1A6SA

M-domain from gag polyprotein of rous sarcoma virus, nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
GEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Solution structure and dynamics of the bioactive retroviral M domain from Rous sarcoma virus
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
total genus 18
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02813 Retro_M Retroviral M domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1a6sA00
2H3ZA 1L6NA 2H3IA 2LYAA 2NV3A 1HEKA 4ICAA 4IC9A 1UPHA 2K4IA 2N1RA 2GOLA 2JMGA 4JMUA 2H3QA 2H3FA 1ED1A 2H3VA 1A6SA 1HIWA 1ECWA 2K4EA 2LYBA 2K4HA 1TAMA 2HMXA
chains in the Genus database with same CATH superfamily
5DB9A 4YD2A 1OXJA 3Q8KA 2W9BB 2JZBA 4KMOB 4IR1A 1TE2A 4O5KA 1N5WA 2KJ9A 8ICAA 2NRVA 4DWIA 7ICFA 4B9SA 2FPLA 4I2EA 5HR6A 5C0YA 5DGAA 2JH1A 3SQIA 5AHXA 4UQGA 2XIDA 3QU2A 3KOOA 3PMNA 1S0OA 1BNOA 2JEJA 3QU4A 2KG5A 1V38A 3Q8QB 3M8SA 1J2MA 3RBEA 4RPZA 1KBUA 4C8NA 3SZ2A 2M9NA 1ZQQA 4BDPA 4KITB 4BWMA 1UT8A 2QB0B 4KLTA 1SKSA 4KLUA 2H3ZA 2KSOB 2E5SA 4A8EA 2DPJA 1COKA 5EWEA 1S97A 2VA8A 4PHPA 3BJYA 3PO5A 4P0QA 3LWMA 5HNKA 3GILA 3TI0A 4PL2A 1TK5A 4R8UB 1SKWA 4RQ5A 2IOFK 4EEYA 2ASLA 1SWWA 4KTQA 5KFUA 2KK0A 2K4PA 5AKIA 1PUZA 4DL7A 2HHXA 5DGBA 1C7YA 3ED5A 4F72A 5KTQA 5KFMA 4Z6FA 4C0ZA 4F5PA 1QSLA 2D8CA 4QWEA 1X9XA 3QZ8A 4F8RA 1KEJA 4KLEA 4ECTA 3RRHA 4DFJA 9ICXA 1ZXIA 1RQNA 5BOMA 2HHTA 4PPXA 2KP7A 2YMLA 1NK5A 2XGPA 4DL3A 4YFKA 1X9WA 2AH5A 1TKDA 1LB2B 2K4EA 4QZ9A 2KZMA 3PSIA 5ALOA 4YR3A 4UB2A 1ZD3A 4ED3A 2D3DA 5J0UA 1RPLA 1SXDA 4J9NA 2KD1A 2K4IA 1ZQFA 5HMLA 5CEHA 1ZQAA 3EWAA 3N7PD 3AQFA 2QARA 3KBBA 2PFPA 4J9RA 4DOCA 2NO5A 3NVWA 3OJUA 4ECVA 2AHOB 2WAQF 3WKEA 1YZ6A 1ZD2P 2MUTB 4NLZA 4O0IA 5DG8A 2BCSA 1V85A 3PNCA 1OW5A 2BDUA 2XI9A 3UXOA 4GLXA 4YN4A 2O6KA 2OCEA 2G0AA 5AI5A 2FDRA 2I1QA 5JUMA 9ICCA 2JH7A 4YMOA 5C5JA 4ELVA 8ICKA 3G6XA 4YP3A 4I2FA 1S10A 2EANA 1ZQVA 2FJ6A 5J2DA 5KT4A 2OEHA 2W3RA 1IXRA 5E79U 4QZDA 2BCVA 2HBKA 2K89A 2G06A 4U7CA 4B9UA 2NRTA 4RZRA 2Y0SC 4RU9A 2F44A 5KT5A 4QZCA 3L5KA 1U47A 5DBCA 3RB6A 1KFDA 5DLGA 2PMZF 3FM9A 7ICKA 4DS4A 3PO4A 1UA1A 4UB1A 4NXZA 1IG6A 1AROP 4O3RA 1QTMA 2R8HA 2DGZA 2E1EA 4Q8EA 1S8OA 9ICLA 2UVRA 3HX0A 2LYBA 3AL0B 8ICNA 3IHQB 2HOIA 3GV8B 1Q46A 2LBOA 3MR6A 1TAUA 3I76A 4RQ7A 1JXLA 1T7PA 4QW9A 4QZFA 1N5XA 5KG1A 5DB8A 2KE7A 8ICMA 3OSNA 2P6UA 2A3VA 1X2IA 2QB1A 4M6WA 5KFPA 4DSKA 4JUZA 4OO1J 4Y2SA 5KG6A 2KNJA 4M0AA 9ICIA 1CUKA 1SZPA 4AP9A 4I2IA 5BPCA 4Y2XA 4O3PA 9ICQA 2ESEA 5KG5A 2DKXA 1N48A 3EPIA 4CF5A 3LYSA 3C1ZA 5ALMA 1PK1B 4RNOA 1KFSA 4ED6A 8ICSA 2BHNA 1JXEA 2JEGA 3C2KA 1X66A 5AI0A 4DL4A 5DQHA 2HHVA 3K4GA 4ED2A 4F5NA 4M2YA 5ALFA 5L1MA 1JROA 3D2SA 2IHMA 3ZD8A 1COOA 2V4QA 3C28A 5AKZA 8ICPA 3OJSA 5GTHU 5J2EA 2KV2A 5CHGA 4I28A 4ECRA 3M9MB 3E2EA 4KN4A 3SYZA 3TAPA 2HOFA 2B0CA 2EZZA 2XC9A 1D8YA 4QJFB 1RXVA 7ICUA 3V7KA 4O5CA 5H2FU 2H3IA 5ALJA 9ICVA 5AK5A 1L3TA 3HKZC 2FLPA 3RJGA 4NWIA 2XVTA 4FE3A 1FO4A 2DWQA 4RQ0A 4G3IA 3QUTA 3BS7A 1XWLA 2NRWA 2DPIA 1KL9A 3C21A 3UQ0A 1ZQSA 3LVWA 3HT3A 3MFHA 3ETRA 1SIJA 4K4GA 3BS5B 4YG2A 5ALSA 2EH9A 5J0XA 3NRWA 8ICFA 3F2BA 2W7OA 2PXIA 3QEAZ 4CNQA 5L9XA 2G5IB 5DDMA 3GQCA 4K4IA 1IV8A 2LYHA 1TAQA 5HHHA 4PHEA 4DF4A 4NL9A 5ALNA 4KLJA 2ZUCA 4M9HA 2VJ5A 1ZQYA 3QE9Y 4PJ0U 3D2QA 3KHRA 3KHGA 4B9MA 4DOBA 5DG9A 2G09A 4DS5A 3VC8A 4Y2UA 4QWDA 2KICA 2OH2A 1ZJMA 5ALYA 1DXSA 5KFSA 5F9NA 4B9VA 2HW3A 3NGDA 1XSLA 4RT2A 2JZBB 8ICYA 3M6ZA 5EE0A 4C8OA 5KFBA 2WF8A 3L3FX 5ALPA 9ICEA 1SZHA 4WJ3B 3PZPA 3ONNA 4FZNA 5B66U 2YMQA 5J8YA 2E8PA 1L3SA 9ICKA 3F53A 3PW2A 4JWMA 4BXOB 1SL1A 3PX4A 2HBMA 4PL1A 3TKAA 3H0MB 5KAFU 2FMQA 3IN5A 4PGXA 9ICMA 2KKPA 2E8NA 5JTIA 2DF4B 1A77A 5ALDA 5J2HA 1XNSA 4QZIA 2HDOA 5JRTA 1FEZA 4F71A 7ICQA 4KLGA 5CR0A 3D2NA 3H40A 1SL2A 5AK4A 2RRDA 2P6RA 5KFNA 2NYVA 4RNMA 4YR0A 3BQ1A 2DUYA 3RFAA 7ICHA 2DBYA 1YT3A 2P35A 1XS9D 3V6HA 4P0QB 3RB3A 1SKRA 3O0FA 4UB3A 2AGQA 4O3MA 4XQ8A 2ZIUB 1ZQWA 2DL0A 1Q3UA 5DDYA 4UB4A 4C4TA 5FP0A 3BQ0A 4UB8U 2FMSA 2W9CA 4EX7A 9ICSA 8ICGA 2OHFA 4R65A 2EQYA 5DB7A 4JWNA 3K1RB 3SAGA 3WK8A 5EOZA 1UPHA 3I1YA 1F5SA 3WK5A 4NV0A 3GIMA 1X40A 1EXNA 3WK6A 1ZQNA 3RR7A 4ED1A 5ALVA 1BPBA 1KW4A 3ISCA 7ICPA 1AQ6A 3UMBA 2F1JA 9ICNA 3EZ5A 1KLNA 4KLHA 