FTNA 5ITUA 2DHYA 1D0MA 1V2XA 2LWXA 3K2LA 4CNDA 1OJLA 4DV2M 4JXJA 2F4VM 4YQAA 4DR3M 5BPVA 1VQ1A 3GLFA 2RGOA 3E4RA 2K6BA 4PDIA 3UK6A 4DV4M 4G4RA 4LJAA 1L2BA 3KP0E 2ZBKB 1H6UA 2KRKA 4A3VB 2O5RA 4KO8A 3U61A 3VK7A 3LQRA 4GIPA 2JUJA 4W5WA 5C1BA 4GMQA 1HNZM 3U60B 5EXPA 3JAMS 7CATA 1OAIA 2YFQA 2LVAA 5H37D 2CWBA 2UXBM 4YQ9A 4JWHA 1NHGC 3SMPA 2CUZA 4DV1M 3U6QA 2DHRA 2K47A 3AOEA 1G71A 3I4VA 4NOOB 5E26A 3CF0A 3RFWA 2F5SA 3A98B 3PNVA 3B7NA 3GPYA 1QAMA 1WXQA 4KODA 1IN4A 2V3KA 4YPYA 1D0LA 1JQJC 2L4FA 2Z3XA 2HA8A 4LFBM 3NK7A 4YQGA 1GO5A 4MCCA 4QHSA 3W0LB 3IECA 4LRTA 4YVIA 1JR3E 3GLHA 4RG1A 4JI3M 2UUAM 3RE8A 4FWDA 2JY7A 3FUVA 1E9RA 4IBIA 3BBEA 3CF6E 4Z6YA 3OINA 4NRWA 3HHWA 2WZJA 1GVNA 4NRVA 5IWAM 3U6MA 4ZPXA 3CGWA 2UXDM 4IBGA 3L25A 3SAUA 1R6BX 2XSZD 3TE6A 4PCZA 1JB0F 1NJFA 2JA2A 5EXSA 1OIPA 3GPXA 2LH0A 5KPRA 1PJIA 2CEAA 2L7IA 2FOIC 3KW6A 5KO3A 1HNWM 4F1IA 5FAIA 1SXJE 1NJGA 3NK6A 4AW4A 4DUYM 2F5OA 1N34M 1TDZA 1ZAEA 3ZH9B 3GPPA 1UFZA 3U6EA 1IXSB 1IY0A 1E94E 1R5LA 1N75A 4G4QA 2XZFA 2QQ8A 4AKHA 1WJ7A 1IPAA 2L09A 3UZUA 1KYIA 2CHGA 4JI1M 1MU5A 4OW0A 4Q7JA 4JI4M 3LCUA 3T38A 1T3TA 1TO0A 2R62A 2Q2EB 1OTRA 1QQWA 2C99A 4GHLA 3AI9X 3I01M 2YQZA 4R3DA 2R4EA 3LVVA 2HAKA 4ITQA 4J3CA 1WR1B 4H3YA 3HY5A 2LVOC 1ZMUA 4YVJA 1VG5A 4LF9M 5E6JA 1OKSA 2KZUA 4FCTA 3KS8A 1HT1E 1L1TA 4LRSA 2VDBB 2V1UA 5ITYA 3QWLA 1YE9A 3L29A 2R46A 4DV7M 1EE8A 1NV8A 2F5QA 3KOZE 1SXJA 1Z59A 3Q8GA 3TPZA 3B89A 4LJ8A 3GLGA 3FYDA 4H3ZA 4XBOA 2DWMA 4CGYB 3B7QA 1LV7A 2VQFM 4MGHA 3ONPA 1NS5A 1NNUC 4FCVA 3J2PB 1AUAA 1R7RA 4IJFA 3AOEC 3FTCA 4FWGA 4M9XA 5ITXE 1TTEA 2J7OA 4FVMA 3SATA 5L8RF 4OU7A 3SBJA 1WIVA 5FTJA 2Y21A 1P3QQ 2V3JA 4YPZA 1WHCA 2VIIA 4YHHM 5EXTA 2JZ0A 2QCUA 4GC5A 2LNHC 3NBXX 4BBAA 1OIZA 2P5TA 4R71A 1GL6A 4PDGA 2D7HA 3LMMA 3Q8XA 3E46A 1Q02A 3ZCBB 4QOSA 2DAMA 1NY5A 4QHTA 4LGYA 2ZANA 3TWLA 3K8ZA 5GMCA 2BWEA 4CHTB 2Z8YM 3HHYA 4YVHA 5FTLA 5IT9S 5EJCA 4X3LA 1J09A 2R0IA 4CIZA 3GO8A 1WGLA 1VHKA 2KZSA 4YQSA 1ZMVA 4JN6A 4LJ7A 1A5TA 3GPUA 2X4AA 1QZMA 3CTWB 3OIJA 1QDRA 3KDSE 3HJSA 4F2LA 2DWZB 3BXWA 1IBKM 4JALA 4IBBA 1D0KA 3HJQA 3FUUA 4YQBA 2C98A 3U5ZA 4JWGA 4WW0A 2LHCA 2QZ4A 5KPTA 2D7EA 1L1ZA 1HNXM 2CV1A 2KDLA 1NNJA 5EQTA 4D81A 1IM2A 2R45A 4I8OA 3M6AA 3RGPA 4NSOB 4Z8XA 2G8LA 2JY6B 1XMOM 8CATA 5BR8M 3K9PA 2JP7A 4MM3B 4AG5A 4M0DA 1GJSA 4G4OA 1XNQM 1BVSA 4DV3M 4YQ6A 2R65A 1SXJD 4MGKE 4P16A 1HJPA 4GHAA 4YQRA 2MH8A 1MXIA 1L2CA 5ITRA 3C3DA 3HWSA 3SMSA 3WHKA 3FTDA 5IREB 1V92A 3J7BA 4LFCM 4YY3M 2L7HA 4FAKA 1Q3CA 2EO2A 1Y8GA 2VF8A 5CO4A 3FUTA 2NQ8C 3V76A 3DZDA 4CJ6A 2E5LM 2BNKA 1W5SA 1CUKA 1VEKA 1Q3BA 2F5NA 3J7AS 4WP2A 3A46A 3GLIE 2DWLA 5ITXA 4GKJM 5ITQA 1GLNA 3U6SA 2DAIA 4R7GA 3VDPA 1OFHA 2EJSA 2QHOB 3N4JA 4JWFA 2QBYA 1XWIA 2G3QA 4XK8F 1J7KA 3J81S 5FTMA 2QP9X 1NO1A 3FD9A 4AZFA 2OQ4A 1IXZA 3K1JA 4PZKA 4B3SM 1V34A 4GRIA 3GRVA 4DR1M 1QUTA 3U6LA 4G4NA 2F5PA 2WSEF 3QYEA 1UM8A 3AFHA 3SC3A 1LTMA 4QNMA 4P17A 1YSYA 2KHHA 2G5GX 1O6DA 3SFZA 3L2AA 1IBMM 3AIAA 3FYCA 4YQ5A 5DYGA 4IBFA 2Z4RA 4KGNA 2DKLA 1QAOA 3C3EA 2I6DA 2B3TA 1GABA 3DCMX 2ERCA 4YQ3A 4I5SA 4LF5M 1TH4A 4WURA 4CISA 1NHWC 4KT0F 2LVNC 1NY6A 2XSZA 3TWKA 3R9XB 4L69A 5ITTA 3K9OA 3KOXE 1G3IA 4I81A 5DNYA 1QVRA 1PM5A 3AOGA 2BWBA 1KSFX 4K0KM 2K0BX 1P9PA 1W5TA 1DGFA 1MN3A 1GKIA 2KEBA 1QUSA 1T6OA 2FH0A 3HGIA 3T15A 2Y20A 2FS1A 2R18A 4IJEA 3W68A 2LHGA 5EP1A 3VK8A 2OO9A 2Z4SA 5EP4A 2QMMA 2XEPA 4LZZA 3BBZA 2JZ1A 4II7A 2WSCF 3NBIA 4M0WA 1X7OA 1KFVA 4CNEA 3AXZA 2D7GA 2Z0YA 2DNAA 4YQJA 3JR5A 2EUCA 1TH3A 4E8BA 2H5XA 3AKZA 3SAWA 1XC8A 4RF0A 1DGHB 1G59A 3KTYA 2GQFA 3ILKA 4FMWA 4JI8M 4YVGA 3VFDA 4LJ9A 2JNHA 4YQTA 3GQ3A 1JR3A 2CHQA 3GLHE 3B74A 3PVSA 1NXZA 2M60A 3PXGA 4MH0E 1R2YA 1S3SA 2O01F 2WSFF 1Q39A 2X8AA 3FTEA 2EA0A 2DZNB 4QOZC 1DV0A 4B3TM 3VKHA 2BJWA 2XFTA 2O3AA 4Y28F 4HL4A 4DR6M 2Y0TA 2ZTCA 3FUXA 4HLQA 2XH9A 1RU3A 4D80A 3GLGB 4YQCA 1J85A 4DUZM 1IN6A 2DWNA 3BBDA 2LBCA 3BOSA 3KNUA 1SXJC 1PRBA 1QYRA 2DAKA 2VF7A 3B7ZA 