4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
molecule tags Transferase
source organism Escherichia coli k12
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
2EGVA 2Z0YA 2EGWA 3KY7A 1UALA 5GMCA 1UAJA 4YQ3A 3GYQA 4YQRA 4JAKA 4YQ9A 4YQLA 4YQNA 1GZ0A 4YVJA 4X3MA 4YPZA 4YQBA 4YVHA 3KNUA 4YQ5A 1VHYA 4YQ6A 4KGNA 4YQ4A 4YQAA 4YQ2A 3N4JA 4YQ1A 3AI9X 3E5YA 3NK6A 5GM8A 4MCDA 1NS5A 4YPYA 5CO4A 4L69A 3IC6A 4YQTA 4YVIA 4YPWA 4YQ7A 4YQGA 4YQDA 4YPXA 3ONPA 1P9PA 4YQKA 3O7BA 4XBOA 3KW2A 3OIJA 1V6ZA 2O3AA 1VH0A 4H3YA 4YQQA 2YY8A 4YVGA 2QWVA 3AIAA 2V3JA 4CNGA 3AXZA 4YQ0A 4X3LA 3ILKA 2QMMA 3DCMX 1UAMA 4YQJA 4J3CA 1OY5A 2I6DA 3OINA 4CNFA 2V3KA 5FAIA 3BBDA 1VHKA 4H3ZA 4PZKA 2CX8A 1MXIA 4YQIA 2HA8A 4YQCA 5D9FA 3QUVA 1K3RA 3IEFA 1X7OA 4FAKA 1TO0A 4YVKA 3OIIA 4E8BA 4YQOA 1Z85A 4YQPA 1J85A 1O6DA 4KDZA 4MCCA 4YQSA 1UAKA 3NK7A 4CNEA 3BBHA 4IG6A 4MCBA 4JALA 5GMBA 3L8UA 4RG1A 4CNDA 1IPAA 1X7PA 1V2XA 3N4KA 3BBEA 4YQ8A 1NXZA 1ZJRA 3KTYA
chains in the Genus database with same CATH superfamily
2HAKA 1ZAEA 2EGWA 3I04M 4MH0E 2KZSA 2R44A 4AKIA 1C7YA 2UXDM 4RF1A 4I8OA 3GQ3A 1TH4A 3IECA 2DXIA 4PT5A 2XF3A 3UJNA 4OW0A 1ZMWA 1E9SA 2QBYB 4QNMA 2WZJA 3GYQA 4FVMA 1HNWM 4YQ9A 3I51A 4YQLA 4YQNA 4RNAA 3U60A 2BJWA 4JN6A 4YVJA 1V34A 2EKKA 1QYRA 4LGMA 3NWLA 4AG6A 3IG5A 4R71A 3U6LA 3L27A 5LMUM 4YQBA 3KP0E 4LGYA 1IXZA 1YLAA 5KPZA 3KNUA 3J7BA 3SAUA 1GL6A 2QSFX 4NXMM 4KGNA 1VEJA 4B3SM 1MJGM 3E5YA 1IXSB 1Q39A 3TWMA 1GL7A 2LHCA 3GLFE 3AOEC 1OFIA 4IBEA 4IBIA 3J81S 2QCUA 4DUYM 4A3VB 1NO1A 4CHTB 2Z3XA 3VK7A 4I4LA 3K92A 3PFIA 2CWBA 4G4NA 1XMQM 2BJVA 3EIHA 4DV5M 1VDLA 2LVNC 4MCDA 4DR5M 1DV0A 3CTWB 3GLGA 3VK8A 1SXJA 1NV9A 1IQPA 1HQYE 2FE8A 1JB0F 3GPUA 3GQ5A 1IBMM 3IC6A 1ZV1A 1GJSA 2JZ0A 3SHGB 3AKZA 1YUBA 4EIWA 2XSZA 2R6FA 3I4YA 1J5EM 3B7NA 1XXHE 1EE8A 1QZMA 3E9SA 1JR3A 1NV8A 2QENA 3TE6A 4X62M 1KYIA 4YQGA 2F5NA 1P9PA 3SFZA 1TTEA 2Z7JA 4XBOA 4R7GA 3GPYA 2UUCM 3SC3A 3GLHA 2JNHA 1EIJA 2CUZA 2XLJA 3JAMS 4BBAA 4YQQA 4WURA 1OAOC 2VDBB 4DV4M 2P5TA 3HHXA 2JUJA 3I01M 5EP2A 1IBKM 2LVAA 4JI3M 5KO3A 2FOIC 3GLIA 3SBJA 4RF0A 4DV2M 3VKHA 2DWNA 4JI0M 1FNNA 1IBLM 1UFZA 3U6CA 2F5SA 3AXZA 1G71A 3VDUA 3HU2A 1L2CA 2CV0A 3UGJA 3GP1A 3KDSE 1NJFA 4QNRA 3DZDA 2V3KA 4LF4M 1W5TA 3CGWA 3R9XB 1VHKA 3AV0A 4HLQA 4B3TM 1N33M 2HL7A 3MJ5A 2FFJA 3FTEA 2KZUA 1OJLA 1RU3A 4GITA 1HNXM 1K3RA 3B7ZA 4Y28F 1UM8A 2KNZA 4IBDA 4DR3M 3IEFA 1OTRA 3FE3A 4HL4A 4IJEA 3L2AA 3HWSA 1QVRA 1Z85A 4RKUF 2CFOA 4LJAA 4DR1M 3HJSA 2R62A 3GLFB 1J85A 1O6DA 4MGHA 4MCCA 1JQJC 4IJFA 2Z4SA 4YQSA 3E21A 1PJQA 1XXHA 5EXXA 2LVPC 3THGA 5ITQA 2ZM6M 3AL0C 3FRIA 3K1JA 3L8UA 4RG1A 4CNDA 1DGGA 3E4RA 4I81A 2ZAMA 4GKJM 4L6V6 4NRWA 4YQ8A 3SMPA 2KHHA 3CF0A 3W0FA 1Z6TA 1IN7A 3OIIA 1HT2E 3VLFB 4DV7M 1NJGA 1QQWA 4FCWA 3FKEA 1ZMVA 1IN5A 3F92A 3KXEC 4OX9M 2L7HA 1VG5A 2ZAOA 5GMCA 1TDZA 3ZH9B 1UAJA 3U6OA 5F3WA 4L4UA 1OIZA 3U6DA 4CGYB 1IM2A 2LWXA 4YQRA 4LJ6A 2G5GX 2KEBA 2HHHM 1A5TA 4HEOA 4LCBA 3GQ4A 2R45A 2K9DA 1GZ0A 5EXTA 3FD9A 3J2PB 3HJ8A 8CATA 1E9RA 4YPZA 2OPFA 3KOZE 4OVZB 1CUKA 2KXEA 2JY5A 4LJ7A 5C18A 1Z59A 2XEPA 4AZFA 2KA6B 4YVHA 1HJPA 1HT1E 1WR1B 3M0EA 2MGWA 3GLGE 4YQ6A 2EO2A 1SXJE 3SMSA 5ITRA 1H6UA 4YQ4A 1VEKA 3K9PA 3NBIA 4JI2M 4YQAA 4B7HA 3PNYA 2CE7A 2WSFF 2K6BA 4L78A 4LG2A 4JYAM 2DHYA 2AHMA 2JY6B 4WW0A 4JWHA 1GKIA 1N78A 2YR0A 4DR6M 2CHQA 4JI5M 4GMQA 3MK6A 4JI7M 1JR3E 2DZNB 2G3QA 3WHLA 2VQEM 3W0LB 5GM8A 4LF6M 2C98A 4B08A 1NS5A 2JA2A 3GLHE 2G8LA 4L15A 2V1UA 3UK6A 3PVSA 5GKNA 5KQ8A 1QUTA 3FUXA 2JXNA 2DAIA 2L2DA 4AKHA 5ITXA 2OOBA 4YQTA 5EXPA 5FTNA 1IY1A 1NY5A 3GLIE 4GKKM 1GO5A 3D8BA 3LQRA 2LBCA 4YVIA 4BB9A 2WSCF 4AW4A 2DZOB 3SAWA 4LY6A 3HHWA 5E26A 2DI0A 3LCVB 3OIJA 2LTUA 5IZ7D 2O3AA 1VH0A 3U60B 3M7GA 2CV1A 2DVWB 5FTKA 4CJ6A 3DOAA 4JV5M 2DAKA 5EQTA 4X66M 2H5XA 3J7AS 1N32M 3B7QA 2QWVA 4IBBA 2V3JA 3AIAA 2LVQD 4GC9A 5DYIA 1R2YA 4P16A 4BLCA 4I5SA 4ZPXA 3M6AA 3CF6E 2N35A 3HY5A 2E5LM 2QMMA 3DCMX 3C58A 2M5ZA 3EIEA 4M9ZA 3U6EA 3KOXE 2I6DA 3OINA 3E46A 4FD2A 5FAIA 2KRUA 2K47A 2XZUA 4JXJA 3OTOM 4PZKA 5FTMA 3KS4A 1GJTA 1HR0M 3HU1A 1PJTA 1SXJD 4NC6A 1MXIA 4IBGA 2YNMD 5D9FA 3SATA 3QUVA 1XHBA 1IN8A 4NL4H 5ITYA 1D0LA 1X7OA 4FAKA 4YVKA 4KT0F 3VDPA 4E8BA 2XSZD 1SXJC 1SXJB 3TPZA 1T3TA 3TWLA 1JR3D 5LMNM 1G8PA 4CNEA 2BWEA 2J7OA 3BBHA 3SYLA 5ITTA 