3QU7A 3F2DA 1A76A 2AQ4A 8ICZA 2UVWA 2CRXA 3NVVA 4UBCA 3MBYA 3N7RC 8ICWA 3ORYA 7ICLA 4J9QA 1JALA 2HVHA 2QARB 8ICTA 3ISDA 4J9PA 3QUCA 4DSEA 3L4PA 2ZIXA 4GIBA 2G07A 1ZRNA 2W9MA 1RYUA 3EUB2 4F4WA 1DK2A 4TUPA 5KAIU 3LWLA 3TACB 3OPXA 4LZGA 3B9JA 3M8RA 4FFDA 3JPRA 3MDCA 3T5KA 2LKYA 2H5XA 3RJJA 4M9LA 3RAXA 2CXYA 5EE9A 1Z3EB 4M9GA 2W03A 5ALIA 4I2HA 3ZDEA 2JMGA 1K1SA 1QQ7A 1PVPA 2KVCA 4RQMA 1QH9A 5AM2A 1S5LU 3CYMA 5CP2A 1TAMA 3F2CA 4CDGA 1O08A 4DL5A 2IHNA 4K4HA 2HHWA 2YTUA 4F4ZA 1TV9A 3PW7A 3HPOA 1BVSA 3H4DA 8ICVA 3H4BA 1NK8A 4UAUA 2LHTA 4XRHA 5ALQA 4P0PA 4IQUA 4F2RA 3MABA 3MC1A 5AKKA 3WKBA 3EW9A 4F3OA 3RTVA 1K1QA 3T79A 4F4KA 1IM4A 4UARA 3SI8A 5F9LA 4QZGA 5ALUA 2D6FC 3ALRA 4NLNA 3ZDDA 3QZ7A 3HRDD 1VDVA 3NS1A 1A6SA 2UVVA 4RNNA 3PR4A 4O3QA 4QZBA 4FBTA 4C8KA 1ZQIA 5ALXA 4C4SA 2KZ3A 1BNPA 4ZH4A 5AKXA 3RH4A 1HUZA 2OXOA 2HHQA 5K4LA 4GXKA 3SMVA 3WK9A 2ZIVA 3G6YA 4F4XA 1K5OA 4J9OA 2K4HA 2IA6A 8ICUA 4QZEA 5D46A 1SWVA 1JRPA 5J0PA 3HWTA 3AUOA 4Y2JA 2F76X 3AN1A 4FS2A 1L6NA 4Q8FA 4R66A 3KFUF 3OSPA 1WCLA 1OUQA 1XSPA 3AU2A 2A19A 4DL2A 1ECWA 1KQQA 2LM1A 4ECSA 1PK3A 2PMZC 4EBCA 5EE3A 2BPCA 4ACOA 1N62A 2Y9TA 4F50A 2HBJA 2HI0A 1WWUA 3PW0A 5IIKA 2AGPA 5KT6A 1BPZA 1X9MA 2B6GA 3BZKA 2E8OA 4JV2A 1L7MA 7ICGA 4J03A 2Y1IA 1TFRA 4UB5A 1DRGA 5IIIA 4O9MA 1UCVA 4C8LA 2KIWA 3SD7A 2I6XA 1QSSA 3MGHA 1V97A 1HJPA 3ISBA 5KFAA 3MGIA 3WKAA 1Z4NA 3V6JA 1QQ5A 1T3QA 4TQSA 4EYHB 4LJXA 2BQUA 4DLGA 3PW4A 4EBEA 2VKQA 4OJLA 1S9FA 3HJEA 1D8BA 5HR7A 2XCAA 5AICA 4I29A 5G5HA 5EWGA 5J2JA 5AI8A 3UM9A 2GH1A 1QCKA 3Q8MA 5AK3A 2JV3A 1U9LA 1WG8A 4OJPA 2JR5A 4F4YA 3WK4A 2Z7JA 4F5RA 2YMPA 2PFNA 4ELTA 1RQLA 1ZQEA 1ZQBA 2QB0A 5DLFA 4TUQA 4ED0A 2F3NA 2C22A 4MHVA 5J2BA 2KSOA 5L1KA 5ALWA 2KKVA 4Y2VA 3VCBA 5KFIA 5KFTA 4RQ2A 1FFUA 4U6PA 2ZIWA 4R8UA 2FLNA 4YVZA 1PVRA 2ES6A 2GO7A 4J9SA 3FAHA 2P66A 2R8GA 5TISU 4MF8A 5DB6A 4J9LA 5KFEA 3GDXA 4QZHA 3C5FA 1MA7A 4EBDA 1T3NA 1ZQUA 1P7DA 4TURA 1ZQPA 3B0YA 1NK0A 2LYAA 4ECUA 1ZQMA 5G5GA 4ICAA 4NLBA 2F77X 3OHBA 4Q45A 4JK1A 4AYBC 3FYHA 2F8KA 3M7DA 2JEFA 5DKWA 4J9MA 3J81j 4FO6A 1ZRMA 3NASA 3FDSA 3SR6A 4DLEA 5J2IA 1DGJA 4I2DA 1NK4A 4RQ3A 4JV0A 2HOQA 5D49A 5J2AA 1YZ7A 3TFSA 2XO7A 3KZXA 4IQWA 5AIAA 4DL6A 3QEBZ 2IOFA 2BPFA 4KN7A 2I5HA 4F5OA 2LM4A 4F92B 4TUSA 2MUTA 3QU9A 3UMGA 5KFJA 3RJEA 8ICLA 3NUQA 5JU5A 4CF4A 1RG6A 5IILA 1KKXA 3WKCA 4YXMA 4RT3A 2K60A 5KFQA 3IG8A 2WB1C 2W9CB 4MFCA 3GFKB 4US8A 2K8BB 1ZOLA 2RHFA 1ED1A 4ECWA 3TANA 1FFVA 4Q43A 2WHEA 2VANA 4NLCA 4GXJA 1T4GA 5KFKA 5ALTA 5J29A 3ZD9A 4M04A 1SV0A 7ICEA 4OJ5A 1ZQHA 9ICOA 1NJZA 3KD3A 4QWAA 2BGWA 5KFDA 2AJQA 3RB0A 3IDWA 1NJWA 7ICNA 3UPQA 4KLQA 1B43A 2N1RA 3TADC 2MU2A 1L7PA 3TFRA 1WYGA 5J2CA 1N61A 1S0NA 4IQVA 4CCHA 3OTQA 4UBBA 4B9NA 2K8AA 9ICWA 1ZD4A 1NJYA 2ALZA 4I2JA 1U4BA 3SV3A 1X6IA 5KFHA 1BPYA 2F1IA 3H8JA 2R8KA 3IP4B 1NK6A 5CJ7A 4YD1A 5AKJA 1Y88A 1TVAA 3ICXA 4IL6U 3H0RB 1T94A 4HAIA 4QZ8A 4P2HA 5AM3A 4CF3A 4G9BA 2ZIXB 4O3NA 4GC6A 2PFOA 1XO1A 5KFZA 4DEZA 3TQ1A 2YN4A 1ZQ1C 5KFVA 3R9KA 7ICRA 4PGYA 1CRXA 1RZTA 4YCXA 1NKCA 2H3QA 2NO4A 3C2LA 5KFXA 3C2MA 4DOAA 4BJQA 4MEXA 4QW8A 2FPMA 4I2AA 4IRKA 1PK1A 1Z1BA 1PVQA 1UQVA 4QNLA 2W8KA 5CB1A 2F1HA 2ZTEA 4YMNA 3H8SA 5KG3A 5EWFA 5J0OA 1IIPA 1WWVA 3RJHA 3PVXA 3ZDCA 1ZJNA 5ALGA 5KG7A 3PR5B 3TARA 4PH5A 1SV0C 2A1JA 4DSFA 2FE9A 1N2XA 4RUAA 1T8EA 5L1JA 1ZQLA 4ZOHC 5HHIA 3AMZA 1Z00A 4P0PB 2J6SA 2ZJAA 2RDIA 2HBLA 4FZMA 3RH5A 3KKAA 4YMMA 2HHUA 2C2EA 4JV1A 2H3FA 2M0NA 1TK8A 2CPRA 4RQ4A 1HIWA 2KJ5A 3MDAA 2JHDA 2BQRA 3QX7A 2MAXA 4PZOA 5KL1B 4KLLA 1KTQA 2BZFA 4XUSA 3N7SC 2AU0A 3PX0A 1NZBA 1JIHA 1JX4A 3T5HA 3WU2U 2WF5A 1F44A 1ZQGA 1ZQTA 2GOLA 2DKZA 5AI9A 2RP5A 3PSPA 3LVVA 2F8LA 3QNMA 1S0MA 3V72A 3BS5A 2QLTA 2ATLA 4IS7A 7ICVA 3K1ZA 2Q4TA 2J6UA 1F0MA 3QUQA 2W9AA 2WF9A 5AKYA 3K75D 4RPYA 1ZETA 4GC7A 1U45A 1ZQJA 3SV4A 1D9FA 4MF2A 2JEIA 3MR2A 2V9WA 2W43A 2FLLA 4XA5A 4QIWF 2W04A 4R63A 4PGQA 4JMUA 1ZYQA 1X6JA 4QWBA 1NKEA 1JUDA 1MQ3A 1MC8A 5CA7A 4I2CA 5KNIA 5KT7A 1NKBA 7ICJA 1SB3C 2KTQA 2YX8A 4UAYA 4P4MA 3OHAA 2W7PA 1QSYA 2ZUDA 3KTQA 4UAZA 1XSNA 2IOHA 1KRPA 4YR2A 1ZD5A 4NM2A 3C5GA 1V9PA 4DFDA 3M1YA 2RQ5A 1JI7A 2XGQA 1NI3A 2ODGA 9ICGA 3H7IA 1RDFA 5AM0A 9ICFA 3KKAC 4Z6CA 4DSIA 8ICOA 1LKYA 2WFAA 3GIIA 2R8IA 3BQ2A 2XY6A 3Q8LA 