1A6SA

M-domain from gag polyprotein of rous sarcoma virus, nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
b'GEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Solution structure and dynamics of the bioactive retroviral M domain from Rous sarcoma virus
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
total genus 18
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02813 Retro_M Retroviral M domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1a6sA00
4IC9A 1UPHA 4JMUA 1ED1A 1HEKA 1TAMA 2HMXA 2N1RA 2JMGA 2H3ZA 2H3QA 2K4HA 2LYBA 1HIWA 4ICAA 2K4EA 1L6NA 2H3FA 2LYAA 1ECWA 2H3VA 2H3IA 2K4IA 1A6SA 2NV3A 2GOLA
chains in the Genus database with same CATH superfamily
5KT3A 5A0LA 4IC9A 1SV0A 3LYSA 4NXZA 1L7NA 4DLGA 3LVWA 2Y9TA 2DGZA 4IQUA 9ICLA 4Y2SA 5C0YA 4F4KA 2NO4A 5DB7A 3LWMA 5HMMA 8ICVA 5AICA 4F8RA 2ZUDA 3PSTA 1KQQA 1U9LA 4NLNA 5L9XA 1KBUA 1T94A 2JZBB 1Q8KA 5ALQA 3N4MB 4FZLA 1RYUA 3LDAA 2JHDA 2ZJAA 3UXNA 4DF4A 2YY6A 3N97B 1BVSA 5BOMA 2P35A 1DXSA 4UARA 3IRUA 3C23A 5AKGA 5KT5A 3ISCA 2W8LA 4QW8A 5TZVA 2DPJA 3ZDEA 5AK3A 3SV4A 4MFCA 3A0BU 3QU7A 2BDPA 1X9XA 2FLLA 1KFSA 4YG2A 3RTVA 5KNIA 2G08A 3WK9A 1KSPA 4LJXA 4E0DA 1NOMA 3ISDA 3V6HA 4CE6A 2E1FA 1B0XA 2FLNA 4PJ0U 2HBJA 5EE1A 7ICEA 1L5UA 2YMQA 5KFHA 3TADC 2LKYA 3BJYA 2VANA 2IHNA 3WK7A 3RJGA 4WJ3B 1FEZA 2Q0ZX 1ZRNA 1ZQLA 4KLOA 1L3VA 4KLTA 5KG4A 3E58A 5J0YA 4PL1A 1XNSA 2A1AA 4CF4A 4M6WA 5ALDA 2RRDA 3C5FA 2LBOA 2VIXA 2EANA 4Y2JA 1S8OA 3B9JA 4C4RA 3Q8PB 3F2CA 4F3OA 2PFNA 2LHTA 1S5LU 4M04A 2EZXA 1P7DA 5DDMA 5KFTA 1ZD4A 2R8KA 5KFYA 8ICKA 5DLFA 5KAFU 4KLMA 3D2QA 5DBBA 3UQ2A 4Y2PA 3QEAZ 5J8YA 4G3IA 1WWVA 3G6YA 4EYIB 4RQ4A 4DSEA 4QZ8A 4NJ8A 4YMOA 1PVQA 2H3IA 2DPIA 3PW2A 9ICMA 7ICRA 3GZFA 1KRPA 2KJ9A 1V38A 2KD1A 4RU9A 1JUDA 5AI0A 3ED5A 3GU3A 3HPOA 9ICEA 2YB1A 4ELVA 4B9NA 5KG6A 3WKDA 4EZ6A 3T5JA 5IIMA 1TKDA 4I2HA 3V72A 1SL1A 4ECVA 5KT2A 2ZIXA 2OHFA 3E0FA 1KKXA 2FE9A 2ZG6A 2QB0A 8ICIA 2MUTB 2YMLA 4AYBF 1NKBA 4DQSA 2IA6A 2AHOB 1T7PA 3TFRA 1L3SA 4QW9A 1S0VA 4KMUA 4ED1A 1XC9A 5EWEA 3TKAA 5L1KA 4ED7A 3RB3A 3CW2C 4R63A 5KFCA 5T14A 9ICOA 1UPHA 2ZTDA 1X9SA 4IQVA 2KOBA 3GIKA 1QLNA 3QNMA 4Q43A 4P0QB 4G9BA 2CXYA 3KTQA 3ETLA 2DBYA 3C28A 1NJXA 8ICEA 4RUCA 2NO5A 3GV7B 5J2HA 8ICXA 1WUDA 4FS2A 2KP7A 1HUOA 3M9OB 5F9NA 3KHRA 1NJWA 8ICBA 4J9OA 1RYRA 3H8JA 1RG6A 4P4PA 3THVA 5KFSA 1MN8A 2MRLA 1XS9D 1DGJA 5AKLA 2PFPA 3WKAA 2WAQF 3D6JA 2ZJ5A 4IRKA 3HRDD 3PV8A 4RQMA 3QU9A 4US9A 2W9BA 4QWDA 5KL1B 1S0NA 4J9PA 1ZQUA 2RP5A 5KFRA 2KIVA 5ALGA 2JEGA 3RJEA 4QWBA 4K4IA 3RRGA 4ECWA 2H3QA 3B0YA 4ICAA 3CP8A 3RJFA 1KEJA 4QZDA 1BPYA 4YR3A 3OGUA 4ED3A 3PR4A 4PZNA 2HBMA 2F1IA 2WFAA 2ZIUA 5CJ7A 2HI0A 2HHQA 1QH9A 3ISBA 1JXLA 5KG5A 2JMGA 1FIQA 5CEHA 3WK6A 4MHVA 3BQ0A 2ZIVA 2PKEA 2HHUA 1KLNA 1SZHA 4JWNA 5AI5A 4MEXA 5IILA 4CF3A 2BDUA 3EUB2 3ONNA 5J0WA 4Y2XA 2ASDA 2IOHA 4KLGA 4DFKA 4B9UA 5J0RA 4UBCA 5KT7A 1KW4A 1N61A 3OSNA 2KVSA 5HR7A 2BCQA 1SL2A 3V6KA 3H8SA 1TFRA 2DQNB 3H7IA 9ICSA 3MR2A 3L4PA 5JTIA 2YQEA 3FM9A 3GV8B 3NUQA 9ICPA 2LM1A 3AQFA 3K1RB 2JEFA 4M6WB 2VJ5A 3TADA 5AM3A 3QZ8A 2DKZA 3ZDCA 4AP9A 2PI4A 2W9MA 2ATLA 1B22A 1T8EA 3E2EA 2RDIA 3O0FA 3HKZF 3RB0A 2VA2A 2G07A 2BCUA 2R8GA 4Q45A 4C8OA 3MABA 5J0QA 4R64A 2F77X 3H8MA 2HOQA 2K8AA 4MFAA 2UVVA 4A8EA 4KLLA 3GIIA 4B6JA 3QEBZ 4O3MA 1ZQYA 3WKCA 2XY7A 4Y2QA 2EZZA 4QZAA 4UQGA 3D2NA 5DQGA 1U48A 2XCPA 7ICSA 3BS7A 4EYHB 1CI4A 3KZXA 8ICLA 3RAQA 4F93B 4ECTA 1D9DA 3IV6A 3H0RB 2E5SA 5IIKA 4BUGA 2JZBA 2DWQA 5AKZA 3T3FA 5J0TA 4I2BA 4US8A 4XQ8A 2MSNA 2E8MA 3TQ1A 4DS5A 1PVPA 4IRDA 1ZQMA 4YVZA 2W3SA 2FI1A 2K4HA 1O08A 4B9TA 5B66U 2EZYA 2NRVA 2HHSA 5DGAA 3F5EA 5DBAA 1A76A 4F5QA 1QCKA 4O3RA 2HBLA 1VDVA 3ORYA 5J2DA 3Q8SB 4R8UB 3MDCA 2BPGA 9ICRA 3SYZA 4QZHA 5JUMA 4TQSA 2OEHA 3PNCA 2WB1F 3GFKB 4GXKA 1ZQ1C 3HX0A 3T79A 5J2KA 4KLJA 3H0LB 3KD3A 4PHAA 3OPXA 4UAUA 5ALIA 5EWFA 2W7PA 1YZ7A 1Z4OA 5FP0A 5DG7A 4I2JA 8ICOA 2RLTA 4X5VA 4I2GA 9ICUA 3BS5B 5CA7A 5AI6A 4YMNA 1UQVA 2W9AA 8ICTA 1ZRMA 1IIPA 2ESEA 1MSWD 4RUAA 5DDYA 1TE2A 2R8JA 2IBKA 3T5KA 5DQHA 3AU6A 2YTUA 5ALKA 4BWJA 1XSLA 2NRZA 3FC4A 2XIDA 1TK0A 5B5EU 1SKWA 2HVIA 5J0PA 4P2HA 1Z3EB 5J2EA 2ISPA 3C2MA 2BQUA 4GC7A 4Y2TA 4DL6A 3RR7A 2EH9A 2F1HA 3KHHA 1HJPA 3KZIU 1T3QA 1N2XA 