1A6SA

M-domain from gag polyprotein of rous sarcoma virus, nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
GEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the bioactive retroviral M domain from Rous sarcoma virus
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
total genus 18
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02813 Retro_M Retroviral M domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1a6sA00
1L6NA 2K4HA 2NV3A 4JMUA 2LYAA 1ED1A 2HMXA 1UPHA 2H3VA 2GOLA 2N1RA 2LYBA 1TAMA 2H3ZA 2H3QA 4ICAA 1HEKA 2JMGA 2H3IA 4IC9A 1ECWA 2K4IA 1HIWA 2H3FA 2K4EA 1A6SA
chains in the Genus database with same CATH superfamily
2XGQA 3RJFA 1NJWA 4TUQA 1X9XA 3Q8QB 3ICXA 1N63A 4C8NA 1RQLA 4PHPA 3PNCA 2BPCA 1M6YA 5KG2A 4UAYA 5J29A 3D6JA 7ICTA 4M9NA 2W8LA 2HBLA 4C4RA 3AN1A 5AKHA 4B9SA 4JV0A 2PXIA 4GLXA 3TI0A 9ICCA 3UPQA 2WF6A 3EYZA 5CWRA 4F2RA 1PVPA 2HHXA 1CEZA 3RF9A 2CN1A 1L3SA 2MUTB 2FPLA 3NRWA 3WKAA 2ODGA 5HP4A 4UARA 1UA1A 2H3FA 4F93B 4DF4A 5ALYA 2VKQA 4KN4A 5DDYA 2HOIA 2XY7A 5J0OA 1ZQOA 2YB4A 5AIBA 4I29A 9ICLA 1ZJNA 4UAVA 4J9KA 2BKEA 2XY6A 1KKXA 2AU0A 4YMNA 2VJ5A 1ZD2P 4NL9A 2NO5A 5KFSA 1D8BA 4ECTA 1TAUA 4Y2PA 2Y9TA 1PK3A 1BPBA 5KFIA 2KIVA 2E3TA 3OJSA 3RAXA 3IG8A 2YY6A 2JZBB 5KG3A 5DG9A 3B0YA 3JPPA 2JV3A 5AI4A 5AKXA 5ALPA 3PW0A 2YB1A 1V9PA 5EE3A 5L1MA 4IQWA 4F5OA 2ASJA 4KMUA 4K4IA 2RLTA 4UB3A 1Z1BA 4QNLA 5L1IA 5DLGA 3PSIA 2NYVA 4DF8A 5EWGA 3GFKB 1ZQGA 2EAMA 2W03A 2F3NA 3TAPA 2WB1C 1XSLA 4O0IA 3PO5A 2G06A 4EEYA 3IN5A 4DEZA 4LZGA 1CUKA 1T7PA 2EZZA 4Y2YA 1HUOA 2EDUA 2LYBA 4PGYA 2KD1A 3RFAA 5J0WA 4DSJA 2YTUA 2E5SA 5AM0A 4JV2A 4NLBA 4F5QA 2A1JA 2LBOA 1L6NA 1L7MA 2PMZF 1UT8A 3V7KA 5DB6A 4KMOB 4OJPA 1QLNA 3M6KA 1U47A 2A1AA 2JH7A 8ICJA 1S5LU 4I2HA 1QSSA 2ZJAA 1X9MA 2WF9A 3EZ5A 2BQUA 4AYBF 3KFUF 1S8OA 3OHBA 3GIMA 2ES6A 2WB1F 1SL0A 4M0AA 5F9LA 1WCNA 4J03A 1Z4NA 3RTVA 2YX8A 4F5PA 4RQ2A 5F9NA 2ZTDA 3F2CA 1V85A 3KBBA 2LKYA 2M0NA 1ZQUA 2BPGA 2RDJA 3ISDA 4IS7A 3QUQA 2JRZA 2ZTEA 2W3RA 5KFHA 4K4GA 3Q8PB 4QZIA 4JB3A 2IOFA 2G0AA 3BZKA 4TQRA 1WWUA 4DQRA 4ECRA 1KDHA 2GOLA 1DOQA 1NKBA 2VA8A 4AP9A 4IQTA 3B9JA 1JXEA 8ICSA 4KTQA 4KLMA 3C29A 4IRDA 5D4BA 4OO1J 4EELA 5J8YC 2GLEA 3OSNA 3H4BA 3K75D 4YFKA 3KKAA 5KL8B 5BOMA 4M9HA 2K60A 3MDCA 1LV5A 2ZUDA 3GILA 9ICOA 1DGSA 4CDGA 4R8UB 4ED8A 2C22A 4KLOA 2KV2A 1L3VA 3LVVA 5DQGA 3LVWA 2G07A 4UAZA 3FC4A 1YT3A 5KFJA 1Z00A 5KAIU 2ESEA 2XO7A 5KT4A 3HWTA 4O3PA 3AUOA 2DPJA 2CXYA 3M8RA 4MEXA 4GIBA 5J2KA 1LB2B 2KZ3A 1X42A 3PSFA 4C4TA 4I2IA 8ICVA 3SAFA 5IINA 4OJOA 4O3OA 3F5AA 4K4HA 3ZD9A 3H8WA 4YR0A 2F1IA 4BWMA 3K4GA 1DXSA 4RQ1A 9ICUA 2ISOA 1KQQA 2GO7A 2FJ6A 1PK1B 4Q43A 4YMOA 5G5GA 2W54A 1RPLA 4NM1A 4NV0A 4RNNA 4XQ8A 2IOHA 1ZETA 3ISBA 2JH1A 1DGJA 2FI1A 1FO4A 3GU3A 3N7RC 4J9RA 3M9OB 4RQNA 2RQ5A 4DFKA 4IR9A 2KNJA 5KFYA 3PMLA 4O3SA 3JPTA 2OM6A 1JN3A 2HW3A 2QB1A 2YMQA 5JTIA 5KFWA 1Z3EB 1RG6A 4J9SA 5DKWA 5AKZA 1T3QA 2PFOA 1L5UA 4FE3A 3C28A 2K89A 2HHVA 5DBCA 1SZPA 2JEFA 3QNMA 2V4RA 1HJPA 2B6GA 2K4IA 3LDAA 2HHTA 4P4MA 1TE2A 8ICCA 4J9PA 2FLLA 1JUDA 2R8JA 4FZLA 5L9XA 4R8UA 7ICMA 2PI4A 1VJ5A 5KL1B 1F5SA 3WK5A 2F77X 2I1QA 1N5XA 4JV1A 2F8KA 1SL2A 4RUCA 4RNOA 4PZOA 3SMVA 4DQSA 3HPOA 1LKYA 3QYPA 1Q8KA 4DL5A 5L1JA 1B0XA 5CHGA 3DDHA 1QQ7A 2BQ3A 1X9WA 5KFBA 4I2EA 4TUSA 5DQHA 3SAGA 3IDWA 7ICGA 4TURA 3BS5A 5J2EA 5B66U 3NGDA 2IBKA 2R8KA 3RB6A 5AIAA 4FO6A 1L3UA 4YXJA 4RQ8A 1CI4A 4QW8A 4F5RA 1U4BA 1C20A 2R8GA 3AQFA 2KFNA 2I6XA 1EXNA 5CB1A 3OGUA 5ALXA 2HMXA 2I5HA 2OXOA 5AK5A 4CGZA 5KT6A 2LMRA 2JEIA 1BNOA 3OJUA 5DG8A 3IP4B 1U9LA 2V4QA 1J2MA 3RB3A 2IOFK 2BCSA 3B0XA 1SXDA 4IQUA 2JEJA 1IIPA 5AKIA 1S9FA 5IIKA 4J9LA 5IIMA 5HHHA 4PZNA 4U6PA 1NK9A 4Y2XA 1S76D 4RPZA 1AQ6A 1XO0A 2ZIXB 1JRPA 3KHLA 4XRHA 4G9BA 5AM4A 7ICUA 1BVSA 5IIJA 3T3FA 3PX0A 2NV3A 3D2QA 3THVA 4DQQA 1PK1A 4YQWA 3SENA 3N7SC 1H38A 3BQTA 3RBEA 2OHFA 2N1RA 4RUAA 1A0PA 4US8A 2E8OA 2BCVA 2DKXA 2H3IA 4DQPA 4FBTA 4DSLA 4QIWC 3ISCA 3PR5B 1VDVA 3GZFA 5DBBA 2R8HA 2KZMA 1N48A 3EUB2 5KFRA 1C7YA 3KOOA 9ICIA 2Z7JA 2XIDA 3BQ0A 2HSZA 4M6WA 4MF2A 9ICPA 5KG5A 3H40A 1SKRA 1SZHA 3F2DA 1NKEA 1QQ5A 1Q3UA 4UB2A 4Y2UA 4F8RA 3ZDAA 5CR0A 1JMSA 3FYHA 4BX9C 3T79A 1N5WA 4EYIB 5KFLA 2CRXA 1SV0A 4P4PA 1D8LA 3C1ZA 3G6YA 5BPCA 