4MGZE 4D80A 2FH0A 5GMBA 2KNVA 1NNUC 4OU7A 3GPPA 2D7HA 4YHHM 1V2XA 4G6ZA 4GEWA 3GRYA 3RGSA 3BBZA 1DO2A 4REZA 4LJ8A 3GLHB 4FW9A 4FWHA 1NVMA 1LV7A 3LQQA 4DBGB 3T15A 2EGVA 3T38A 1KFVA 4CISA 4GIPA 3FUWA 3IG8A 1DGBA 4GRIA 1UALA 2YFQA 3KY7A 3SARA 3TQSA 3U61A 1W5SA 1I94M 5H37D 4G4OA 2XFTA 4YQ3A 5IWAM 4JAKA 2D7GA 1G4AE 1DGHA 4FWGA 3L25A 4Q7JA 3SHFA 4IBFA 5EJCA 1L1TA 4XGIA 1VEGA 4KO8A 3C3EA 2OQ4A 2DAGA 1XNRM 4LF8M 1R5LA 2XGNA 3W67A 2UXCM 4X3MA 4LFAM 3NBXX 1P3QQ 2R65A 4LJ5A 3UMMA 4IBJA 2F5PA 1PM5A 1G3IA 4II7A 4NXNM 3PXGA 3A42A 1AIPC 4YQ5A 2CRUA 3GO8A 1EFUB 1WHCA 3T1HM 3RE8A 5BR8M 2XH9A 4LF9M 4YQ2A 1I4WA 2VIIA 3J27B 3U6PA 4YQ1A 4NOOB 3AJIB 2QQ8A 2VF7A 5ITXE 1NNJA 2DWLA 4DV0M 4QOZC 1IN4A 2MROB 2V1CA 2WSEF 2HCBA 3A98B 4FWDA 1E94E 3HHZA 4CIZA 1Z5AA 1XXHB 4QHTA 3KOYE 5KPRA 3H4JA 1PJIA 3NK6A 1XWIA 2Y20A 1MX0A 3KSJA 3H4MA 1NY6A 4Z8XA 2LVOC 1OKSA 1Y8GA 5CO4A 1TGUA 3GRRA 4G4RA 4L69A 2Y0TA 2CP8A 1D0KA 4XK8F 4B3RM 3RFWA 1WGNA 2XFSA 4G3OA 1V92A 3HKPA 4LZJA 3A46A 1R2ZA 1N34M 1ZMUA 2ZTCA 3B9PA 3FTCA 4OVZA 1XNQM 2CV2A 3B89A 3LW5F 4ANRA 4YPWA 4PDIA 4YQDA 1TDHA 5E6JA 2FS1A 4P17A 4DUZM 4YPXA 4YQKA 2RGOA 4LRSA 1TF0B 5JI3E 3U5ZA 3DFZA 3O7BA 3KW6A 2DHRA 1Q3CA 3DA1A 4D81A 4B7GA 3LMMA 1IFYA 2QPAA 1FJGM 4K0KM 2YY8A 1TR8A 1OFHA 4WP2A 2D7EA 2A5YB 1TH2A 1R6BX 2JY7A 1XC8A 5A2QS 4JI4M 2CEAA 3LVWA 4CNGA 3Q8GA 2W82A 3FRHA 3HHYA 2J7NA 2QBYA 1J7KA 4X3LA 3ILKA 1PJSA 3ZC7B 2GQFA 4NSRA 4W5WA 1NHWC 4FCVA 3CF2A 5EP4A 2DNAA 1HQCA 5FTLA 1Q3BA 2DZLA 4DV6M 2UU9M 1K3XA 4MGYE 1OY5A 2QP9X 2RRUA 3BBDA 4QHSA 4H3ZA 3QYBA 3L26A 2CHVA 3V76A 3IHPA 4LF7M 1IY2A 3FUVA 5C1BA 1MN3A 2JP7A 3KOWE 3FUUA 1G59A 3HGIA 2DENA 1TO0A 1G41A 1S3SA 4B3MM 1BVSA 2LHGA 2MR9A 1IXSA 2Y0QA 2Y21A 3C9PA 3SYKA 2KRKA 3ZCBB 1N36M 3AOEA 3VKGA 1QDTA 2EKFA 3KSXA 3JR4A 3U6MA 4LFBM 3KP1E 1OAIA 1OIPA 3AOGA 3WHKA 2DAEA 2UUAM 4IG6A 4MCBA 2C9CA 4DV3M 2R46A 3K2LA 1D0MA 4GC5A 1E32A 2ZBKB 3TL4X 3SASA 1X7PA 4FMWA 5DFLA 3BBEA 4DR7M 1NXZA 3GPXA 2EA0A 1IN6A 2HWJA 2V6ZM 4NRVA 5FSWA 1WXQA 1ORYB 5JI2E 3JR5A 1QUSA 4GH9A 3QYEA 4AKGA 3KTYA 2MH8A 5L8RF 2Z0YA 1PGYA 3Q8XA 4DR2M 1R7RA 2R4JA 2KNAA 3QWLA 3GLGB 1L8QA 2OOAA 3K8ZA 4L16A 2DAMA 4M0DA 2JZ1A 3I4VA 2C5RA 1N75A 2NQ8C 1LTMA 4NSOB 4JWFA 4G4QA 2MJ5B 3FTFA 1SG9A 2EJSA 2X4AA 1IXRC 2L4FA 4PD2A 2UUBM 4LRTA 1Z5BA 1K3WA 2RKOA 2OO9A 1GVNA 2QZ4A 1QAQA 1VDDA 3K9OA 2DKLA 4M9SA 7CATA 2C9OA 2ERCA 2QNJA 2O5RA 3LCUA 4Z6YA 2DWMA 1F4IA 5FLXS 1VQ1A 2APLA 4LZZA 4LFCM 3QAUA 2I7NA 4M0WA 2K0BX 3B74A 4IBKA 5BPVA 1VHYA 3VFDA 3HZJA 3FYCA 4AG5A 3N4JA 3KS8A 2F5OA 4KODA 5EP1A 2L7IA 4X65M 1N77A 4MB7A 4KHPM 3AI9X 1TH3A 1WGLA 3T6PA 2O25A 2VF8A 3GLIB 1YE9A 2C96A 4DR4M 3FUTA 1D2NA 4AQYM 2R4EA 3GRUA 4PCZA 3U6SA 1C1KA 4MGIE 3RGPA 2BWBA 1UAMA 4B7FA 2R18A 2JY8A 4YPYA 1XMOM 2O01F 2L6OA 2ZTDA 2J5YA 2RGHA 3PNVA 3GLFA 4DV1M 3UZUA 4TUWA 1AUAA 2EUCA 1KSFX 4S12A 1QDRA 3FYDA 2KDLA 2YQZA 4R3DA 2LNHC 1IY0A 1DGFA 4IBCA 1MU5A 3MHVC 4YQ7A 3ZQJA 3U61B 3R8FA 4YY3M 2XZFA 2BNKA 2GNOA 3J80S 3ONPA 1NSFA 2JWSA 3KW2A 5DYGA 1DGHB 1V6ZA 1QANA 1OQYA 3C3DA 1WJ7A 3SAVA 4H3YA 2KW0A 4LJ9A 1ZQ9A 4YVGA 2CHGA 1QZEA 4PDGA 3A45A 4GHAA 3L29A 4X64M 2X49A 1J09A 1NHGC 5DNYA 1R4GA 5IT9S 1DO0A 4IIWA 5EXSA 1YSYA 3W68A 4JI1M 4F1IA 1K82A 4MM3B 1L1ZA 4ITQA 2ZANA 4MGKE 5IREB 2QHOB 3MMPA 4L8RC 4JWGA 1PRBA 4YQ0A 1V33A 2M60A 4YQJA 1GABA 4J3CA 2DWZB 2F5QA 2L4EA 4F2LA 2HKJA 2R0IA 1Z5CA 4CNFA 3L28A 1L2DA 5ITUA 4JI8M 2Z8YM 3KVWA 4LJ4A 1QAMA 1XB2B 3HU3A 1WIVA 4LF5M 2CX8A 2HA8A 4YQCA 2LH0A 4GHLA 4YQIA 2Q2EB 1HNZM 2C99A 1QAOA 2B3TA 3KFUG 2H1RA 5FTJA 2VQFM 2F4VM 2I7PA 4YQOA 1X37A 4KLNA 4YQPA 1T43A 4D82A 3T1YM 1GLNA 3BOSA 3BXWA 4KDZA 2LXEA 4JWJA 5EP3A 1PJJA 3HX3A 3AFHA 1UAKA 3NK7A 3HJQA 2UXBM 4JALA 5KQDA 3D8LA 3LVVA 2L09A 1L2BA 3GRVA 1IPAA 4AI6A 2Z4RA 1T6OA 3FTDA 4QOSA 3TWKA 4FCTA 4M9XA 3U5ZB 3N4KA 2FNAA 2X8AA 3U6QA 1ZJRA 4UN2B 5KPTA 1Q02A 4JI6M
chains in the Genus database with same CATH topology
