3TANA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tanA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tanA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tanA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tanA01
4F3TA 4DEZA 4QZCA 5D49A 2VG6A 3GFKB 1SL1A 1JLQA 3SYZA 3JPPA 3ALYA 4QW9A 4ECYA 4O3RA 4I2HA 3V9ZA 3QNOA 4OPKA 2R8GA 4FBUA 3QINA 4DO9A 5KFLA 4J2DA 3OYBA 4O3QA 3E01A 1LAVA 3HO1A 4I2AA 1Z00B 2XHBA 2FBTA 2UVRA 1H38A 2ATQA 4IQUA 2YKMA 4LZGA 4OKEA 4M3TA 1BI4B 1J54A 1QTMA 9ICAA 1RT4A 1RNHA 3P5JA 3RR7A 4KLEA 3FFIA 5J0YA 2DFFA 3MFIA 3ZSOA 3O3HA 4HTUA 4ECSA 1VSHA 3K4GA 9ICJA 3KKSA 5DGAA 2ZJ5A 5FROA 2ZE2A 4FCYA 3SI8A 1XI1A 1NJWA 2W9AA 3PW0A 3PX0A 2MUTB 4CERA 4O5KA 7ICEA 4CEBA 2PFNA 2C2DA 4YCXA 3ULDA 2J6TA 2P6UA 3ISNC 4TQRA 3HX0A 1K1SA 8ICEA 3EPIA 3VQEA 4WE1A 5HROA 4DG1A 1WSEA 5KG4A 3V9XA 1TL3A 3AO1A 4CJ3A 4E7LA 4CEQA 3T5HA 1EXNA 3JPTA 4IFYA 4NM1A 2GV9A 4R64A 3VA3A 4JV1A 4CEZA 4CHPA 1VSMA 3QEXA 3QETA 9ICKA 3M9OB 4DTPA 2KQ2A 4O3PA 3NF7A 4K4GA 1KFDA 3RH5A 4DQQA 1J5OA 4AHVA 1BVSA 1HUZA 2DFEA 5HMLA 4FJXA 3AVJA 1HMVA 1BPBA 1ASWA 3KTQA 7ICHA 1T8EA 4IFVA 4I29A 3SPZA 4OPJA 1FK9A 5DBAA 2XY7A 4J2BA 4CEAA 4F5QA 3PVXA 5KFIA 2HMIA 4I2DA 4B8CA 1WAJA 1ZQMA 5KT3A 1WLJA 1BL3A 4DF4A 7ICJA 2BANA 3KHLA 3ZSZA 3K57A 2W8LA 2PY5A 4KHNA 1IM4A 4DQIA 1ZJMA 3V9SA 3HP6A 2QKBA 3RRHA 4DSJA 1TAQA 5DMRA 3L8BA 3H08A 4KHWA 4BDPA 2VANA 5IIOA 1KVAA 3MEGA 3SQ2A 3HPGA 1NK7A 3K5MA 2J6UA 4RT3A 2PFQA 4Z4CA 5HHHA 3MECA 4CJEA 2XO7A 4O55A 5DBCA 1X9MA 2BPFA 1RT7A 1L5UA 4YNQA 2KFZA 1RDCA 4KB1A 4DFMA 2FLPA 4QAGA 2BKEA 1Q9YA 1IKYA 3OYFA 4ECWA 3T5JA 1MQ3A 1S0VA 9ICMA 2KZZA 5DBBA 4JWNA 4CFDA 5HLFA 2P66A 1U04A 4NYNA 4KAZA 3RMAA 3T5LA 4NCBA 3TWHA 3ZSRA 3PW4A 1RILA 1L3TA 