1IXRC 4DV0M 4M9SA 3QAUA 5JI2E 2OOAA 3HHXA 3QYBA 2LTUA 4JI5M 2CFOA 2HCBA 4JI6M 5KPZA 1IFYA 1R2ZA 1IN5A 3NWLA 1I94M 3L27A 4MGZE 4JI7M 3AL0C 4YQ2A 4YQIA 1ZJRA 3W67A 3L28A 3U6DA 3SASA 4LF7M 2N35A 2I7NA 3ZQJA 2DI0A 4DR4M 4CNGA 4IG6A 2JXNA 3E5YA 4MCBA 1AIPC 1VDLA 4NSRA 3IG8A 3GLGE 4GKKM 4MGYE 2Y0QA 2R44A 1UALA 4YQQA 4REZA 2MR9A 4JI2M 4BLCA 2QSFX 1MX0A 3WHLA 3GQ5A 3N4KA 4LY6A 2H1RA 2R6FA 2L4EA 4EIWA 4AKIA 1ORYB 1HR0M 1QAQA 1YLAA 4OVZB 4CNFA 1PGYA 1N77A 2ZAMA 3U6OA 1D2NA 1VDDA 4L16A 1TH2A 3U6PA 4DR7M 2DENA 3HHZA 3SAVA 1UAMA 4YVKA 1XXHB 4DV6M 4X62M 3E9SA 4RF1A 3KY7A 5IZ7D 4OX9M 2QWVA 1UAKA 1XXHA 2MROB 3GRYA 2MGWA 4YPWA 2O25A 3KSXA 1E9SA 3F92A 1C7YA 3T6PA 3GQ4A 3KVWA 3J27B 2CX8A 1DO0A 4ANRA 3LCVB 4G3OA 2QNJA 1OY5A 3H4MA 4JAKA 2QPAA 1L2DA 4LGMA 5D9FA 1GZ0A 2APLA 1MJGM 4LF4M 1Z5BA 2XGNA 3AJIB 2M5ZA 4B3RM 3LQQA 4LZJA 2XLJA 3M0EA 2FE8A 1G8PA 1X7PA 4L6V6 3MJ5A 4RNAA 5C18A 4MB7A 1Z6TA 3T1YM 1OFIA 2LXEA 2BJVA 4AQYM 2XZUA 1EIJA 4NXNM 5KQDA 1IQPA 1T43A 4PD2A 1Z5CA 4DR5M 2HHHM 3L26A 5GKNA 2EKFA 1N36M 4AI6A 2CV0A 2RRUA 2C9CA 1TR8A 3KSJA 4KLNA 3PFIA 1VHYA 4NC6A 3ZC7B 3FKEA 1N78A 3U61B 1I4WA 1ZMWA 4LF6M 4IBCA 3SYLA 3GRRA 1FJGM 1TF0B 4YQOA 3RGSA 4B7GA 1IXSA 4XGIA 3KS4A 5EXXA 1HQCA 1N33M 1PJSA 4IBEA 2HL7A 5FLXS 4GEWA 3GYQA 4I4LA 4YQKA 3OIIA 4YQ1A 2JY5A 1NVMA 2KW0A 4LCBA 4UN2B 3DOAA 3BBHA 3C58A 4JWJA 5EP3A 4LG2A 1K3WA 2FNAA 3TL4X 2CP8A 2JWSA 1XNRM 1SG9A 4S12A 2RKOA 1XB2B 2L2DA 2RGHA
chains in the Genus database with same CATH topology
2EGWA 4OVZA 4LFAM 3SHFA 3I4YA 1HQYE 3MHVC 3THGA 4B7HA 2V1CA 1V6ZA 4YQLA 2UXCM 2C96A 3GLHB 1FNNA 2FFJA 3B9PA 3PNYA 1DO2A 3DA1A 3OTOM 2QENA 4LJ6A 4NL4H 1TGUA 4JV5M 1NSFA 4FD2A 3EIHA 3T1HM 1K82A 3J80S 5F3WA 5JI3E 4AG6A 4X3MA 2I7PA 4IBJA 3M7GA 3UJNA 1DGBA 2XFSA 4L78A 5KQ8A 3GLIA 4M9ZA 3AV0A 1E32A 1IY2A 3MK6A 3HU2A 1VH0A 3FUWA 1UAJA 3L8UA 1JR3D 3D8BA 5LMNM 1QANA 1Z85A 3SHGB 4X66M 2CE7A 3HU1A 1J5EM 3TQSA 3R8FA 3GP1A 2CV2A 2A5YB 3A45A 4KHPM 3FTFA 2UUCM 2C5RA 4IBKA 3KW2A 3DFZA 2UUBM 2UU9M 2QBYB 3D8LA 1N32M 4PT5A 4YQNA 3LVWA 3SYKA 3GRUA 3KXEC 1DGGA 1Z5AA 4DR2M 1DGHA 2HKJA 3KFUG 5A2QS 3SARA 4X64M 4YQ8A 5FSWA 4L8RC 2AHMA 3JR4A 4LJ5A 3EIEA 2ZAOA 5GM8A 5DYIA 3U6CA 4YQ4A 4GC9A 3KP1E 3UMMA 4YQ7A 1TDHA 1IBLM 3VDUA 4B08A 1IY1A 5FTKA 2R4JA 4GH9A 4QNRA 4FWHA 2KXEA 3VKGA 1IN7A 3K92A 2YR0A 2YY8A 1XHBA 3HJ8A 3KOWE 4IIWA 4JI0M 4D82A 1PJJA 2DXIA 2X49A 4YPXA 1YUBA 1K3XA 4JYAM 3O7BA 2C9OA 4YQDA 5GMBA 3GLIB 4TUWA 4FW9A 2EGVA 3I51A 5EP2A 1HT2E 1SXJB 3IC6A 4L4UA 3UGJA 3U5ZB 3A42A 2Z7JA 1C1KA 2CHVA 4FCWA 4DV5M 2L6OA 4KDZA 4YQ0A 3VLFB 1X37A 2DVWB 2DZOB 4LF8M 1G4AE 2KA6B 2W82A 4BB9A 4AKGA 3KOYE 3QUVA 3HU3A 3TWMA 4X65M 1XMQM 3HKPA 2J7NA 2V6ZM 3IEFA 4YQPA 2XF3A 1L8QA 2YNMD 3U60A 3CF2A 3W0FA 1G41A 4GITA 4B7FA 4LJ4A 5LMUM 4L15A 1IN8A 3IG5A 2KRUA 4NXMM 4B3MM 1K3RA 4IBDA 3GLFB 4MCDA 1ZQ9A 2OPFA 4MGIE 1GL7A 5FTNA 5ITUA 1V2XA 2LWXA 3K2LA 4CNDA 1OJLA 4DV2M 4JXJA 2F4VM 4YQAA 4DR3M 5BPVA 3GLFA 2RGOA 3E4RA 4PDIA 4G4RA 3UK6A 4DV4M 4LJAA 1L2BA 3KP0E 2ZBKB 1H6UA 2KRKA 4A3VB 2O5RA 4KO8A 3U61A 3VK7A 3LQRA 4GIPA 4W5WA 5C1BA 4GMQA 1HNZM 3U60B 5EXPA 3JAMS 7CATA 2YFQA 5H37D 2UXBM 4YQ9A 4JWHA 1NHGC 3SMPA 2CUZA 4DV1M 3U6QA 2DHRA 2K47A 3AOEA 4NOOB 3I4VA 5E26A 2F5SA 3CF0A 3RFWA 3A98B 3PNVA 3GPYA 1QAMA 1WXQA 4KODA 1IN4A 2V3KA 4YPYA 1JQJC 2Z3XA 2HA8A 4LFBM 3NK7A 4YQGA 4MCCA 4QHSA 3W0LB 4LRTA 4YVIA 3GLHA 4RG1A 4JI3M 2UUAM 3RE8A 4FWDA 3FUVA 1E9RA 4IBIA 3BBEA 3CF6E 4Z6YA 3OINA 4NRWA 3HHWA 1GVNA 4NRVA 5IWAM 3U6MA 4ZPXA 2UXDM 4IBGA 3L25A 3SAUA 1R6BX 2XSZD 3TE6A 4PCZA 1NJFA 2JA2A 5EXSA 3GPXA 2LH0A 5KPRA 1PJIA 2CEAA 2L7IA 2FOIC 3KW6A 5KO3A 1HNWM 5FAIA 1SXJE 1NJGA 3NK6A 4AW4A 4DUYM 2F5OA 1N34M 1TDZA 1ZAEA 3ZH9B 3GPPA 3U6EA 1IXSB 1IY0A 1E94E 1N75A 4G4QA 2XZFA 4AKHA 1IPAA 2L09A 3UZUA 1KYIA 2CHGA 4JI1M 1MU5A 4OW0A 4JI4M 3T38A 1T3TA 1TO0A 2R62A 2Q2EB 1QQWA 2C99A 4GHLA 3AI9X 2YQZA 4R3DA 2R4EA 3LVVA 4ITQA 4J3CA 4H3YA 4YVJA 4LF9M 5E6JA 2KZUA 