1ZAEA 2EGWA 4MH0E 2KZSA 4AKIA 4RF1A 4I8OA 3GQ3A 1TH4A 2DXIA 4PT5A 2XF3A 3UJNA 4OW0A 2QBYB 1E9SA 3GYQA 4QNMA 4FVMA 1HNWM 4YQ9A 3I51A 4YQLA 4YQNA 4RNAA 3U60A 2BJWA 4JN6A 4YVJA 1QYRA 4LGMA 3NWLA 4AG6A 3IG5A 3U6LA 3L27A 5LMUM 4YQBA 3KP0E 4LGYA 1IXZA 5KPZA 3KNUA 3J7BA 3SAUA 1GL6A 4KGNA 4NXMM 4B3SM 1IXSB 1Q39A 3TWMA 1GL7A 3AOEC 1OFIA 4IBEA 4IBIA 3J81S 2QCUA 4DUYM 4A3VB 4CHTB 2Z3XA 3VK7A 4I4LA 3K92A 3PFIA 4G4NA 1XMQM 2BJVA 3EIHA 4DV5M 4MCDA 4DR5M 3CTWB 3GLGA 3VK8A 1SXJA 1IQPA 1HQYE 2FE8A 3GPUA 3GQ5A 1IBMM 3IC6A 3SHGB 3AKZA 1YUBA 4EIWA 2XSZA 3I4YA 1J5EM 1EE8A 1QZMA 3E9SA 1JR3A 3TE6A 2QENA 4X62M 4YQGA 1KYIA 2F5NA 1P9PA 3SFZA 2Z7JA 3GPYA 4XBOA 4R7GA 2UUCM 3SC3A 3GLHA 2CUZA 2XLJA 3JAMS 4BBAA 4YQQA 4WURA 4DV4M 2P5TA 3HHXA 5EP2A 1IBKM 4JI3M 5KO3A 2FOIC 3GLIA 3SBJA 4RF0A 4DV2M 3VKHA 2DWNA 4JI0M 1FNNA 1IBLM 3AXZA 3U6CA 2F5SA 3VDUA 3HU2A 1L2CA 2CV0A 3UGJA 3GP1A 3KDSE 1NJFA 4QNRA 3DZDA 2V3KA 4LF4M 1W5TA 3R9XB 1VHKA 3AV0A 4HLQA 4B3TM 1N33M 2HL7A 3MJ5A 2FFJA 3FTEA 2KZUA 1OJLA 4GITA 1HNXM 1K3RA 3IEFA 1UM8A 4IBDA 4DR3M 4HL4A 4IJEA 3L2AA 3HWSA 1QVRA 1Z85A 2CFOA 4LJAA 4DR1M 3HJSA 2R62A 3GLFB 1J85A 1O6DA 4MGHA 4MCCA 1JQJC 4IJFA 2Z4SA 4YQSA 1XXHA 5EXXA 3THGA 5ITQA 2ZM6M 3AL0C 3K1JA 3L8UA 4RG1A 4CNDA 1DGGA 3E4RA 4I81A 2ZAMA 4GKJM 4NRWA 4YQ8A 3SMPA 3CF0A 3W0FA 1IN7A 1Z6TA 1HT2E 3VLFB 4DV7M 1NJGA 1QQWA 4FCWA 3FKEA 1IN5A 3KXEC 4OX9M 2L7HA 2ZAOA 5GMCA 1TDZA 3ZH9B 1UAJA 3U6OA 5F3WA 4L4UA 3U6DA 4CGYB 1IM2A 2LWXA 4YQRA 4LJ6A 2G5GX 2KEBA 2HHHM 4LCBA 3GQ4A 2R45A 1GZ0A 5EXTA 3FD9A 3J2PB 3HJ8A 8CATA 1E9RA 4YPZA 2OPFA 3KOZE 4OVZB 4LJ7A 2KXEA 5C18A 1Z59A 2XEPA 4AZFA 2KA6B 4YVHA 1HT1E 3M0EA 4YQ6A 2EO2A 1SXJE 3SMSA 5ITRA 1H6UA 4YQ4A 3NBIA 4JI2M 4YQAA 4B7HA 3PNYA 2CE7A 4L78A 4LG2A 4JYAM 2AHMA 4JWHA 4WW0A 1GKIA 1N78A 2YR0A 4DR6M 2CHQA 4JI5M 4GMQA 3MK6A 4JI7M 2DZNB 3WHLA 2VQEM 5GM8A 3W0LB 2C98A 4B08A 1NS5A 2JA2A 2G8LA 4L15A 2V1UA 3UK6A 3PVSA 5GKNA 5KQ8A 3FUXA 4AKHA 5ITXA 4YQTA 5EXPA 5FTNA 1IY1A 1NY5A 4GKKM 3D8BA 3LQRA 4YVIA 4BB9A 4AW4A 2DZOB 3SAWA 4LY6A 3HHWA 5E26A 3OIJA 5IZ7D 2O3AA 1VH0A 3U60B 3M7GA 2CV1A 2DVWB 5FTKA 3DOAA 4JV5M 5EQTA 4X66M 3J7AS 1N32M 2QWVA 3AIAA 4IBBA 2V3JA 4GC9A 5DYIA 1R2YA 4P16A 4BLCA 4I5SA 4ZPXA 3M6AA 3CF6E 2E5LM 2QMMA 3DCMX 3C58A 2M5ZA 3EIEA 4M9ZA 3U6EA 3KOXE 2I6DA 3OINA 4FD2A 5FAIA 2KRUA 2K47A 2XZUA 4JXJA 3OTOM 4PZKA 5FTMA 3KS4A 3HU1A 1SXJD 1MXIA 4IBGA 2YNMD 5D9FA 3SATA 3QUVA 1XHBA 1IN8A 4NL4H 5ITYA 1X7OA 4FAKA 4YVKA 3VDPA 4E8BA 2XSZD 1SXJC 1SXJB 3TPZA 1T3TA 3TWLA 1JR3D 5LMNM 1G8PA 4CNEA 2J7OA 3BBHA 3SYLA 5ITTA 4MGZE 4D80A 5GMBA 1NNUC 4OU7A 3GPPA 2D7HA 4YHHM 1V2XA 4G6ZA 3GRYA 3RGSA 1DO2A 4REZA 4LJ8A 3GLHB 4FW9A 4FWHA 1NVMA 1LV7A 3LQQA 3T15A 2EGVA 3T38A 1KFVA 4CISA 4GIPA 3FUWA 3IG8A 1DGBA 4GRIA 1UALA 2YFQA 3KY7A 3SARA 3TQSA 3U61A 1W5SA 1I94M 5H37D 4G4OA 2XFTA 4YQ3A 5IWAM 4JAKA 2D7GA 1G4AE 1DGHA 4FWGA 3L25A 3SHFA 4IBFA 5EJCA 1L1TA 4XGIA 1XNRM 4KO8A 4X3MA 2OQ4A 2UXCM 4LF8M 2XGNA 4LFAM 2R65A 4LJ5A 3UMMA 4IBJA 2F5PA 1PM5A 1G3IA 4II7A 4NXNM 3PXGA 3A42A 4YQ5A 3GO8A 3T1HM 3RE8A 5BR8M 2XH9A 4LF9M 4YQ2A 1I4WA 2VIIA 3J27B 3U6PA 4YQ1A 4NOOB 3AJIB 5ITXE 1NNJA 2DWLA 4DV0M 4QOZC 1IN4A 2V1CA 4FWDA 3HHZA 2HCBA 3A98B 3T1YM 1E94E 3E5YA 5KPRA 1Z5AA 1XXHB 4QHTA 3KOYE 3NK6A 1PJIA 1XWIA 2Y20A 1MX0A 3KSJA 3H4MA 1NY6A 4Z8XA 5CO4A 1TGUA 3GRRA 4G4RA 4L69A 2Y0TA 4B3RM 3RFWA 4LZJA 2XFSA 1R2ZA 1HR0M 3HKPA 3A46A 1N34M 3B9PA 3FTCA 4OVZA 1XNQM 2CV2A 4YPWA 4PDIA 4YQDA 1TDHA 5E6JA 4DUZM 4YPXA 4YQKA 2RGOA 4LRSA 5JI3E 3U5ZA 3O7BA 3DFZA 3KW6A 2DHRA 1Q3CA 3DA1A 4D81A 4B7GA 3LMMA 2QPAA 1FJGM 4K0KM 2YY8A 1OFHA 2D7EA 2A5YB 1TH2A 1R6BX 4JI4M 1XC8A 5A2QS 2CEAA 3LVWA 4CNGA 2W82A 3HHYA 2J7NA 2QBYA 1J7KA 4X3LA 3ILKA 3ZC7B 4W5WA 4NSRA 5EP4A 1NHWC 4FCVA 3CF2A 5FTLA 4DV6M 1HQCA 4JI8M 1Q3BA 4LF6M 2UU9M 1OY5A 1K3XA 4MGYE 2QP9X 3BBDA 4QHSA 4H3ZA 3L26A 2CHVA 4LF7M 1IY2A 3FUVA 5C1BA 3KOWE 3FUUA 1G59A 3HGIA 1TO0A 1G41A 1S3SA 4B3MM 3ZCBB 2Y0QA 3OIIA 3VKGA 1N36M 2Y21A 3SYKA 2KRKA 3AOEA 3KSXA 3JR4A 3U6MA 4LFBM 3KP1E 3AOGA 3WHKA 2UUAM 4IG6A 4MCBA 2C9CA 4DV3M 2R46A 3K2LA 4GC5A 3TL4X 1E32A 2ZBKB 4FMWA 3SASA 1X7PA 3BBEA 4DR7M 1NXZA 3GPXA 2EA0A 1IN6A 2V6ZM 4NRVA 5FSWA 5JI2E 1WXQA 1ORYB 3JR5A 4GH9A 4AKGA 3KTYA 2Z0YA 3Q8XA 4DR2M 1R7RA 2R4JA 3QWLA 3GLGB 1L8QA 3K8ZA 4L16A 4M0DA 2C5RA 3I4VA 1N75A 2NQ8C 4NSOB 4JWFA 4G4QA 3FTFA 2X4AA 1IXRC 4PD2A 2UUBM 4LRTA 1Z5BA 1K3WA 2RKOA 1GVNA 2QZ4A 1QAQA 1VDDA 4M9SA 7CATA 2C9OA 2ERCA 2O5RA 4Z6YA 2DWMA 5FLXS 4LFCM 4LZZA 1VHYA 3QAUA 2I7NA 4M0WA 4IBKA 5BPVA 3VFDA 3FYCA 4AG5A 3N4JA 3KS8A 2F5OA 4KODA 5EP1A 2L7IA 4X65M 1N77A 4MB7A 4KHPM 3AI9X 1TH3A 3GLIB 1YE9A 2C96A 4DR4M 3FUTA 1D2NA 4AQYM 