5HR7A 1Y88A 3M7DA 4UQGA 3C2LA 5KFQA 3ZDCA 1A76A 4RQ6A 1ZQHA 4C0ZA 3SD7A 4F5NA 4PH5A 3WK7A 4P0PA 4F2SA 4NLZA 3H7IA 3ZDEA 3F2BA 3L5KA 1S97A 5CEHA 1F44A 4KX3A 5AI9A 5EWFA 3HKZC 2XC9A 5J8YA 3Q8SB 1UQVA 4RQ7A 1LVHA 4DSKA 3K1ZA 1S77D 3SZ2A 3BS7A 2NO4A 2R18A 4QZGA 2YMMA 1B4FA 2LYHA 2D8CA 4F50A 2G5IB 2C28A 4QZFA 2W9BA 8ICHA 5DLFA 3VCBA 5KNIA 1NJZA 2ZXIA 5ALOA 3S6JA 2FLPA 8ICLA 4ZH4A 1KFSA 3QEAZ 2VA2A 5JU5A 3LWLA 1A77A 7ICJA 7ICEA 4IQVA 1ZQIA 3UMBA 5DB8A 2DBYA 3UXPA 4Z6CA 2WAQC 9ICTA 4F4KA 2J6SA 5AK3A 4UB6U 4KLHA 1NNLA 2NRTA 2F76X 5ALQA 3CP8A 7ICKA 1ECWA 2EQYA 4TUPA 3BS5B 2W7OA 4Y2VA 2HCFA 1X6JA 2ZUBA 2RRDA 4QWBA 4R65A 5EWEA 1TAQA 3M6ZA 3JPRA 1S10A 4MHVA 1KL9A 4OJ5A 4O5EA 4X5VA 1XNSA 1ZRNA 1SGGA 4ELTA 2AH5A 4DLEA 1J97A 3HW8A 1ZRMA 1IM4A 2EAOA 5B5EU 1ZQTA 8ICTA 2KICA 4QZDA 1CRXA 2A19A 4CRXA 2OH2A 3MABA 1RYRA 1N61A 4YD2A 4C8LA 4JMUA 1ED1A 3KTQA 4F4ZA 4P0PB 2D6FC 2OYYA 3C1YA 4DWIA 5L1KA 5JRTA 1ZQRA 5H2FU 3WU2U 4DFMA 3EPGA 5TISU 3FAHA 3QZ8A 5AM3A 4IL6U 4EBCA 1BPYA 2ASLA 2Y9UA 4J9MA 4ELVA 1X9SA 1TK0A 9ICSA 3NRZA 2W43A 3ZD8A 4DS5A 2NRWA 5HMLA 3ORYA 2AHOB 2BQRA 3QEBZ 2R8IA 2HHSA 2DKZA 2Y0SC 3RJGA 3RB4A 5KFEA 8ICEA 2FMSA 1X6IA 1UHUA 1SKWA 2ZIWA 8ICPA 1O03A 4RU9A 2GH1A 4QZAA 1SWWA 8ICBA 2JZBA 1S0NA 4CF3A 3PR4A 2Y1JA 5KFNA 2KHVA 4M9JA 2J6TA 4KLGA 2PI5A 4O9MA 3UMCA 4QWEA 4I2FA 5KFPA 3UQ2A 3HP6A 5KT3A 1Z4OA 2A1JB 9ICQA 2Y1IA 1SIJA 3QUBA 4DQIA 2HI0A 3QUCA 3AEVA 8ICAA 2YMPA 4P2HA 4CF4A 5ALRA 4M9LA 1ZQKA 4US9A 1SXEA 2W7PA 2D3DA 5C5JA 4ICAA 2KG5A 2ISPA 4KLIA 2LI6A 4GC7A 9ICRA 4MFCA 1ZQYA 4KLUA 1XS9D 4FBUA 5J2CA 2BZFA 3Q8KA 1N60A 2GWSA 4R66A 2H3VA 3PVXA 2K8BB 1UT5A 2XCPA 2FPKA 1N2XA 2XCAA 4YN4A 5HNKA 3MC1A 3SV4A 1L8OA 2WTFA 3MFIA 3PV8A 1ZQMA 4YG2A 2L5YA 2V9WA 5KFFA 7ICQA 3KZXA 2KKPA 2AGPA 2KP7A 5J2HA 4B9LA 5DBAA 3E58A 1RXWA 4QW9A 1WWVA 3JPQA 3NVZA 4Y2SA 4YMMA 3TQ1A 8ICGA 4RQ5A 8ICZA 2KSOB 3H8SA 4Q45A 2K4EA 4AYBC 3MDAA 4NY8A 2F44A 3PZPA 2Y0SF 4I27A 8ICNA 5CRXA 5ALLA 4PGQA 3IV6A 2UVVA 5DB9A 4P4OA 4B9TA 2P6RA 2AGOA 5ALDA 4DO9A 5KFMA 4DL3A 4QZCA 3A0HU 1XSPA 1NOMA 1P7DA 4GXKA 3SYZA 4R63A 3V6KA 1B43A 5DDMA 3MGIA 4Q8FA 2F2AB 5AI0A 3SR6A 7ICHA 2KSOA 4HYKA 1FIQA 5AI8A 3I76A 2DQNB 4PL1A 2F1JA 2KIWA 1BGXT 1SB3C 4C4SA 2ZUCA 1TV9A 2YN4A 2BR0A 1A6SA 2IHMA 4Y2TA 4EYHB 1ZJMA 2J6UA 2DFLA 3DEEA 3T5KA 1TKDA 4DSEA 3O0FA 1Z00B 3ED5A 3L3FX 2W8KA 4QWDA 3PW2A 2BDPA 3OSPA 1KFDA 4DFDA 1RYUA 7ICVA 2OCEA 4F91B 3WK4A 1T94A 9ICNA 1ZQVA 5KG6A 2WF5A 4ECYA 3F53A 8ICMA 4ECQA 2OWOA 4FS1A 1L3TA 1B22A 3M9MB 5EOZA 4QWAA 4MFAA 4EX6A 4F4YA 2BCQA 3QE9Y 3RH6A 4CF5A 5AKEA 2P6UA 3WKEA 2HOFA 1ZQDA 4ECWA 3HKZF 3R9KA 3I28A 1FEZA 2ZIVB 5KAFU 4EZ9A 4UATA 7ICFA 4UAUA 4QZHA 2PFNA 1D8YA 2DWQA 2EAPA 3QXGA 3N28A 2WHEA 2HVIA 3WK9A 5JUMA 2WFAA 3EW9A 4HAIA 5ALWA 3SI8A 2O6KA 1ZQCA 3MBYA 3PW5A 3J81j 3EWAA 3RRHA 5HMMA 1Z19A 5KFOA 1SL1A 2BCUA 8ICYA 4NL9C 3EPIA 2H3QA 2K8AA 2Q4TA 4ED1A 5EE1A 3MR3A 1ZQPA 1NK8A 4UB5A 5J0RA 4ZOHC 2UVUA 4JK1A 5ALJA 3ETRA 1NK4A 3UXOA 5K4LA 2AJQA 8ICKA 2NRZA 4MF8A 2AXTU 4F4WA 4F92B 2HVHA 1ZQLA 3K1RB 1Q46A 2KE7A 9ICKA 2K4PA 5J0TA 4B9VA 4YD1A 2W11A 3MR2A 3TACB 1NI3A 4B6JA 4UB1A 2WAQF 4PGXA 9ICVA 1S0OA 3PW7A 2W9MA 5AKYA 5HHIA 8ICOA 2PFQA 4R64A 3AU2A 5KFXA 5J0PA 1ZQEA 3KHHA 5TZVA 2ZJ5A 3ALRA 3TKAA 1RDFA 4NLGA 4XA5A 2XY5A 1ZYQA 3RBDA 3HT3A 4ECZA 1MQ2A 4NLKA 5CP2A 1L7PA 2MA1A 1FFUA 1X40A 3NTUA 5DGBA 4DCCA 4ECXA 1BNPA 1COOA 2YQEA 2QKQA 1RZTA 3H0LB 5AM5A 1NJXA 4C8KA 4G3IA 3UM9A 1IXRA 3UXNA 2W9BB 2CPRA 2QB0B 4UB4A 2H5XA 5D46A 3D2SA 2QARA 4ECVA 1KN5A 1SV4A 3Q8RB 1ZQQA 2BGWA 5KFTA 4Z6FA 1D9FA 2JHDA 5IILA 5KFAA 2OEHA 3AL0B 3NVVA 4YR3A 1MC8A 4BDPA 1Q3VA 3QU5A 5IIIA 1AROP 4FFDA 1T4GA 3BZCA 2NRVA 3AQEA 1U49A 4EBEA 4I2BA 9ICAA 1U45A 4IR1A 3E0FA 1K5OA 2FMPA 5ALIA 2F8LA 3H0RB 3CRXA 2VIXA 4RQ4A 3H4DA 3WKCA 4O3QA 4MEYA 9ICXA 1DK2A 1JX4A 1ZQ1C 4KLQA 3AMZA 5T14A 3PSPA 2EANA 5AKKA 4O3RA 2KN7A 2FDRA 3CYMA 4ACOA 4DSIA 3LK9A 4M6WB 3BQ2A 4O5KA 1ZQSA 5AK6A 1ZQFA 1V38A 1TAMA 5KFUA 4ED0A 3KKAC 1K1SA 4JUZA 2WF7A 5AKGA 1XU4A 3V6JA 2HHQA 2RP5A 1XSNA 2KFZA 1WCLA 5ALEA 4E0DA 3C2KA 4RQ3A 2ZIVA 1GO3F 3PX4A 3PY8A 1NKCA 1S0VA 1PVQA 9ICEA 1T3NA 4F72A 4PHDA 2E8MA 3MR5A 4YR2A 1URJA 5J0QA 3PSTA 1BPZA 4Q8EA 4RQMA 4IRKA 1JI7A 5KT2A 2LM1A 2DUYA 4PPXA 