4FCTA 3KS8A 1HT1E 1L1TA 4LRSA 2V1UA 5ITYA 3QWLA 1YE9A 3L29A 2R46A 4DV7M 1EE8A 2F5QA 3KOZE 1SXJA 1Z59A 3TPZA 4LJ8A 3GLGA 3FYDA 4H3ZA 4XBOA 2DWMA 4CGYB 2VQFM 1LV7A 3ONPA 4MGHA 1NS5A 1NNUC 4FCVA 3J2PB 1R7RA 4IJFA 4M9XA 3AOEC 3FTCA 4FWGA 5ITXE 2VQEM 2J7OA 3SATA 4FVMA 4OU7A 3SBJA 5FTJA 2Y21A 2V3JA 4YPZA 2VIIA 4YHHM 5EXTA 2QCUA 4GC5A 2LNHC 4BBAA 2P5TA 1GL6A 4PDGA 3LMMA 3Q8XA 2D7HA 3ZCBB 4QOSA 1NY5A 4QHTA 4LGYA 2ZANA 3TWLA 3K8ZA 5GMCA 4CHTB 3HHYA 4YVHA 5FTLA 5IT9S 5EJCA 4X3LA 1J09A 3GO8A 1VHKA 2KZSA 4YQSA 4JN6A 4LJ7A 3GPUA 2X4AA 1QZMA 3CTWB 3OIJA 3KDSE 3HJSA 2DWZB 1IBKM 4JALA 4IBBA 3HJQA 4YQBA 3FUUA 2C98A 3U5ZA 4JWGA 2RKOA 4WW0A 2QZ4A 5KPTA 2D7EA 1L1ZA 1HNXM 2CV1A 1NNJA 5EQTA 4D81A 1IM2A 2R45A 4I8OA 3M6AA 3RGPA 4NSOB 4Z8XA 2G8LA 1XMOM 8CATA 5BR8M 4AG5A 4MM3B 4M0DA 4G4OA 1XNQM 4DV3M 4YQ6A 2R65A 1SXJD 4MGKE 4P16A 4GHAA 4YQRA 1MXIA 1L2CA 5ITRA 3HWSA 3SMSA 3WHKA 3FTDA 5IREB 3J7BA 4LFCM 4YY3M 2L7HA 4FAKA 1Q3CA 2EO2A 5CO4A 3FUTA 2NQ8C 2E5LM 3DZDA 2BNKA 1W5SA 1Q3BA 2F5NA 3J7AS 3A46A 2DWLA 5ITXA 4GKJM 5ITQA 1GLNA 3U6SA 4R7GA 3VDPA 1OFHA 3N4JA 4JWFA 2QBYA 1XWIA 1J7KA 3J81S 5FTMA 2QP9X 2OQ4A 3FD9A 4AZFA 1IXZA 3K1JA 4PZKA 4B3SM 4GRIA 4DR1M 3GRVA 3U6LA 4G4NA 2F5PA 1UM8A 3AFHA 3SC3A 4QNMA 1YSYA 1O6DA 2G5GX 3SFZA 3L2AA 1IBMM 3AIAA 3FYCA 4YQ5A 5DYGA 4IBFA 2Z4RA 4KGNA 1QAOA 2I6DA 3DCMX 2ERCA 4YQ3A 4I5SA 4LF5M 1TH4A 4WURA 4CISA 1NHWC 1NY6A 2XSZA 3TWKA 3R9XB 4L69A 5ITTA 3KOXE 4I81A 1G3IA 5DNYA 1PM5A 1QVRA 3AOGA 1KSFX 4K0KM 1P9PA 1W5TA 1DGFA 2KEBA 1GKIA 3T15A 3HGIA 2Y20A 2R18A 4IJEA 5EP1A 3VK8A 2Z4SA 5EP4A 2QMMA 2XEPA 4LZZA 4II7A 3NBIA 4M0WA 1X7OA 1KFVA 4CNEA 3AXZA 2D7GA 2Z0YA 4YQJA 3JR5A 2EUCA 1TH3A 4E8BA 3AKZA 3SAWA 1XC8A 4RF0A 1DGHB 1G59A 3KTYA 3ILKA 4FMWA 4JI8M 4YVGA 3VFDA 4LJ9A 4YQTA 3GQ3A 1JR3A 2CHQA 3PVSA 1NXZA 2M60A 3PXGA 4MH0E 1R2YA 1S3SA 2X8AA 1Q39A 3VKHA 3FTEA 2EA0A 2DZNB 4QOZC 4B3TM 2BJWA 2XFTA 2O3AA 4HL4A 4DR6M 2Y0TA 3FUXA 4HLQA 2XH9A 4D80A 3GLGB 4YQCA 1J85A 4DUZM 1IN6A 2DWNA 3BBDA 4YVKA 3BOSA 3KNUA 1SXJC 1QYRA 1IXRC 4DV0M 4M9SA 3QAUA 5JI2E 4JI5M 3HHXA 2CFOA 2HCBA 4JI6M 5KPZA 4YQ2A 1R2ZA 1IN5A 3NWLA 1I94M 3L27A 4MGZE 4JI7M 3AL0C 4YQIA 1ZJRA 3L28A 3U6DA 3SASA 4LF7M 4CNGA 2I7NA 4DR4M 4IG6A 3E5YA 4MCBA 4NSRA 3IG8A 4GKKM 4MGYE 2Y0QA 1UALA 4YQQA 4REZA 4JI2M 4BLCA 1MX0A 3WHLA 3GQ5A 3N4KA 4LY6A 2H1RA 4EIWA 4AKIA 1ORYB 1HR0M 1QAQA 4OVZB 4CNFA 1N77A 2ZAMA 3U6OA 1D2NA 1VDDA 4L16A 1TH2A 3U6PA 4DR7M 3HHZA 3SAVA 1UAMA 1XXHB 4DV6M 4X62M 3E9SA 4RF1A 3KY7A 5IZ7D 4OX9M 2QWVA 1UAKA 1XXHA 3GRYA 4YPWA 3KSXA 1E9SA 3GQ4A 3KVWA 3J27B 2CX8A 1DO0A 1OY5A 3H4MA 4JAKA 2QPAA 1L2DA 4LGMA 5D9FA 1GZ0A 4LF4M 1Z5BA 2XGNA 3AJIB 2M5ZA 4B3RM 3LQQA 4LZJA 2XLJA 3M0EA 2FE8A 1G8PA 1X7PA 3MJ5A 4RNAA 5C18A 4MB7A 1Z6TA 3T1YM 1OFIA 2LXEA 2BJVA 4AQYM 2XZUA 4NXNM 5KQDA 1IQPA 4PD2A 1Z5CA 4DR5M 2HHHM 3L26A 5GKNA 1N36M 4AI6A 2CV0A 4KLNA 2C9CA 3KSJA 3PFIA 1VHYA 3ZC7B 3FKEA 1N78A 3U61B 1I4WA 4LF6M 4IBCA 3SYLA 3GRRA 1FJGM 4YQOA 3RGSA 4B7GA 4XGIA 3KS4A 5EXXA 1HQCA 1N33M 4IBEA 5FLXS 2HL7A 3GYQA 4YQKA 4I4LA 3OIIA 4YQ1A 1NVMA 2KW0A 4LCBA 3BBHA 3DOAA 4JWJA 3C58A 5EP3A 4LG2A 1K3WA 2FNAA 3TL4X 1XNRM 4S12A 4G6ZA 2ZM6M 2RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CND A;  2EGW A;  4YQA A;  5GMC A;  2O3A A;  4YVH A;  1V6Z A;  4YQL A;  4X3L A;  4YQC A;  1J85 A;  4YVK A;  3BBD A;  3KNU A;  1VHK A;  4YQS A;  4YQ9 A;  3OIJ A;  4JAL A;  4YQ2 A;  4YQB A;  4X3M A;  4YQI A;  1ZJR A;  4CNG A;  4IG6 A;  2V3K A;  4YPY A;  3E5Y A;  4MCB A;  3NK7 A;  2HA8 A;  4YQG A;  4MCC A;  1VH0 A;  1UAJ A;  1UAL A;  3L8U A;  4YVI A;  1Z85 A;  4YQQ A;  4RG1 A;  4YQ6 A;  3BBE A;  4YQR A;  3N4K A;  3OIN A;  1MXI A;  3KW2 A;  4CNF A;  4FAK A;  5CO4 A;  1UAM A;  4YQN A;  3KY7 A;  2QWV A;  4YQ8 A;  1UAK A;  3N4J A;  5FAI A;  4YPW A;  3NK6 A;  5GM8 A;  4YQ4 A;  4YQ7 A;  2CX8 A;  4PZK A;  1OY5 A;  4JAK A;  1IPA A;  5D9F A;  1GZ0 A;  2YY8 A;  1TO0 A;  1O6D A;  3AIA A;  4YQ5 A;  4YPX A;  3O7B A;  4KGN A;  3AI9 X;  1X7P A;  2I6D A;  4YQD A;  5GMB A;  3DCM X;  2EGV A;  4J3C A;  4YQ3 A;  4H3Y A;  3IC6 A;  4YVJ A;  4L69 A;  4KDZ A;  4YQ0 A;  1VHY A;  1P9P A;  4H3Z A;  4XBO A;  3QUV A;  2QMM A;  3ONP A;  4YQO A;  1NS5 A;  3IEF A;  4YQP A;  1X7O A;  4CNE A;  3AXZ A;  3GYQ A;  4YQK A;  3OII A;  2Z0Y A;  4YQJ A;  4YQ1 A;  3BBH A;  2V3J A;  4YPZ A;  4E8B A;  4MCD A;  1K3R A;  3KTY A;  3ILK A;  4YVG A;  4YQT A;  1NXZ A;  1V2X A; 