2R4EA 3GRUA 4PCZA 3U6SA 1C1KA 4MGIE 3RGPA 1UAMA 4B7FA 2R18A 4YPYA 1XMOM 2L6OA 3PNVA 2RGHA 3GLFA 4DV1M 3UZUA 4TUWA 2EUCA 1KSFX 4S12A 3FYDA 4R3DA 2YQZA 2LNHC 1IY0A 1DGFA 4IBCA 1MU5A 3MHVC 4YQ7A 3U61B 3R8FA 4YY3M 2XZFA 2BNKA 3ONPA 3J80S 1NSFA 3KW2A 5DYGA 1DGHB 1V6ZA 1QANA 3SAVA 4H3YA 2KW0A 4LJ9A 1ZQ9A 4YVGA 2CHGA 4PDGA 4GHAA 3A45A 3L29A 4X64M 2X49A 1J09A 1NHGC 5DNYA 5IT9S 1DO0A 4IIWA 5EXSA 1YSYA 4JI1M 1K82A 4MM3B 1L1ZA 4ITQA 2ZANA 4MGKE 5IREB 4L8RC 4JWGA 4YQ0A 2M60A 4YQJA 4J3CA 2DWZB 2F5QA 4CNFA 2HKJA 1Z5CA 3L28A 1L2DA 5ITUA 3KVWA 4LJ4A 1QAMA 3HU3A 2CX8A 4YQIA 4LF5M 2HA8A 4YQCA 2LH0A 4GHLA 2Q2EB 1HNZM 2C99A 1QAOA 3KFUG 2H1RA 5FTJA 2VQFM 2F4VM 2I7PA 4YQOA 1X37A 4KLNA 4YQPA 4D82A 1GLNA 3BOSA 4KDZA 2LXEA 4JWJA 5EP3A 1PJJA 1UAKA 3AFHA 3NK7A 3HJQA 2UXBM 4JALA 5KQDA 3D8LA 3LVVA 2L09A 1L2BA 3GRVA 1IPAA 4AI6A 2Z4RA 4QOSA 3FTDA 3TWKA 3U5ZB 4FCTA 4M9XA 3N4KA 2FNAA 2X8AA 3U6QA 1ZJRA 2UXDM 5KPTA 4JI6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGV A;  2Z0Y A;  2EGW A;  3KY7 A;  1UAL A;  5GMC A;  1UAJ A;  4YQ3 A;  3GYQ A;  4YQR A;  4JAK A;  4YQ9 A;  4YQL A;  4YQN A;  1GZ0 A;  4YVJ A;  4X3M A;  4YPZ A;  4YQB A;  4YVH A;  3KNU A;  4YQ5 A;  1VHY A;  4YQ6 A;  4KGN A;  4YQ4 A;  4YQA A;  4YQ2 A;  3N4J A;  4YQ1 A;  3AI9 X;  3E5Y A;  3NK6 A;  5GM8 A;  4MCD A;  1NS5 A;  4YPY A;  5CO4 A;  4L69 A;  3IC6 A;  4YQT A;  4YVI A;  4YPW A;  4YQ7 A;  4YQG A;  4YQD A;  4YPX A;  3ONP A;  1P9P A;  4YQK A;  3O7B A;  4XBO A;  3KW2 A;  3OIJ A;  1V6Z A;  2O3A A;  1VH0 A;  4H3Y A;  4YQQ A;  2YY8 A;  4YVG A;  2QWV A;  3AIA A;  2V3J A;  4CNG A;  3AXZ A;  4YQ0 A;  4X3L A;  3ILK A;  2QMM A;  3DCM X;  1UAM A;  4YQJ A;  4J3C A;  1OY5 A;  2I6D A;  3OIN A;  4CNF A;  2V3K A;  5FAI A;  3BBD A;  1VHK A;  4H3Z A;  4PZK A;  2CX8 A;  1MXI A;  4YQI A;  2HA8 A;  4YQC A;  5D9F A;  3QUV A;  1K3R A;  3IEF A;  1X7O A;  4FAK A;  1TO0 A;  4YVK A;  3OII A;  4E8B A;  4YQO A;  1Z85 A;  4YQP A;  1J85 A;  1O6D A;  4KDZ A;  4MCC A;  4YQS A;  1UAK A;  3NK7 A;  4CNE A;  3BBH A;  4IG6 A;  4MCB A;  4JAL A;  5GMB A;  3L8U A;  4RG1 A;  4CND A;  1IPA A;  1X7P A;  1V2X A;  3N4K A;  3BBE A;  4YQ8 A;  1NXZ A;  1ZJR A;  3KTY A; 
#chains in the Genus database with same CATH topology
 2HAK A;  1ZAE A;  2EGW A;  3I04 M;  4MH0 E;  2KZS A;  2R44 A;  4AKI A;  1C7Y A;  2UXD M;  4RF1 A;  4I8O A;  3GQ3 A;  1TH4 A;  3IEC A;  2DXI A;  4PT5 A;  2XF3 A;  3UJN A;  4OW0 A;  1ZMW A;  1E9S A;  2QBY B;  4QNM A;  2WZJ A;  3GYQ A;  4FVM A;  1HNW M;  4YQ9 A;  3I51 A;  4YQL A;  4YQN A;  4RNA A;  3U60 A;  2BJW A;  4JN6 A;  4YVJ A;  1V34 A;  2EKK A;  1QYR A;  4LGM A;  3NWL A;  4AG6 A;  3IG5 A;  4R71 A;  3U6L A;  3L27 A;  5LMU M;  4YQB A;  3KP0 E;  4LGY A;  1IXZ A;  1YLA A;  5KPZ A;  3KNU A;  3J7B A;  3SAU A;  1GL6 A;  2QSF X;  4NXM M;  4KGN A;  1VEJ A;  4B3S M;  1MJG M;  3E5Y A;  1IXS B;  1Q39 A;  3TWM A;  1GL7 A;  2LHC A;  3GLF E;  3AOE C;  1OFI A;  4IBE A;  4IBI A;  3J81 S;  2QCU A;  4DUY M;  4A3V B;  1NO1 A;  4CHT B;  2Z3X A;  3VK7 A;  4I4L A;  3K92 A;  3PFI A;  2CWB A;  4G4N A;  1XMQ M;  2BJV A;  3EIH A;  4DV5 M;  1VDL A;  2LVN C;  4MCD A;  4DR5 M;  1DV0 A;  3CTW B;  3GLG A;  3VK8 A;  1SXJ A;  1NV9 A;  1IQP A;  1HQY E;  2FE8 A;  1JB0 F;  3GPU A;  3GQ5 A;  1IBM M;  3IC6 A;  1ZV1 A;  1GJS A;  2JZ0 A;  3SHG B;  3AKZ A;  1YUB A;  4EIW A;  2XSZ A;  2R6F A;  3I4Y A;  1J5E M;  3B7N A;  1XXH E;  1EE8 A;  1QZM A;  3E9S A;  1JR3 A;  1NV8 A;  2QEN A;  3TE6 A;  4X62 M;  1KYI A;  4YQG A;  2F5N A;  1P9P A;  3SFZ A;  1TTE A;  2Z7J A;  4XBO A;  4R7G A;  3GPY A;  2UUC M;  3SC3 A;  3GLH A;  2JNH A;  1EIJ A;  2CUZ A;  2XLJ A;  3JAM S;  4BBA A;  4YQQ A;  4WUR A;  1OAO C;  2VDB B;  4DV4 M;  2P5T A;  3HHX A;  2JUJ A;  3I01 M;  5EP2 A;  1IBK M;  2LVA A;  4JI3 M;  5KO3 A;  2FOI C;  3GLI A;  3SBJ A;  4RF0 A;  4DV2 M;  3VKH A;  2DWN A;  4JI0 M;  1FNN A;  1IBL M;  1UFZ A;  3U6C A;  2F5S A;  3AXZ A;  1G71 A;  3VDU A;  3HU2 A;  1L2C A;  2CV0 A;  3UGJ A;  3GP1 A;  3KDS E;  1NJF A;  4QNR A;  3DZD A;  2V3K A;  4LF4 M;  1W5T A;  3CGW A;  3R9X B;  1VHK A;  3AV0 A;  4HLQ A;  4B3T M;  1N33 M;  2HL7 A;  3MJ5 A;  2FFJ A;  3FTE A;  2KZU A;  1OJL A;  1RU3 A;  4GIT A;  1HNX M;  1K3R A;  3B7Z A;  4Y28 F;  1UM8 A;  2KNZ A;  4IBD