4OJ6A 2PFQA 2NRXA 4O3PA 3SI8A 4EBDA 2B0CA 1Z1VA 2BPCA 2VA8A 5AIBA 1ZQVA 1Q46A 3DV9A 2GLEA 3NVVA 4CDGA 4PH5A 1JMSA 1UT8A 1S0OA 1AQ6A 1GO3F 1ZQEA 4TQRA 1ZQCA 4RPYA 2JV3A 2MUTA 3GIJA 5ALHA 5KG7A 4DSFA 4DL7A 4JUZA 4BXOB 4PL2A 3PMNA 1TAMA 4YP3A 4UATA 1L8LA 5GTIU 3GIMA 2ISOA 2KSOB 1JRPA 9ICHA 1KDHA 4DOAA 5KFOA 4RQ7A 4TURA 3I1YA 4PHDA 4P0QA 4AYBC 4Y2VA 3I28A 4FS1A 3J81j 1U47A 2XY5A 7ICUA 3C1ZA 3BQTA 1FO4A 2UVRA 5AI4A 4ECXA 2H3FA 2LYAA 5KG2A 4F4WA 2J6UA 4B9SA 2WF9A 1S76D 3OHBA 1JROA 2F3NA 1BPXA 5CHGA 2I1QA 3C21A 5KFQA 4F5NA 4XRHA 5AI8A 3PX4A 1BNOA 4LZGA 5KFXA 3D2SA 1RXVA 1D8LA 5KFBA 5ALJA 1TVAA 4KITB 2EAPA 2BZFA 3B0XA 5J2BA 2HSZA 2B21A 1T4GA 4ZH4A 2QARA 1XO1A 1IG6A 4TUQA 2WAQC 3PW7A 3DEEA 3NVWA 1PUZA 2BGWA 2OM6A 5HP4A 3EW9A 3SR6A 4K4GA 5AK6A 5KFMA 3V6JA 3RJJA 3BZKA 1BPEA 5H2FU 5J0OA 2W11A 4GXJA 5J0SA 5AKYA 5L1LA 1OUQA 2C28A 3AM9A 1MA7A 1BGXT 4YCXA 1NK6A 4DL5A 1NK8A 2N1RA 3ALRA 3PX0A 1SV4A 2HBKA 4C8LA 4B9LA 3IN5A 3LVVA 2KMDA 4PHPA 2ZXHA 2R18A 3KOOA 1RXWA 4F5PA 3H4DA 5G5HA 2CN1A 2V4RA 4ACOA 1U4BA 3UMBA 4J9SA 8ICJA 4F4ZA 1Y88A 2NRWA 3RJKA 4IR1A 2QKQA 2D6FC 1BPZA 4F5OA 3HW8A 3RAXA 5J2IA 5AM0A 1NK5A 4J9MA 1B4FA 2AQ4A 2GO7A 4YD2A 2FJ6A 3V7LA 7ICPA 2KJ8A 1RQLA 3HKZC 4PPXA 4CCHA 4NL9C 4UB2A 3TARA 3ZDAA 3RBDA 5KFAA 9ICXA 1L8OA 4PZOA 4KLUA 2E1EA 5EWGA 2A3VA 1N48A 4UAZA 4F4YA 2JR5A 5ALNA 4YR2A 5ALMA 2HOFA 2MU2A 9ICJA 2HHXA 4NLGA 5ALTA 1N5XA 4CRXA 4RNNA 1YT3A 1XWLA 2RQ5A 4DSIA 1JXEA 4KX5A 4KMOB 3OJSA 4C8KA 2IHMA 1X9MA 2LM4A 2E8PA 1X6IA 5L1IA 3KFUF 2JH1A 1RDFA 3PR5B 3SZ2A 1SGGA 4PGXA 4UASA 3NGDA 4R8UA 2WTFA 3CRXA 4JB3A 2I6XA 4PGQA 1SB3C 1URJA 1JIHA 2NRTA 1ZQDA 2ZUCA 4RQ0A 2I9GA 4I2AA 3FYHA 4DQQA 1X66A 2W04A 2DUYA 1JX4A 2NV3A 1DGSA 5EE0A 3BS5A 5DKWA 2KIWA 1F0MA 2IMWP 3QU5A 1J2NA 4KN4A 2A1JB 2JH7A 3HWTA 2WB1C 5TISU 3BQ7A 3MDAA 1UT5A 3ZD8A 2GH1A 8ICMA 1ZQTA 3UMGA 4RQ3A 3M9MB 4M47A 2I5HA 3HILA 2FPMA 2W43A 3UQ0A 3H8WA 1D9FA 4BJQA 1NI3A 4DEZA 4IL6U 4P4MA 4J9QA 4DF8A 1C7YA 1Z00B 1TAUA 5GTHU 4QZ9A 2P6RA 4DCCA 4OO1J 3NRWA 3CYMA 3C1YA 2C2DA 5KL8B 1S77D 3GV5B 2P6UA 2VKQA 3L5KA 2OCEA 1VJ5A 3F2DA 2KJ5A 2QARB 3AN1A 3ICXA 3LK9A 2HCFA 5JU5A 4I27A 4M9LA 5HHIA 2XICA 4DQRA 4FBUA 4UB6U 2C2EA 2Y1IA 1L7OA 2G5IB 4O3SA 3QE9Y 4DOBA 2AXTU 2EQYA 4F92B 3T5HA 4ECRA 2EDUA 4DSLA 3M1YA 1SWWA 3NTUA 1X6JA 1SXEA 2YN4A 9ICCA 1ZQZA 4EBEA 5DLGA 2PXIA 4BXOA 2BR0A 3M6ZA 4QZCA 3EYZA 4EEKA 1HEKA 4QWEA 3F5AA 4I28A 2KSOA 1ZQOA 1F44A 3IDWA 3JPNA 1NJZA 1VLBA 1ZQRA 1ZJNA 2V4QA 3M8RA 3NRZA 7ICQA 5IIOA 4HYKA 3FDSA 2AJQA 2YMPA 3EWAA 2K8BB 9ICAA 4YFKA 4ED6A 4KLQA 2L5YA 2XY6A 2DL0A 3PX6A 8ICFA 3H4BA 2W9CB 2H3VA 2KE7A 1ZJMA 7ICIA 2UVWA 1ZQFA 8ICPA 3S6JA 4DWIA 4C8MA 2YX8A 3TACB 5AM2A 4EENA 5AKHA 2AGQA 4M9HA 4NV0A 2W7OA 2ZTEA 2RDJA 3C2LA 2KG5A 3IP4B 4B9MA 4O3QA 5ALYA 3PSPA 4JWMA 5ALWA 2KV2A 4I2DA 4UB5A 1D8BA 2DFLA 4I2IA 3N7RC 3MR5A 5ALVA 3MC1A 2G0AA 4RNMA 3KKAC 4KN7A 4NL9A 7ICVA 2W03A 2KKPA 4C4TA 2VA3A 7ICJA 4RNOA 3JPOA 8ICGA 1KFTA 2WHEA 2KVCA 1NK0A 4QZBA 2ASLA 1CRXA 5J2AA 4J9RA 3RFAA 4GFJA 4J9LA 4NLBA 9ICTA 3ETRA 4JK1A 4MF8A 4UB4A 2CPRA 2M9NA 3BQ1A 2H5XA 3NASA 2P66A 5EE9A 3TAPA 5AKKA 3IHQB 5IIJA 5DB8A 3V7KA 1LV5A 4KLIA 1N63A 2BHNA 5KT4A 4O9MA 2KICA 2ZJ8A 5KG3A 3WKEA 4ELUA 3C2KA 1C20A 4ZOHC 1LKYB 1N62A 2B6GA 4IR9A 4F5RA 3VCBA 5ALUA 4O5EA 1ECWA 5AM5A 3BZCA 1UHUA 3PSFA 2LPEA 4GLXA 8ICSA 2BQ3A 4DSKA 4CNQA 3Q8LA 2AH5A 2BQRA 2ES6A 5ALZA 4Y2UA 4FZNA 2V9WA 3SAGA 2XI9A 4Q8FA 4NLCA 2D3DA 4BX9C 5AI9A 3WK4A 4QZEA 1PK3A 5L1MA 4QIWF 5J2FA 4GC6A 3RH5A 1U45A 4TUPA 3AMZA 5EOZA 1QSLA 3K1ZA 3TI0A 5J0UA 1CEZA 5KFLA 5KFDA 2M0NA 2EAOA 5DBCA 5AKEA 5KG1A 3M7DA 1PK1B 1ZQGA 5DG9A 1TAQA 4JV2A 1PVRA 4FE3A 4YXJA 3C5GA 2OH2A 4Q8EA 1UA0A 2R8IA 1DK2A 2WF8A 3RRHA 1QSSA 4U6PA 4MEYA 4OD0A 1COKA 5AK5A 4RZRA 5HHHA 5CP2A 1ZQIA 5KFGA 1MQ2A 4Z6FA 5JRTA 1Q3UA 2NYVA 2K4IA 2KZZA 2F8KA 3T5LA 4XA5A 5DGBA 3JPRA 3RJHA 3H0MB 1TK8A 2A19A 3EPIA 2KHQA 4FZMA 7ICTA 3HT3A 1Z4NA 7ICGA 3RBEA 3SENA 5AK4A 4PGYA 1HIWA 2BKEA 1NKEA 2KTQA 1SWVA 1QTMA 3Q8QB 4BWMA 5KTQA 3PMLA 5F3XB 4FFDA 3SV3A 2DF4B 4KLSA 5J29A 2A1JA 2F76X 9ICVA 1IM4A 8ICUA 3QUBA 4KLEA 2J6SA 3RR8A 2XCAA 5ALOA 7ICKA 4RQ6A 5K4LA 4M9GA 2WF5A 1Z00A 1SKRA 3EZ5A 1NK7A 2JEIA 3RH6A 2MAXA 4QZGA 2HHTA 5AKIA 4B9VA 2Y0SF 3WK8A 3PW5A 