3C1YA 3UXNA 3NRZA 1NK7A 3E0FA 3PSFA 2FI1A 2KJ8A 5KFLA 3MR3A 2V4RA 1Z1VA 8ICHA 3RB4A 4F93B 4RQ8A 4KLDA 4F91B 2ISOA 4BXOA 3QXGA 2GLEA 4OD0A 5KFCA 2ZXHA 3Q8RB 3IV6A 1HEKA 3DV9A 3FC4A 3PV8A 1S76D 3AU6A 4ED8A 3N97B 5KT3A 4X5VA 4CGZA 4KMUA 2W3SA 1ZQRA 5GTIU 3CNHA 2XICA 4UB6U 5TZVA 3BZCA 2KHVA 5AM4A 3TAQA 4C80A 3SENA 2BR0A 1BPEA 2WAQC 2ZJ8A 3HW8A 5KFFA 2JGAA 3CRXA 2MA1A 3RJKA 2ZIWB 5AM5A 2ZIUA 9ICBA 4GXIA 1N56A 1NNLA 5ALLA 1L3VA 3RH6A 5BOLA 2ASDA 4M6WB 1ZQDA 2EAOA 5CWRA 1MN8A 2EAPA 2PI4A 7ICTA 2E3TA 4FZLA 5AKGA 3JPTA 5AM1A 1HUOA 3A0HU 8ICXA 2RDJA 4CE6A 4R64A 7ICOA 5ALHA 4EZ9A 4EENA 4UATA 2W11A 4DQQA 3SAHA 1U48A 4ECZA 2PI5A 4E0DA 4DFPA 1GO3F 1L5UA 1X42A 4HYKA 2JXJA 3JPOA 1NZPA 3IM1A 3WKDA 5KG4A 3ZI4A 4M47A 9ICUA 3LK9A 2B21A 4Y2QA 4DQSA 4DF8A 1B0XA 2R18A 3H0LB 3GV5B 5AIBA 3AQEA 1U49A 2XY7A 2YQEA 4DO9A 5J0RA 1N60A 4NM1A 2VIXA 4UW9A 8ICIA 1N63A 1QQ6A 2W9BA 3V7JA 4IR9A 8ICCA 1DK3A 2BQ3A 5L1IA 9ICPA 2L5YA 2KHQA 5IINA 3H8MA 2E1FA 1Q3VA 1QLNA 2KVSA 3JPQA 1MSWD 3GZFA 4MFAA 3Q8SB 4M9JA 2W8LA 4QWCA 4P4PA 3PSTA 3RJFA 3DEEA 4RUCA 2IMWP 1L7NA 1X9SA 2PKEA 2K8CB 8ICBA 1Z4OA 2OYYA 3JPPA 1O03A 9ICJA 3D6JA 2UVUA 5IIOA 2AGOA 3WK7A 7ICSA 5DG7A 2A1AA 4Y2TA 4DFKA 2HSZA 5EE1A 3NTUA 1NJXA 1VLBA 2YMMA 2WF7A 8ICJA 3THVA 1KN5A 3C23A 1S77D 3OGUA 1LV5A 1MQ2A 2KN7A 1JN3A 3U26A 1DOQA 3UXPA 1D8LA 2VA2A 4C8MA 2BPGA 4KLFA 3T5LA 4DQPA 4DQIA 2ZJ5A 5KT2A 4RQ6A 3HILA 5F3XB 3ZDBA 5J2KA 5L1LA 1UT5A 5DBAA 5KFWA 4O3OA 4NLGA 3SAFA 4PHDA 5KFYA 5J0SA 2BKEA 3GIJA 1JMSA 4MFFA 4Z6DA 4DCCA 4EX6A 1VJ5A 2AXTU 1BPDA 5KFGA 2I9GA 3TADA 2Y0SF 5AKLA 1TK0A 4KLMA 3UQ2A 3T3FA 2W55A 2J6TA 2QKQA 5T14A 3QUBA 4OJOA 4Q44A 4ED7A 2KMDA 3A0BU 3PX6A 4LZDA 8ICEA 4YXJA 3B0XA 1SGGA 2G5HB 3G6VA 2XCPA 2LI6A 2BCRA 1ZQOA 9ICTA 4IRDA 1J97A 2MRLA 4C4RA 2WF6A 4BGDA 5D4BA 1LVHA 3H8WA 3N28A 1XO0A 3F5AA 1KSPA 2ZTCA 4DSJA 2HMXA 4NJ8A 2A1JB 3GV7B 3KZIU 4RQ1A 4O3SA 3S6JA 2Y1JA 2OWOA 4KLOA 2NV3A 1M6YA 5B5EU 4YQWA 1NOMA 4IC9A 1WCNA 2G08A 2HHSA 2JRZA 3I28A 2LPEA 4DQRA 5ALKA 2YB4A 1Z00B 2W54A 3Q8PB 2ZTDA 5KG0A 5J0WA 3UMCA 3M6KA 4PZNA 2NRXA 1S0VA 1WUDA 3RR8A 1ZQXA 2AQ0A 4DFMA 4RPXA 2E8MA 4P4OA 2WTFA 4US9A 2ASJA 3E58A 5HMMA 2CN1A 3GIKA 5IIJA 5J0TA 4I2GA 2H3VA 1FIQA 3BDPA 4EEKA 4UAVA 2KIVA 3PMLA 4AYBF 3M9OB 5AI4A 5ALZA 2BCUA 2ZUBA 3PY8A 1XU4A 4C7YA 3AM9A 1KFTA 5AI6A 2Q0ZX 2BCQA 2LMRA 2OM6A 3QYPA 1PZNA 1ZQCA 3NVYA 3MFIA 4OJ6A 1L8OA 3F5EA 1URJA 1A0PA 4M9NA 3N4MB 2FPKA 5ALEA 2HVIA 1NK9A 4I27A 1DGSA 1Z19A 7ICIA 3V6KA 2VA3A 4FS1A 2GWSA 4ECYA 4TQRA 9ICRA 3HKZF 4BUGA 1BGXT 4NLKA 9ICAA 4RQNA 2EAMA 2C28A 3MR5A 3IRUA 5KL8B 1Q8KA 3RRGA 3CP8A 1D9DA 1L3UA 3LDAA 5HP4A 1CEZA 2KFNA 4Y2YA 3BQTA 2WB1F 1RXWA 5AKHA 3RAQA 1ZQKA 4KLIA 3EYZA 1C20A 5ALRA 3IG5A 1LKYB 1CI4A 4Y2PA 4UAWA 4KX3A 1B22A 3JPSA 4JB3A 3KHLA 4BWJA 2YB1A 5IIMA 4PHAA 4ELUA 1UA0A 3RF9A 2BDPA 2VJ4A 1H38A 2IBKA 2C2RA 4IRCA 4IQTA 4MEYA 3DDHA 2F2AB 3RBDA 3AEVA 4UASA 4C7ZA 5AK6A 2KOBA 1BPXA 4QIWC 2R8JA 4ECXA 4B6JA 4QZAA 2ZXIA 3RJIA 4DSLA 1SV4A 3HP6A 4Y2RA 2RLTA 5AKEA 1KDHA 4B9TA 5CRXA 3JPNA 2NRZA 4USAA 2DFLA 1SL0A 3BQ7A 4F2SA 1L8LA 8ICQA 2YY6A 2KEYA 1ZQZA 4NL9C 1UHUA 3QU5A 2KZZA 3M9NB 5J0QA 4GFJA 4BX9C 2EZXA 5KFRA 4KX5A 4OCZA 3T5JA 2ZG6A 2HCFA 5J2FA 4EZ6A 2PFQA 3ETLA 4Z6EA 2ISPA 1RYSA 1L7OA 4KLSA 5J0YA 2ZIVB 3C29A 1B4FA 5J2GA 4B9LA 2FMPA 1J2NA 8ICRA 4LVSA 3KHHA 1SXEA 1RM6C 3EPGA 5DBBA 1RYRA 4CRXA 4J9KA 5J8YC 4EELA 5KG2A 2EDUA 2XY5A 4NY8A 2MSNA 3NVZA 3SEIA 2C2DA 2KFZA 4I2BA 1XC9A 5KFOA 4ECQA 4O5EA 4F5QA 2DQNB 3MGVA 9ICHA 3GU3A 5DQGA 3CW2C 5A0LA 3ZDAA 3V7LA 7ICMA 2Y9UA 5DQIA 4FBUA 2EZYA 4EYIB 3PW5A
chains in the Genus database with same CATH topology