2AJQA 3L2QA 1RT6A 4FLUA 4UQGA 4MFAA 3AO4A 1HYSA 3AVMA 1ZQAA 2JEIA 3B0YA 5SWMA 1XWLA 1O1WA 3H40A 2V4RA 4I9LA 4FLYA 3OYGA 3GV5B 4DSFA 1S0NA 4LY7A 4FK4A 4E0DA 1QLNA 2IBKA 2ISPA 2VA2A 3VQQA 4EYIB 4AHUA 5L9XA 1TKTA 5J2DA 1JXBA 2AU0A 4DOAA 4K8ZA 5DKWA 4K4HA 2HHXA 4M45A 3PW5A 3KKRA 1RXWA 1QSYA 3NF6A 4ECRA 1B22A 1BPYA 4HCCA 3GDXA 4HYKA 4UB3A 3V6JA 1RT2A 4YQWA 2BQRA 1NK6A 8ICJA 4DOBA 3LALA 3BGRA 1QS4A 1YVUA 3DRRA 5KFCA 1IKWA 5DLGA 3VQ8A 2AGOA 2UVVA 2Z1HA 3HPOA 3TFSA 8ICUA 1NK5A 4G1QA 4DF8A 5D4BA 4EZ9A 2WOMA 1ZQQA 4E7HA 1YT3A 9ICPA 3QIPA 5CA7A 4I7FA 1ZQJA 3D45A 5HNKA 3ZSWA 3U3YA 2YKNA 3KJVA 3DOKA 3BQ1A 1NOZA 3VQAA 3ZT3A 2R7YA 4CF0A 5CYQA 2JZBB 3V1QA 4BXOB 4CEFA 5KFHA 3LDSA 3LPUA 8ICQA 2B6AA 1BHLA 4AH9A 3KLFA 3CFRA 4UAZA 4J9OA 4ECUA 2QK9A 4CJKA 3NF8A 4FLWA 4GC6A 9ICGA 1UT8A 5CP2A 4KLDA 4MFCA 4YMOA 4ECQA 1VSJA 3ZT2A 1UOCA 4YN4A 2WONA 1XSLA 1UWBA 8ICIA 4J9QA 3PMNA 4DFPA 5HRPA 3KLGA 4FBTA 2UVWA 2A1RA 2D5RA 3BQ2A 4ID1A 1KLNA 3RJEA 8ICCA 3C21A 2E4LA 3G10A 8ICBA 8ICWA 3PX4A 1Z25A 3SNNA 2FMSA 3KHGA 2BE2A 4FW1A 3LWLA 4JRQA 9ICQA 5CZ2A 4O0IA 4LH5A 3F73A 1BISA 4RQ3A 1C7YA 1C6VA 2V4QA 1RBRA 4RQ2A 1CXUA 4Q5VA 4RW7A 2VA8A 1LB2B 3HP9A 1ZQIA 1Y97A 4PGXA 3O3GA 7ICNA 5J0RA 3ZDAA 1BPXA 4PHEA 3DLGA 4AILC 2R8IA 4DOCA 3HWTA 3FDSA 4M6WB 5HBMA 2AGPA 4CF9A 3TFRA 1KFSA 4KLQA 3AVHA 1VK0A 3LP3A 4B3OA 3Q8LA 3QERA 4Z6CA 9ICBA 3F9KA 1K6YA 4M0AA 4CK3A 1B9FA 4E7JA 2X6SA 2ASJA 1NKCA 4JWMA 4Y1DA 4B9MA 3KLEA 1ZBFA 2BQ3A 4DL2A 3HVTA 1SL0A 9ICEA 3CYMA 3C6TA 4FVMA 4CGIA 4Z6EA 4J9LA 4QWBA 3GILA 4P2HA 2P5GA 4RQ6A 4F3OA 1BQMA 2VWJA 3T19A 2PXIA 1CXQA 4M42A 5J2HA 4NM2A 4FJ5A 2VG5A 3ISCA 8ICGA 7ICRA 5J0UA 3AVAA 2G8UA 3EPGA 3OYMA 4JLHA 3KK1A 3QEVA 1NJXA 3H8JA 3DLRA 2Q3SA 5DB8A 3PX6A 4J9RA 3RJGA 