4F2RA 3IG5A 2H3ZA 4PHEA 4IRCA 2UVUA 3MGVA 5KFEA 5CWRA 3K75D 2ASJA 5HR6A 3Q8RB 2GWSA 3BDPA 4YMMA 2GOLA 5DQIA 2JGAA 2FPKA 2KHVA 2XC9A 3QU2A 4XUSA 2LMRA 2Q4TA 8ICNA 9ICKA 1DOQA 4NLKA 4EELA 4YN4A 1Q3VA 3KKAA 4I2EA 4QZIA 1ZOLA 4BDPA 4P0PA 4RQNA 2JEJA 5KAIU 4F2SA 4DFPA 1ZQBA 4IQWA 7ICHA 2HHVA 2KFNA 1MQ3A 4RT3A 2WF7A 2HMXA 1AROP 5ALXA 4F71A 3WKBA 1QQ5A 8ICAA 1NJYA 4DL3A 2F2AB 9ICIA 4JV1A 3UM9A 4P4OA 2QB1A 4ED0A 5J2GA 3A0HU 1ZYQA 4DL2A 3MGHA 4CF5A 1NK4A 2CRXA 3QUTA 2HHWA 3GDXA 5ALEA 4UAVA 2AU0A 2KN7A 1A0PA 1WYGA 5BOLA 2JRZA 2W9CA 1Z1BA 1HUZA 1KL9A 2C22A 2K89A 5AKXA 3NS1A 2KNJA 5D4BA 3F2BA 4NWIA 1BPBA 1TV9A 1JI7A 1O03A 4RQ2A 2PI5A 4Z6DA 4M9JA 2ZUBA 3QZ7A 1ZD2P 4F50A 4DFDA 4UB3A 2PMZF 3SEIA 4J03A 1K1SA 4KLHA 1NNLA 1DK3A 1OXJA 1XU4A 2RHFA 3N7PD 5E79U 1KFDA 4K4HA 1L6NA 2K4PA 5ALRA 3L3FX 3R9KA 5EE3A 3RH4A 1NK9A 4R66A 3AU2A 3AEVA 4ED8A 7ICLA 8ICQA 4QZFA 5ALPA 4FBTA 1COOA 2MA1A 3MBYA 5KG0A 3OJUA 3TFSA 4IQTA 2K60A 4UAYA 5BPCA 4YD1A 2E8NA 1ZQWA 3JPTA 8ICZA 1V9PA 4UAWA 1ZD5A 5CR0A 2OYYA 5D49A 5J0XA 2Z7JA 3HJEA 4DFMA 1M6YA 2G09A 1LB2B 4RQ1A 3M9NB 2LYBA 4EX7A 4KX3A 5HNKA 1ZQNA 1XSPA 4HAIA 2YMMA 2Y1JA 1NZPA 4O5CA 4EX6A 1QSYA 4I29A 4M2YA 1N5WA 2OWOA 1LKYA 3RB6A 3M6KA 4OJOA 4JV0A 4MFFA 3PO5A 4GIBA 3VC8A 4QJFB 8ICHA 4C7ZA 1PZNA 1L3TA 3PY8A 5ALLA 1DRGA 1EXNA 2OXOA 1NZBA 3GILA 2D8CA 3G6VA 9ICFA 4DL4A 2O6KA 2C2RA 1WCNA 1S10A 3KHLA 4ECUA 3WK5A 4DSJA 4J9KA 4R65A 3MGIA 4EZ9A 2QLTA 2LYHA 5KFWA 1ED1A 3ZDDA 4U7CA 4UBBA 1CUKA 1KTQA 4DLEA 2ZXIA 4LZDA 1B43A 2XGQA 5F9LA 2E3TA 1PK1A 3QYPA 4KTQA 1XSNA 4C4SA 2XVTA 8ICRA 3SAFA 1U49A 4C7YA 3EPGA 3M8SA 1K1QA 4QIWC 3AL0B 1H38A 2AQ0A 4P0PB 5L1JA 2HDOA 1RPLA 2YB4A 5KFIA 5KT6A 4Z6EA 1WCLA 4O3NA 4BGDA 1YZ6A 2KZ3A 2F1JA 1ZQXA 1T3NA 1S9FA 2ZIWA 4ECQA 4RPXA 3UPQA 4FO6A 2E8OA 4ECYA 3RJIA 1FFVA 3IG8A 3MR3A 3AUOA 1IXRA 8ICWA 1BPDA 2DKXA 4Q44A 3TANA 3IM1A 7ICMA 4ELTA 4C80A 4M0AA 5KFNA 5KFKA 1N60A 9ICQA 1JALA 3RB4A 2G5HB 1QQ6A 3QXGA 1JN3A 4ED2A 2F8LA 5DB9A 1SV0C 1SIJA 2FMPA 8ICCA 2HOIA 2VJ4A 5IIIA 2KK0A 7ICNA 2BCRA 3BQ2A 1MC8A 2HVHA 4EBCA 3NVYA 2W8KA 4CGZA 1RYSA 2FMQA 1S0MA 9ICGA 4UW9A 5DG8A 1WWUA 4DS4A 5IINA 4YXMA 5KFVA 5DB6A 1WG8A 5J2JA 3QUQA 4O3OA 1ZQKA 1L3UA 2ALZA 3UMCA 4M9NA 5KFPA 3MFIA 2XGPA 1ZQAA 1SL0A 3KHGA 5HMLA 1X2IA 2Y0SC 1Z19A 3SD7A 4J9NA 2ZIXB 5CB1A 5J2CA 2G06A 2QB0B 3UXOA 3AQEA 1TK5A 2J6TA 1X40A 4F91B 4QNLA 3H40A 2W3RA 4Y2RA 1ZXIA 2FPLA 4DQIA 1ZQSA 1KN5A 1A77A 2LI6A 3PO4A 2BPFA 1A6SA 2KKVA 4ECZA 3JPPA 4TUSA 4KLFA 2ZTCA 4YQWA 3QUCA 4Z6CA 3G6XA 2BCSA 1SXDA 2XO7A 1SKSA 4LVSA 5C5JA 9ICWA 1RQNA 5AHXA 3JPSA 3MFHA 4NLZA 4YR0A 2F44A 1ZQJA 1J2MA 4QWCA 4Y2YA 3Q8KA 2W55A 4DOCA 3LWLA 3ZI4A 1RM6C 4DO9A 1K5OA 3U26A 9ICBA 3PW4A 2KZMA 1RZTA 4JMUA 3Q8MA 3UXPA 9ICNA 3HP6A 3GQCA 1F5SA 4DQPA 4RT2A 5G5GA 4OJLA 1SZPA 3FAHA 4IS7A 2FLPA 5J8YC 3N7SC 3TAQA 4RQ8A 4ECSA 5ALSA 4F72A 3MR6A 1ZQPA 1UCVA 1BNPA 4NM1A 2W54A 3ZDBA 2EAMA 4DFJA 2W9BB 1X9WA 1ZQQA 5AIAA 3QX7A 3ZD9A 7ICFA 3F53A 7ICOA 3OHAA 5AM4A 1LVHA 2WF6A 2Y9UA 3DDHA 3SQIA 4GXIA 2PFOA 3PW0A 1V85A 2PMZC 3WU2U 2HW3A 4MF2A 2AGOA 1J97A 4QWAA 4I2CA 2ZIUB 1UA1A 1QQ7A 4I2FA 5AKJA 5KFFA 3I76A 4OJ5A 3N28A 5ALFA 1X42A 4OCZA 2ZIVB 2AGPA 4UB1A 2ZIWB 4OJPA 2IOFA 2BCVA 2R8HA 2K8CB 1IV8A 5CRXA 3PSIA 1S97A 3PZPA 3K4GA 4UB8U 3JPQA 3QU4A 4USAA 2FDRA 4F4XA 2KFZA 4RQ5A 1ZD3A 2KEYA 1ZETA 3KBBA 1OW5A 1V97A 4O5KA 4C0ZA 8ICYA 4NY8A 4C8NA 5KFZA 1L7MA 3NVZA 2FMSA 5KFUA 2IOFK 1N56A 4EEYA 5KFJA 2JXJA 2ODGA 1D8YA 3V7JA 1L7PA 3OSPA 5D46A 1XO0A 1ZQHA 3OTQA 4KLDA 4RPZA 4O0IA 4NM2A 2K4EA 3CNHA 1FFUA 5AM1A 3C29A 3RF9A 3SAHA 3SMVA 3PVXA 1NKCA
chains in the Genus database with same CATH topology