2R18A 2KOBA 2ZXHA 3H0LB 3PZPA 3N7SC 3IP4B 4KMOB 2H3IA 3ONNA 4FZNA 4QIWC 3T79A 1NZBA 2KJ9A 2VKQA 3AQEA 1HEKA 4OJLA 2ZXIA 3F53A 3HKZC 1D8BA 3F2DA 3ICXA 1F44A 2DGZA 2D6FC 2GOLA 2HBMA 2E1EA 2OM6A 3ALRA 4PL1A 2RP5A 1T94A 2VIXA 3H0RB 3LVVA 3PSPA 2F8LA 4NWIA 2CRXA 4CGZA 3H0MB 2HOQA 5CRXA 1A6SA 2K4EA 2LYBA 2XVTA 3N7RC 4FE3A 3IN5A 2ZIXB 4OJ6A 3AL0B 5HR6A 2GH1A 3PSIA 5C0YA 2JH1A 2Y0SF 1URJA 2KKPA 2Q4TA 1A0PA 3F5EA 3K1ZA 3KZXA 3SQIA 2HOIA 2XICA 4OJPA 2KEYA 2XIDA 2DF4B 2LBOA 2KHQA 1XNSA 2Z7JA 2E1FA 5T14A 1ZQ1C 2KHVA 3LVWA 1Q3VA 1Z19A 4OJOA 4GFJA 4BX9C 4KX5A 3D2NA 2ZIXA 1KBUA 2KD1A 3GZFA 2G07A 2K4IA 1CRXA 2ZG6A 2G5HB 2RRDA 4QIWF 2W04A 3NRWA 2OXOA 4JMUA 2A3VA 3N7PD 3SMVA 2H3QA 3PSTA 2MRLA 2ZIVA 3AQFA 3DEEA 2WAQC 3F2BA 2W7OA 2JGAA 3HKZF 4BUGA 3NUQA 2MA1A 3CRXA 4OO1J 2K4HA 2ZIWB 3OPXA 1XO0A 3F5AA 2WAQF 2K8CB 2KNJA 2ZIUA 5KL8B 3RFAA 2G5IB 2KKVA 2LKYA 2OYYA 4BJQA 2HMXA 1YT3A 2YX8A 4P0QB 2ZIVB 3C29A 3CP8A 2H3ZA 3O0FA 1Z1BA 3VCBA 2F76X 1PVQA 4QNLA 3IG8A 2WB1C 4O3MA 1L6NA 2NV3A 2E5SA 2BDUA 4A8EA 2XI9A 2W7PA 2ZIUB 4IC9A 4U6PA 2ZIWA 1IIPA 2WB1F 2VJ5A 2G0AA 2G08A 2K8BB 2W03A 3LYSA 4FZLA 3D2QA 1PVRA 1Q3UA 2RHFA 1OUQA 3KFUF 2JMGA 2YB4A 1ED1A 4P0QA 3IG5A 1PVPA 2JH7A 2KVCA 1ECWA 3M6KA 4NLCA 3CYMA 2PMZC 4KX3A 4PL2A 4CRXA 1TAMA 1WUDA 4ACOA 3F2CA 4CDGA 2HBJA 2G09A 4OJ5A 1MA7A 1P7DA 3SAHA 3VC8A 4P0PB 2LYAA 2YB1A 2KICA 2OH2A 3SAGA 2DQNB 1GO3F 3MGVA 4ICAA 2HBLA 4FZMA 1UPHA 3RF9A 2HBKA 3D2SA 3GU3A 2K89A 2VJ4A 2CN1A 4NLBA 2G06A 2N1RA 3E0FA 2F77X 3PSFA 4C0ZA 4U7CA 1DRGA 5HR7A 3C28A 4NV0A 2KJ8A 2H3FA 2M0NA 2Y0SC 2LHTA 5A0LA 4AYBC 2H3VA 2CPRA 1HIWA 2KIWA 2KJ5A 3M6ZA 2JHDA 4P0PA 2KV2A 2K8AA 4AYBF 3L3FX 5KL1B 2F2AB 3M7DA 2HOFA 1SZHA 2PMZF 4WJ3B 3SAFA 4QJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Z A;  1L6N A;  2H3I A;  2LYA A;  2NV3 A;  1HEK A;  4ICA A;  4IC9 A;  1UPH A;  2K4I A;  2N1R A;  2GOL A;  2JMG A;  4JMU A;  2H3Q A;  2H3F A;  1ED1 A;  2H3V A;  1A6S A;  1HIW A;  1ECW A;  2K4E A;  2LYB A;  2K4H A;  1TAM A;  2HMX A; 
#chains in the Genus database with same CATH topology
 5DB9 A;  4YD2 A;  1OXJ A;  3Q8K A;  2W9B B;  2JZB A;  4KMO B;  4IR1 A;  1TE2 A;  4O5K A;  1N5W A;  2KJ9 A;  8ICA A;  2NRV A;  4DWI A;  7ICF A;  4B9S A;  2FPL A;  4I2E A;  5HR6 A;  5C0Y A;  5DGA A;  2JH1 A;  3SQI A;  5AHX A;  4UQG A;  2XID A;  3QU2 A;  3KOO A;  3PMN A;  1S0O A;  1BNO A;  2JEJ A;  3QU4 A;  2KG5 A;  1V38 A;  3Q8Q B;  3M8S A;  1J2M A;  3RBE A;  4RPZ A;  1KBU A;  4C8N A;  3SZ2 A;  2M9N A;  1ZQQ A;  4BDP A;  4KIT B;  4BWM A;  1UT8 A;  2QB0 B;  4KLT A;  1SKS A;  4KLU A;  2H3Z A;  2KSO B;  2E5S A;  4A8E A;  2DPJ A;  1COK A;  5EWE A;  1S97 A;  2VA8 A;  4PHP A;  3BJY A;  3PO5 A;  4P0Q A;  3LWM A;  5HNK A;  3GIL A;  3TI0 A;  4PL2 A;  1TK5 A;  4R8U B;  1SKW A;  4RQ5 A;  2IOF K;  4EEY A;  2ASL A;  1SWW A;  4KTQ A;  5KFU A;  2KK0 A;  2K4P A;  5AKI A;  1PUZ A;  4DL7 A;  2HHX A;  5DGB A;  1C7Y A;  3ED5 A;  4F72 A;  5KTQ A;  5KFM A;  4Z6F A;  4C0Z A;  4F5P A;  1QSL A;  2D8C A;  4QWE A;  1X9X A;  3QZ8 A;  4F8R A;  1KEJ A;  4KLE A;  4ECT A;  3RRH A;  4DFJ A;  9ICX A;  1ZXI A;  1RQN A;  5BOM A;  2HHT A;  4PPX A;  2KP7 A;  2YML A;  1NK5 A;  2XGP A;  4DL3 A;  4YFK A;  1X9W A;  2AH5 A;  1TKD A;  1LB2 B;  2K4E A;  4QZ9 A;  2KZM A;  3PSI A;  5ALO A;  4YR3 A;  4UB2 A;  1ZD3 A;  4ED3 A;  2D3D A;  5J0U A;  1RPL A;  1SXD A;  4J9N A;  2KD1 A;  2K4I A;  1ZQF A;  5HML A;  5CEH A;  1ZQA A;  3EWA A;  3N7P D;  3AQF A;  2QAR A;  3KBB A;  2PFP A;  4J9R A;  4DOC A;  2NO5 A;  3NVW A;  3OJU A;  4ECV A;  2AHO B;  2WAQ F;  3WKE A;  1YZ6 A;  1ZD2 P;  2MUT B;  4NLZ A;  4O0I A;  5DG8 A;  2BCS A;  1V85 A;  3PNC A;  1OW5 A;  2BDU A;  2XI9 A;  3UXO A;  4GLX A;  4YN4 A;  2O6K A;  2OCE A;  2G0A A;  5AI5 A;  2FDR A;  2I1Q A;  5JUM A;  9ICC A;  2JH7 A;  4YMO A;  5C5J A;  4ELV A;  8ICK A;  3G6X A;  4YP3 A;  4I2F A;  1S10 A;  2EAN A;  1ZQV A;  2FJ6 A;  5J2D A;  5KT4 A;  2OEH A;  2W3R A;  1IXR A;  5E79 U;  4QZD A;  2BCV A;  2HBK A;  2K89 A;  2G06 A;  4U7C A;  4B9U A;  2NRT A;  4RZR A;  2Y0S C;  4RU9 A;  2F44 A;  5KT5 A;  4QZC A;  3L5K A;  1U47 A;  5DBC A;  3RB6 A;  1KFD A;  5DLG A;  2PMZ F;  3FM9 A;  7ICK A;  4DS4 A;  3PO4 A;  1UA1 A;  4UB1 A;  4NXZ A;  1IG6 A;  1ARO P;  4O3R A;  1QTM A;  2R8H A;  2DGZ A;  2E1E A;  4Q8E A;  1S8O A;  9ICL A;  2UVR A;  3HX0 A;  2LYB A;  3AL0 B;  8ICN A;  3IHQ B;  2HOI A;  3GV8 B;  1Q46 A;  2LBO A;  3MR6 A;  1TAU A;  3I76 A;  4RQ7 A;  1JXL A;  1T7P A;  4QW9 A;  4QZF A;  1N5X A;  5KG1 A;  5DB8 A;  2KE7 A;  8ICM A;  3OSN A;  2P6U A;  2A3V A;  1X2I A;  2QB1 A;  4M6W A;  5KFP A;  4DSK A;  4JUZ A;  4OO1 J;  4Y2S A;  5KG6 A;  2KNJ A;  4M0A A;  9ICI A;  1CUK A;  1SZP A;  4AP9 A;  4I2I A;  5BPC A;  4Y2X A;  4O3P A;  9ICQ A;  2ESE A;  5KG5 A;  2DKX A;  1N48 A;  3EPI A;  4CF5 A;  3LYS A;  