#chains in the Genus database with same CATH topology
 1V33 A;  2EGW A;  4OVZ A;  4LFA M;  3SHF A;  3I4Y A;  1HQY E;  3C9P A;  3MHV C;  3THG A;  2GNO A;  2V1C A;  3FRI A;  1OQY A;  4B7H A;  1V6Z A;  4YQL A;  2KNZ A;  2UXC M;  4G6Z A;  2KNV A;  2C96 A;  2JY8 A;  3GLH B;  4HEO A;  1FNN A;  2FFJ A;  3B9P A;  3PNY A;  1DO2 A;  3DA1 A;  3OTO M;  3GLF E;  2QEN A;  4LJ6 A;  4NL4 H;  1TGU A;  4JV5 M;  1NSF A;  4FD2 A;  1XXH E;  3EIH A;  3T1H M;  1K82 A;  3J80 S;  5F3W A;  3HZJ A;  3FE3 A;  5JI3 E;  4AG6 A;  4X3M A;  2I7P A;  4IBJ A;  3M7G A;  2ZTD A;  2OOB A;  1DGB A;  3UJN A;  2XFS A;  2DZL A;  4L78 A;  5KQ8 A;  3GLI A;  4M9Z A;  3AV0 A;  1VEJ A;  1E32 A;  1IY2 A;  3MK6 A;  3HU2 A;  1VH0 A;  3FUW A;  1UAJ A;  3L8U A;  2LVQ D;  1JR3 D;  1ZV1 A;  3D8B A;  1QAN A;  5LMN M;  3SHG B;  1Z85 A;  4X66 M;  2LVP C;  1GJT A;  2CE7 A;  3HU1 A;  1J5E M;  1PJQ A;  3TQS A;  3R8F A;  3GP1 A;  2CV2 A;  2A5Y B;  3A45 A;  4KHP M;  3FTF A;  3IHP A;  2UUC M;  2C5R A;  2CRU A;  4IBK A;  3KW2 A;  3DFZ A;  4RKU F;  2UUB M;  2UU9 M;  2QBY B;  1QZE A;  3D8L A;  1N32 M;  4PT5 A;  4YQN A;  3LVW A;  3SYK A;  3GRU A;  3KXE C;  1DGG A;  1Z5A A;  4DR2 M;  1DGH A;  2HKJ A;  3H4J A;  2EKK A;  3KFU G;  5A2Q S;  2ZM6 M;  3SAR A;  4X64 M;  4YQ8 A;  5FSW A;  1R4G A;  2AHM A;  3JR4 A;  4L8R C;  4LJ5 A;  3EIE A;  1EFU B;  2ZAO A;  5GM8 A;  5DYI A;  3U6C A;  3E21 A;  4YQ4 A;  4GC9 A;  3KP1 E;  3UMM A;  3MMP A;  1TDH A;  1IBL M;  4YQ7 A;  3VDU A;  1F4I A;  4B08 A;  1IY1 A;  5FTK A;  2R4J A;  4GH9 A;  4QNR A;  4FWH A;  2KXE A;  3VKG A;  1OAO C;  2DAG A;  2K9D A;  3I04 M;  1IN7 A;  3K92 A;  2YR0 A;  2YY8 A;  1XHB A;  3HJ8 A;  3KOW E;  4IIW A;  4JI0 M;  4D82 A;  1PJJ A;  2DXI A;  2X49 A;  4YPX A;  1YUB A;  1K3X A;  4JYA M;  3O7B A;  3HX3 A;  2C9O A;  4YQD A;  2J5Y A;  5GMB A;  3GLI B;  5DFL A;  4FW9 A;  4TUW A;  3I51 A;  2EGV A;  5EP2 A;  1HT2 E;  1SXJ B;  3IC6 A;  1PJT A;  4L4U A;  3UGJ A;  3U5Z B;  3A42 A;  2Z7J A;  2MJ5 B;  3LW5 F;  2VQE M;  1C1K A;  2CHV A;  4FCW A;  2KNA A;  2L6O A;  4DV5 M;  4KDZ A;  4YQ0 A;  3VLF B;  1X37 A;  1WGN A;  2DVW B;  2DZO B;  4LF8 M;  1G4A E;  2KA6 B;  2W82 A;  4BB9 A;  4AKG A;  3KOY E;  1NV9 A;  4DBG B;  2DAE A;  3QUV A;  3HU3 A;  3TWM A;  4X65 M;  1XMQ M;  3HKP A;  2J7N A;  2V6Z M;  3IEF A;  4YQP A;  2XF3 A;  1L8Q A;  2YNM D;  3U60 A;  3CF2 A;  3W0F A;  1G41 A;  4GIT A;  1QDT A;  2HWJ A;  4B7F A;  4LJ4 A;  5LMU M;  1VEG A;  4L15 A;  1IN8 A;  3IG5 A;  2KRU A;  4NXM M;  4B3M M;  1K3R A;  4IBD A;  3GLF B;  4MCD A;  3FRH A;  1ZQ9 A;  2OPF A;  4MGI E;  1GL7 A;  5FTN A;  5ITU A;  2DHY A;  1D0M A;  1V2X A;  2LWX A;  3K2L A;  4CND A;  1OJL A;  4DV2 M;  4JXJ A;  2F4V M;  4YQA A;  4DR3 M;  5BPV A;  1VQ1 A;  3GLF A;  2RGO A;  3E4R A;  2K6B A;  4PDI A;  3UK6 A;  4DV4 M;  4G4R A;  4LJA A;  1L2B A;  3KP0 E;  2ZBK B;  1H6U A;  2KRK A;  4A3V B;  2O5R A;  4KO8 A;  3U61 A;  3VK7 A;  3LQR A;  4GIP A;  2JUJ A;  4W5W A;  5C1B A;  4GMQ A;  1HNZ M;  3U60 B;  5EXP A;  3JAM S;  7CAT A;  1OAI A;  2YFQ A;  2LVA A;  5H37 D;  2CWB A;  2UXB M;  4YQ9 A;  4JWH A;  1NHG C;  3SMP A;  2CUZ A;  4DV1 M;  3U6Q A;  2DHR A;  2K47 A;  3AOE A;  1G71 A;  3I4V A;  4NOO B;  5E26 A;  3CF0 A;  3RFW A;  2F5S A;  3A98 B;  3PNV A;  3B7N A;  3GPY A;  1QAM A;  1WXQ A;  4KOD A;  1IN4 A;  2V3K A;  4YPY A;  1D0L A;  1JQJ C;  2L4F A;  2Z3X A;  2HA8 A;  4LFB M;  3NK7 A;  4YQG A;  1GO5 A;  4MCC A;  4QHS A;  3W0L B;  3IEC A;  4LRT A;  4YVI A;  1JR3 E;  3GLH A;  4RG1 A;  4JI3 M;  2UUA M;  3RE8 A;  4FWD A;  2JY7 A;  3FUV A;  1E9R A;  4IBI A;  3BBE A;  3CF6 E;  4Z6Y A;  3OIN A;  4NRW A;  3HHW A;  2WZJ A;  1GVN A;  4NRV A;  5IWA M;  3U6M A;  4ZPX A;  3CGW A;  2UXD M;  4IBG A;  3L25 A;  3SAU A;  1R6B X;  2XSZ D;  3TE6 A;  4PCZ A;  1JB0 F;  1NJF A;  2JA2 A;  5EXS A;  1OIP A;  3GPX A;  2LH0 A;  5KPR A;  1PJI A;  2CEA A;  2L7I A;  2FOI C;  3KW6 A;  5KO3 A;  1HNW M;  4F1I A;  5FAI A;  1SXJ E;  1NJG A;  3NK6 A;  4AW4 A;  4DUY M;  2F5O A;  1N34 M;  1TDZ A;  1ZAE A;  3ZH9 B;  3GPP A;  1UFZ A;  3U6E A;  1IXS B;  1IY0 A;  1E94 E;  1R5L A;  1N75 A;  4G4Q A;  2XZF A;  2QQ8 A;  4AKH A;  1WJ7 A;  1IPA A;  2L09 A;  3UZU A;  1KYI A;  2CHG A;  4JI1 M;  1MU5 A;  4OW0 A;  4Q7J A;  4JI4 M;  3LCU A;  3T38 A;  1T3T A;  1TO0 A;  2R62 A;  2Q2E B;  1OTR A;  1QQW A;  2C99 A;  4GHL A;  3AI9 X;  3I01 M;  2YQZ A;  4R3D A;  2R4E A;  3LVV A;  2HAK A;  4ITQ A;  4J3C A;  1WR1 B;  4H3Y A;  3HY5 A;  2LVO C;  1ZMU A;  4YVJ A;  1VG5 A;  4LF9 M;  5E6J A;  1OKS A;  2KZU A;  4FCT A;  3KS8 A;  1HT1 E;  1L1T A;  4LRS A;  2VDB B;  2V1U A;  5ITY A;  3QWL A;  1YE9 A;  3L29 A;  2R46 A;  4DV7 M;  1EE8 A;  1NV8 A;  2F5Q A;  3KOZ E;  1SXJ A;  1Z59 A;  3Q8G A;  3TPZ A;  3B89 A;  4LJ8 A;  3GLG A;  3FYD A;  4H3Z A;  4XBO A;  2DWM A;  4CGY B;  3B7Q A;  1LV7 A;  2VQF M;  4MGH A;  3ONP A;  1NS5 A;  1NNU C;  4FCV A;  3J2P B;  1AUA A;  1R7R A;  4IJF A;  3AOE C;  3FTC A;  4FWG A;  4M9X A;  5ITX E;  1TTE A;  2J7O A;  4FVM A;  3SAT A;  5L8R F;  4OU7 A;  3SBJ A;  1WIV A;  5FTJ A;  2Y21 A;  1P3Q Q;  2V3J A;  4YPZ A;  1WHC A;  2VII A;  4YHH M;  5EXT A;  2JZ0 A;  2QCU A;  4GC5 A;  2LNH C;  3NBX X;  4BBA A;  1OIZ A;  2P5T A;  4R71 A;  1GL6 A;  4PDG A;  2D7H A;  3LMM A;  3Q8X A;  3E46 A;  1Q02 A;  3ZCB B;  4QOS A;  2DAM A;  1NY5 A;  4QHT A;  4LGY A;  2ZAN A;  3TWL A;  3K8Z A;  5GMC A;  2BWE A;  4CHT B;  2Z8Y M;  3HHY A;  4YVH A;  5FTL A;  5IT9 S;  5EJC A;  4X3L A;  1J09 A;  2R0I A;  4CIZ A;  3GO8 A;  1WGL A;  1VHK A;  2KZS A;  4YQS A;  1ZMV A;  4JN6 A;  4LJ7 A;  1A5T A;  3GPU A;  2X4A A;  1QZM A;  3CTW B;  3OIJ A;  1QDR A;  3KDS E;  3HJS A;  4F2L A;  2DWZ B;  3BXW A;  1IBK M;  4JAL A;  4IBB A;  1D0K A;  3HJQ A;  3FUU A;  4YQB A;  2C98 A;  3U5Z A;  4JWG A;  4WW0 A;  2LHC A;  2QZ4 A;  5KPT A;  2D7E A;  1L1Z A;  1HNX M;  2CV1 A;  2KDL A;  1NNJ A;  5EQT A;  4D81 A;  1IM2 A;  2R45 A;  4I8O A;  3M6A A;  3RGP A;  4NSO B;  4Z8X A;  2G8L A;  2JY6 B;  1XMO M;  8CAT A;  5BR8 M;  3K9P A;  2JP7 A;  4MM3 B;  4AG5 A;  4M0D A;  1GJS A;  4G4O A;  1XNQ M;  1BVS A;  4DV3 M;  4YQ6 A;  2R65 A;  1SXJ D;  4MGK E;  4P16 A;  1HJP A;  4GHA A;  4YQR A;  2MH8 A;  1MXI A;  1L2C A;  5ITR A;  3C3D A;  3HWS A;  3SMS A;  3WHK A;  3FTD A;  5IRE B;  1V92 A;  3J7B A;  4LFC M;  4YY3 M;  2L7H A;  4FAK A;  1Q3C A;  2EO2 A;  1Y8G A;  2VF8 A;  5CO4 A;  3FUT A;  2NQ8 C;  3V76 A;  3DZD A;  4CJ6 A;  2E5L M;  2BNK A;  1W5S A;  1CUK A;  1VEK A;  1Q3B A;  2F5N A;  3J7A S;  4WP2 A;  3A46 A;  3GLI E;  2DWL A;  5ITX A;  4GKJ M;  5ITQ A;  1GLN A;  3U6S A;  2DAI A;  4R7G A;  3VDP A;  1OFH A;  2EJS A;  2QHO B;  3N4J A;  4JWF A;  2QBY A;  1XWI A;  2G3Q A;  4XK8 F;  1J7K A;  3J81 S;  5FTM A;  2QP9 X;  1NO1 A;  3FD9 A;  4AZF A;  2OQ4 A;  1IXZ A;  3K1J A;  4PZK A;  4B3S M;  1V34 A;  4GRI A;  3GRV A;  4DR1 M;  1QUT A;  3U6L A;  4G4N A;  2F5P A;  2WSE F;  3QYE A;  1UM8 A;  3AFH A;  3SC3 A;  1LTM A;  4QNM A;  4P17 A;  1YSY A;  2KHH A;  2G5G X;  1O6D A;  3SFZ A;  3L2A A;  1IBM M;  3AIA A;  3FYC A;  4YQ5 A;  5DYG A;  4IBF A;  2Z4R A;  4KGN A;  2DKL A;  1QAO A;  3C3E A;  2I6D A;  2B3T A;  1GAB A;  3DCM X;  2ERC A;  4YQ3 A;  4I5S A;  4LF5 M;  1TH4 A;  4WUR A;  4CIS A;  1NHW C;  4KT0 F;  2LVN C;  1NY6 A;  2XSZ A;  3TWK A;  3R9X B;  4L69 A;  5ITT A;  3K9O A;  3KOX E;  1G3I A;  4I81 A;  5DNY A;  