2P66A 2M9NA 2JXJA 4J9QA 2NRXA 5AI5A 2W9CB 3IHQB 3RRGA 5KFCA 2HBKA 2PMZC 2G08A 2E8NA 2H3ZA 3BQ7A 4RZRA 4QZ8A 1HEKA 2JEGA 4IC9A 1KTQA 1Z1VA 2MRLA 2MSNA 2DF4B 3OPXA 1MQ3A 3V6HA 8ICWA 1D9DA 2MU2A 4PHEA 1O08A 1ZXIA 2W9CA 3M1YA 1XO1A 1HUZA 1RXVA 5L1LA 2EZYA 5ALHA 2LM4A 3MGHA 2XGPA 3FM9A 4EX7A 3C2MA 2ZIUB 8ICUA 1ZQZA 3KHRA 4FZNA 8ICIA 3GIJA 3JPNA 4Z6EA 5ALZA 9ICWA 1IV8A 8ICQA 3BQ1A 2P35A 3WK8A 3TFRA 4GC6A 2VA3A 1SWVA 2E1FA 1TFRA 2IMWP 1ZQBA 2BPFA 1ZD3A 7ICSA 2MAXA 4I2DA 1PUZA 2AQ4A 1JXLA 4RT2A 5BOLA 3LWMA 5ALKA 4F4XA 3BDPA 2FMQA 3QZ7A 2YMLA 3I1YA 1LKYB 4UB8U 5KG4A 2F1HA 2JR5A 2HBJA 3RH4A 3IG5A 4KLSA 7ICPA 4IRCA 8ICFA 4BWJA 4UASA 2HHWA 3V72A 2K8CB 1F0MA 1VLBA 4QWCA 1N62A 1NK5A 2KJ8A 2RHFA 1KLNA 2ZIWB 4O3MA 5FP0A 4LJXA 4ED2A 2KOBA 1MN8A 3M8SA 1KW4A 4QZ9A 3RAQA 3HILA 3QU2A 4YXMA 3GV8B 2IA6A 2ZTCA 4ECSA 4USAA 3RB0A 4EEKA 5DQIA 5J2DA 9ICGA 2ALZA 3KHGA 1ZQJA 4GFJA 3MR6A 5G5HA 2DL0A 3N97B 3NASA 4KLTA 2ZG6A 3AM9A 5DGAA 3SEIA 3UQ0A 4KLEA 1N56A 4Z6DA 5KFZA 4Y2RA 3ETLA 4NLNA 3SQIA 4F3OA 5KT7A 5CA7A 5KFDA 7ICLA 3QU9A 3KD3A 9ICHA 5A0LA 5AKJA 3D2NA 5IIOA 4ELUA 4DOBA 5KFKA 2E1EA 5EE9A 1BPEA 1NZBA 3WKDA 3CW2C 5AI6A 3WKBA 4C8MA 4EENA 4M04A 3RH5A 3KZIU 1ZQAA 4DS4A 2ATLA 4FZMA 3DV9A 3RJHA 2ZJ8A 5AK4A 4C8OA 1COKA 5J0SA 5EE0A 9ICJA 1RQNA 2KJ5A 2LPEA 4I2CA 4UW9A 4WJ3B 2DPIA 3SAHA 4PL2A 5ALMA 3V7JA 3PW4A 9ICBA 4OJLA 4QZBA 4P0QA 5DB7A 4ECUA 2G5HB 4YVZA 4BUGA 5ALFA 1RYSA 4DFJA 2KKVA 2K4HA 2UVRA 7ICNA 2PKEA 2MUTA 3IM1A 2HHUA 2LYAA 5AHXA 4YP3A 8ICRA 2B0CA 4O3NA 2HBMA 3HX0A 3GDXA 2I9GA 4RQ0A 4Q44A 2QLTA 3RJEA 3M9NB 3RR7A 4CCHA 5ALSA 2C2EA 2AQ0A 4GXJA 4KLLA 1QTMA 1TVAA 3PO4A 2KVCA 1DRGA 2IHNA 4BXOB 4MFFA 2G09A 5KTQA 4P0QB 1WUDA 4NLCA 1SKSA 3A0BU 5GTHU 1YZ7A 3H8JA 5C0YA 4EBDA 3HRDD 3GIKA 3QU7A 4KN7A 4J9OA 4JWNA 3Q8MA 3QX7A 4OJ6A 1PVRA 4BXOA 1PZNA 5AM1A 3GV5B 3NS1A 1BPXA 1HIWA 4Y2JA 1QSLA 5J2AA 4DSFA 3PX6A 1BPDA 3TADA 1K1QA 4TQSA 4JWMA 5KG1A 2KJ9A 5ALNA 4ED3A 3G6VA 5KFGA 3E2EA 5D49A 2BDUA 1T8EA 1MA7A 4UBCA 4NM2A 2W04A 4BJQA 5AKLA 5KFVA 4I2JA 7ICOA 4DOCA 1J2NA 2JMGA 1KEJA 3RR8A 2XICA 2W9AA 7ICRA 4J9NA 3U26A 4GXIA 1TK5A 1OUQA 2Q0ZX 2ZXHA 5ALVA 4C7ZA 3SV3A 2VJ4A 1XWLA 5KG0A 4CNQA 1OXJA 4A8EA 3HJEA 5KG7A 5AM2A 3WK6A 3NUQA 5ALTA 3RJKA 2ASDA 4NJ8A 3OHAA 2RDIA 3N7PD 3GQCA 1JIHA 3TANA 4DL2A 4M9GA 4RPYA 3QUTA 4KLDA 5J2JA 4PJ0U 2WF8A 3GV7B 3T5LA 3V7LA 5HR6A 4DL6A 3C5GA 1YZ6A 4RT3A 4B9NA 3L4PA 4DL7A 3ZDDA 1UPHA 1UA0A 1KBUA 4NXZA 5E79U 3ZI4A 9ICFA 4NWIA 4O5CA 5J2FA 1MSWD 3T5JA 4LZDA 2KEYA 3RJJA 4U7CA 2VANA 4LVSA 2XI9A 1V97A 2KHQA 2C2DA 3C5FA 4FS2A 1UCVA 4QZEA 2KTQA 4OCZA 1QQ6A 1L7OA 3LYSA 1JROA 4KLFA 5J2BA 4EZ6A 4KITB 1XC9A 4QIWF 2KZZA 2UVWA 1QH9A 1ZQWA 1X66A 4ED6A 4DL4A 1ZD5A 3GIIA 2XVTA 3OTQA 4DFPA 2ZIXA 4KX5A 4RPXA 3H0MB 1ZQNA 2QARB 5J2GA 5J0UA 1X2IA 5F3XB 5J0YA 4UBBA 4Y2QA 1TK8A 4B9UA 2B21A 4PHAA 4C80A 1WG8A 1NJYA 1ZOLA 4CE6A 2KVSA 3ONNA 4DLGA 3PMNA 4ED7A 1JALA 1FFVA 1U48A 1KFTA 3JPSA 3MFHA 4B9MA 1NK6A 3H8MA 4OD0A 1ZD4A 3TADC 1WYGA 4YCXA 3F5EA 2BHNA 1L8LA 5GTIU 4BGDA 1SV0C 2HDOA 2KMDA 1IG6A 1ZQXA 5ALUA 4UAWA 3TFSA 5ALGA 3CNHA 2FE9A 3FDSA 3MGVA 2A3VA 4M47A 8ICXA 1KRPA 2EZXA 2HOQA 3N4MB 4RNMA 2W55A 1NK0A 7ICIA 2FLNA 5KT5A 2KK0A 3G6XA 2E8PA 5DG7A 2ZIUA 3C23A 1QCKA 2LHTA 5J2IA 3T5HA 4C7YA 4F71A 4I28A 3C21A 2PFPA 3IRUA 4I2AA 1L7NA 3QU4A 1KSPA 3Q8LA 5AICA 3VC8A 3TARA 5CJ7A 4I2GA 5J0XA 3NVWA 1S0MA 3AU6A 1NK7A 2W3SA 3JPOA 4XUSA 2BCRA 1OW5A 2DGZA 2AGQA 2C2RA 1RM6C 3UMGA 9ICMA 2EH9A 3RJIA 1NZPA 2QB0A 3ZDBA 3TAQA 1DK3A 3NVYA 4DOAA 4QJFB 2JGAA 3BJYA 4M2YA 2FPMA 1QSYA 4KLJA
chains in the Genus database with same CATH topology