3C1Z A;  5ALM A;  1PK1 B;  4RNO A;  1KFS A;  4ED6 A;  8ICS A;  2BHN A;  1JXE A;  2JEG A;  3C2K A;  1X66 A;  5AI0 A;  4DL4 A;  5DQH A;  2HHV A;  3K4G A;  4ED2 A;  4F5N A;  4M2Y A;  5ALF A;  5L1M A;  1JRO A;  3D2S A;  2IHM A;  3ZD8 A;  1COO A;  2V4Q A;  3C28 A;  5AKZ A;  8ICP A;  3OJS A;  5GTH U;  5J2E A;  2KV2 A;  5CHG A;  4I28 A;  4ECR A;  3M9M B;  3E2E A;  4KN4 A;  3SYZ A;  3TAP A;  2HOF A;  2B0C A;  2EZZ A;  2XC9 A;  1D8Y A;  4QJF B;  1RXV A;  7ICU A;  3V7K A;  4O5C A;  5H2F U;  2H3I A;  5ALJ A;  9ICV A;  5AK5 A;  1L3T A;  3HKZ C;  2FLP A;  3RJG A;  4NWI A;  2XVT A;  4FE3 A;  1FO4 A;  2DWQ A;  4RQ0 A;  4G3I A;  3QUT A;  3BS7 A;  1XWL A;  2NRW A;  2DPI A;  1KL9 A;  3C21 A;  3UQ0 A;  1ZQS A;  3LVW A;  3HT3 A;  3MFH A;  3ETR A;  1SIJ A;  4K4G A;  3BS5 B;  4YG2 A;  5ALS A;  2EH9 A;  5J0X A;  3NRW A;  8ICF A;  3F2B A;  2W7O A;  2PXI A;  3QEA Z;  4CNQ A;  5L9X A;  2G5I B;  5DDM A;  3GQC A;  4K4I A;  1IV8 A;  2LYH A;  1TAQ A;  5HHH A;  4PHE A;  4DF4 A;  4NL9 A;  5ALN A;  4KLJ A;  2ZUC A;  4M9H A;  2VJ5 A;  1ZQY A;  3QE9 Y;  4PJ0 U;  3D2Q A;  3KHR A;  3KHG A;  4B9M A;  4DOB A;  5DG9 A;  2G09 A;  4DS5 A;  3VC8 A;  4Y2U A;  4QWD A;  2KIC A;  2OH2 A;  1ZJM A;  5ALY A;  1DXS A;  5KFS A;  5F9N A;  4B9V A;  2HW3 A;  3NGD A;  1XSL A;  4RT2 A;  2JZB B;  8ICY A;  3M6Z A;  5EE0 A;  4C8O A;  5KFB A;  2WF8 A;  3L3F X;  5ALP A;  9ICE A;  1SZH A;  4WJ3 B;  3PZP A;  3ONN A;  4FZN A;  5B66 U;  2YMQ A;  5J8Y A;  2E8P A;  1L3S A;  9ICK A;  3F53 A;  3PW2 A;  4JWM A;  4BXO B;  1SL1 A;  3PX4 A;  2HBM A;  4PL1 A;  3TKA A;  3H0M B;  5KAF U;  2FMQ A;  3IN5 A;  4PGX A;  9ICM A;  2KKP A;  2E8N A;  5JTI A;  2DF4 B;  1A77 A;  5ALD A;  5J2H A;  1XNS A;  4QZI A;  2HDO A;  5JRT A;  1FEZ A;  4F71 A;  7ICQ A;  4KLG A;  5CR0 A;  3D2N A;  3H40 A;  1SL2 A;  5AK4 A;  2RRD A;  2P6R A;  5KFN A;  2NYV A;  4RNM A;  4YR0 A;  3BQ1 A;  2DUY A;  3RFA A;  7ICH A;  2DBY A;  1YT3 A;  2P35 A;  1XS9 D;  3V6H A;  4P0Q B;  3RB3 A;  1SKR A;  3O0F A;  4UB3 A;  2AGQ A;  4O3M A;  4XQ8 A;  2ZIU B;  1ZQW A;  2DL0 A;  1Q3U A;  5DDY A;  4UB4 A;  4C4T A;  5FP0 A;  3BQ0 A;  4UB8 U;  2FMS A;  2W9C A;  4EX7 A;  9ICS A;  8ICG A;  2OHF A;  4R65 A;  2EQY A;  5DB7 A;  4JWN A;  3K1R B;  3SAG A;  3WK8 A;  5EOZ A;  1UPH A;  3I1Y A;  1F5S A;  3WK5 A;  4NV0 A;  3GIM A;  1X40 A;  1EXN A;  3WK6 A;  1ZQN A;  3RR7 A;  4ED1 A;  5ALV A;  1BPB A;  1KW4 A;  3ISC A;  7ICP A;  1AQ6 A;  3UMB A;  2F1J A;  9ICN A;  3EZ5 A;  1KLN A;  4KLH A;  3QU7 A;  3F2D A;  1A76 A;  2AQ4 A;  8ICZ A;  2UVW A;  2CRX A;  3NVV A;  4UBC A;  3MBY A;  3N7R C;  8ICW A;  3ORY A;  7ICL A;  4J9Q A;  1JAL A;  2HVH A;  2QAR B;  8ICT A;  3ISD A;  4J9P A;  3QUC A;  4DSE A;  3L4P A;  2ZIX A;  4GIB A;  2G07 A;  1ZRN A;  2W9M A;  1RYU A;  3EUB 2;  4F4W A;  1DK2 A;  4TUP A;  5KAI U;  3LWL A;  3TAC B;  3OPX A;  4LZG A;  3B9J A;  3M8R A;  4FFD A;  3JPR A;  3MDC A;  3T5K A;  2LKY A;  2H5X A;  3RJJ A;  4M9L A;  3RAX A;  2CXY A;  5EE9 A;  1Z3E B;  4M9G A;  2W03 A;  5ALI A;  4I2H A;  3ZDE A;  2JMG A;  1K1S A;  1QQ7 A;  1PVP A;  2KVC A;  4RQM A;  1QH9 A;  5AM2 A;  1S5L U;  3CYM A;  5CP2 A;  1TAM A;  3F2C A;  4CDG A;  1O08 A;  4DL5 A;  2IHN A;  4K4H A;  2HHW A;  2YTU A;  4F4Z A;  1TV9 A;  3PW7 A;  3HPO A;  1BVS A;  3H4D A;  8ICV A;  3H4B A;  1NK8 A;  4UAU A;  2LHT A;  4XRH A;  5ALQ A;  4P0P A;  4IQU A;  4F2R A;  3MAB A;  3MC1 A;  5AKK A;  3WKB A;  3EW9 A;  4F3O A;  3RTV A;  1K1Q A;  3T79 A;  4F4K A;  1IM4 A;  4UAR A;  3SI8 A;  5F9L A;  4QZG A;  5ALU A;  2D6F C;  3ALR A;  4NLN A;  3ZDD A;  3QZ7 A;  3HRD D;  1VDV A;  3NS1 A;  1A6S A;  2UVV A;  4RNN A;  3PR4 A;  4O3Q A;  4QZB A;  4FBT A;  4C8K A;  1ZQI A;  5ALX A;  4C4S A;  2KZ3 A;  1BNP A;  4ZH4 A;  5AKX A;  3RH4 A;  1HUZ A;  2OXO A;  2HHQ A;  5K4L A;  4GXK A;  3SMV A;  3WK9 A;  2ZIV A;  3G6Y A;  4F4X A;  1K5O A;  4J9O A;  2K4H A;  2IA6 A;  8ICU A;  4QZE A;  5D46 A;  1SWV A;  1JRP A;  5J0P A;  3HWT A;  3AUO A;  4Y2J A;  2F76 X;  3AN1 A;  4FS2 A;  1L6N A;  4Q8F A;  4R66 A;  3KFU F;  3OSP A;  1WCL A;  1OUQ A;  1XSP A;  3AU2 A;  2A19 A;  4DL2 A;  1ECW A;  1KQQ A;  2LM1 A;  4ECS A;  1PK3 A;  2PMZ C;  4EBC A;  5EE3 A;  2BPC A;  4ACO A;  1N62 