2JGAA 2VJ5A 1MA7A 3M6ZA 4GFJA 5A0LA 2W7PA 3CRXA 4CGZA 4IC9A 3F2CA 2KHVA 1ED1A 3LYSA 1HEKA 4NLBA 3F5AA 2LHTA 2ZXIA 4P0QA 4U7CA 2OH2A 1URJA 4AYBC 2Q4TA 1P7DA 2N1RA 3ALRA 1F44A 2CPRA 3HKZF 3LVWA 3O0FA 4U6PA 3OPXA 2DGZA 2G07A 2MRLA 2MA1A 1Q3VA 2HBKA 3F53A 5C0YA 3LVVA 1IIPA 3IN5A 2XVTA 3D2QA 2F77X 2ZXHA 3SAFA 2R18A 4P0PA 2HOQA 2K8AA 2H3FA 2LYAA 2WAQF 4A8EA 1Q3UA 2W04A 4QIWC 1PVQA 3PSTA 2H3IA 2K4IA 3SQIA 3AL0B 2NV3A 1KBUA 3GZFA 1T94A 4P0PB 2CN1A 2KJ9A 4O3MA 3H0MB 5KL1B 2Y0SC 2KIWA 2KD1A 2PMZC 2YB4A 1Z19A 4ACOA 2OYYA 2KICA 2RP5A 2Z7JA 2ZIXB 2KHQA 3D2NA 4FZMA 2K8BB 2XIDA 3GU3A 2HMXA 4FZLA 2JH7A 2ZIUB 2G06A 2WB1C 2G09A 2JHDA 2YB1A 3AQEA 2H3QA 2GH1A 4QNLA 2LYBA 3KZXA 1HIWA 4ICAA 4KX3A 2D6FC 3CP8A 4OJ5A 3VCBA 3H0RB 3D2SA 2E5SA 2ZIWA 1ECWA 3PSFA 2H3VA 2ZIVB 2LBOA 4BUGA 2F2AB 1A6SA 2KKVA 4BJQA 2ZIXA 2DF4B 3E0FA 2ZIWB 4OJPA 2HBMA 3AQFA 2ZIUA 2ZG6A 3IG8A 1PVPA 2KJ8A 2F76X 4OJ6A 2YX8A 3HKZC 2G08A 3M6KA 4OJOA 2CRXA 2K8CB 4NV0A 4AYBF 2W7OA 4OO1J 2JMGA 3PSIA 3NRWA 3CYMA 5CRXA 3PZPA 5KL8B 2K4HA 3IP4B 2VKQA 1A0PA 1Z1BA 3VC8A 2E1FA 2ZIVA 3PSPA 4FZNA 2K89A 2WAQC 4CDGA 4QJFB 1SZHA 2E1EA 2HBJA 3F2DA 2KV2A 2KEYA 2A3VA 3SAGA 2G5HB 2KJ5A 2KNJA 2XI9A 3F5EA 3DEEA 3ICXA 4NLCA 1GO3F 2BDUA 3ONNA 4BX9C 3F2BA 4NWIA 1D8BA 4C0ZA 2F8LA 4QIWF 2XICA 2HOFA 2LKYA 5T14A 3K1ZA 3N7RC 1UPHA 4JMUA 1DRGA 2HBLA 2OXOA 1NZBA 2OM6A 4WJ3B 2HOIA 2Y0SF 2PMZF 2VJ4A 2G5IB 4PL2A 4CRXA 1TAMA 1YT3A 5HR7A 2G0AA 2KOBA 2M0NA 4P0QB 3IG5A 2H3ZA 2WB1F 4KX5A 1XO0A 2W03A 2KKPA 4KMOB 4OJLA 4PL1A 1XNSA 2DQNB 1ZQ1C 2RHFA 3M7DA 2K4EA 3N7PD 3T79A 2KVCA 3N7SC 3MGVA 3C28A 3C29A 3RF9A 1L6NA 3KFUF 2RRDA 2JH1A 1CRXA 1PVRA 4FE3A 3NUQA 3H0LB 3SAHA 5HR6A 3SMVA 3RFAA 1WUDA 3L3FX 2VIXA 1OUQA 2GOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC9 A;  1UPH A;  4JMU A;  1ED1 A;  1HEK A;  1TAM A;  2HMX A;  2N1R A;  2JMG A;  2H3Z A;  2H3Q A;  2K4H A;  2LYB A;  1HIW A;  4ICA A;  2K4E A;  1L6N A;  2H3F A;  2LYA A;  1ECW A;  2H3V A;  2H3I A;  2K4I A;  1A6S A;  2NV3 A;  2GOL A; 
#chains in the Genus database with same CATH topology
 5KT3 A;  5A0L A;  4IC9 A;  1SV0 A;  3LYS A;  4NXZ A;  1L7N A;  4DLG A;  3LVW A;  2Y9T A;  2DGZ A;  4IQU A;  9ICL A;  4Y2S A;  5C0Y A;  4F4K A;  2NO4 A;  5DB7 A;  3LWM A;  5HMM A;  8ICV A;  5AIC A;  4F8R A;  2ZUD A;  3PST A;  1KQQ A;  1U9L A;  4NLN A;  5L9X A;  1KBU A;  1T94 A;  2JZB B;  1Q8K A;  5ALQ A;  3N4M B;  4FZL A;  1RYU A;  3LDA A;  2JHD A;  2ZJA A;  3UXN A;  4DF4 A;  2YY6 A;  3N97 B;  1BVS A;  5BOM A;  2P35 A;  1DXS A;  4UAR A;  3IRU A;  3C23 A;  5AKG A;  5KT5 A;  3ISC A;  2W8L A;  4QW8 A;  5TZV A;  2DPJ A;  3ZDE A;  5AK3 A;  3SV4 A;  4MFC A;  3A0B U;  3QU7 A;  2BDP A;  1X9X A;  2FLL A;  1KFS A;  4YG2 A;  3RTV A;  5KNI A;  2G08 A;  3WK9 A;  1KSP A;  4LJX A;  4E0D A;  1NOM A;  3ISD A;  3V6H A;  4CE6 A;  2E1F A;  1B0X A;  2FLN A;  4PJ0 U;  2HBJ A;  5EE1 A;  7ICE A;  1L5U A;  2YMQ A;  5KFH A;  3TAD C;  2LKY A;  3BJY A;  2VAN A;  2IHN A;  3WK7 A;  3RJG A;  4WJ3 B;  1FEZ A;  2Q0Z X;  1ZRN A;  1ZQL A;  4KLO A;  1L3V A;  4KLT A;  5KG4 A;  3E58 A;  5J0Y A;  4PL1 A;  1XNS A;  2A1A A;  4CF4 A;  4M6W A;  5ALD A;  2RRD A;  3C5F A;  2LBO A;  2VIX A;  2EAN A;  4Y2J A;  1S8O A;  3B9J A;  4C4R A;  3Q8P B;  3F2C A;  4F3O A;  2PFN A;  2LHT A;  1S5L U;  4M04 A;  2EZX A;  1P7D A;  5DDM A;  5KFT A;  1ZD4 A;  2R8K A;  5KFY A;  8ICK A;  5DLF A;  5KAF U;  4KLM A;  3D2Q A;  5DBB A;  3UQ2 A;  4Y2P A;  3QEA Z;  5J8Y A;  4G3I A;  1WWV A;  3G6Y A;  4EYI B;  4RQ4 A;  4DSE A;  4QZ8 A;  4NJ8 A;  4YMO A;  1PVQ A;  2H3I A;  2DPI A;  3PW2 A;  9ICM A;  7ICR A;  3GZF A;  1KRP A;  2KJ9 A;  1V38 A;  2KD1 A;  4RU9 A;  1JUD A;  5AI0 A;  3ED5 A;  3GU3 A;  3HPO A;  9ICE A;  2YB1 A;  4ELV A;  4B9N A;  5KG6 A;  3WKD A;  4EZ6 A;  3T5J A;  5IIM A;  1TKD A;  4I2H A;  3V72 A;  1SL1 A;  4ECV A;  5KT2 A;  2ZIX A;  2OHF A;  3E0F A;  1KKX A;  2FE9 A;  2ZG6 A;  2QB0 A;  8ICI A;  2MUT B;  2YML A;  4AYB F;  1NKB A;  4DQS A;  2IA6 A;  2AHO B;  1T7P A;  3TFR A;  1L3S A;  4QW9 A;  1S0V A;  4KMU A;  4ED1 A;  1XC9 A;  5EWE A;  3TKA A;  5L1K A;  4ED7 A;  3RB3 A;  3CW2 C;  4R63 A;  5KFC A;  5T14 A;  9ICO A;  1UPH A;  2ZTD A;  1X9S A;  4IQV A;  2KOB A;  3GIK A;  1QLN A;  3QNM A;  4Q43 A;  4P0Q B;  4G9B A;  2CXY A;  3KTQ A;  3ETL A;  2DBY A;  3C28 A;  1NJX A;  8ICE A;  4RUC A;  2NO5 A;  3GV7 B;  5J2H A;  8ICX A;  1WUD A;  4FS2 A;  2KP7 A;  1HUO A;  3M9O B;  5F9N A;  3KHR A;  1NJW A;  8ICB A;  4J9O A;  1RYR A;  3H8J A;  1RG6 A;  4P4P A;  3THV A;  5KFS A;  1MN8 A;  2MRL A;  1XS9 D;  1DGJ A;  5AKL A;  2PFP A;  3WKA A;  2WAQ F;  3D6J A;  2ZJ5 A;  4IRK A;  3HRD D;  3PV8 A;  4RQM A;  3QU9 A;  4US9 A;  2W9B A;  4QWD A;  5KL1 B;  1S0N A;  4J9P A;  1ZQU A;  2RP5 A;  5KFR A;  2KIV A;  5ALG A;  2JEG A;  3RJE A;  4QWB A;  4K4I A;  3RRG