4CK1A 1VSLA 5KFKA 4RNMA 1YTUA 4DQPA 5J0WA 4P4PA 2FLLA 4RQ8A 3V6DA 2JEJA 3MR5A 3RJIA 2IS3A 4J9PA 4R8UB 3A2FA 4DS4A 3VQ6A 3MXJA 2ASLA 4ECTA 4YMMA 3ISDA 3EW9A 1HUOA 7ICOA 4RW6A 3DI6A 3DLEA 5TZVA 3M8QA 4J2EA 1BIZA 4F2SA 5J0XA 4E89A 3ZD9A 4C8LA 4NLGA 2HNYA 4I2IA 3G6VA 3H8SA 3LP0A 5KFRA 3C5GA 2OZMA 3UQ0A 4RUAA 4GXIA 4QZDA 3IM1A 2KFNA 4FM1A 1HQEA 1RT5A 2AGQA 1XSPA 3TI0A 3BJYA 4FS2A 2BPGA 1U4BA 3AVIA 1JLFA 4IR9A 2PFOA 4W5RA 3NH1A 1Q8IA 3HT3A 2O4IA 2NRZA 3VN5A 3L2UA 5IIKA 1JL1A 3S3NA 2WTFA 3DOLA 3LANA 5KFNA 5J2EA 2W9MA 5J2JA 3QE9Y 2BCVA 4O9MA 5EOZA 3JPRA 5D3GA 4I28A 1RDAA 3V9WA 4QOZB 2O4GA 4KTWA 5KFEA 1A5XA 3OJSA 4CJQA 4PHAA 1SKWA 4HUEA 1T4GA 1MQ2A 5J2KA 4FJGA 2D0AA 2HHQA 4KLUA 3V81A 1BGXT 1T7PA 3PO5A 2Z1IA 1QE1A 3OYNA 4EBEA 5DG7A 4KRFA 2HHWA 4YR0A 3M8SA 4AHSA 2KW4A 1ZQZA 2W9CA 2G8KA 1FKPA 5KFQA 4CJRA 1ZBHA 4FJKA 1ZQPA 4F4WA 4PA1A 3AO3A 5BPCA 4PGYA 1BIUA 4DSKA 3JSMA 3JYTA 2P5OA 2BGWA 2ZUCA 2C22A 4OKJA 5KFYA 3WNEA 1GOCA 1TL1A 1KTQA 8ICZA 4RQ5A 4CESA 1TKDA 4RU9A 3DLHA 5DK5A 1RDBA 4CJPA 4IDKA 1KRPA 5KG5A 3MR6A 4CJSA 1N5YA 1LWCA 1ASUA 2EHGA 3HM9A 3NGIA 3V7KA 4N76A 4Z4FA 1T3NA 4KLTA 3MFHA 1COOA 4Z0UA 4M3YA 4KHUA 4QZFA 1IXRA 1T05A 4RQ7A 4YR2A 5J0TA 5CZ1A 1RZTA 2F1JA 3ITHA 8ICXA 1XU4A 2HHUA 4K8XA 3WNFA 4N41A 1ZJNA 1XSNA 2QKKA 4CGGA 3QESA 2FBYA 5KFOA 1KLMA 1GOBA 3Q8PB 1W0HA 1Z00A 4ZH4A 4RQ0A 2ZD1A 3SQ0A 1RT3A 5CB1A 4DTOA 1KVCA 3ZD8A 1BPZA 1BI4A 2NRTA 1NK4A 7ICKA 1RBSA 1RTIA 1DTTA 2XCAA 4MF8A 3VQ4A 4M2YA 3S9HA 3GIMA 1FKOA 4P4OA 5SZTA 4DTUA 4QWAA 1L3UA 3NGZA 4CJLA 3MXMA 3M9MB 3PR4A 4NLZA 1S0MA 4FZYA 2DFLA 1ZBIA 1SZPA 4DLGA 4YD2A 1U48A 4QZHA 1S77D 1CZ9A 3K5LA 4XQ8A 2HVHA 2MUTA 3JPOA 2YNHA 4UBCA 1KCFA 1BPDA 4CJVA 4NCAA 3QEWA 1ITGA 4I2PA 3SJJA 3ZT0A 4W5QA 