1QVR A;  1PM5 A;  3AOG A;  2BWB A;  1KSF X;  4K0K M;  2K0B X;  1P9P A;  1W5T A;  1DGF A;  1MN3 A;  1GKI A;  2KEB A;  1QUS A;  1T6O A;  2FH0 A;  3HGI A;  3T15 A;  2Y20 A;  2FS1 A;  2R18 A;  4IJE A;  3W68 A;  2LHG A;  5EP1 A;  3VK8 A;  2OO9 A;  2Z4S A;  5EP4 A;  2QMM A;  2XEP A;  4LZZ A;  3BBZ A;  2JZ1 A;  4II7 A;  2WSC F;  3NBI A;  4M0W A;  1X7O A;  1KFV A;  4CNE A;  3AXZ A;  2D7G A;  2Z0Y A;  2DNA A;  4YQJ A;  3JR5 A;  2EUC A;  1TH3 A;  4E8B A;  2H5X A;  3AKZ A;  3SAW A;  1XC8 A;  4RF0 A;  1DGH B;  1G59 A;  3KTY A;  2GQF A;  3ILK A;  4FMW A;  4JI8 M;  4YVG A;  3VFD A;  4LJ9 A;  2JNH A;  4YQT A;  3GQ3 A;  1JR3 A;  2CHQ A;  3GLH E;  3B74 A;  3PVS A;  1NXZ A;  2M60 A;  3PXG A;  4MH0 E;  1R2Y A;  1S3S A;  2O01 F;  2WSF F;  1Q39 A;  2X8A A;  3FTE A;  2EA0 A;  2DZN B;  4QOZ C;  1DV0 A;  4B3T M;  3VKH A;  2BJW A;  2XFT A;  2O3A A;  4Y28 F;  4HL4 A;  4DR6 M;  2Y0T A;  2ZTC A;  3FUX A;  4HLQ A;  2XH9 A;  1RU3 A;  4D80 A;  3GLG B;  4YQC A;  1J85 A;  4DUZ M;  1IN6 A;  2DWN A;  3BBD A;  2LBC A;  3BOS A;  3KNU A;  1SXJ C;  1PRB A;  1QYR A;  2DAK A;  2VF7 A;  3B7Z A;  1IXR C;  4DV0 M;  4M9S A;  3QAU A;  5JI2 E;  2OOA A;  3HHX A;  3QYB A;  2LTU A;  4JI5 M;  2CFO A;  2HCB A;  4JI6 M;  5KPZ A;  1IFY A;  1R2Z A;  1IN5 A;  3NWL A;  1I94 M;  3L27 A;  4MGZ E;  4JI7 M;  3AL0 C;  4YQ2 A;  4YQI A;  1ZJR A;  3W67 A;  3L28 A;  3U6D A;  3SAS A;  4LF7 M;  2N35 A;  2I7N A;  3ZQJ A;  2DI0 A;  4DR4 M;  4CNG A;  4IG6 A;  2JXN A;  3E5Y A;  4MCB A;  1AIP C;  1VDL A;  4NSR A;  3IG8 A;  3GLG E;  4GKK M;  4MGY E;  2Y0Q A;  2R44 A;  1UAL A;  4YQQ A;  4REZ A;  2MR9 A;  4JI2 M;  4BLC A;  2QSF X;  1MX0 A;  3WHL A;  3GQ5 A;  3N4K A;  4LY6 A;  2H1R A;  2R6F A;  2L4E A;  4EIW A;  4AKI A;  1ORY B;  1HR0 M;  1QAQ A;  1YLA A;  4OVZ B;  4CNF A;  1PGY A;  1N77 A;  2ZAM A;  3U6O A;  1D2N A;  1VDD A;  4L16 A;  1TH2 A;  3U6P A;  4DR7 M;  2DEN A;  3HHZ A;  3SAV A;  1UAM A;  4YVK A;  1XXH B;  4DV6 M;  4X62 M;  3E9S A;  4RF1 A;  3KY7 A;  5IZ7 D;  4OX9 M;  2QWV A;  1UAK A;  1XXH A;  2MRO B;  3GRY A;  2MGW A;  4YPW A;  2O25 A;  3KSX A;  1E9S A;  3F92 A;  1C7Y A;  3T6P A;  3GQ4 A;  3KVW A;  3J27 B;  2CX8 A;  1DO0 A;  4ANR A;  3LCV B;  4G3O A;  2QNJ A;  1OY5 A;  3H4M A;  4JAK A;  2QPA A;  1L2D A;  4LGM A;  5D9F A;  1GZ0 A;  2APL A;  1MJG M;  4LF4 M;  1Z5B A;  2XGN A;  3AJI B;  2M5Z A;  4B3R M;  3LQQ A;  4LZJ A;  2XLJ A;  3M0E A;  2FE8 A;  1G8P A;  1X7P A;  4L6V 6;  3MJ5 A;  4RNA A;  5C18 A;  4MB7 A;  1Z6T A;  3T1Y M;  1OFI A;  2LXE A;  2BJV A;  4AQY M;  2XZU A;  1EIJ A;  4NXN M;  5KQD A;  1IQP A;  1T43 A;  4PD2 A;  1Z5C A;  4DR5 M;  2HHH M;  3L26 A;  5GKN A;  2EKF A;  1N36 M;  4AI6 A;  2CV0 A;  2RRU A;  2C9C A;  1TR8 A;  3KSJ A;  4KLN A;  3PFI A;  1VHY A;  4NC6 A;  3ZC7 B;  3FKE A;  1N78 A;  3U61 B;  1I4W A;  1ZMW A;  4LF6 M;  4IBC A;  3SYL A;  3GRR A;  1FJG M;  1TF0 B;  4YQO A;  3RGS A;  4B7G A;  1IXS A;  4XGI A;  3KS4 A;  5EXX A;  1HQC A;  1N33 M;  1PJS A;  4IBE A;  2HL7 A;  5FLX S;  4GEW A;  3GYQ A;  4I4L A;  4YQK A;  3OII A;  4YQ1 A;  2JY5 A;  1NVM A;  2KW0 A;  4LCB A;  4UN2 B;  3DOA A;  3BBH A;  3C58 A;  4JWJ A;  5EP3 A;  4LG2 A;  1K3W A;  2FNA A;  3TL4 X;  2CP8 A;  2JWS A;  1XNR M;  1SG9 A;  4S12 A;  2RKO A;  1XB2 B;  2L2D A;  2RGH A; 
#chains in the Genus database with same CATH homology