A;  4ECW A;  2H3Q A;  3B0Y A;  4ICA A;  3CP8 A;  3RJF A;  1KEJ A;  4QZD A;  1BPY A;  4YR3 A;  3OGU A;  4ED3 A;  3PR4 A;  4PZN A;  2HBM A;  2F1I A;  2WFA A;  2ZIU A;  5CJ7 A;  2HI0 A;  2HHQ A;  1QH9 A;  3ISB A;  1JXL A;  5KG5 A;  2JMG A;  1FIQ A;  5CEH A;  3WK6 A;  4MHV A;  3BQ0 A;  2ZIV A;  2PKE A;  2HHU A;  1KLN A;  1SZH A;  4JWN A;  5AI5 A;  4MEX A;  5IIL A;  4CF3 A;  2BDU A;  3EUB 2;  3ONN A;  5J0W A;  4Y2X A;  2ASD A;  2IOH A;  4KLG A;  4DFK A;  4B9U A;  5J0R A;  4UBC A;  5KT7 A;  1KW4 A;  1N61 A;  3OSN A;  2KVS A;  5HR7 A;  2BCQ A;  1SL2 A;  3V6K A;  3H8S A;  1TFR A;  2DQN B;  3H7I A;  9ICS A;  3MR2 A;  3L4P A;  5JTI A;  2YQE A;  3FM9 A;  3GV8 B;  3NUQ A;  9ICP A;  2LM1 A;  3AQF A;  3K1R B;  2JEF A;  4M6W B;  2VJ5 A;  3TAD A;  5AM3 A;  3QZ8 A;  2DKZ A;  3ZDC A;  4AP9 A;  2PI4 A;  2W9M A;  2ATL A;  1B22 A;  1T8E A;  3E2E A;  2RDI A;  3O0F A;  3HKZ F;  3RB0 A;  2VA2 A;  2G07 A;  2BCU A;  2R8G A;  4Q45 A;  4C8O A;  3MAB A;  5J0Q A;  4R64 A;  2F77 X;  3H8M A;  2HOQ A;  2K8A A;  4MFA A;  2UVV A;  4A8E A;  4KLL A;  3GII A;  4B6J A;  3QEB Z;  4O3M A;  1ZQY A;  3WKC A;  2XY7 A;  4Y2Q A;  2EZZ A;  4QZA A;  4UQG A;  3D2N A;  5DQG A;  1U48 A;  2XCP A;  7ICS A;  3BS7 A;  4EYH B;  1CI4 A;  3KZX A;  8ICL A;  3RAQ A;  4F93 B;  4ECT A;  1D9D A;  3IV6 A;  3H0R B;  2E5S A;  5IIK A;  4BUG A;  2JZB A;  2DWQ A;  5AKZ A;  3T3F A;  5J0T A;  4I2B A;  4US8 A;  4XQ8 A;  2MSN A;  2E8M A;  3TQ1 A;  4DS5 A;  1PVP A;  4IRD A;  1ZQM A;  4YVZ A;  2W3S A;  2FI1 A;  2K4H A;  1O08 A;  4B9T A;  5B66 U;  2EZY A;  2NRV A;  2HHS A;  5DGA A;  3F5E A;  5DBA A;  1A76 A;  4F5Q A;  1QCK A;  4O3R A;  2HBL A;  1VDV A;  3ORY A;  5J2D A;  3Q8S B;  4R8U B;  3MDC A;  2BPG A;  9ICR A;  3SYZ A;  4QZH A;  5JUM A;  4TQS A;  2OEH A;  3PNC A;  2WB1 F;  3GFK B;  4GXK A;  1ZQ1 C;  3HX0 A;  3T79 A;  5J2K A;  4KLJ A;  3H0L B;  3KD3 A;  4PHA A;  3OPX A;  4UAU A;  5ALI A;  5EWF A;  2W7P A;  1YZ7 A;  1Z4O A;  5FP0 A;  5DG7 A;  4I2J A;  8ICO A;  2RLT A;  4X5V A;  4I2G A;  9ICU A;  3BS5 B;  5CA7 A;  5AI6 A;  4YMN A;  1UQV A;  2W9A A;  8ICT A;  1ZRM A;  1IIP A;  2ESE A;  1MSW D;  4RUA A;  5DDY A;  1TE2 A;  2R8J A;  2IBK A;  3T5K A;  5DQH A;  3AU6 A;  2YTU A;  5ALK A;  4BWJ A;  1XSL A;  2NRZ A;  3FC4 A;  2XID A;  1TK0 A;  5B5E U;  1SKW A;  2HVI A;  5J0P A;  4P2H A;  1Z3E B;  5J2E A;  2ISP A;  3C2M A;  2BQU A;  4GC7 A;  4Y2T A;  4DL6 A;  3RR7 A;  2EH9 A;  2F1H A;  3KHH A;  1HJP A;  3KZI U;  1T3Q A;  1N2X A;  4OJ6 A;  2PFQ A;  2NRX A;  4O3P A;  3SI8 A;  4EBD A;  2B0C A;  1Z1V A;  2BPC A;  2VA8 A;  5AIB A;  1ZQV A;  1Q46 A;  3DV9 A;  2GLE A;  3NVV A;  4CDG A;  4PH5 A;  1JMS A;  1UT8 A;  1S0O A;  1AQ6 A;  1GO3 F;  1ZQE A;  4TQR A;  1ZQC A;  4RPY A;  2JV3 A;  2MUT A;  3GIJ A;  5ALH A;  5KG7 A;  4DSF A;  4DL7 A;  4JUZ A;  4BXO B;  4PL2 A;  3PMN A;  1TAM A;  4YP3 A;  4UAT A;  1L8L A;  5GTI U;  3GIM A;  2ISO A;  2KSO B;  1JRP A;  9ICH A;  1KDH A;  4DOA A;  5KFO A;  4RQ7 A;  4TUR A;  3I1Y A;  4PHD A;  4P0Q A;  4AYB C;  4Y2V A;  3I28 A;  4FS1 A;  3J81 j;  1U47 A;  2XY5 A;  7ICU A;  3C1Z A;  3BQT A;  1FO4 A;  2UVR A;  5AI4 A;  4ECX A;  2H3F A;  2LYA A;  5KG2 A;  4F4W A;  2J6U A;  4B9S A;  2WF9 A;  1S76 D;  3OHB A;  1JRO A;  2F3N A;  1BPX A;  5CHG A;  2I1Q A;  3C21 A;  5KFQ A;  4F5N A;  4XRH A;  5AI8 A;  3PX4 A;  1BNO A;  4LZG A;  5KFX A;  3D2S A;  1RXV A;  1D8L A;  5KFB A;  5ALJ A;  1TVA A;  4KIT B;  2EAP A;  2BZF A;  3B0X A;  5J2B A;  2HSZ A;  2B21 A;  1T4G A;  4ZH4 A;  2QAR A;  1XO1 A;  1IG6 A;  4TUQ A;  2WAQ C;  3PW7 A;  3DEE A;  3NVW A;  1PUZ A;  2BGW A;  2OM6 A;  5HP4 A;  3EW9 A;  3SR6 A;  4K4G A;  5AK6 A;  5KFM A;  3V6J A;  3RJJ A;  3BZK A;  1BPE A;  5H2F U;  5J0O A;  2W11 A;  4GXJ A;  5J0S A;  5AKY A;  5L1L A;  1OUQ A;  2C28 A;  3AM9 A;  1MA7 A;  1BGX T;  4YCX A;  1NK6 A;  4DL5 A;  1NK8 A;  2N1R A;  3ALR A;  3PX0 A;  1SV4 A;  2HBK A;  4C8L A;  4B9L A;  3IN5 A;  3LVV A;  2KMD A;  4PHP A;  2ZXH A;  2R18 A;  3KOO A;  1RXW A;  4F5P A;  3H4D A;  5G5H A;  2CN1 A;  2V4R A;  4ACO A;  1U4B A;  3UMB A;  4J9S A;  8ICJ A;  4F4Z A;  1Y88 A;  2NRW A;  3RJK A;  4IR1 A;  2QKQ A;  2D6F C;  1BPZ A;  4F5O A;  3HW8 A;  3RAX A;  5J2I A;  