A;  4DR3 M;  3IEF A;  1OTR A;  3FE3 A;  4HL4 A;  4IJE A;  3L2A A;  3HWS A;  1QVR A;  1Z85 A;  4RKU F;  2CFO A;  4LJA A;  4DR1 M;  3HJS A;  2R62 A;  3GLF B;  1J85 A;  1O6D A;  4MGH A;  4MCC A;  1JQJ C;  4IJF A;  2Z4S A;  4YQS A;  3E21 A;  1PJQ A;  1XXH A;  5EXX A;  2LVP C;  3THG A;  5ITQ A;  2ZM6 M;  3AL0 C;  3FRI A;  3K1J A;  3L8U A;  4RG1 A;  4CND A;  1DGG A;  3E4R A;  4I81 A;  2ZAM A;  4GKJ M;  4L6V 6;  4NRW A;  4YQ8 A;  3SMP A;  2KHH A;  3CF0 A;  3W0F A;  1Z6T A;  1IN7 A;  3OII A;  1HT2 E;  3VLF B;  4DV7 M;  1NJG A;  1QQW A;  4FCW A;  3FKE A;  1ZMV A;  1IN5 A;  3F92 A;  3KXE C;  4OX9 M;  2L7H A;  1VG5 A;  2ZAO A;  5GMC A;  1TDZ A;  3ZH9 B;  1UAJ A;  3U6O A;  5F3W A;  4L4U A;  1OIZ A;  3U6D A;  4CGY B;  1IM2 A;  2LWX A;  4YQR A;  4LJ6 A;  2G5G X;  2KEB A;  2HHH M;  1A5T A;  4HEO A;  4LCB A;  3GQ4 A;  2R45 A;  2K9D A;  1GZ0 A;  5EXT A;  3FD9 A;  3J2P B;  3HJ8 A;  8CAT A;  1E9R A;  4YPZ A;  2OPF A;  3KOZ E;  4OVZ B;  1CUK A;  2KXE A;  2JY5 A;  4LJ7 A;  5C18 A;  1Z59 A;  2XEP A;  4AZF A;  2KA6 B;  4YVH A;  1HJP A;  1HT1 E;  1WR1 B;  3M0E A;  2MGW A;  3GLG E;  4YQ6 A;  2EO2 A;  1SXJ E;  3SMS A;  5ITR A;  1H6U A;  4YQ4 A;  1VEK A;  3K9P A;  3NBI A;  4JI2 M;  4YQA A;  4B7H A;  3PNY A;  2CE7 A;  2WSF F;  2K6B A;  4L78 A;  4LG2 A;  4JYA M;  2DHY A;  2AHM A;  2JY6 B;  4WW0 A;  4JWH A;  1GKI A;  1N78 A;  2YR0 A;  4DR6 M;  2CHQ A;  4JI5 M;  4GMQ A;  3MK6 A;  4JI7 M;  1JR3 E;  2DZN B;  2G3Q A;  3WHL A;  2VQE M;  3W0L B;  5GM8 A;  4LF6 M;  2C98 A;  4B08 A;  1NS5 A;  2JA2 A;  3GLH E;  2G8L A;  4L15 A;  2V1U A;  3UK6 A;  3PVS A;  5GKN A;  5KQ8 A;  1QUT A;  3FUX A;  2JXN A;  2DAI A;  2L2D A;  4AKH A;  5ITX A;  2OOB A;  4YQT A;  5EXP A;  5FTN A;  1IY1 A;  1NY5 A;  3GLI E;  4GKK M;  1GO5 A;  3D8B A;  3LQR A;  2LBC A;  4YVI A;  4BB9 A;  2WSC F;  4AW4 A;  2DZO B;  3SAW A;  4LY6 A;  3HHW A;  5E26 A;  2DI0 A;  3LCV B;  3OIJ A;  2LTU A;  5IZ7 D;  2O3A A;  1VH0 A;  3U60 B;  3M7G A;  2CV1 A;  2DVW B;  5FTK A;  4CJ6 A;  3DOA A;  4JV5 M;  2DAK A;  5EQT A;  4X66 M;  2H5X A;  3J7A S;  1N32 M;  3B7Q A;  2QWV A;  4IBB A;  2V3J A;  3AIA A;  2LVQ D;  4GC9 A;  5DYI A;  1R2Y A;  4P16 A;  4BLC A;  4I5S A;  4ZPX A;  3M6A A;  3CF6 E;  2N35 A;  3HY5 A;  2E5L M;  2QMM A;  3DCM X;  3C58 A;  2M5Z A;  3EIE A;  4M9Z A;  3U6E A;  3KOX E;  2I6D A;  3OIN A;  3E46 A;  4FD2 A;  5FAI A;  2KRU A;  2K47 A;  2XZU A;  4JXJ A;  3OTO M;  4PZK A;  5FTM A;  3KS4 A;  1GJT A;  1HR0 M;  3HU1 A;  1PJT A;  1SXJ D;  4NC6 A;  1MXI A;  4IBG A;  2YNM D;  5D9F A;  3SAT A;  3QUV A;  1XHB A;  1IN8 A;  4NL4 H;  5ITY A;  1D0L A;  1X7O A;  4FAK A;  4YVK A;  4KT0 F;  3VDP A;  4E8B A;  2XSZ D;  1SXJ C;  1SXJ B;  3TPZ A;  1T3T A;  3TWL A;  1JR3 D;  5LMN M;  1G8P A;  4CNE A;  2BWE A;  2J7O A;  3BBH A;  3SYL A;  5ITT A;  4MGZ E;  4D80 A;  2FH0 A;  5GMB A;  2KNV A;  1NNU C;  4OU7 A;  3GPP A;  2D7H A;  4YHH M;  1V2X A;  4G6Z A;  4GEW A;  3GRY A;  3RGS A;  3BBZ A;  1DO2 A;  4REZ A;  4LJ8 A;  3GLH B;  4FW9 A;  4FWH A;  1NVM A;  1LV7 A;  3LQQ A;  4DBG B;  3T15 A;  2EGV A;  3T38 A;  1KFV A;  4CIS A;  4GIP A;  3FUW A;  3IG8 A;  1DGB A;  4GRI A;  1UAL A;  2YFQ A;  3KY7 A;  3SAR A;  3TQS A;  3U61 A;  1W5S A;  1I94 M;  5H37 D;  4G4O A;  2XFT A;  4YQ3 A;  5IWA M;  4JAK A;  2D7G A;  1G4A E;  1DGH A;  4FWG A;  3L25 A;  4Q7J A;  3SHF A;  4IBF A;  5EJC A;  1L1T A;  4XGI A;  1VEG A;  4KO8 A;  3C3E A;  2OQ4 A;  2DAG A;  1XNR M;  4LF8 M;  1R5L A;  2XGN A;  3W67 A;  2UXC M;  4X3M A;  4LFA M;  3NBX X;  1P3Q Q;  2R65 A;  4LJ5 A;  3UMM A;  4IBJ A;  2F5P A;  1PM5 A;  1G3I A;  4II7 A;  4NXN M;  3PXG A;  3A42 A;  1AIP C;  4YQ5 A;  2CRU A;  3GO8 A;  1EFU B;  1WHC A;  3T1H M;  3RE8 A;  5BR8 M;  2XH9 A;  4LF9 M;  4YQ2 A;  1I4W A;  2VII A;  3J27 B;  3U6P A;  4YQ1 A;  4NOO B;  3AJI B;  2QQ8 A;  2VF7 A;  5ITX E;  1NNJ A;  2DWL A;  4DV0 M;  4QOZ C;  1IN4 A;  2MRO B;  2V1C A;  2WSE F;  2HCB A;  3A98 B;  4FWD A;  1E94 E;  3HHZ A;  4CIZ A;  1Z5A A;  1XXH B;  4QHT A;  3KOY E;  5KPR A;  3H4J A;  1PJI A;  3NK6 A;  1XWI A;  2Y20 A;  1MX0 A;  3KSJ A;  3H4M A;  1NY6 A;  4Z8X A;  2LVO C;  1OKS A;  1Y8G A;  5CO4 A;  1TGU A;  3GRR A;  4G4R A;  4L69 A;  2Y0T A;  2CP8 A;  1D0K A;  4XK8 F;  4B3R M;  3RFW A;  1WGN