A;  2Y9T A;  4F50 A;  2HBJ A;  2HI0 A;  1WWU A;  3PW0 A;  5IIK A;  2AGP A;  5KT6 A;  1BPZ A;  1X9M A;  2B6G A;  3BZK A;  2E8O A;  4JV2 A;  1L7M A;  7ICG A;  4J03 A;  2Y1I A;  1TFR A;  4UB5 A;  1DRG A;  5III A;  4O9M A;  1UCV A;  4C8L A;  2KIW A;  3SD7 A;  2I6X A;  1QSS A;  3MGH A;  1V97 A;  1HJP A;  3ISB A;  5KFA A;  3MGI A;  3WKA A;  1Z4N A;  3V6J A;  1QQ5 A;  1T3Q A;  4TQS A;  4EYH B;  4LJX A;  2BQU A;  4DLG A;  3PW4 A;  4EBE A;  2VKQ A;  4OJL A;  1S9F A;  3HJE A;  1D8B A;  5HR7 A;  2XCA A;  5AIC A;  4I29 A;  5G5H A;  5EWG A;  5J2J A;  5AI8 A;  3UM9 A;  2GH1 A;  1QCK A;  3Q8M A;  5AK3 A;  2JV3 A;  1U9L A;  1WG8 A;  4OJP A;  2JR5 A;  4F4Y A;  3WK4 A;  2Z7J A;  4F5R A;  2YMP A;  2PFN A;  4ELT A;  1RQL A;  1ZQE A;  1ZQB A;  2QB0 A;  5DLF A;  4TUQ A;  4ED0 A;  2F3N A;  2C22 A;  4MHV A;  5J2B A;  2KSO A;  5L1K A;  5ALW A;  2KKV A;  4Y2V A;  3VCB A;  5KFI A;  5KFT A;  4RQ2 A;  1FFU A;  4U6P A;  2ZIW A;  4R8U A;  2FLN A;  4YVZ A;  1PVR A;  2ES6 A;  2GO7 A;  4J9S A;  3FAH A;  2P66 A;  2R8G A;  5TIS U;  4MF8 A;  5DB6 A;  4J9L A;  5KFE A;  3GDX A;  4QZH A;  3C5F A;  1MA7 A;  4EBD A;  1T3N A;  1ZQU A;  1P7D A;  4TUR A;  1ZQP A;  3B0Y A;  1NK0 A;  2LYA A;  4ECU A;  1ZQM A;  5G5G A;  4ICA A;  4NLB A;  2F77 X;  3OHB A;  4Q45 A;  4JK1 A;  4AYB C;  3FYH A;  2F8K A;  3M7D A;  2JEF A;  5DKW A;  4J9M A;  3J81 j;  4FO6 A;  1ZRM A;  3NAS A;  3FDS A;  3SR6 A;  4DLE A;  5J2I A;  1DGJ A;  4I2D A;  1NK4 A;  4RQ3 A;  4JV0 A;  2HOQ A;  5D49 A;  5J2A A;  1YZ7 A;  3TFS A;  2XO7 A;  3KZX A;  4IQW A;  5AIA A;  4DL6 A;  3QEB Z;  2IOF A;  2BPF A;  4KN7 A;  2I5H A;  4F5O A;  2LM4 A;  4F92 B;  4TUS A;  2MUT A;  3QU9 A;  3UMG A;  5KFJ A;  3RJE A;  8ICL A;  3NUQ A;  5JU5 A;  4CF4 A;  1RG6 A;  5IIL A;  1KKX A;  3WKC A;  4YXM A;  4RT3 A;  2K60 A;  5KFQ A;  3IG8 A;  2WB1 C;  2W9C B;  4MFC A;  3GFK B;  4US8 A;  2K8B B;  1ZOL A;  2RHF A;  1ED1 A;  4ECW A;  3TAN A;  1FFV A;  4Q43 A;  2WHE A;  2VAN A;  4NLC A;  4GXJ A;  1T4G A;  5KFK A;  5ALT A;  5J29 A;  3ZD9 A;  4M04 A;  1SV0 A;  7ICE A;  4OJ5 A;  1ZQH A;  9ICO A;  1NJZ A;  3KD3 A;  4QWA A;  2BGW A;  5KFD A;  2AJQ A;  3RB0 A;  3IDW A;  1NJW A;  7ICN A;  3UPQ A;  4KLQ A;  1B43 A;  2N1R A;  3TAD C;  2MU2 A;  1L7P A;  3TFR A;  1WYG A;  5J2C A;  1N61 A;  1S0N A;  4IQV A;  4CCH A;  3OTQ A;  4UBB A;  4B9N A;  2K8A A;  9ICW A;  1ZD4 A;  1NJY A;  2ALZ A;  4I2J A;  1U4B A;  3SV3 A;  1X6I A;  5KFH A;  1BPY A;  2F1I A;  3H8J A;  2R8K A;  3IP4 B;  1NK6 A;  5CJ7 A;  4YD1 A;  5AKJ A;  1Y88 A;  1TVA A;  3ICX A;  4IL6 U;  3H0R B;  1T94 A;  4HAI A;  4QZ8 A;  4P2H A;  5AM3 A;  4CF3 A;  4G9B A;  2ZIX B;  4O3N A;  4GC6 A;  2PFO A;  1XO1 A;  5KFZ A;  4DEZ A;  3TQ1 A;  2YN4 A;  1ZQ1 C;  5KFV A;  3R9K A;  7ICR A;  4PGY A;  1CRX A;  1RZT A;  4YCX A;  1NKC A;  2H3Q A;  2NO4 A;  3C2L A;  5KFX A;  3C2M A;  4DOA A;  4BJQ A;  4MEX A;  4QW8 A;  2FPM A;  4I2A A;  4IRK A;  1PK1 A;  1Z1B A;  1PVQ A;  1UQV A;  4QNL A;  2W8K A;  5CB1 A;  2F1H A;  2ZTE A;  4YMN A;  3H8S A;  5KG3 A;  5EWF A;  5J0O A;  1IIP A;  1WWV A;  3RJH A;  3PVX A;  3ZDC A;  1ZJN A;  5ALG A;  5KG7 A;  3PR5 B;  3TAR A;  4PH5 A;  1SV0 C;  2A1J A;  4DSF A;  2FE9 A;  1N2X A;  4RUA A;  1T8E A;  5L1J A;  1ZQL A;  4ZOH C;  5HHI A;  3AMZ A;  1Z00 A;  4P0P B;  2J6S A;  2ZJA A;  2RDI A;  2HBL A;  4FZM A;  3RH5 A;  3KKA A;  4YMM A;  2HHU A;  2C2E A;  4JV1 A;  2H3F A;  2M0N A;  1TK8 A;  2CPR A;  4RQ4 A;  1HIW A;  2KJ5 A;  3MDA A;  2JHD A;  2BQR A;  3QX7 A;  2MAX A;  4PZO A;  5KL1 B;  4KLL A;  1KTQ A;  2BZF A;  4XUS A;  3N7S C;  2AU0 A;  3PX0 A;  1NZB A;  1JIH A;  1JX4 A;  3T5H A;  3WU2 U;  2WF5 A;  1F44 A;  1ZQG A;  1ZQT A;  2GOL A;  2DKZ A;  5AI9 A;  2RP5 A;  3PSP A;  3LVV A;  2F8L A;  3QNM A;  1S0M A;  3V72 A;  3BS5 A;  2QLT A;  2ATL A;  4IS7 A;  7ICV A;  3K1Z A;  2Q4T A;  2J6U A;  1F0M A;  3QUQ A;  2W9A A;  2WF9 A;  5AKY A;  3K75 D;  4RPY A;  1ZET A;  4GC7 A;  1U45 A;  1ZQJ A;  3SV4 A;  1D9F A;  4MF2 A;  2JEI A;  3MR2 A;  2V9W A;  2W43 A;  2FLL A;  4XA5 A;  4QIW F;  2W04 A;  4R63 A;  4PGQ A;  4JMU A;  1ZYQ A;  1X6J A;  4QWB A;  1NKE A;  1JUD A;  1MQ3 A;  1MC8 A;  5CA7 A;  4I2C A;  5KNI A;  5KT7 A;  1NKB A;  7ICJ A;  1SB3 C;  2KTQ A;  2YX8 A;  4UAY A;  4P4M A;  3OHA A;  2W7P A;  1QSY A;  2ZUD A;  3KTQ A;  4UAZ A;  1XSN A;  2IOH A;  1KRP A;  4YR2 A;  1ZD5 A;  4NM2 A;  3C5G A;  1V9P A;  4DFD A;  3M1Y A;  2RQ5 A;  1JI7 A;  2XGQ A;  1NI3 A;  2ODG A;  9ICG A;  3H7I A;  1RDF A;  5AM0 A;  9ICF A;  3KKA C;  4Z6C A;  4DSI A;  8ICO A;  1LKY A;  2WFA A;  3GII A;  2R8I A;  3BQ2 A;  2XY6 A;  3Q8L A;  3C1Y A;  3UXN A;  3NRZ A;  1NK7 A;  3E0F A;  3PSF A;  2FI1 A;  2KJ8 A;  5KFL A;  3MR3 A;  2V4R A;  1Z1V A;  8ICH A;  3RB4 A;  4F93 B;  4RQ8 A;  4KLD A;  4F91 B;  2ISO A;  4BXO A;  3QXG A;  2GLE A;  4OD0 A;  5KFC A;  2ZXH A;  3Q8R B;  3IV6 A;  1HEK A;  3DV9 A;  3FC4 A;  3PV8 A;  1S76 D;  3AU6 A;  4ED8 A;  3N97 B;  5KT3 A;  4X5V A;  4CGZ A;  4KMU A;  2W3S A;  1ZQR A;  5GTI U;  3CNH A;  2XIC A;  4UB6 U;  5TZV A;  3BZC A;  2KHV A;  5AM4 A;  3TAQ A;  4C80 A;  3SEN A;  2BR0 A;  1BPE A;  2WAQ C;  2ZJ8 A;  3HW8 A;  5KFF A;  2JGA A;  3CRX A;  2MA1 A;  3RJK A;  2ZIW B;  5AM5 A;  2ZIU A;  9ICB A;  4GXI A;  1N56 A;  1NNL A;  5ALL A;  1L3V A;  3RH6 A;  5BOL A;  2ASD A;  4M6W B;  1ZQD A;  2EAO A;  5CWR A;  1MN8 A;  2EAP A;  2PI4 A;  7ICT A;  2E3T A;  4FZL A;  5AKG A;  3JPT A;  5AM1 A;  1HUO A;  3A0H U;  8ICX A;  2RDJ A;  4CE6 A;  4R64 A;  7ICO A;  5ALH A;  4EZ9 A;  4EEN A;  4UAT A;  2W11 A;  4DQQ A;  3SAH A;  1U48 A;  4ECZ A;  2PI5 A;  4E0D A;  4DFP A;  1GO3 F;  1L5U A;  1X42 A;  4HYK A;  2JXJ A;  3JPO A;  1NZP A;  3IM1 A;  3WKD A;  5KG4 A;  3ZI4 A;  4M47 A;  9ICU A;  3LK9 A;  2B21 A;  4Y2Q A;  4DQS A;  4DF8 A;  1B0X A;  2R18 A;  3H0L B;  3GV5 B;  5AIB A;  3AQE A;  1U49 A;  2XY7 A;  2YQE A;  4DO9 A;  5J0R A;  1N60 A;  4NM1 A;  2VIX A;  4UW9 A;  8ICI A;  1N63 A;  1QQ6 A;  2W9B A;  3V7J A;  4IR9 A;  8ICC A;  1DK3 A;  2BQ3 A;  5L1I A;  9ICP A;  2L5Y A;  2KHQ A;  5IIN A;  3H8M A;  2E1F A;  1Q3V A;  1QLN A;  2KVS A;  3JPQ A;  1MSW D;  3GZF A;  4MFA A;  3Q8S B;  4M9J A;  2W8L A;  4QWC A;  4P4P A;  3PST A;  3RJF A;  3DEE A;  4RUC A;  2IMW P;  1L7N A;  1X9S A;  2PKE A;  2K8C B;  8ICB A;  1Z4O A;  2OYY A;  3JPP A;  1O03 A;  9ICJ A;  3D6J A;  2UVU A;  5IIO A;  2AGO A;  3WK7 A;  7ICS A;  5DG7 A;  2A1A A;  4Y2T A;  4DFK A;  2HSZ A;  5EE1 A;  3NTU A;  1NJX A;  1VLB A;  2YMM A;  2WF7 A;  8ICJ A;  3THV A;  1KN5 A;  3C23 A;  1S77 D;  3OGU A;  1LV5 A;  1MQ2 A;  2KN7 A;  1JN3 A;  3U26 A;  1DOQ A;  3UXP A;  1D8L A;  2VA2 A;  4C8M A;  2BPG A;  4KLF A;  3T5L A;  4DQP A;  4DQI A;  2ZJ5 A;  5KT2 A;  4RQ6 A;  3HIL A;  5F3X B;  3ZDB A;  5J2K A;  5L1L A;  1UT5 A;  5DBA A;  5KFW A;  4O3O A;  4NLG A;  3SAF A;  4PHD A;  5KFY A;  5J0S A;  2BKE A;  3GIJ A;  1JMS A;  4MFF A;  4Z6D A;  4DCC A;  4EX6 A;  1VJ5 A;  2AXT U;  1BPD A;  5KFG A;  2I9G A;  3TAD A;  2Y0S F;  5AKL A;  1TK0 A;  4KLM A;  3UQ2 A;  3T3F A;  2W55 A;  2J6T A;  2QKQ A;  5T14 A;  3QUB A;  4OJO A;  4Q44 A;  4ED7 A;  2KMD A;  3A0B U;  3PX6 A;  4LZD A;  8ICE A;  4YXJ A;  3B0X A;  1SGG A;  2G5H B;  3G6V A;  2XCP A;  2LI6 A;  2BCR A;  1ZQO A;  9ICT A;  4IRD A;  1J97 A;  2MRL A;  4C4R A;  2WF6 A;  4BGD A;  5D4B A;  1LVH A;  3H8W A;  3N28 A;  1XO0 A;  3F5A A;  1KSP A;  2ZTC A;  4DSJ A;  2HMX A;  4NJ8 A;  2A1J B;  3GV7 B;  3KZI U;  4RQ1 A;  4O3S A;  3S6J A;  2Y1J A;  2OWO A;  4KLO A;  2NV3 A;  1M6Y A;  5B5E U;  4YQW A;  1NOM A;  4IC9 A;  1WCN A;  2G08 A;  2HHS A;  2JRZ A;  3I28 A;  2LPE A;  4DQR A;  5ALK A;  2YB4 A;  1Z00 B;  2W54 A;  3Q8P B;  2ZTD A;  5KG0 A;  5J0W A;  3UMC A;  3M6K A;  4PZN A;  2NRX A;  1S0V A;  1WUD A;  3RR8 A;  1ZQX A;  2AQ0 A;  4DFM A;  4RPX A;  2E8M A;  4P4O A;  2WTF A;  4US9 A;  2ASJ A;  3E58 A;  5HMM A;  2CN1 A;  3GIK A;  5IIJ A;  5J0T A;  4I2G A;  2H3V A;  1FIQ A;  3BDP A;  4EEK A;  4UAV A;  2KIV A;  3PML A;  4AYB F;  3M9O B;  5AI4 A;  5ALZ A;  2BCU A;  2ZUB A;  3PY8 A;  1XU4 A;  4C7Y A;  3AM9 A;  1KFT A;  5AI6 A;  2Q0Z X;  2BCQ A;  2LMR A;  2OM6 A;  3QYP A;  1PZN A;  1ZQC A;  3NVY A;  3MFI A;  4OJ6 A;  1L8O A;  3F5E A;  1URJ A;  1A0P A;  4M9N A;  3N4M B;  2FPK A;  5ALE A;  2HVI A;  1NK9 A;  4I27 A;  1DGS A;  1Z19 A;  7ICI A;  3V6K A;  2VA3 A;  4FS1 A;  2GWS A;  4ECY A;  4TQR A;  9ICR A;  3HKZ F;  4BUG A;  1BGX T;  4NLK A;  9ICA A;  4RQN A;  