3M6ZA 3D2SA 2G0AA 3AQFA 4NV0A 4A8EA 3ONNA 2CRXA 2F2AB 3ICXA 2KJ5A 2HMXA 4OJ5A 2OXOA 4CGZA 2JH1A 1URJA 2JHDA 3NUQA 1Z1BA 5HR7A 4WJ3B 3M7DA 3PSTA 4QNLA 3SAHA 1Z19A 2GOLA 3PSIA 3N7PD 4PL2A 3T79A 3AL0B 3GU3A 3N7RC 4OJLA 2HBJA 4P0QA 2W7PA 3IG5A 2DQNB 2H3QA 2HBLA 2K8AA 4ICAA 4PL1A 3CRXA 2KIWA 2W03A 2Q4TA 4C0ZA 1Q3VA 4P0PA 3IP4B 2G5HB 2WB1C 4BUGA 3C29A 2KICA 3F5EA 4OO1J 3F2BA 1A6SA 2K8CB 3AQEA 1CRXA 5HR6A 2KKVA 2KNJA 2G06A 2K4HA 4KX3A 1F44A 2OH2A 4CRXA 2OM6A 3IN5A 3HKZC 3DEEA 1IIPA 4JMUA 1ED1A 2KJ8A 2LYAA 2RHFA 3E0FA 2ZIWB 4O3MA 4P0PB 3MGVA 2D6FC 5KL8B 1UPHA 2OYYA 2A3VA 2H3VA 2HBKA 2KOBA 3O0FA 2F8LA 2PMZC 2G08A 3H0RB 4U6PA 1PVPA 3K1ZA 2HBMA 2HOQA 3L3FX 2VIXA 4FE3A 2K89A 3RF9A 2K8BB 3C28A 2LYBA 2CN1A 1XO0A 2ZIXB 2KD1A 3RFAA 4NWIA 4CDGA 2H3ZA 2R18A 1XNSA 1HEKA 3NRWA 2KEYA 4IC9A 2KV2A 2K4IA 2MRLA 4U7CA 1KBUA 2XI9A 2ZIUA 2E5SA 2KVCA 4NLBA 2KHQA 2DF4B 2G5IB 2H3FA 3LVVA 2LHTA 1DRGA 3OPXA 2WAQF 3LVWA 2LBOA 1L6NA 2G09A 2G07A 2PMZF 1ZQ1C 4FZLA 1YT3A 3VCBA 5T14A 4GFJA 4P0QB 1WUDA 2NV3A 3PSPA 2VKQA 4KMOB 4NLCA 3D2QA 3KZXA 2KKPA 1T94A 4OJPA 2ZXIA 3CYMA 4ACOA 5C0YA 3M6KA 5KL1B 2ZG6A 3N7SC 3LYSA 3F53A 2JH7A 2HOIA 2F77X 2N1RA 3ALRA 1TAMA 3VC8A 1A0PA 2YB4A 4QIWF 2Y0SC 4OJ6A 1PVRA 2H3IA 3SMVA 2ZIUB 4QIWC 3SQIA 1HIWA 4AYBF 3GZFA 3KFUF 2VJ5A 3PSFA 2WB1F 4FZNA 2K4EA 2ZIWA 2HOFA 4AYBC 5A0LA 3SAFA 3PZPA 2KJ9A 3D2NA 3HKZF 2Y0SF 2GH1A 2E1EA 2RP5A 2MA1A 4OJOA 2DGZA 1D8BA 2BDUA 2Z7JA 2ZIVB 2XVTA 2YX8A 1NZBA 2ZIXA 2WAQC 4KX5A 5CRXA 1MA7A 2XIDA 3F5AA 3SAGA 3F2CA 2W04A 4BJQA 1SZHA 2LKYA 2M0NA 3H0LB 3IG8A 2KHVA 3H0MB 3F2DA 2ZIVA 2E1FA 1Q3UA 1GO3F 2JMGA 2F76X 4QJFB 2XICA 3CP8A 2CPRA 1ECWA 2JGAA 1PVQA 1OUQA 4FZMA 2W7OA 2ZXHA 1P7DA 2VJ4A 4BX9C 2RRDA 2YB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  2K4H A;  2NV3 A;  4JMU A;  2LYA A;  1ED1 A;  2HMX A;  1UPH A;  2H3V A;  2GOL A;  2N1R A;  2LYB A;  1TAM A;  2H3Z A;  2H3Q A;  4ICA A;  1HEK A;  2JMG A;  2H3I A;  4IC9 A;  1ECW A;  2K4I A;  1HIW A;  2H3F A;  2K4E A;  1A6S A; 
#chains in the Genus database with same CATH topology
 2XGQ A;  3RJF A;  1NJW A;  4TUQ A;  1X9X A;  3Q8Q B;  3ICX A;  1N63 A;  4C8N A;  1RQL A;  4PHP A;  3PNC A;  2BPC A;  1M6Y A;  5KG2 A;  4UAY A;  5J29 A;  3D6J A;  7ICT A;  4M9N A;  2W8L A;  2HBL A;  4C4R A;  3AN1 A;  5AKH A;  4B9S A;  4JV0 A;  2PXI A;  4GLX A;  3TI0 A;  9ICC A;  3UPQ A;  2WF6 A;  3EYZ A;  5CWR A;  4F2R A;  1PVP A;  2HHX A;  1CEZ A;  3RF9 A;  2CN1 A;  1L3S A;  2MUT B;  2FPL A;  3NRW A;  3WKA A;  2ODG A;  5HP4 A;  4UAR A;  1UA1 A;  2H3F A;  4F93 B;  4DF4 A;  5ALY A;  2VKQ A;  4KN4 A;  5DDY A;  2HOI A;  2XY7 A;  5J0O A;  1ZQO A;  2YB4 A;  5AIB A;  4I29 A;  9ICL A;  1ZJN A;  4UAV A;  4J9K A;  2BKE A;  2XY6 A;  1KKX A;  2AU0 A;  4YMN A;  2VJ5 A;  1ZD2 P;  4NL9 A;  2NO5 A;  5KFS A;  1D8B A;  4ECT A;  1TAU A;  4Y2P A;  2Y9T A;  1PK3 A;  1BPB A;  5KFI A;  2KIV A;  2E3T A;  3OJS A;  3RAX A;  3IG8 A;  2YY6 A;  2JZB B;  5KG3 A;  5DG9 A;  3B0Y A;  3JPP A;  2JV3 A;  5AI4 A;  5AKX A;  5ALP A;  3PW0 A;  2YB1 A;  1V9P A;  5EE3 A;  5L1M A;  4IQW A;  4F5O A;  2ASJ A;  4KMU A;  4K4I A;  2RLT A;  4UB3 A;  1Z1B A;  4QNL A;  5L1I A;  5DLG A;  3PSI A;  2NYV A;  4DF8 A;  5EWG A;  3GFK B;  1ZQG A;  2EAM A;  2W03 A;  2F3N A;  3TAP A;  2WB1 C;  1XSL A;  4O0I A;  3PO5 A;  2G06 A;  4EEY A;  3IN5 A;  4DEZ A;  4LZG A;  1CUK A;  1T7P A;  2EZZ A;  4Y2Y A;  1HUO A;  2EDU A;  2LYB A;  4PGY A;  2KD1 A;  3RFA A;  5J0W A;  4DSJ A;  2YTU A;  2E5S A;  5AM0 A;  4JV2 A;  4NLB A;  4F5Q A;  2A1J A;  2LBO A;  1L6N A;  1L7M A;  2PMZ F;  1UT8 A;  3V7K A;  5DB6 A;  4KMO B;  4OJP A;  1QLN A;  3M6K A;  1U47 A;  2A1A A;  2JH7 A;  8ICJ A;  1S5L U;  4I2H A;  1QSS A;  2ZJA A;  1X9M A;  2WF9 A;  3EZ5 A;  2BQU A;  4AYB F;  3KFU F;  1S8O A;  3OHB A;  3GIM A;  2ES6 A;  2WB1 F;  1SL0 A;  4M0A A;  5F9L A;  1WCN A;  4J03 A;  1Z4N A;  3RTV A;  2YX8 A;  4F5P A;  4RQ2 A;  5F9N A;  2ZTD A;  3F2C A;  1V85 A;  3KBB A;  2LKY A;  2M0N A;  1ZQU A;  2BPG A;  2RDJ A;  3ISD A;  4IS7 A;  3QUQ A;  2JRZ A;  2ZTE A;  2W3R A;  5KFH A;  4K4G A;  3Q8P B;  4QZI A;  4JB3 A;  2IOF A;  2G0A A;  3BZK A;  4TQR A;  1WWU A;  4DQR A;  4ECR A;  1KDH A;  2GOL A;  1DOQ A;  1NKB A;  2VA8 A;  4AP9 A;  4IQT A;  3B9J A;  1JXE A;  8ICS A;  4KTQ A;  4KLM A;  3C29 A;  4IRD A;  5D4B A;  4OO1 J;  4EEL A;  5J8Y C;  2GLE A;  3OSN A;  3H4B A;  3K75 D;  4YFK A;  3KKA A;  5KL8 B;  5BOM A;  4M9H A;  2K60 A;  3MDC A;  1LV5 A;  2ZUD A;  3GIL A;  9ICO A;  1DGS A;  4CDG A;  4R8U B;  4ED8 A;  2C22 A;  4KLO A;  2KV2 A;  1L3V A;  3LVV A;  5DQG A;  3LVW A;  2G07 A;  4UAZ A;  3FC4 A;  1YT3 A;  5KFJ A;  1Z00 A;  5KAI U;  2ESE A;  2XO7 A;  5KT4 A;  3HWT A;  4O3P A;  3AUO A;  2DPJ A;  2CXY A;  3M8R A;  4MEX A;  4GIB A;  5J2K A;  1LB2 B;  2KZ3 A;  1X42 A;  3PSF A;  4C4T A;  4I2I A;  8ICV A;  