A;  2XFS A;  4G3O A;  1V92 A;  3HKP A;  4LZJ A;  3A46 A;  1R2Z A;  1N34 M;  1ZMU A;  2ZTC A;  3B9P A;  3FTC A;  4OVZ A;  1XNQ M;  2CV2 A;  3B89 A;  3LW5 F;  4ANR A;  4YPW A;  4PDI A;  4YQD A;  1TDH A;  5E6J A;  2FS1 A;  4P17 A;  4DUZ M;  4YPX A;  4YQK A;  2RGO A;  4LRS A;  1TF0 B;  5JI3 E;  3U5Z A;  3DFZ A;  3O7B A;  3KW6 A;  2DHR A;  1Q3C A;  3DA1 A;  4D81 A;  4B7G A;  3LMM A;  1IFY A;  2QPA A;  1FJG M;  4K0K M;  2YY8 A;  1TR8 A;  1OFH A;  4WP2 A;  2D7E A;  2A5Y B;  1TH2 A;  1R6B X;  2JY7 A;  1XC8 A;  5A2Q S;  4JI4 M;  2CEA A;  3LVW A;  4CNG A;  3Q8G A;  2W82 A;  3FRH A;  3HHY A;  2J7N A;  2QBY A;  1J7K A;  4X3L A;  3ILK A;  1PJS A;  3ZC7 B;  2GQF A;  4NSR A;  4W5W A;  1NHW C;  4FCV A;  3CF2 A;  5EP4 A;  2DNA A;  1HQC A;  5FTL A;  1Q3B A;  2DZL A;  4DV6 M;  2UU9 M;  1K3X A;  4MGY E;  1OY5 A;  2QP9 X;  2RRU A;  3BBD A;  4QHS A;  4H3Z A;  3QYB A;  3L26 A;  2CHV A;  3V76 A;  3IHP A;  4LF7 M;  1IY2 A;  3FUV A;  5C1B A;  1MN3 A;  2JP7 A;  3KOW E;  3FUU A;  1G59 A;  3HGI A;  2DEN A;  1TO0 A;  1G41 A;  1S3S A;  4B3M M;  1BVS A;  2LHG A;  2MR9 A;  1IXS A;  2Y0Q A;  2Y21 A;  3C9P A;  3SYK A;  2KRK A;  3ZCB B;  1N36 M;  3AOE A;  3VKG A;  1QDT A;  2EKF A;  3KSX A;  3JR4 A;  3U6M A;  4LFB M;  3KP1 E;  1OAI A;  1OIP A;  3AOG A;  3WHK A;  2DAE A;  2UUA M;  4IG6 A;  4MCB A;  2C9C A;  4DV3 M;  2R46 A;  3K2L A;  1D0M A;  4GC5 A;  1E32 A;  2ZBK B;  3TL4 X;  3SAS A;  1X7P A;  4FMW A;  5DFL A;  3BBE A;  4DR7 M;  1NXZ A;  3GPX A;  2EA0 A;  1IN6 A;  2HWJ A;  2V6Z M;  4NRV A;  5FSW A;  1WXQ A;  1ORY B;  5JI2 E;  3JR5 A;  1QUS A;  4GH9 A;  3QYE A;  4AKG A;  3KTY A;  2MH8 A;  5L8R F;  2Z0Y A;  1PGY A;  3Q8X A;  4DR2 M;  1R7R A;  2R4J A;  2KNA A;  3QWL A;  3GLG B;  1L8Q A;  2OOA A;  3K8Z A;  4L16 A;  2DAM A;  4M0D A;  2JZ1 A;  3I4V A;  2C5R A;  1N75 A;  2NQ8 C;  1LTM A;  4NSO B;  4JWF A;  4G4Q A;  2MJ5 B;  3FTF A;  1SG9 A;  2EJS A;  2X4A A;  1IXR C;  2L4F A;  4PD2 A;  2UUB M;  4LRT A;  1Z5B A;  1K3W A;  2RKO A;  2OO9 A;  1GVN A;  2QZ4 A;  1QAQ A;  1VDD A;  3K9O A;  2DKL A;  4M9S A;  7CAT A;  2C9O A;  2ERC A;  2QNJ A;  2O5R A;  3LCU A;  4Z6Y A;  2DWM A;  1F4I A;  5FLX S;  1VQ1 A;  2APL A;  4LZZ A;  4LFC M;  3QAU A;  2I7N A;  4M0W A;  2K0B X;  3B74 A;  4IBK A;  5BPV A;  1VHY A;  3VFD A;  3HZJ A;  3FYC A;  4AG5 A;  3N4J A;  3KS8 A;  2F5O A;  4KOD A;  5EP1 A;  2L7I A;  4X65 M;  1N77 A;  4MB7 A;  4KHP M;  3AI9 X;  1TH3 A;  1WGL A;  3T6P A;  2O25 A;  2VF8 A;  3GLI B;  1YE9 A;  2C96 A;  4DR4 M;  3FUT A;  1D2N A;  4AQY M;  2R4E A;  3GRU A;  4PCZ A;  3U6S A;  1C1K A;  4MGI E;  3RGP A;  2BWB A;  1UAM A;  4B7F A;  2R18 A;  2JY8 A;  4YPY A;  1XMO M;  2O01 F;  2L6O A;  2ZTD A;  2J5Y A;  2RGH A;  3PNV A;  3GLF A;  4DV1 M;  3UZU A;  4TUW A;  1AUA A;  2EUC A;  1KSF X;  4S12 A;  1QDR A;  3FYD A;  2KDL A;  2YQZ A;  4R3D A;  2LNH C;  1IY0 A;  1DGF A;  4IBC A;  1MU5 A;  3MHV C;  4YQ7 A;  3ZQJ A;  3U61 B;  3R8F A;  4YY3 M;  2XZF A;  2BNK A;  2GNO A;  3J80 S;  3ONP A;  1NSF A;  2JWS A;  3KW2 A;  5DYG A;  1DGH B;  1V6Z A;  1QAN A;  1OQY A;  3C3D A;  1WJ7 A;  3SAV A;  4H3Y A;  2KW0 A;  4LJ9 A;  1ZQ9 A;  4YVG A;  2CHG A;  1QZE A;  4PDG A;  3A45 A;  4GHA A;  3L29 A;  4X64 M;  2X49 A;  1J09 A;  1NHG C;  5DNY A;  1R4G A;  5IT9 S;  1DO0 A;  4IIW A;  5EXS A;  1YSY A;  3W68 A;  4JI1 M;  4F1I A;  1K82 A;  4MM3 B;  1L1Z A;  4ITQ A;  2ZAN A;  4MGK E;  5IRE B;  2QHO B;  3MMP A;  4L8R C;  4JWG A;  1PRB A;  4YQ0 A;  1V33 A;  2M60 A;  4YQJ A;  1GAB A;  4J3C A;  2DWZ B;  2F5Q A;  2L4E A;  4F2L A;  2HKJ A;  2R0I A;  1Z5C A;  4CNF A;  3L28 A;  1L2D A;  5ITU A;  4JI8 M;  2Z8Y M;  3KVW A;  4LJ4 A;  1QAM A;  1XB2 B;  3HU3 A;  1WIV A;  4LF5 M;  2CX8 A;  2HA8 A;  4YQC A;  2LH0 A;  4GHL A;  4YQI A;  2Q2E B;  1HNZ M;  2C99 A;  1QAO A;  2B3T A;  3KFU G;  2H1R A;  5FTJ A;  2VQF M;  2F4V M;  2I7P A;  4YQO A;  1X37 A;  4KLN A;  4YQP A;  1T43 A;  4D82 A;  3T1Y M;  1GLN A;  3BOS A;  3BXW A;  4KDZ A;  2LXE A;  4JWJ A;  5EP3 A;  1PJJ A;  3HX3 A;  3AFH A;  1UAK A;  3NK7 A;  3HJQ A;  2UXB M;  4JAL A;  5KQD A;  3D8L A;  3LVV A;  2L09 A;  1L2B A;  3GRV A;  1IPA A;  4AI6 A;  2Z4R A;  1T6O A;  3FTD A;  4QOS A;  3TWK A;  4FCT A;  4M9X A;  3U5Z B;  3N4K A;  2FNA A;  2X8A A;  3U6Q A;  1ZJR A;  4UN2 B;  5KPT A;  1Q02 A;  4JI6 M; 