5AM0 A;  1NK5 A;  4J9M A;  1B4F A;  2AQ4 A;  2GO7 A;  4YD2 A;  2FJ6 A;  3V7L A;  7ICP A;  2KJ8 A;  1RQL A;  3HKZ C;  4PPX A;  4CCH A;  4NL9 C;  4UB2 A;  3TAR A;  3ZDA A;  3RBD A;  5KFA A;  9ICX A;  1L8O A;  4PZO A;  4KLU A;  2E1E A;  5EWG A;  2A3V A;  1N48 A;  4UAZ A;  4F4Y A;  2JR5 A;  5ALN A;  4YR2 A;  5ALM A;  2HOF A;  2MU2 A;  9ICJ A;  2HHX A;  4NLG A;  5ALT A;  1N5X A;  4CRX A;  4RNN A;  1YT3 A;  1XWL A;  2RQ5 A;  4DSI A;  1JXE A;  4KX5 A;  4KMO B;  3OJS A;  4C8K A;  2IHM A;  1X9M A;  2LM4 A;  2E8P A;  1X6I A;  5L1I A;  3KFU F;  2JH1 A;  1RDF A;  3PR5 B;  3SZ2 A;  1SGG A;  4PGX A;  4UAS A;  3NGD A;  4R8U A;  2WTF A;  3CRX A;  4JB3 A;  2I6X A;  4PGQ A;  1SB3 C;  1URJ A;  1JIH A;  2NRT A;  1ZQD A;  2ZUC A;  4RQ0 A;  2I9G A;  4I2A A;  3FYH A;  4DQQ A;  1X66 A;  2W04 A;  2DUY A;  1JX4 A;  2NV3 A;  1DGS A;  5EE0 A;  3BS5 A;  5DKW A;  2KIW A;  1F0M A;  2IMW P;  3QU5 A;  1J2N A;  4KN4 A;  2A1J B;  2JH7 A;  3HWT A;  2WB1 C;  5TIS U;  3BQ7 A;  3MDA A;  1UT5 A;  3ZD8 A;  2GH1 A;  8ICM A;  1ZQT A;  3UMG A;  4RQ3 A;  3M9M B;  4M47 A;  2I5H A;  3HIL A;  2FPM A;  2W43 A;  3UQ0 A;  3H8W A;  1D9F A;  4BJQ A;  1NI3 A;  4DEZ A;  4IL6 U;  4P4M A;  4J9Q A;  4DF8 A;  1C7Y A;  1Z00 B;  1TAU A;  5GTH U;  4QZ9 A;  2P6R A;  4DCC A;  4OO1 J;  3NRW A;  3CYM A;  3C1Y A;  2C2D A;  5KL8 B;  1S77 D;  3GV5 B;  2P6U A;  2VKQ A;  3L5K A;  2OCE A;  1VJ5 A;  3F2D A;  2KJ5 A;  2QAR B;  3AN1 A;  3ICX A;  3LK9 A;  2HCF A;  5JU5 A;  4I27 A;  4M9L A;  5HHI A;  2XIC A;  4DQR A;  4FBU A;  4UB6 U;  2C2E A;  2Y1I A;  1L7O A;  2G5I B;  4O3S A;  3QE9 Y;  4DOB A;  2AXT U;  2EQY A;  4F92 B;  3T5H A;  4ECR A;  2EDU A;  4DSL A;  3M1Y A;  1SWW A;  3NTU A;  1X6J A;  1SXE A;  2YN4 A;  9ICC A;  1ZQZ A;  4EBE A;  5DLG A;  2PXI A;  4BXO A;  2BR0 A;  3M6Z A;  4QZC A;  3EYZ A;  4EEK A;  1HEK A;  4QWE A;  3F5A A;  4I28 A;  2KSO A;  1ZQO A;  1F44 A;  3IDW A;  3JPN A;  1NJZ A;  1VLB A;  1ZQR A;  1ZJN A;  2V4Q A;  3M8R A;  3NRZ A;  7ICQ A;  5IIO A;  4HYK A;  3FDS A;  2AJQ A;  2YMP A;  3EWA A;  2K8B B;  9ICA A;  4YFK A;  4ED6 A;  4KLQ A;  2L5Y A;  2XY6 A;  2DL0 A;  3PX6 A;  8ICF A;  3H4B A;  2W9C B;  2H3V A;  2KE7 A;  1ZJM A;  7ICI A;  2UVW A;  1ZQF A;  8ICP A;  3S6J A;  4DWI A;  4C8M A;  2YX8 A;  3TAC B;  5AM2 A;  4EEN A;  5AKH A;  2AGQ A;  4M9H A;  4NV0 A;  2W7O A;  2ZTE A;  2RDJ A;  3C2L A;  2KG5 A;  3IP4 B;  4B9M A;  4O3Q A;  5ALY A;  3PSP A;  4JWM A;  5ALW A;  2KV2 A;  4I2D A;  4UB5 A;  1D8B A;  2DFL A;  4I2I A;  3N7R C;  3MR5 A;  5ALV A;  3MC1 A;  2G0A A;  4RNM A;  3KKA C;  4KN7 A;  4NL9 A;  7ICV A;  2W03 A;  2KKP A;  4C4T A;  2VA3 A;  7ICJ A;  4RNO A;  3JPO A;  8ICG A;  1KFT A;  2WHE A;  2KVC A;  1NK0 A;  4QZB A;  2ASL A;  1CRX A;  5J2A A;  4J9R A;  3RFA A;  4GFJ A;  4J9L A;  4NLB A;  9ICT A;  3ETR A;  4JK1 A;  4MF8 A;  4UB4 A;  2CPR A;  2M9N A;  3BQ1 A;  2H5X A;  3NAS A;  2P66 A;  5EE9 A;  3TAP A;  5AKK A;  3IHQ B;  5IIJ A;  5DB8 A;  3V7K A;  1LV5 A;  4KLI A;  1N63 A;  2BHN A;  5KT4 A;  4O9M A;  2KIC A;  2ZJ8 A;  5KG3 A;  3WKE A;  4ELU A;  3C2K A;  1C20 A;  4ZOH C;  1LKY B;  1N62 A;  2B6G A;  4IR9 A;  4F5R A;  3VCB A;  5ALU A;  4O5E A;  1ECW A;  5AM5 A;  3BZC A;  1UHU A;  3PSF A;  2LPE A;  4GLX A;  8ICS A;  2BQ3 A;  4DSK A;  4CNQ A;  3Q8L A;  2AH5 A;  2BQR A;  2ES6 A;  5ALZ A;  4Y2U A;  4FZN A;  2V9W A;  3SAG A;  2XI9 A;  4Q8F A;  4NLC A;  2D3D A;  4BX9 C;  5AI9 A;  3WK4 A;  4QZE A;  1PK3 A;  5L1M A;  4QIW F;  5J2F A;  4GC6 A;  3RH5 A;  1U45 A;  4TUP A;  3AMZ A;  5EOZ A;  1QSL A;  3K1Z A;  3TI0 A;  5J0U A;  1CEZ A;  5KFL A;  5KFD A;  2M0N A;  2EAO A;  5DBC A;  5AKE A;  5KG1 A;  3M7D A;  1PK1 B;  1ZQG A;  5DG9 A;  1TAQ A;  4JV2 A;  1PVR A;  4FE3 A;  4YXJ A;  3C5G A;  2OH2 A;  4Q8E A;  1UA0 A;  2R8I A;  1DK2 A;  2WF8 A;  3RRH A;  1QSS A;  4U6P A;  4MEY A;  4OD0 A;  1COK A;  5AK5 A;  4RZR A;  5HHH A;  5CP2 A;  1ZQI A;  5KFG A;  1MQ2 A;  4Z6F A;  5JRT A;  1Q3U A;  2NYV A;  2K4I A;  2KZZ A;  2F8K A;  3T5L A;  4XA5 A;  5DGB A;  3JPR A;  3RJH A;  3H0M B;  1TK8 A;  2A19 A;  3EPI A;  2KHQ A;  4FZM A;  7ICT A;  3HT3 A;  1Z4N A;  7ICG A;  3RBE A;  3SEN A;  5AK4 A;  4PGY A;  1HIW A;  2BKE A;  1NKE A;  2KTQ A;  1SWV