3SAF A;  5IIN A;  4OJO A;  4O3O A;  3F5A A;  4K4H A;  3ZD9 A;  3H8W A;  4YR0 A;  2F1I A;  4BWM A;  3K4G A;  1DXS A;  4RQ1 A;  9ICU A;  2ISO A;  1KQQ A;  2GO7 A;  2FJ6 A;  1PK1 B;  4Q43 A;  4YMO A;  5G5G A;  2W54 A;  1RPL A;  4NM1 A;  4NV0 A;  4RNN A;  4XQ8 A;  2IOH A;  1ZET A;  3ISB A;  2JH1 A;  1DGJ A;  2FI1 A;  1FO4 A;  3GU3 A;  3N7R C;  4J9R A;  3M9O B;  4RQN A;  2RQ5 A;  4DFK A;  4IR9 A;  2KNJ A;  5KFY A;  3PML A;  4O3S A;  3JPT A;  2OM6 A;  1JN3 A;  2HW3 A;  2QB1 A;  2YMQ A;  5JTI A;  5KFW A;  1Z3E B;  1RG6 A;  4J9S A;  5DKW A;  5AKZ A;  1T3Q A;  2PFO A;  1L5U A;  4FE3 A;  3C28 A;  2K89 A;  2HHV A;  5DBC A;  1SZP A;  2JEF A;  3QNM A;  2V4R A;  1HJP A;  2B6G A;  2K4I A;  3LDA A;  2HHT A;  4P4M A;  1TE2 A;  8ICC A;  4J9P A;  2FLL A;  1JUD A;  2R8J A;  4FZL A;  5L9X A;  4R8U A;  7ICM A;  2PI4 A;  1VJ5 A;  5KL1 B;  1F5S A;  3WK5 A;  2F77 X;  2I1Q A;  1N5X A;  4JV1 A;  2F8K A;  1SL2 A;  4RUC A;  4RNO A;  4PZO A;  3SMV A;  4DQS A;  3HPO A;  1LKY A;  3QYP A;  1Q8K A;  4DL5 A;  5L1J A;  1B0X A;  5CHG A;  3DDH A;  1QQ7 A;  2BQ3 A;  1X9W A;  5KFB A;  4I2E A;  4TUS A;  5DQH A;  3SAG A;  3IDW A;  7ICG A;  4TUR A;  3BS5 A;  5J2E A;  5B66 U;  3NGD A;  2IBK A;  2R8K A;  3RB6 A;  5AIA A;  4FO6 A;  1L3U A;  4YXJ A;  4RQ8 A;  1CI4 A;  4QW8 A;  4F5R A;  1U4B A;  1C20 A;  2R8G A;  3AQF A;  2KFN A;  2I6X A;  1EXN A;  5CB1 A;  3OGU A;  5ALX A;  2HMX A;  2I5H A;  2OXO A;  5AK5 A;  4CGZ A;  5KT6 A;  2LMR A;  2JEI A;  1BNO A;  3OJU A;  5DG8 A;  3IP4 B;  1U9L A;  2V4Q A;  1J2M A;  3RB3 A;  2IOF K;  2BCS A;  3B0X A;  1SXD A;  4IQU A;  2JEJ A;  1IIP A;  5AKI A;  1S9F A;  5IIK A;  4J9L A;  5IIM A;  5HHH A;  4PZN A;  4U6P A;  1NK9 A;  4Y2X A;  1S76 D;  4RPZ A;  1AQ6 A;  1XO0 A;  2ZIX B;  1JRP A;  3KHL A;  4XRH A;  4G9B A;  5AM4 A;  7ICU A;  1BVS A;  5IIJ A;  3T3F A;  3PX0 A;  2NV3 A;  3D2Q A;  3THV A;  4DQQ A;  1PK1 A;  4YQW A;  3SEN A;  3N7S C;  1H38 A;  3BQT A;  3RBE A;  2OHF A;  2N1R A;  4RUA A;  1A0P A;  4US8 A;  2E8O A;  2BCV A;  2DKX A;  2H3I A;  4DQP A;  4FBT A;  4DSL A;  4QIW C;  3ISC A;  3PR5 B;  1VDV A;  3GZF A;  5DBB A;  2R8H A;  2KZM A;  1N48 A;  3EUB 2;  5KFR A;  1C7Y A;  3KOO A;  9ICI A;  2Z7J A;  2XID A;  3BQ0 A;  2HSZ A;  4M6W A;  4MF2 A;  9ICP A;  5KG5 A;  3H40 A;  1SKR A;  1SZH A;  3F2D A;  1NKE A;  1QQ5 A;  1Q3U A;  4UB2 A;  4Y2U A;  4F8R A;  3ZDA A;  5CR0 A;  1JMS A;  3FYH A;  4BX9 C;  3T79 A;  1N5W A;  4EYI B;  5KFL A;  2CRX A;  1SV0 A;  4P4P A;  1D8L A;  3C1Z A;  3G6Y A;  5BPC A;  5HR7 A;  1Y88 A;  3M7D A;  4UQG A;  3C2L A;  5KFQ A;  3ZDC A;  1A76 A;  4RQ6 A;  1ZQH A;  4C0Z A;  3SD7 A;  4F5N A;  4PH5 A;  3WK7 A;  4P0P A;  4F2S A;  4NLZ A;  3H7I A;  3ZDE A;  3F2B A;  3L5K A;  1S97 A;  5CEH A;  1F44 A;  4KX3 A;  5AI9 A;  5EWF A;  3HKZ C;  2XC9 A;  5J8Y A;  3Q8S B;  1UQV A;  4RQ7 A;  1LVH A;  4DSK A;  3K1Z A;  1S77 D;  3SZ2 A;  3BS7 A;  2NO4 A;  2R18 A;  4QZG A;  2YMM A;  1B4F A;  2LYH A;  2D8C A;  4F50 A;  2G5I B;  2C28 A;  4QZF A;  2W9B A;  8ICH A;  5DLF A;  3VCB A;  5KNI A;  1NJZ A;  2ZXI A;  5ALO A;  3S6J A;  2FLP A;  8ICL A;  4ZH4 A;  1KFS A;  3QEA Z;  2VA2 A;  5JU5 A;  3LWL A;  1A77 A;  7ICJ A;  7ICE A;  4IQV A;  1ZQI A;  3UMB A;  5DB8 A;  2DBY A;  3UXP A;  4Z6C A;  2WAQ C;  9ICT A;  4F4K A;  2J6S A;  5AK3 A;  4UB6 U;  4KLH A;  1NNL A;  2NRT A;  2F76 X;  5ALQ A;  3CP8 A;  7ICK A;  1ECW A;  2EQY A;  4TUP A;  3BS5 B;  2W7O A;  4Y2V A;  2HCF A;  1X6J A;  2ZUB A;  2RRD A;  4QWB A;  4R65 A;  5EWE A;  1TAQ A;  3M6Z A;  3JPR A;  1S10 A;  4MHV A;  1KL9 A;  4OJ5 A;  4O5E A;  4X5V A;  1XNS A;  1ZRN A;  1SGG A;  4ELT A;  2AH5 A;  4DLE A;  1J97 A;  3HW8 A;  1ZRM A;  1IM4 A;  2EAO A;  5B5E U;  1ZQT A;  8ICT A;  2KIC A;  4QZD A;  1CRX A;  2A19 A;  4CRX A;  2OH2 A;  3MAB A;  1RYR A;  1N61 A;  4YD2 A;  4C8L A;  4JMU A;  1ED1 A;  3KTQ A;  4F4Z A;  4P0P B;  2D6F C;  2OYY A;  3C1Y A;  4DWI A;  5L1K A;  5JRT A;  1ZQR A;  5H2F U;  3WU2 U;  4DFM A;  3EPG A;  5TIS U;  3FAH A;  3QZ8 A;  5AM3 A;  4IL6 U;  4EBC A;  1BPY A;  2ASL A;  2Y9U A;  4J9M A;  4ELV A;  1X9S A;  1TK0 A;  9ICS A;  3NRZ A;  2W43 A;  3ZD8 A;  4DS5 A;  2NRW A;  5HML A;  3ORY A;  2AHO B;  2BQR A;  3QEB Z;  