#chains in the Genus database with same CATH homology
 1ZAE A;  2EGW A;  4MH0 E;  2KZS A;  4AKI A;  4RF1 A;  4I8O A;  3GQ3 A;  1TH4 A;  2DXI A;  4PT5 A;  2XF3 A;  3UJN A;  4OW0 A;  2QBY B;  1E9S A;  3GYQ A;  4QNM A;  4FVM A;  1HNW M;  4YQ9 A;  3I51 A;  4YQL A;  4YQN A;  4RNA A;  3U60 A;  2BJW A;  4JN6 A;  4YVJ A;  1QYR A;  4LGM A;  3NWL A;  4AG6 A;  3IG5 A;  3U6L A;  3L27 A;  5LMU M;  4YQB A;  3KP0 E;  4LGY A;  1IXZ A;  5KPZ A;  3KNU A;  3J7B A;  3SAU A;  1GL6 A;  4KGN A;  4NXM M;  4B3S M;  1IXS B;  1Q39 A;  3TWM A;  1GL7 A;  3AOE C;  1OFI A;  4IBE A;  4IBI A;  3J81 S;  2QCU A;  4DUY M;  4A3V B;  4CHT B;  2Z3X A;  3VK7 A;  4I4L A;  3K92 A;  3PFI A;  4G4N A;  1XMQ M;  2BJV A;  3EIH A;  4DV5 M;  4MCD A;  4DR5 M;  3CTW B;  3GLG A;  3VK8 A;  1SXJ A;  1IQP A;  1HQY E;  2FE8 A;  3GPU A;  3GQ5 A;  1IBM M;  3IC6 A;  3SHG B;  3AKZ A;  1YUB A;  4EIW A;  2XSZ A;  3I4Y A;  1J5E M;  1EE8 A;  1QZM A;  3E9S A;  1JR3 A;  3TE6 A;  2QEN A;  4X62 M;  4YQG A;  1KYI A;  2F5N A;  1P9P A;  3SFZ A;  2Z7J A;  3GPY A;  4XBO A;  4R7G A;  2UUC M;  3SC3 A;  3GLH A;  2CUZ A;  2XLJ A;  3JAM S;  4BBA A;  4YQQ A;  4WUR A;  4DV4 M;  2P5T A;  3HHX A;  5EP2 A;  1IBK M;  4JI3 M;  5KO3 A;  2FOI C;  3GLI A;  3SBJ A;  4RF0 A;  4DV2 M;  3VKH A;  2DWN A;  4JI0 M;  1FNN A;  1IBL M;  3AXZ A;  3U6C A;  2F5S A;  3VDU A;  3HU2 A;  1L2C A;  2CV0 A;  3UGJ A;  3GP1 A;  3KDS E;  1NJF A;  4QNR A;  3DZD A;  2V3K A;  4LF4 M;  1W5T A;  3R9X B;  1VHK A;  3AV0 A;  4HLQ A;  4B3T M;  1N33 M;  2HL7 A;  3MJ5 A;  2FFJ A;  3FTE A;  2KZU A;  1OJL A;  4GIT A;  1HNX M;  1K3R A;  3IEF A;  1UM8 A;  4IBD A;  4DR3 M;  4HL4 A;  4IJE A;  3L2A A;  3HWS A;  1QVR A;  1Z85 A;  2CFO A;  4LJA A;  4DR1 M;  3HJS A;  2R62 A;  3GLF B;  1J85 A;  1O6D A;  4MGH A;  4MCC A;  1JQJ C;  4IJF A;  2Z4S A;  4YQS A;  1XXH A;  5EXX A;  3THG A;  5ITQ A;  2ZM6 M;  3AL0 C;  3K1J A;  3L8U A;  4RG1 A;  4CND A;  1DGG A;  3E4R A;  4I81 A;  2ZAM A;  4GKJ M;  4NRW A;  4YQ8 A;  3SMP A;  3CF0 A;  3W0F A;  1IN7 A;  1Z6T A;  1HT2 E;  3VLF B;  4DV7 M;  1NJG A;  1QQW A;  4FCW A;  3FKE A;  1IN5 A;  3KXE C;  4OX9 M;  2L7H A;  2ZAO A;  5GMC A;  1TDZ A;  3ZH9 B;  1UAJ A;  3U6O A;  5F3W A;  4L4U A;  3U6D A;  4CGY B;  1IM2 A;  2LWX A;  4YQR A;  4LJ6 A;  2G5G X;  2KEB A;  2HHH M;  4LCB A;  3GQ4 A;  2R45 A;  1GZ0 A;  5EXT A;  3FD9 A;  3J2P B;  3HJ8 A;  8CAT A;  1E9R A;  4YPZ A;  2OPF A;  3KOZ E;  4OVZ B;  4LJ7 A;  2KXE A;  5C18 A;  1Z59 A;  2XEP A;  4AZF A;  2KA6 B;  4YVH A;  1HT1 E;  3M0E A;  4YQ6 A;  2EO2 A;  1SXJ E;  3SMS A;  5ITR A;  1H6U A;  4YQ4 A;  3NBI A;  4JI2 M;  4YQA A;  4B7H A;  3PNY A;  2CE7 A;  4L78 A;  4LG2 A;  4JYA M;  2AHM A;  4JWH A;  4WW0 A;  1GKI A;  1N78 A;  2YR0 A;  4DR6 M;  2CHQ A;  4JI5 M;  4GMQ A;  3MK6 A;  4JI7 M;  2DZN B;  3WHL A;  2VQE M;  5GM8 A;  3W0L B;  2C98 A;  4B08 A;  1NS5 A;  2JA2 A;  2G8L A;  4L15 A;  2V1U A;  3UK6 A;  3PVS A;  5GKN A;  5KQ8 A;  3FUX A;  4AKH A;  5ITX A;  4YQT A;  5EXP A;  5FTN A;  1IY1 A;  1NY5 A;  4GKK M;  3D8B A;  3LQR A;  4YVI A;  4BB9 A;  4AW4 A;  2DZO B;  3SAW A;  4LY6 A;  3HHW A;  5E26 A;  3OIJ A;  5IZ7 D;  2O3A A;  1VH0 A;  3U60 B;  3M7G A;  2CV1 A;  2DVW B;  5FTK A;  3DOA A;  4JV5 M;  5EQT A;  4X66 M;  3J7A S;  1N32 M;  2QWV A;  3AIA A;  4IBB A;  2V3J A;  4GC9 A;  5DYI A;  1R2Y A;  4P16 A;  4BLC A;  4I5S A;  4ZPX A;  3M6A A;  3CF6 E;  2E5L M;  2QMM A;  3DCM X;  3C58 A;  2M5Z A;  3EIE A;  4M9Z A;  3U6E A;  3KOX E;  2I6D A;  3OIN A;  4FD2 A;  5FAI A;  2KRU A;  2K47 A;  2XZU A;  4JXJ A;  3OTO M;  4PZK A;  5FTM A;  3KS4 A;  3HU1 A;  1SXJ D;  1MXI A;  4IBG A;  2YNM D;  5D9F A;  3SAT A;  3QUV A;  1XHB A;  1IN8 A;  4NL4 H;  5ITY A;  1X7O A;  4FAK A;  4YVK A;  3VDP A;  4E8B A;  2XSZ D;  1SXJ C;  1SXJ B;  3TPZ A;  1T3T A;  3TWL A;  1JR3 D;  5LMN M;  1G8P A;  4CNE A;  2J7O A;  3BBH A;  3SYL A;  5ITT A;  4MGZ E;  4D80 A;  5GMB A;  1NNU C;  4OU7 A;  3GPP A;  2D7H A;  4YHH M;  1V2X A;  4G6Z A;  3GRY A;  3RGS A;  1DO2 A;  4REZ A;  4LJ8 A;  3GLH B;  4FW9 A;  4FWH A;  1NVM A;  1LV7 A;  3LQQ A;  3T15 A;  2EGV A;  3T38 A;  1KFV A;  4CIS A;  4GIP A;  3FUW A;  3IG8 A;  1DGB A;  4GRI A;  1UAL A;  2YFQ A;  3KY7 A;  