A;  1QTM A;  3Q8Q B;  4BWM A;  5KTQ A;  3PML A;  5F3X B;  4FFD A;  3SV3 A;  2DF4 B;  4KLS A;  5J29 A;  2A1J A;  2F76 X;  9ICV A;  1IM4 A;  8ICU A;  3QUB A;  4KLE A;  2J6S A;  3RR8 A;  2XCA A;  5ALO A;  7ICK A;  4RQ6 A;  5K4L A;  4M9G A;  2WF5 A;  1Z00 A;  1SKR A;  3EZ5 A;  1NK7 A;  2JEI A;  3RH6 A;  2MAX A;  4QZG A;  2HHT A;  5AKI A;  4B9V A;  2Y0S F;  3WK8 A;  3PW5 A;  4F2R A;  3IG5 A;  2H3Z A;  4PHE A;  4IRC A;  2UVU A;  3MGV A;  5KFE A;  5CWR A;  3K75 D;  2ASJ A;  5HR6 A;  3Q8R B;  2GWS A;  3BDP A;  4YMM A;  2GOL A;  5DQI A;  2JGA A;  2FPK A;  2KHV A;  2XC9 A;  3QU2 A;  4XUS A;  2LMR A;  2Q4T A;  8ICN A;  9ICK A;  1DOQ A;  4NLK A;  4EEL A;  4YN4 A;  1Q3V A;  3KKA A;  4I2E A;  4QZI A;  1ZOL A;  4BDP A;  4P0P A;  4RQN A;  2JEJ A;  5KAI U;  4F2S A;  4DFP A;  1ZQB A;  4IQW A;  7ICH A;  2HHV A;  2KFN A;  1MQ3 A;  4RT3 A;  2WF7 A;  2HMX A;  1ARO P;  5ALX A;  4F71 A;  3WKB A;  1QQ5 A;  8ICA A;  1NJY A;  4DL3 A;  2F2A B;  9ICI A;  4JV1 A;  3UM9 A;  4P4O A;  2QB1 A;  4ED0 A;  5J2G A;  3A0H U;  1ZYQ A;  4DL2 A;  3MGH A;  4CF5 A;  1NK4 A;  2CRX A;  3QUT A;  2HHW A;  3GDX A;  5ALE A;  4UAV A;  2AU0 A;  2KN7 A;  1A0P A;  1WYG A;  5BOL A;  2JRZ A;  2W9C A;  1Z1B A;  1HUZ A;  1KL9 A;  2C22 A;  2K89 A;  5AKX A;  3NS1 A;  2KNJ A;  5D4B A;  3F2B A;  4NWI A;  1BPB A;  1TV9 A;  1JI7 A;  1O03 A;  4RQ2 A;  2PI5 A;  4Z6D A;  4M9J A;  2ZUB A;  3QZ7 A;  1ZD2 P;  4F50 A;  4DFD A;  4UB3 A;  2PMZ F;  3SEI A;  4J03 A;  1K1S A;  4KLH A;  1NNL A;  1DK3 A;  1OXJ A;  1XU4 A;  2RHF A;  3N7P D;  5E79 U;  1KFD A;  4K4H A;  1L6N A;  2K4P A;  5ALR A;  3L3F X;  3R9K A;  5EE3 A;  3RH4 A;  1NK9 A;  4R66 A;  3AU2 A;  3AEV A;  4ED8 A;  7ICL A;  8ICQ A;  4QZF A;  5ALP A;  4FBT A;  1COO A;  2MA1 A;  3MBY A;  5KG0 A;  3OJU A;  3TFS A;  4IQT A;  2K60 A;  4UAY A;  5BPC A;  4YD1 A;  2E8N A;  1ZQW A;  3JPT A;  8ICZ A;  1V9P A;  4UAW A;  1ZD5 A;  5CR0 A;  2OYY A;  5D49 A;  5J0X A;  2Z7J A;  3HJE A;  4DFM A;  1M6Y A;  2G09 A;  1LB2 B;  4RQ1 A;  3M9N B;  2LYB A;  4EX7 A;  4KX3 A;  5HNK A;  1ZQN A;  1XSP A;  4HAI A;  2YMM A;  2Y1J A;  1NZP A;  4O5C A;  4EX6 A;  1QSY A;  4I29 A;  4M2Y A;  1N5W A;  2OWO A;  1LKY A;  3RB6 A;  3M6K A;  4OJO A;  4JV0 A;  4MFF A;  3PO5 A;  4GIB A;  3VC8 A;  4QJF B;  8ICH A;  4C7Z A;  1PZN A;  1L3T A;  3PY8 A;  5ALL A;  1DRG A;  1EXN A;  2OXO A;  1NZB A;  3GIL A;  2D8C A;  3G6V A;  9ICF A;  4DL4 A;  2O6K A;  2C2R A;  1WCN A;  1S10 A;  3KHL A;  4ECU A;  3WK5 A;  4DSJ A;  4J9K A;  4R65 A;  3MGI A;  4EZ9 A;  2QLT A;  2LYH A;  5KFW A;  1ED1 A;  3ZDD A;  4U7C A;  4UBB A;  1CUK A;  1KTQ A;  4DLE A;  2ZXI A;  4LZD A;  1B43 A;  2XGQ A;  5F9L A;  2E3T A;  1PK1 A;  3QYP A;  4KTQ A;  1XSN A;  4C4S A;  2XVT A;  8ICR A;  3SAF A;  1U49 A;  4C7Y A;  3EPG A;  3M8S A;  1K1Q A;  4QIW C;  3AL0 B;  1H38 A;  2AQ0 A;  4P0P B;  5L1J A;  2HDO A;  1RPL A;  2YB4 A;  5KFI A;  5KT6 A;  4Z6E A;  1WCL A;  4O3N A;  4BGD A;  1YZ6 A;  2KZ3 A;  2F1J A;  1ZQX A;  1T3N A;  1S9F A;  2ZIW A;  4ECQ A;  4RPX A;  3UPQ A;  4FO6 A;  2E8O A;  4ECY A;  3RJI A;  1FFV A;  3IG8 A;  3MR3 A;  3AUO A;  1IXR A;  8ICW A;  1BPD A;  2DKX A;  4Q44 A;  3TAN A;  3IM1 A;  7ICM A;  4ELT A;  4C80 A;  4M0A A;  5KFN A;  5KFK A;  1N60 A;  9ICQ A;  1JAL A;  3RB4 A;  2G5H B;  1QQ6 A;  3QXG A;  1JN3 A;  4ED2 A;  2F8L A;  5DB9 A;  1SV0 C;  1SIJ A;  2FMP A;  8ICC A;  2HOI A;  2VJ4 A;  5III A;  2KK0 A;  7ICN A;  2BCR A;  3BQ2 A;  1MC8 A;  2HVH A;  4EBC A;  3NVY A;  2W8K A;  4CGZ A;  1RYS A;  2FMQ A;  1S0M A;  9ICG A;  4UW9 A;  5DG8 A;  1WWU A;  4DS4 A;  5IIN A;  4YXM A;  5KFV A;  5DB6 A;  1WG8 A;  5J2J A;  3QUQ A;  4O3O A;  1ZQK A;  1L3U A;  2ALZ A;  3UMC A;  4M9N A;  5KFP A;  3MFI A;  2XGP A;  1ZQA A;  1SL0 A;  3KHG A;  5HML A;  1X2I A;  2Y0S C;  1Z19 A;  3SD7 A;  4J9N A;  2ZIX B;  5CB1 A;  5J2C A;  2G06 A;  2QB0 B;  3UXO A;  3AQE A;  1TK5 A;  2J6T A;  1X40 A;  4F91 B;  4QNL A;  3H40 A;  2W3R A;  4Y2R A;  1ZXI A;  2FPL A;  4DQI A;  1ZQS A;  1KN5 A;  1A77 A;  2LI6 A;  3PO4 A;  2BPF A;  1A6S A;  2KKV A;  4ECZ A;  3JPP A;  4TUS A;  4KLF A;  2ZTC A;  4YQW A;  3QUC A;  4Z6C A;  3G6X A;  2BCS A;  1SXD A;  2XO7 A;  1SKS A;  4LVS A;  5C5J A;  9ICW A;  