2R8I A;  2HHS A;  2DKZ A;  2Y0S C;  3RJG A;  3RB4 A;  5KFE A;  8ICE A;  2FMS A;  1X6I A;  1UHU A;  1SKW A;  2ZIW A;  8ICP A;  1O03 A;  4RU9 A;  2GH1 A;  4QZA A;  1SWW A;  8ICB A;  2JZB A;  1S0N A;  4CF3 A;  3PR4 A;  2Y1J A;  5KFN A;  2KHV A;  4M9J A;  2J6T A;  4KLG A;  2PI5 A;  4O9M A;  3UMC A;  4QWE A;  4I2F A;  5KFP A;  3UQ2 A;  3HP6 A;  5KT3 A;  1Z4O A;  2A1J B;  9ICQ A;  2Y1I A;  1SIJ A;  3QUB A;  4DQI A;  2HI0 A;  3QUC A;  3AEV A;  8ICA A;  2YMP A;  4P2H A;  4CF4 A;  5ALR A;  4M9L A;  1ZQK A;  4US9 A;  1SXE A;  2W7P A;  2D3D A;  5C5J A;  4ICA A;  2KG5 A;  2ISP A;  4KLI A;  2LI6 A;  4GC7 A;  9ICR A;  4MFC A;  1ZQY A;  4KLU A;  1XS9 D;  4FBU A;  5J2C A;  2BZF A;  3Q8K A;  1N60 A;  2GWS A;  4R66 A;  2H3V A;  3PVX A;  2K8B B;  1UT5 A;  2XCP A;  2FPK A;  1N2X A;  2XCA A;  4YN4 A;  5HNK A;  3MC1 A;  3SV4 A;  1L8O A;  2WTF A;  3MFI A;  3PV8 A;  1ZQM A;  4YG2 A;  2L5Y A;  2V9W A;  5KFF A;  7ICQ A;  3KZX A;  2KKP A;  2AGP A;  2KP7 A;  5J2H A;  4B9L A;  5DBA A;  3E58 A;  1RXW A;  4QW9 A;  1WWV A;  3JPQ A;  3NVZ A;  4Y2S A;  4YMM A;  3TQ1 A;  8ICG A;  4RQ5 A;  8ICZ A;  2KSO B;  3H8S A;  4Q45 A;  2K4E A;  4AYB C;  3MDA A;  4NY8 A;  2F44 A;  3PZP A;  2Y0S F;  4I27 A;  8ICN A;  5CRX A;  5ALL A;  4PGQ A;  3IV6 A;  2UVV A;  5DB9 A;  4P4O A;  4B9T A;  2P6R A;  2AGO A;  5ALD A;  4DO9 A;  5KFM A;  4DL3 A;  4QZC A;  3A0H U;  1XSP A;  1NOM A;  1P7D A;  4GXK A;  3SYZ A;  4R63 A;  3V6K A;  1B43 A;  5DDM A;  3MGI A;  4Q8F A;  2F2A B;  5AI0 A;  3SR6 A;  7ICH A;  2KSO A;  4HYK A;  1FIQ A;  5AI8 A;  3I76 A;  2DQN B;  4PL1 A;  2F1J A;  2KIW A;  1BGX T;  1SB3 C;  4C4S A;  2ZUC A;  1TV9 A;  2YN4 A;  2BR0 A;  1A6S A;  2IHM A;  4Y2T A;  4EYH B;  1ZJM A;  2J6U A;  2DFL A;  3DEE A;  3T5K A;  1TKD A;  4DSE A;  3O0F A;  1Z00 B;  3ED5 A;  3L3F X;  2W8K A;  4QWD A;  3PW2 A;  2BDP A;  3OSP A;  1KFD A;  4DFD A;  1RYU A;  7ICV A;  2OCE A;  4F91 B;  3WK4 A;  1T94 A;  9ICN A;  1ZQV A;  5KG6 A;  2WF5 A;  4ECY A;  3F53 A;  8ICM A;  4ECQ A;  2OWO A;  4FS1 A;  1L3T A;  1B22 A;  3M9M B;  5EOZ A;  4QWA A;  4MFA A;  4EX6 A;  4F4Y A;  2BCQ A;  3QE9 Y;  3RH6 A;  4CF5 A;  5AKE A;  2P6U A;  3WKE A;  2HOF A;  1ZQD A;  4ECW A;  3HKZ F;  3R9K A;  3I28 A;  1FEZ A;  2ZIV B;  5KAF U;  4EZ9 A;  4UAT A;  7ICF A;  4UAU A;  4QZH A;  2PFN A;  1D8Y A;  2DWQ A;  2EAP A;  3QXG A;  3N28 A;  2WHE A;  2HVI A;  3WK9 A;  5JUM A;  2WFA A;  3EW9 A;  4HAI A;  5ALW A;  3SI8 A;  2O6K A;  1ZQC A;  3MBY A;  3PW5 A;  3J81 j;  3EWA A;  3RRH A;  5HMM A;  1Z19 A;  5KFO A;  1SL1 A;  2BCU A;  8ICY A;  4NL9 C;  3EPI A;  2H3Q A;  2K8A A;  2Q4T A;  4ED1 A;  5EE1 A;  3MR3 A;  1ZQP A;  1NK8 A;  4UB5 A;  5J0R A;  4ZOH C;  2UVU A;  4JK1 A;  5ALJ A;  3ETR A;  1NK4 A;  3UXO A;  5K4L A;  2AJQ A;  8ICK A;  2NRZ A;  4MF8 A;  2AXT U;  4F4W A;  4F92 B;  2HVH A;  1ZQL A;  3K1R B;  1Q46 A;  2KE7 A;  9ICK A;  2K4P A;  5J0T A;  4B9V A;  4YD1 A;  2W11 A;  3MR2 A;  3TAC B;  1NI3 A;  4B6J A;  4UB1 A;  2WAQ F;  4PGX A;  9ICV A;  1S0O A;  3PW7 A;  2W9M A;  5AKY A;  5HHI A;  8ICO A;  2PFQ A;  4R64 A;  3AU2 A;  5KFX A;  5J0P A;  1ZQE A;  3KHH A;  5TZV A;  2ZJ5 A;  3ALR A;  3TKA A;  1RDF A;  4NLG A;  4XA5 A;  2XY5 A;  1ZYQ A;  3RBD A;  3HT3 A;  4ECZ A;  1MQ2 A;  4NLK A;  5CP2 A;  1L7P A;  2MA1 A;  1FFU A;  1X40 A;  3NTU A;  5DGB A;  4DCC A;  4ECX A;  1BNP A;  1COO A;  2YQE A;  2QKQ A;  1RZT A;  3H0L B;  5AM5 A;  1NJX A;  4C8K A;  4G3I A;  3UM9 A;  1IXR A;  3UXN A;  2W9B B;  2CPR A;  2QB0 B;  4UB4 A;  2H5X A;  5D46 A;  3D2S A;  2QAR A;  4ECV A;  1KN5 A;  1SV4 A;  3Q8R B;  1ZQQ A;  2BGW A;  5KFT A;  4Z6F A;  1D9F A;  2JHD A;  5IIL A;  5KFA A;  2OEH A;  3AL0 B;  3NVV A;  4YR3 A;  1MC8 A;  4BDP A;  1Q3V A;  3QU5 A;  5III A;  1ARO P;  4FFD A;  1T4G A;  3BZC A;  2NRV A;  3AQE A;  1U49 A;  4EBE A;  4I2B A;  9ICA A;  1U45 A;  4IR1 A;  3E0F A;  1K5O A;  2FMP A;  5ALI A;  2F8L A;  3H0R B;  3CRX A;  2VIX A;  4RQ4 A;  3H4D A;  3WKC A;  4O3Q A;  4MEY A;  9ICX A;  1DK2 A;  1JX4 A;  1ZQ1 C;  4KLQ A;  3AMZ A;  5T14 A;  3PSP A;  2EAN A;  5AKK A;  4O3R A;  2KN7 A;  2FDR A;  3CYM A;  4ACO A;  4DSI A;  3LK9 A;  4M6W B;  3BQ2 A;  4O5K A;  1ZQS A;  5AK6 A;  1ZQF A;  1V38 A;  