3SAR A;  3TQS A;  3U61 A;  1W5S A;  1I94 M;  5H37 D;  4G4O A;  2XFT A;  4YQ3 A;  5IWA M;  4JAK A;  2D7G A;  1G4A E;  1DGH A;  4FWG A;  3L25 A;  3SHF A;  4IBF A;  5EJC A;  1L1T A;  4XGI A;  1XNR M;  4KO8 A;  4X3M A;  2OQ4 A;  2UXC M;  4LF8 M;  2XGN A;  4LFA M;  2R65 A;  4LJ5 A;  3UMM A;  4IBJ A;  2F5P A;  1PM5 A;  1G3I A;  4II7 A;  4NXN M;  3PXG A;  3A42 A;  4YQ5 A;  3GO8 A;  3T1H M;  3RE8 A;  5BR8 M;  2XH9 A;  4LF9 M;  4YQ2 A;  1I4W A;  2VII A;  3J27 B;  3U6P A;  4YQ1 A;  4NOO B;  3AJI B;  5ITX E;  1NNJ A;  2DWL A;  4DV0 M;  4QOZ C;  1IN4 A;  2V1C A;  4FWD A;  3HHZ A;  2HCB A;  3A98 B;  3T1Y M;  1E94 E;  3E5Y A;  5KPR A;  1Z5A A;  1XXH B;  4QHT A;  3KOY E;  3NK6 A;  1PJI A;  1XWI A;  2Y20 A;  1MX0 A;  3KSJ A;  3H4M A;  1NY6 A;  4Z8X A;  5CO4 A;  1TGU A;  3GRR A;  4G4R A;  4L69 A;  2Y0T A;  4B3R M;  3RFW A;  4LZJ A;  2XFS A;  1R2Z A;  1HR0 M;  3HKP A;  3A46 A;  1N34 M;  3B9P A;  3FTC A;  4OVZ A;  1XNQ M;  2CV2 A;  4YPW A;  4PDI A;  4YQD A;  1TDH A;  5E6J A;  4DUZ M;  4YPX A;  4YQK A;  2RGO A;  4LRS A;  5JI3 E;  3U5Z A;  3O7B A;  3DFZ A;  3KW6 A;  2DHR A;  1Q3C A;  3DA1 A;  4D81 A;  4B7G A;  3LMM A;  2QPA A;  1FJG M;  4K0K M;  2YY8 A;  1OFH A;  2D7E A;  2A5Y B;  1TH2 A;  1R6B X;  4JI4 M;  1XC8 A;  5A2Q S;  2CEA A;  3LVW A;  4CNG A;  2W82 A;  3HHY A;  2J7N A;  2QBY A;  1J7K A;  4X3L A;  3ILK A;  3ZC7 B;  4W5W A;  4NSR A;  5EP4 A;  1NHW C;  4FCV A;  3CF2 A;  5FTL A;  4DV6 M;  1HQC A;  4JI8 M;  1Q3B A;  4LF6 M;  2UU9 M;  1OY5 A;  1K3X A;  4MGY E;  2QP9 X;  3BBD A;  4QHS A;  4H3Z A;  3L26 A;  2CHV A;  4LF7 M;  1IY2 A;  3FUV A;  5C1B A;  3KOW E;  3FUU A;  1G59 A;  3HGI A;  1TO0 A;  1G41 A;  1S3S A;  4B3M M;  3ZCB B;  2Y0Q A;  3OII A;  3VKG A;  1N36 M;  2Y21 A;  3SYK A;  2KRK A;  3AOE A;  3KSX A;  3JR4 A;  3U6M A;  4LFB M;  3KP1 E;  3AOG A;  3WHK A;  2UUA M;  4IG6 A;  4MCB A;  2C9C A;  4DV3 M;  2R46 A;  3K2L A;  4GC5 A;  3TL4 X;  1E32 A;  2ZBK B;  4FMW A;  3SAS A;  1X7P A;  3BBE A;  4DR7 M;  1NXZ A;  3GPX A;  2EA0 A;  1IN6 A;  2V6Z M;  4NRV A;  5FSW A;  5JI2 E;  1WXQ A;  1ORY B;  3JR5 A;  4GH9 A;  4AKG A;  3KTY A;  2Z0Y A;  3Q8X A;  4DR2 M;  1R7R A;  2R4J A;  3QWL A;  3GLG B;  1L8Q A;  3K8Z A;  4L16 A;  4M0D A;  2C5R A;  3I4V A;  1N75 A;  2NQ8 C;  4NSO B;  4JWF A;  4G4Q A;  3FTF A;  2X4A A;  1IXR C;  4PD2 A;  2UUB M;  4LRT A;  1Z5B A;  1K3W A;  2RKO A;  1GVN A;  2QZ4 A;  1QAQ A;  1VDD A;  4M9S A;  7CAT A;  2C9O A;  2ERC A;  2O5R A;  4Z6Y A;  2DWM A;  5FLX S;  4LFC M;  4LZZ A;  1VHY A;  3QAU A;  2I7N A;  4M0W A;  4IBK A;  5BPV A;  3VFD A;  3FYC A;  4AG5 A;  3N4J A;  3KS8 A;  2F5O A;  4KOD A;  5EP1 A;  2L7I A;  4X65 M;  1N77 A;  4MB7 A;  4KHP M;  3AI9 X;  1TH3 A;  3GLI B;  1YE9 A;  2C96 A;  4DR4 M;  3FUT A;  1D2N A;  4AQY M;  2R4E A;  3GRU A;  4PCZ A;  3U6S A;  1C1K A;  4MGI E;  3RGP A;  1UAM A;  4B7F A;  2R18 A;  4YPY A;  1XMO M;  2L6O A;  3PNV A;  2RGH A;  3GLF A;  4DV1 M;  3UZU A;  4TUW A;  2EUC A;  1KSF X;  4S12 A;  3FYD A;  4R3D A;  2YQZ A;  2LNH C;  1IY0 A;  1DGF A;  4IBC A;  1MU5 A;  3MHV C;  4YQ7 A;  3U61 B;  3R8F A;  4YY3 M;  2XZF A;  2BNK A;  3ONP A;  3J80 S;  1NSF A;  3KW2 A;  5DYG A;  1DGH B;  1V6Z A;  1QAN A;  3SAV A;  4H3Y A;  2KW0 A;  4LJ9 A;  1ZQ9 A;  4YVG A;  2CHG A;  4PDG A;  4GHA A;  3A45 A;  3L29 A;  4X64 M;  2X49 A;  1J09 A;  1NHG C;  5DNY A;  5IT9 S;  1DO0 A;  4IIW A;  5EXS A;  1YSY A;  4JI1 M;  1K82 A;  4MM3 B;  1L1Z A;  4ITQ A;  2ZAN A;  4MGK E;  5IRE B;  4L8R C;  4JWG A;  4YQ0 A;  2M60 A;  4YQJ A;  4J3C A;  2DWZ B;  2F5Q A;  4CNF A;  2HKJ A;  1Z5C A;  3L28 A;  1L2D A;  5ITU A;  3KVW A;  4LJ4 A;  1QAM A;  3HU3 A;  2CX8 A;  4YQI A;  4LF5 M;  2HA8 A;  4YQC A;  2LH0 A;  4GHL A;  2Q2E B;  1HNZ M;  2C99 A;  1QAO A;  3KFU G;  2H1R A;  5FTJ A;  2VQF M;  2F4V M;  2I7P A;  4YQO A;  1X37 A;  4KLN A;  4YQP A;  4D82 A;  1GLN A;  3BOS A;  4KDZ A;  2LXE A;  4JWJ A;  5EP3 A;  1PJJ A;  1UAK A;  3AFH A;  3NK7 A;  3HJQ A;  2UXB M;  4JAL A;  5KQD A;  3D8L A;  3LVV A;  2L09 A;  1L2B A;  3GRV A;  1IPA A;  4AI6 A;  2Z4R A;  4QOS A;  3FTD A;  3TWK A;  3U5Z B;  4FCT A;  4M9X A;  3N4K A;  2FNA A;  2X8A A;  3U6Q A;  1ZJR A;  2UXD M;  5KPT A;  4JI6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...