 2EGW A;  4OVZ A;  4LFA M;  3SHF A;  3I4Y A;  1HQY E;  3MHV C;  3THG A;  4B7H A;  2V1C A;  1V6Z A;  4YQL A;  2UXC M;  2C96 A;  3GLH B;  1FNN A;  2FFJ A;  3B9P A;  3PNY A;  1DO2 A;  3DA1 A;  3OTO M;  2QEN A;  4LJ6 A;  4NL4 H;  1TGU A;  4JV5 M;  1NSF A;  4FD2 A;  3EIH A;  3T1H M;  1K82 A;  3J80 S;  5F3W A;  5JI3 E;  4AG6 A;  4X3M A;  2I7P A;  4IBJ A;  3M7G A;  3UJN A;  1DGB A;  2XFS A;  4L78 A;  5KQ8 A;  3GLI A;  4M9Z A;  3AV0 A;  1E32 A;  1IY2 A;  3MK6 A;  3HU2 A;  1VH0 A;  3FUW A;  1UAJ A;  3L8U A;  1JR3 D;  3D8B A;  5LMN M;  1QAN A;  1Z85 A;  3SHG B;  4X66 M;  2CE7 A;  3HU1 A;  1J5E M;  3TQS A;  3R8F A;  3GP1 A;  2CV2 A;  2A5Y B;  3A45 A;  4KHP M;  3FTF A;  2UUC M;  2C5R A;  4IBK A;  3KW2 A;  3DFZ A;  2UUB M;  2UU9 M;  2QBY B;  3D8L A;  1N32 M;  4PT5 A;  4YQN A;  3LVW A;  3SYK A;  3GRU A;  3KXE C;  1DGG A;  1Z5A A;  4DR2 M;  1DGH A;  2HKJ A;  3KFU G;  5A2Q S;  3SAR A;  4X64 M;  4YQ8 A;  5FSW A;  4L8R C;  2AHM A;  3JR4 A;  4LJ5 A;  3EIE A;  2ZAO A;  5GM8 A;  5DYI A;  3U6C A;  4YQ4 A;  4GC9 A;  3KP1 E;  3UMM A;  4YQ7 A;  1TDH A;  1IBL M;  3VDU A;  4B08 A;  1IY1 A;  5FTK A;  2R4J A;  4GH9 A;  4QNR A;  4FWH A;  2KXE A;  3VKG A;  1IN7 A;  3K92 A;  2YR0 A;  2YY8 A;  1XHB A;  3HJ8 A;  3KOW E;  4IIW A;  4JI0 M;  4D82 A;  1PJJ A;  2DXI A;  2X49 A;  4YPX A;  1YUB A;  1K3X A;  4JYA M;  3O7B A;  2C9O A;  4YQD A;  5GMB A;  3GLI B;  4TUW A;  4FW9 A;  2EGV A;  3I51 A;  5EP2 A;  1HT2 E;  1SXJ B;  3IC6 A;  4L4U A;  3UGJ A;  3U5Z B;  3A42 A;  2Z7J A;  1C1K A;  2CHV A;  4FCW A;  4DV5 M;  2L6O A;  4KDZ A;  4YQ0 A;  3VLF B;  1X37 A;  2DVW B;  2DZO B;  4LF8 M;  1G4A E;  2KA6 B;  2W82 A;  4BB9 A;  4AKG A;  3KOY E;  3QUV A;  3HU3 A;  3TWM A;  4X65 M;  1XMQ M;  3HKP A;  2J7N A;  2V6Z M;  3IEF A;  4YQP A;  2XF3 A;  1L8Q A;  2YNM D;  3U60 A;  3CF2 A;  3W0F A;  1G41 A;  4GIT A;  4B7F A;  4LJ4 A;  5LMU M;  4L15 A;  1IN8 A;  3IG5 A;  2KRU A;  4NXM M;  4B3M M;  1K3R A;  4IBD A;  3GLF B;  4MCD A;  1ZQ9 A;  2OPF A;  4MGI E;  1GL7 A;  5FTN A;  5ITU A;  1V2X A;  2LWX A;  3K2L A;  4CND A;  1OJL A;  4DV2 M;  4JXJ A;  2F4V M;  4YQA A;  4DR3 M;  5BPV A;  3GLF A;  2RGO A;  3E4R A;  4PDI A;  4G4R A;  3UK6 A;  4DV4 M;  4LJA A;  1L2B A;  3KP0 E;  2ZBK B;  1H6U A;  2KRK A;  4A3V B;  2O5R A;  4KO8 A;  3U61 A;  3VK7 A;  3LQR A;  4GIP A;  4W5W A;  5C1B A;  4GMQ A;  1HNZ M;  3U60 B;  5EXP A;  3JAM S;  7CAT A;  2YFQ A;  5H37 D;  2UXB M;  4YQ9 A;  4JWH A;  1NHG C;  3SMP A;  2CUZ A;  4DV1 M;  3U6Q A;  2DHR A;  2K47 A;  3AOE A;  4NOO B;  3I4V A;  5E26 A;  2F5S A;  3CF0 A;  3RFW A;  3A98 B;  3PNV A;  3GPY A;  1QAM A;  1WXQ A;  4KOD A;  1IN4 A;  2V3K A;  4YPY A;  1JQJ C;  2Z3X A;  2HA8 A;  4LFB M;  3NK7 A;  4YQG A;  4MCC A;  4QHS A;  3W0L B;  4LRT A;  4YVI A;  3GLH A;  4RG1 A;  4JI3 M;  2UUA M;  3RE8 A;  4FWD A;  3FUV A;  1E9R A;  4IBI A;  3BBE A;  3CF6 E;  4Z6Y A;  3OIN A;  4NRW A;  3HHW A;  1GVN A;  4NRV A;  5IWA M;  3U6M A;  4ZPX A;  2UXD M;  4IBG A;  3L25 A;  3SAU A;  1R6B X;  2XSZ D;  3TE6 A;  4PCZ A;  1NJF A;  2JA2 A;  5EXS A;  3GPX A;  2LH0 A;  5KPR A;  1PJI A;  2CEA A;  2L7I A;  2FOI C;  3KW6 A;  5KO3 A;  1HNW M;  5FAI A;  1SXJ E;  1NJG A;  3NK6 A;  4AW4 A;  4DUY M;  2F5O A;  1N34 M;  1TDZ A;  1ZAE A;  3ZH9 B;  3GPP A;  3U6E A;  1IXS B;  1IY0 A;  1E94 E;  1N75 A;  4G4Q A;  2XZF A;  4AKH A;  1IPA A;  2L09 A;  3UZU A;  1KYI A;  2CHG A;  4JI1 M;  1MU5 A;  4OW0 A;  4JI4 M;  3T38 A;  1T3T A;  1TO0 A;  2R62 A;  2Q2E B;  1QQW A;  2C99 A;  4GHL A;  3AI9 X;  2YQZ A;  4R3D A;  2R4E A;  3LVV A;  4ITQ A;  4J3C A;  4H3Y A;  4YVJ A;  4LF9 M;  5E6J A;  2KZU A;  4FCT A;  3KS8 A;  1HT1 E;  1L1T A;  4LRS A;  2V1U A;  5ITY A;  3QWL A;  1YE9 A;  3L29 A;  2R46 A;  4DV7 M;  1EE8 A;  2F5Q A;  3KOZ E;  1SXJ A;  1Z59 A;  3TPZ A;  4LJ8 A;  3GLG A;  3FYD A;  4H3Z A;  4XBO A;  2DWM A;  4CGY B;  2VQF M;  1LV7 A;  3ONP A;  4MGH A;  1NS5 A;  1NNU C;  4FCV A;  3J2P B;  1R7R A;  4IJF A;  4M9X A;  3AOE C;  3FTC A;  4FWG A;  5ITX E;  2VQE M;  2J7O A;  3SAT A;  4FVM A;  4OU7 A;  3SBJ A;  5FTJ A;  2Y21 A;  2V3J A;  4YPZ A;  2VII A;  4YHH M;  5EXT A;  2QCU A;  4GC5 A;  2LNH C;  4BBA A;  2P5T A;  1GL6 A;  4PDG A;  3LMM A;  3Q8X A;  2D7H A;  3ZCB B;  4QOS A;  1NY5 A;  4QHT A;  4LGY A;  2ZAN A;  3TWL A;  3K8Z A;  5GMC A;  4CHT B;  3HHY A;  4YVH A;  5FTL A;  5IT9 S;  5EJC A;  4X3L A;  1J09 A;  3GO8 A;  1VHK A;  2KZS A;  4YQS A;  4JN6 A;  4LJ7 A;  3GPU A;  2X4A A;  1QZM A;  3CTW B;  3OIJ A;  