1TAM A;  5KFU A;  4ED0 A;  3KKA C;  1K1S A;  4JUZ A;  2WF7 A;  5AKG A;  1XU4 A;  3V6J A;  2HHQ A;  2RP5 A;  1XSN A;  2KFZ A;  1WCL A;  5ALE A;  4E0D A;  3C2K A;  4RQ3 A;  2ZIV A;  1GO3 F;  3PX4 A;  3PY8 A;  1NKC A;  1S0V A;  1PVQ A;  9ICE A;  1T3N A;  4F72 A;  4PHD A;  2E8M A;  3MR5 A;  4YR2 A;  1URJ A;  5J0Q A;  3PST A;  1BPZ A;  4Q8E A;  4RQM A;  4IRK A;  1JI7 A;  5KT2 A;  2LM1 A;  2DUY A;  4PPX A;  2P66 A;  2M9N A;  2JXJ A;  4J9Q A;  2NRX A;  5AI5 A;  2W9C B;  3IHQ B;  3RRG A;  5KFC A;  2HBK A;  2PMZ C;  2G08 A;  2E8N A;  2H3Z A;  3BQ7 A;  4RZR A;  4QZ8 A;  1HEK A;  2JEG A;  4IC9 A;  1KTQ A;  1Z1V A;  2MRL A;  2MSN A;  2DF4 B;  3OPX A;  1MQ3 A;  3V6H A;  8ICW A;  1D9D A;  2MU2 A;  4PHE A;  1O08 A;  1ZXI A;  2W9C A;  3M1Y A;  1XO1 A;  1HUZ A;  1RXV A;  5L1L A;  2EZY A;  5ALH A;  2LM4 A;  3MGH A;  2XGP A;  3FM9 A;  4EX7 A;  3C2M A;  2ZIU B;  8ICU A;  1ZQZ A;  3KHR A;  4FZN A;  8ICI A;  3GIJ A;  3JPN A;  4Z6E A;  5ALZ A;  9ICW A;  1IV8 A;  8ICQ A;  3BQ1 A;  2P35 A;  3WK8 A;  3TFR A;  4GC6 A;  2VA3 A;  1SWV A;  2E1F A;  1TFR A;  2IMW P;  1ZQB A;  2BPF A;  1ZD3 A;  7ICS A;  2MAX A;  4I2D A;  1PUZ A;  2AQ4 A;  1JXL A;  4RT2 A;  5BOL A;  3LWM A;  5ALK A;  4F4X A;  3BDP A;  2FMQ A;  3QZ7 A;  2YML A;  3I1Y A;  1LKY B;  4UB8 U;  5KG4 A;  2F1H A;  2JR5 A;  2HBJ A;  3RH4 A;  3IG5 A;  4KLS A;  7ICP A;  4IRC A;  8ICF A;  4BWJ A;  4UAS A;  2HHW A;  3V72 A;  2K8C B;  1F0M A;  1VLB A;  4QWC A;  1N62 A;  1NK5 A;  2KJ8 A;  2RHF A;  1KLN A;  2ZIW B;  4O3M A;  5FP0 A;  4LJX A;  4ED2 A;  2KOB A;  1MN8 A;  3M8S A;  1KW4 A;  4QZ9 A;  3RAQ A;  3HIL A;  3QU2 A;  4YXM A;  3GV8 B;  2IA6 A;  2ZTC A;  4ECS A;  4USA A;  3RB0 A;  4EEK A;  5DQI A;  5J2D A;  9ICG A;  2ALZ A;  3KHG A;  1ZQJ A;  4GFJ A;  3MR6 A;  5G5H A;  2DL0 A;  3N97 B;  3NAS A;  4KLT A;  2ZG6 A;  3AM9 A;  5DGA A;  3SEI A;  3UQ0 A;  4KLE A;  1N56 A;  4Z6D A;  5KFZ A;  4Y2R A;  3ETL A;  4NLN A;  3SQI A;  4F3O A;  5KT7 A;  5CA7 A;  5KFD A;  7ICL A;  3QU9 A;  3KD3 A;  9ICH A;  5A0L A;  5AKJ A;  3D2N A;  5IIO A;  4ELU A;  4DOB A;  5KFK A;  2E1E A;  5EE9 A;  1BPE A;  1NZB A;  3WKD A;  3CW2 C;  5AI6 A;  3WKB A;  4C8M A;  4EEN A;  4M04 A;  3RH5 A;  3KZI U;  1ZQA A;  4DS4 A;  2ATL A;  4FZM A;  3DV9 A;  3RJH A;  2ZJ8 A;  5AK4 A;  4C8O A;  1COK A;  5J0S A;  5EE0 A;  9ICJ A;  1RQN A;  2KJ5 A;  2LPE A;  4I2C A;  4UW9 A;  4WJ3 B;  2DPI A;  3SAH A;  4PL2 A;  5ALM A;  3V7J A;  3PW4 A;  9ICB A;  4OJL A;  4QZB A;  4P0Q A;  5DB7 A;  4ECU A;  2G5H B;  4YVZ A;  4BUG A;  5ALF A;  1RYS A;  4DFJ A;  2KKV A;  2K4H A;  2UVR A;  7ICN A;  2PKE A;  2MUT A;  3IM1 A;  2HHU A;  2LYA A;  5AHX A;  4YP3 A;  8ICR A;  2B0C A;  4O3N A;  2HBM A;  3HX0 A;  3GDX A;  2I9G A;  4RQ0 A;  4Q44 A;  2QLT A;  3RJE A;  3M9N B;  3RR7 A;  4CCH A;  5ALS A;  2C2E A;  2AQ0 A;  4GXJ A;  4KLL A;  1QTM A;  1TVA A;  3PO4 A;  2KVC A;  1DRG A;  2IHN A;  4BXO B;  4MFF A;  2G09 A;  5KTQ A;  4P0Q B;  1WUD A;  4NLC A;  1SKS A;  3A0B U;  5GTH U;  1YZ7 A;  3H8J A;  5C0Y A;  4EBD A;  3HRD D;  3GIK A;  3QU7 A;  4KN7 A;  4J9O A;  4JWN A;  3Q8M A;  3QX7 A;  4OJ6 A;  1PVR A;  4BXO A;  1PZN A;  5AM1 A;  3GV5 B;  3NS1 A;  1BPX A;  1HIW A;  4Y2J A;  1QSL A;  5J2A A;  4DSF A;  3PX6 A;  1BPD A;  3TAD A;  1K1Q A;  4TQS A;  4JWM A;  5KG1 A;  2KJ9 A;  5ALN A;  4ED3 A;  3G6V A;  5KFG A;  3E2E A;  5D49 A;  2BDU A;  1T8E A;  1MA7 A;  4UBC A;  4NM2 A;  2W04 A;  4BJQ A;  5AKL A;  5KFV A;  4I2J A;  7ICO A;  4DOC A;  1J2N A;  2JMG A;  1KEJ A;  3RR8 A;  2XIC A;  2W9A A;  7ICR A;  4J9N A;  3U26 A;  4GXI A;  1TK5 A;  1OUQ A;  2Q0Z X;  2ZXH A;  5ALV A;  4C7Z A;  3SV3 A;  2VJ4 A;  1XWL A;  5KG0 A;  4CNQ A;  1OXJ A;  4A8E A;  3HJE A;  5KG7 A;  5AM2 A;  3WK6 A;  3NUQ A;  5ALT A;  3RJK A;  2ASD A;  4NJ8 A;  3OHA A;  2RDI A;  3N7P D;  3GQC A;  1JIH A;  3TAN A;  4DL2 A;  4M9G A;  4RPY A;  3QUT A;  4KLD A;  5J2J A;  4PJ0 U;  2WF8 A;  3GV7 B;  3T5L A;  3V7L A;  5HR6 A;  4DL6 A;  3C5G A;  1YZ6 A;  4RT3 A;  4B9N A;  3L4P A;  4DL7 A;  3ZDD A;  1UPH A;  1UA0 A;  1KBU A;  4NXZ A;  5E79 U;  3ZI4 A;  9ICF A;  4NWI A;  4O5C A;  5J2F A;  1MSW D;  3T5J A;  4LZD A;  2KEY A;  3RJJ A;  4U7C A;  2VAN A;  4LVS A;  2XI9 