2EAM A;  2C28 A;  3MR5 A;  3IRU A;  5KL8 B;  1Q8K A;  3RRG A;  3CP8 A;  1D9D A;  1L3U A;  3LDA A;  5HP4 A;  1CEZ A;  2KFN A;  4Y2Y A;  3BQT A;  2WB1 F;  1RXW A;  5AKH A;  3RAQ A;  1ZQK A;  4KLI A;  3EYZ A;  1C20 A;  5ALR A;  3IG5 A;  1LKY B;  1CI4 A;  4Y2P A;  4UAW A;  4KX3 A;  1B22 A;  3JPS A;  4JB3 A;  3KHL A;  4BWJ A;  2YB1 A;  5IIM A;  4PHA A;  4ELU A;  1UA0 A;  3RF9 A;  2BDP A;  2VJ4 A;  1H38 A;  2IBK A;  2C2R A;  4IRC A;  4IQT A;  4MEY A;  3DDH A;  2F2A B;  3RBD A;  3AEV A;  4UAS A;  4C7Z A;  5AK6 A;  2KOB A;  1BPX A;  4QIW C;  2R8J A;  4ECX A;  4B6J A;  4QZA A;  2ZXI A;  3RJI A;  4DSL A;  1SV4 A;  3HP6 A;  4Y2R A;  2RLT A;  5AKE A;  1KDH A;  4B9T A;  5CRX A;  3JPN A;  2NRZ A;  4USA A;  2DFL A;  1SL0 A;  3BQ7 A;  4F2S A;  1L8L A;  8ICQ A;  2YY6 A;  2KEY A;  1ZQZ A;  4NL9 C;  1UHU A;  3QU5 A;  2KZZ A;  3M9N B;  5J0Q A;  4GFJ A;  4BX9 C;  2EZX A;  5KFR A;  4KX5 A;  4OCZ A;  3T5J A;  2ZG6 A;  2HCF A;  5J2F A;  4EZ6 A;  2PFQ A;  3ETL A;  4Z6E A;  2ISP A;  1RYS A;  1L7O A;  4KLS A;  5J0Y A;  2ZIV B;  3C29 A;  1B4F A;  5J2G A;  4B9L A;  2FMP A;  1J2N A;  8ICR A;  4LVS A;  3KHH A;  1SXE A;  1RM6 C;  3EPG A;  5DBB A;  1RYR A;  4CRX A;  4J9K A;  5J8Y C;  4EEL A;  5KG2 A;  2EDU A;  2XY5 A;  4NY8 A;  2MSN A;  3NVZ A;  3SEI A;  2C2D A;  2KFZ A;  4I2B A;  1XC9 A;  5KFO A;  4ECQ A;  4O5E A;  4F5Q A;  2DQN B;  3MGV A;  9ICH A;  3GU3 A;  5DQG A;  3CW2 C;  5A0L A;  3ZDA A;  3V7L A;  7ICM A;  2Y9U A;  5DQI A;  4FBU A;  2EZY A;  4EYI B;  3PW5 A; 
#chains in the Genus database with same CATH homology
 2R18 A;  2KOB A;  2ZXH A;  3H0L B;  3PZP A;  3N7S C;  3IP4 B;  4KMO B;  2H3I A;  3ONN A;  4FZN A;  4QIW C;  3T79 A;  1NZB A;  2KJ9 A;  2VKQ A;  3AQE A;  1HEK A;  4OJL A;  2ZXI A;  3F53 A;  3HKZ C;  1D8B A;  3F2D A;  3ICX A;  1F44 A;  2DGZ A;  2D6F C;  2GOL A;  2HBM A;  2E1E A;  2OM6 A;  3ALR A;  4PL1 A;  2RP5 A;  1T94 A;  2VIX A;  3H0R B;  3LVV A;  3PSP A;  2F8L A;  4NWI A;  2CRX A;  4CGZ A;  3H0M B;  2HOQ A;  5CRX A;  1A6S A;  2K4E A;  2LYB A;  2XVT A;  3N7R C;  4FE3 A;  3IN5 A;  2ZIX B;  4OJ6 A;  3AL0 B;  5HR6 A;  2GH1 A;  3PSI A;  5C0Y A;  2JH1 A;  2Y0S F;  1URJ A;  2KKP A;  2Q4T A;  1A0P A;  3F5E A;  3K1Z A;  3KZX A;  3SQI A;  2HOI A;  2XIC A;  4OJP A;  2KEY A;  2XID A;  2DF4 B;  2LBO A;  2KHQ A;  1XNS A;  2Z7J A;  2E1F A;  5T14 A;  1ZQ1 C;  2KHV A;  3LVW A;  1Q3V A;  1Z19 A;  4OJO A;  4GFJ A;  4BX9 C;  4KX5 A;  3D2N A;  2ZIX A;  1KBU A;  2KD1 A;  3GZF A;  2G07 A;  2K4I A;  1CRX A;  2ZG6 A;  2G5H B;  2RRD A;  4QIW F;  2W04 A;  3NRW A;  2OXO A;  4JMU A;  2A3V A;  3N7P D;  3SMV A;  2H3Q A;  3PST A;  2MRL A;  2ZIV A;  3AQF A;  3DEE A;  2WAQ C;  3F2B A;  2W7O A;  2JGA A;  3HKZ F;  4BUG A;  3NUQ A;  2MA1 A;  3CRX A;  4OO1 J;  2K4H A;  2ZIW B;  3OPX A;  1XO0 A;  3F5A A;  2WAQ F;  2K8C B;  2KNJ A;  2ZIU A;  5KL8 B;  3RFA A;  2G5I B;  2KKV A;  2LKY A;  2OYY A;  4BJQ A;  2HMX A;  1YT3 A;  2YX8 A;  4P0Q B;  2ZIV B;  3C29 A;  3CP8 A;  2H3Z A;  3O0F A;  1Z1B A;  3VCB A;  2F76 X;  1PVQ A;  4QNL A;  3IG8 A;  2WB1 C;  4O3M A;  1L6N A;  2NV3 A;  2E5S A;  2BDU A;  4A8E A;  2XI9 A;  2W7P A;  2ZIU B;  4IC9 A;  4U6P A;  2ZIW A;  1IIP A;  2WB1 F;  2VJ5 A;  2G0A A;  2G08 A;  2K8B B;  2W03 A;  3LYS A;  4FZL A;  3D2Q A;  1PVR A;  1Q3U A;  2RHF A;  1OUQ A;  3KFU F;  2JMG A;  2YB4 A;  1ED1 A;  4P0Q A;  3IG5 A;  1PVP A;  2JH7 A;  2KVC A;  1ECW A;  3M6K A;  4NLC A;  3CYM A;  2PMZ C;  4KX3 A;  4PL2 A;  4CRX A;  1TAM A;  1WUD A;  4ACO A;  3F2C A;  4CDG A;  2HBJ A;  2G09 A;  4OJ5 A;  1MA7 A;  1P7D A;  3SAH A;  3VC8 A;  4P0P B;  2LYA A;  2YB1 A;  2KIC A;  2OH2 A;  3SAG A;  2DQN B;  1GO3 F;  3MGV A;  4ICA A;  2HBL A;  4FZM A;  1UPH A;  3RF9 A;  2HBK A;  3D2S A;  3GU3 A;  2K89 A;  2VJ4 A;  2CN1 A;  4NLB A;  2G06 A;  2N1R A;  3E0F A;  2F77 X;  3PSF A;  4C0Z A;  4U7C A;  1DRG A;  5HR7 A;  3C28 A;  4NV0 A;  2KJ8 A;  2H3F A;  2M0N A;  2Y0S C;  2LHT A;  5A0L A;  4AYB C;  2H3V A;  2CPR A;  1HIW A;  2KIW A;  2KJ5 A;  3M6Z A;  2JHD A;  4P0P A;  2KV2 A;  2K8A A;  4AYB F;  3L3F X;  5KL1 B;  2F2A B;  3M7D A;  2HOF A;  1SZH A;  2PMZ F;  4WJ3 B;  3SAF A;  4QJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...