3KDS E;  3HJS A;  2DWZ B;  1IBK M;  4JAL A;  4IBB A;  3HJQ A;  4YQB A;  3FUU A;  2C98 A;  3U5Z A;  4JWG A;  2RKO A;  4WW0 A;  2QZ4 A;  5KPT A;  2D7E A;  1L1Z A;  1HNX M;  2CV1 A;  1NNJ A;  5EQT A;  4D81 A;  1IM2 A;  2R45 A;  4I8O A;  3M6A A;  3RGP A;  4NSO B;  4Z8X A;  2G8L A;  1XMO M;  8CAT A;  5BR8 M;  4AG5 A;  4MM3 B;  4M0D A;  4G4O A;  1XNQ M;  4DV3 M;  4YQ6 A;  2R65 A;  1SXJ D;  4MGK E;  4P16 A;  4GHA A;  4YQR A;  1MXI A;  1L2C A;  5ITR A;  3HWS A;  3SMS A;  3WHK A;  3FTD A;  5IRE B;  3J7B A;  4LFC M;  4YY3 M;  2L7H A;  4FAK A;  1Q3C A;  2EO2 A;  5CO4 A;  3FUT A;  2NQ8 C;  2E5L M;  3DZD A;  2BNK A;  1W5S A;  1Q3B A;  2F5N A;  3J7A S;  3A46 A;  2DWL A;  5ITX A;  4GKJ M;  5ITQ A;  1GLN A;  3U6S A;  4R7G A;  3VDP A;  1OFH A;  3N4J A;  4JWF A;  2QBY A;  1XWI A;  1J7K A;  3J81 S;  5FTM A;  2QP9 X;  2OQ4 A;  3FD9 A;  4AZF A;  1IXZ A;  3K1J A;  4PZK A;  4B3S M;  4GRI A;  4DR1 M;  3GRV A;  3U6L A;  4G4N A;  2F5P A;  1UM8 A;  3AFH A;  3SC3 A;  4QNM A;  1YSY A;  1O6D A;  2G5G X;  3SFZ A;  3L2A A;  1IBM M;  3AIA A;  3FYC A;  4YQ5 A;  5DYG A;  4IBF A;  2Z4R A;  4KGN A;  1QAO A;  2I6D A;  3DCM X;  2ERC A;  4YQ3 A;  4I5S A;  4LF5 M;  1TH4 A;  4WUR A;  4CIS A;  1NHW C;  1NY6 A;  2XSZ A;  3TWK A;  3R9X B;  4L69 A;  5ITT A;  3KOX E;  4I81 A;  1G3I A;  5DNY A;  1PM5 A;  1QVR A;  3AOG A;  1KSF X;  4K0K M;  1P9P A;  1W5T A;  1DGF A;  2KEB A;  1GKI A;  3T15 A;  3HGI A;  2Y20 A;  2R18 A;  4IJE A;  5EP1 A;  3VK8 A;  2Z4S A;  5EP4 A;  2QMM A;  2XEP A;  4LZZ A;  4II7 A;  3NBI A;  4M0W A;  1X7O A;  1KFV A;  4CNE A;  3AXZ A;  2D7G A;  2Z0Y A;  4YQJ A;  3JR5 A;  2EUC A;  1TH3 A;  4E8B A;  3AKZ A;  3SAW A;  1XC8 A;  4RF0 A;  1DGH B;  1G59 A;  3KTY A;  3ILK A;  4FMW A;  4JI8 M;  4YVG A;  3VFD A;  4LJ9 A;  4YQT A;  3GQ3 A;  1JR3 A;  2CHQ A;  3PVS A;  1NXZ A;  2M60 A;  3PXG A;  4MH0 E;  1R2Y A;  1S3S A;  2X8A A;  1Q39 A;  3VKH A;  3FTE A;  2EA0 A;  2DZN B;  4QOZ C;  4B3T M;  2BJW A;  2XFT A;  2O3A A;  4HL4 A;  4DR6 M;  2Y0T A;  3FUX A;  4HLQ A;  2XH9 A;  4D80 A;  3GLG B;  4YQC A;  1J85 A;  4DUZ M;  1IN6 A;  2DWN A;  3BBD A;  4YVK A;  3BOS A;  3KNU A;  1SXJ C;  1QYR A;  1IXR C;  4DV0 M;  4M9S A;  3QAU A;  5JI2 E;  4JI5 M;  3HHX A;  2CFO A;  2HCB A;  4JI6 M;  5KPZ A;  4YQ2 A;  1R2Z A;  1IN5 A;  3NWL A;  1I94 M;  3L27 A;  4MGZ E;  4JI7 M;  3AL0 C;  4YQI A;  1ZJR A;  3L28 A;  3U6D A;  3SAS A;  4LF7 M;  4CNG A;  2I7N A;  4DR4 M;  4IG6 A;  3E5Y A;  4MCB A;  4NSR A;  3IG8 A;  4GKK M;  4MGY E;  2Y0Q A;  1UAL A;  4YQQ A;  4REZ A;  4JI2 M;  4BLC A;  1MX0 A;  3WHL A;  3GQ5 A;  3N4K A;  4LY6 A;  2H1R A;  4EIW A;  4AKI A;  1ORY B;  1HR0 M;  1QAQ A;  4OVZ B;  4CNF A;  1N77 A;  2ZAM A;  3U6O A;  1D2N A;  1VDD A;  4L16 A;  1TH2 A;  3U6P A;  4DR7 M;  3HHZ A;  3SAV A;  1UAM A;  1XXH B;  4DV6 M;  4X62 M;  3E9S A;  4RF1 A;  3KY7 A;  5IZ7 D;  4OX9 M;  2QWV A;  1UAK A;  1XXH A;  3GRY A;  4YPW A;  3KSX A;  1E9S A;  3GQ4 A;  3KVW A;  3J27 B;  2CX8 A;  1DO0 A;  1OY5 A;  3H4M A;  4JAK A;  2QPA A;  1L2D A;  4LGM A;  5D9F A;  1GZ0 A;  4LF4 M;  1Z5B A;  2XGN A;  3AJI B;  2M5Z A;  4B3R M;  3LQQ A;  4LZJ A;  2XLJ A;  3M0E A;  2FE8 A;  1G8P A;  1X7P A;  3MJ5 A;  4RNA A;  5C18 A;  4MB7 A;  1Z6T A;  3T1Y M;  1OFI A;  2LXE A;  2BJV A;  4AQY M;  2XZU A;  4NXN M;  5KQD A;  1IQP A;  4PD2 A;  1Z5C A;  4DR5 M;  2HHH M;  3L26 A;  5GKN A;  1N36 M;  4AI6 A;  2CV0 A;  4KLN A;  2C9C A;  3KSJ A;  3PFI A;  1VHY A;  3ZC7 B;  3FKE A;  1N78 A;  3U61 B;  1I4W A;  4LF6 M;  4IBC A;  3SYL A;  3GRR A;  1FJG M;  4YQO A;  3RGS A;  4B7G A;  4XGI A;  3KS4 A;  5EXX A;  1HQC A;  1N33 M;  4IBE A;  5FLX S;  2HL7 A;  3GYQ A;  4YQK A;  4I4L A;  3OII A;  4YQ1 A;  1NVM A;  2KW0 A;  4LCB A;  3BBH A;  3DOA A;  4JWJ A;  3C58 A;  5EP3 A;  4LG2 A;  1K3W A;  2FNA A;  3TL4 X;  1XNR M;  4S12 A;  4G6Z A;  2ZM6 M;  2RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...