1RQN A;  5AHX A;  3JPS A;  3MFH A;  4NLZ A;  4YR0 A;  2F44 A;  1ZQJ A;  1J2M A;  4QWC A;  4Y2Y A;  3Q8K A;  2W55 A;  4DOC A;  3LWL A;  3ZI4 A;  1RM6 C;  4DO9 A;  1K5O A;  3U26 A;  9ICB A;  3PW4 A;  2KZM A;  1RZT A;  4JMU A;  3Q8M A;  3UXP A;  9ICN A;  3HP6 A;  3GQC A;  1F5S A;  4DQP A;  4RT2 A;  5G5G A;  4OJL A;  1SZP A;  3FAH A;  4IS7 A;  2FLP A;  5J8Y C;  3N7S C;  3TAQ A;  4RQ8 A;  4ECS A;  5ALS A;  4F72 A;  3MR6 A;  1ZQP A;  1UCV A;  1BNP A;  4NM1 A;  2W54 A;  3ZDB A;  2EAM A;  4DFJ A;  2W9B B;  1X9W A;  1ZQQ A;  5AIA A;  3QX7 A;  3ZD9 A;  7ICF A;  3F53 A;  7ICO A;  3OHA A;  5AM4 A;  1LVH A;  2WF6 A;  2Y9U A;  3DDH A;  3SQI A;  4GXI A;  2PFO A;  3PW0 A;  1V85 A;  2PMZ C;  3WU2 U;  2HW3 A;  4MF2 A;  2AGO A;  1J97 A;  4QWA A;  4I2C A;  2ZIU B;  1UA1 A;  1QQ7 A;  4I2F A;  5AKJ A;  5KFF A;  3I76 A;  4OJ5 A;  3N28 A;  5ALF A;  1X42 A;  4OCZ A;  2ZIV B;  2AGP A;  4UB1 A;  2ZIW B;  4OJP A;  2IOF A;  2BCV A;  2R8H A;  2K8C B;  1IV8 A;  5CRX A;  3PSI A;  1S97 A;  3PZP A;  3K4G A;  4UB8 U;  3JPQ A;  3QU4 A;  4USA A;  2FDR A;  4F4X A;  2KFZ A;  4RQ5 A;  1ZD3 A;  2KEY A;  1ZET A;  3KBB A;  1OW5 A;  1V97 A;  4O5K A;  4C0Z A;  8ICY A;  4NY8 A;  4C8N A;  5KFZ A;  1L7M A;  3NVZ A;  2FMS A;  5KFU A;  2IOF K;  1N56 A;  4EEY A;  5KFJ A;  2JXJ A;  2ODG A;  1D8Y A;  3V7J A;  1L7P A;  3OSP A;  5D46 A;  1XO0 A;  1ZQH A;  3OTQ A;  4KLD A;  4RPZ A;  4O0I A;  4NM2 A;  2K4E A;  3CNH A;  1FFU A;  5AM1 A;  3C29 A;  3RF9 A;  3SAH A;  3SMV A;  3PVX A;  1NKC A; 
#chains in the Genus database with same CATH homology
 2JGA A;  2VJ5 A;  1MA7 A;  3M6Z A;  4GFJ A;  5A0L A;  2W7P A;  3CRX A;  4CGZ A;  4IC9 A;  3F2C A;  2KHV A;  1ED1 A;  3LYS A;  1HEK A;  4NLB A;  3F5A A;  2LHT A;  2ZXI A;  4P0Q A;  4U7C A;  2OH2 A;  1URJ A;  4AYB C;  2Q4T A;  1P7D A;  2N1R A;  3ALR A;  1F44 A;  2CPR A;  3HKZ F;  3LVW A;  3O0F A;  4U6P A;  3OPX A;  2DGZ A;  2G07 A;  2MRL A;  2MA1 A;  1Q3V A;  2HBK A;  3F53 A;  5C0Y A;  3LVV A;  1IIP A;  3IN5 A;  2XVT A;  3D2Q A;  2F77 X;  2ZXH A;  3SAF A;  2R18 A;  4P0P A;  2HOQ A;  2K8A A;  2H3F A;  2LYA A;  2WAQ F;  4A8E A;  1Q3U A;  2W04 A;  4QIW C;  1PVQ A;  3PST A;  2H3I A;  2K4I A;  3SQI A;  3AL0 B;  2NV3 A;  1KBU A;  3GZF A;  1T94 A;  4P0P B;  2CN1 A;  2KJ9 A;  4O3M A;  3H0M B;  5KL1 B;  2Y0S C;  2KIW A;  2KD1 A;  2PMZ C;  2YB4 A;  1Z19 A;  4ACO A;  2OYY A;  2KIC A;  2RP5 A;  2Z7J A;  2ZIX B;  2KHQ A;  3D2N A;  4FZM A;  2K8B B;  2XID A;  3GU3 A;  2HMX A;  4FZL A;  2JH7 A;  2ZIU B;  2G06 A;  2WB1 C;  2G09 A;  2JHD A;  2YB1 A;  3AQE A;  2H3Q A;  2GH1 A;  4QNL A;  2LYB A;  3KZX A;  1HIW A;  4ICA A;  4KX3 A;  2D6F C;  3CP8 A;  4OJ5 A;  3VCB A;  3H0R B;  3D2S A;  2E5S A;  2ZIW A;  1ECW A;  3PSF A;  2H3V A;  2ZIV B;  2LBO A;  4BUG A;  2F2A B;  1A6S A;  2KKV A;  4BJQ A;  2ZIX A;  2DF4 B;  3E0F A;  2ZIW B;  4OJP A;  2HBM A;  3AQF A;  2ZIU A;  2ZG6 A;  3IG8 A;  1PVP A;  2KJ8 A;  2F76 X;  4OJ6 A;  2YX8 A;  3HKZ C;  2G08 A;  3M6K A;  4OJO A;  2CRX A;  2K8C B;  4NV0 A;  4AYB F;  2W7O A;  4OO1 J;  2JMG A;  3PSI A;  3NRW A;  3CYM A;  5CRX A;  3PZP A;  5KL8 B;  2K4H A;  3IP4 B;  2VKQ A;  1A0P A;  1Z1B A;  3VC8 A;  2E1F A;  2ZIV A;  3PSP A;  4FZN A;  2K89 A;  2WAQ C;  4CDG A;  4QJF B;  1SZH A;  2E1E A;  2HBJ A;  3F2D A;  2KV2 A;  2KEY A;  2A3V A;  3SAG A;  2G5H B;  2KJ5 A;  2KNJ A;  2XI9 A;  3F5E A;  3DEE A;  3ICX A;  4NLC A;  1GO3 F;  2BDU A;  3ONN A;  4BX9 C;  3F2B A;  4NWI A;  1D8B A;  4C0Z A;  2F8L A;  4QIW F;  2XIC A;  2HOF A;  2LKY A;  5T14 A;  3K1Z A;  3N7R C;  1UPH A;  4JMU A;  1DRG A;  2HBL A;  2OXO A;  1NZB A;  2OM6 A;  4WJ3 B;  2HOI A;  2Y0S F;  2PMZ F;  2VJ4 A;  2G5I B;  4PL2 A;  4CRX A;  1TAM A;  1YT3 A;  5HR7 A;  2G0A A;  2KOB A;  2M0N A;  4P0Q B;  3IG5 A;  2H3Z A;  2WB1 F;  4KX5 A;  1XO0 A;  2W03 A;  2KKP A;  4KMO B;  4OJL A;  4PL1 A;  1XNS A;  2DQN B;  1ZQ1 C;  2RHF A;  3M7D A;  2K4E A;  3N7P D;  3T79 A;  2KVC A;  3N7S C;  3MGV A;  3C28 A;  3C29 A;  3RF9 A;  1L6N A;  3KFU F;  2RRD A;  2JH1 A;  1CRX A;  1PVR A;  4FE3 A;  3NUQ A;  3H0L B;  3SAH A;  5HR6 A;  3SMV A;  3RFA A;  1WUD A;  3L3F X;  2VIX A;  1OUQ A;  2GOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...