A;  1V97 A;  2KHQ A;  2C2D A;  3C5F A;  4FS2 A;  1UCV A;  4QZE A;  2KTQ A;  4OCZ A;  1QQ6 A;  1L7O A;  3LYS A;  1JRO A;  4KLF A;  5J2B A;  4EZ6 A;  4KIT B;  1XC9 A;  4QIW F;  2KZZ A;  2UVW A;  1QH9 A;  1ZQW A;  1X66 A;  4ED6 A;  4DL4 A;  1ZD5 A;  3GII A;  2XVT A;  3OTQ A;  4DFP A;  2ZIX A;  4KX5 A;  4RPX A;  3H0M B;  1ZQN A;  2QAR B;  5J2G A;  5J0U A;  1X2I A;  5F3X B;  5J0Y A;  4UBB A;  4Y2Q A;  1TK8 A;  4B9U A;  2B21 A;  4PHA A;  4C80 A;  1WG8 A;  1NJY A;  1ZOL A;  4CE6 A;  2KVS A;  3ONN A;  4DLG A;  3PMN A;  4ED7 A;  1JAL A;  1FFV A;  1U48 A;  1KFT A;  3JPS A;  3MFH A;  4B9M A;  1NK6 A;  3H8M A;  4OD0 A;  1ZD4 A;  3TAD C;  1WYG A;  4YCX A;  3F5E A;  2BHN A;  1L8L A;  5GTI U;  4BGD A;  1SV0 C;  2HDO A;  2KMD A;  1IG6 A;  1ZQX A;  5ALU A;  4UAW A;  3TFS A;  5ALG A;  3CNH A;  2FE9 A;  3FDS A;  3MGV A;  2A3V A;  4M47 A;  8ICX A;  1KRP A;  2EZX A;  2HOQ A;  3N4M B;  4RNM A;  2W55 A;  1NK0 A;  7ICI A;  2FLN A;  5KT5 A;  2KK0 A;  3G6X A;  2E8P A;  5DG7 A;  2ZIU A;  3C23 A;  1QCK A;  2LHT A;  5J2I A;  3T5H A;  4C7Y A;  4F71 A;  4I28 A;  3C21 A;  2PFP A;  3IRU A;  4I2A A;  1L7N A;  3QU4 A;  1KSP A;  3Q8L A;  5AIC A;  3VC8 A;  3TAR A;  5CJ7 A;  4I2G A;  5J0X A;  3NVW A;  1S0M A;  3AU6 A;  1NK7 A;  2W3S A;  3JPO A;  4XUS A;  2BCR A;  1OW5 A;  2DGZ A;  2AGQ A;  2C2R A;  1RM6 C;  3UMG A;  9ICM A;  2EH9 A;  3RJI A;  1NZP A;  2QB0 A;  3ZDB A;  3TAQ A;  1DK3 A;  3NVY A;  4DOA A;  4QJF B;  2JGA A;  3BJY A;  4M2Y A;  2FPM A;  1QSY A;  4KLJ A; 
#chains in the Genus database with same CATH homology
 3M6Z A;  3D2S A;  2G0A A;  3AQF A;  4NV0 A;  4A8E A;  3ONN A;  2CRX A;  2F2A B;  3ICX A;  2KJ5 A;  2HMX A;  4OJ5 A;  2OXO A;  4CGZ A;  2JH1 A;  1URJ A;  2JHD A;  3NUQ A;  1Z1B A;  5HR7 A;  4WJ3 B;  3M7D A;  3PST A;  4QNL A;  3SAH A;  1Z19 A;  2GOL A;  3PSI A;  3N7P D;  4PL2 A;  3T79 A;  3AL0 B;  3GU3 A;  3N7R C;  4OJL A;  2HBJ A;  4P0Q A;  2W7P A;  3IG5 A;  2DQN B;  2H3Q A;  2HBL A;  2K8A A;  4ICA A;  4PL1 A;  3CRX A;  2KIW A;  2W03 A;  2Q4T A;  4C0Z A;  1Q3V A;  4P0P A;  3IP4 B;  2G5H B;  2WB1 C;  4BUG A;  3C29 A;  2KIC A;  3F5E A;  4OO1 J;  3F2B A;  1A6S A;  2K8C B;  3AQE A;  1CRX A;  5HR6 A;  2KKV A;  2KNJ A;  2G06 A;  2K4H A;  4KX3 A;  1F44 A;  2OH2 A;  4CRX A;  2OM6 A;  3IN5 A;  3HKZ C;  3DEE A;  1IIP A;  4JMU A;  1ED1 A;  2KJ8 A;  2LYA A;  2RHF A;  3E0F A;  2ZIW B;  4O3M A;  4P0P B;  3MGV A;  2D6F C;  5KL8 B;  1UPH A;  2OYY A;  2A3V A;  2H3V A;  2HBK A;  2KOB A;  3O0F A;  2F8L A;  2PMZ C;  2G08 A;  3H0R B;  4U6P A;  1PVP A;  3K1Z A;  2HBM A;  2HOQ A;  3L3F X;  2VIX A;  4FE3 A;  2K89 A;  3RF9 A;  2K8B B;  3C28 A;  2LYB A;  2CN1 A;  1XO0 A;  2ZIX B;  2KD1 A;  3RFA A;  4NWI A;  4CDG A;  2H3Z A;  2R18 A;  1XNS A;  1HEK A;  3NRW A;  2KEY A;  4IC9 A;  2KV2 A;  2K4I A;  2MRL A;  4U7C A;  1KBU A;  2XI9 A;  2ZIU A;  2E5S A;  2KVC A;  4NLB A;  2KHQ A;  2DF4 B;  2G5I B;  2H3F A;  3LVV A;  2LHT A;  1DRG A;  3OPX A;  2WAQ F;  3LVW A;  2LBO A;  1L6N A;  2G09 A;  2G07 A;  2PMZ F;  1ZQ1 C;  4FZL A;  1YT3 A;  3VCB A;  5T14 A;  4GFJ A;  4P0Q B;  1WUD A;  2NV3 A;  3PSP A;  2VKQ A;  4KMO B;  4NLC A;  3D2Q A;  3KZX A;  2KKP A;  1T94 A;  4OJP A;  2ZXI A;  3CYM A;  4ACO A;  5C0Y A;  3M6K A;  5KL1 B;  2ZG6 A;  3N7S C;  3LYS A;  3F53 A;  2JH7 A;  2HOI A;  2F77 X;  2N1R A;  3ALR A;  1TAM A;  3VC8 A;  1A0P A;  2YB4 A;  4QIW F;  2Y0S C;  4OJ6 A;  1PVR A;  2H3I A;  3SMV A;  2ZIU B;  4QIW C;  3SQI A;  1HIW A;  4AYB F;  3GZF A;  3KFU F;  2VJ5 A;  3PSF A;  2WB1 F;  4FZN A;  2K4E A;  2ZIW A;  2HOF A;  4AYB C;  5A0L A;  3SAF A;  3PZP A;  2KJ9 A;  3D2N A;  3HKZ F;  2Y0S F;  2GH1 A;  2E1E A;  2RP5 A;  2MA1 A;  4OJO A;  2DGZ A;  1D8B A;  2BDU A;  2Z7J A;  2ZIV B;  2XVT A;  2YX8 A;  1NZB A;  2ZIX A;  2WAQ C;  4KX5 A;  5CRX A;  1MA7 A;  2XID A;  3F5A A;  3SAG A;  3F2C A;  2W04 A;  4BJQ A;  1SZH A;  2LKY A;  2M0N A;  3H0L B;  3IG8 A;  2KHV A;  3H0M B;  3F2D A;  2ZIV A;  2E1F A;  1Q3U A;  1GO3 F;  2JMG A;  2F76 X;  4QJF B;  2XIC A;  3CP8 A;  2CPR A;  1ECW A;  2JGA A;  1PVQ A;  1OUQ A;  4FZM A;  2W7O A;  2ZXH A;  1P7D A;  2VJ4 A;  4BX9 C;  2RRD A;  2YB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...