2DPIA 2VWKA 2H5XA 5DB7A 2ASDA 4I2CA 5FRNA 2XGPA 1HNIA 4GLXA 1MC8A 2ZTEA 1F21A 4CHOA 4UB2A 4JV2A 4Z6FA 3Q8KA 3TQ1A 4UAYA 1JLEA 4O3OA 4ECXA 3OSPA 4RW8A 3PO4A 4F4KA 3M9NB 2RKIA 1R0AA 2XGQA 2XC9A 1S9GA 4I2FA 3Q8SB 4Q45A 5KFZA 1REVA 1BCOA 1WSHA 2BPCA 7ICVA 3HYFA 1IKXA 8ICOA 4DL4A 4TQSA 5KFAA 4IBNA 1JLAA 4M9HA 5DDYA 5J0QA 1WAFA 3K5NA 1B43A 2YNIA 4CGHA 4ED6A 4B9VA 2IAJA 2HNZA 1ZQVA 3OYJA 1C0MA 1EKEA 2F1HA 3K2PA 5J2QA 4ELVA 9ICTA 2OPPA 4ED3A 2D0CA 3N97B 2J6SA 4RW9A 3NF9A 1IH7A 4CGDA 4KTQA 2BR0A 5C42A 3V6HA 3QZ7A 2I5JA 2HNDA 4DS5A 5BOLA 5KT6A 4YD1A 4R66A 3ZDCA 3O3FA 2KZ3A 4KO0A 3ASMA 4UAWA 1G15A 3GIJA 3ZCMA 3SUOA 2QXFA 3OS1A 4BGDA 3UXNA 3NH0A 2Y1JA 1EP4A 5HRSA 4ECZA 4CJTA 2YNGA 1RBTA 5DDMA 5KG0A 1SKSA 4BACA 4HCBA 1XHXA 3QEBZ 1RTHA 1RYSA 2YHAA 3AV9A 4DQSA 3WNHA 3RBDA 2C2EA 3MDCA 1S9FA 3AVFA 4YFKA 3M8PA 3LDAA 4I2QA 3LK9A 3RTVA 3AO2A 3H7IA 3G6YA 1JLGA 4FLXA 4FZZA 3V72A 4HUFA 4C8KA 1V9PA 4YVZA 4FO6A 1C0UA 3RB4A 3OHAA 3DRPA 3MXIA 1CUKA 2ITGA 4FM0A 4QWCA 4XRHA 4M04A 4KLHA 3LAMA 3BQ0A 4NXZA 4CJUA 1MU2A 5KFSA 2W8KA 4PH5A 1SKRA 7ICGA 4EZ6A 1LW0A 4ED7A 4ID5A 1KVBA 3MABA 2F8TA 4CHZA 4H4OA 4F5NA 3QO9A 4O0JA 1KDHA 4DSIA 4M3WA 3RMBA 5KG3A 8ICPA 1EETA 4Q0BA 1TGOA 4RPYA 4LH4A 3RH4A 4TUPA 1RT1A 5I3UA 5KFMA 4JK1A 4CFCA 3QIOA 3AA5X 8ICYA 4UB1A 5KFTA 3OSNA 4DU1A 2Z1GA 4AHCA 4RNOA 4CJWA 4IKFA 3E2EA 1WCLA 2ALZA 5CR0A 2ZUBA 2A1JB 4F2RA 9ICLA 5KRSA 1X2IA 2R8KA 2KZMA 1HJPA 7ICFA 2P6RA 4B08A 3OJUA 3P1GA 3ZSYA 1BPEA 8ICFA 2A1SA 1C1AA 2B5JA 2HHSA 1NK8A 5KFPA 4CCHA 3V9UA 2JZBA 3KK3A 4BXOA 4FLZA 3N4MB 3NDKA 4F92B 4CIEA 3G6XA 1B92A 4E1MA 4QCLA 4M41A 2P51A 4FJ9A 1B9DA 5J2NA 4DL3A 4XUSA 4RZRA 7ICSA 5L1IA 2IMWP 1NJZA 4CF2A 1WSGA 2NRVA 2KN7A 4R5PA 4E7IA 4DQRA 3RB6A 2DY4A 4TUQA 4Z4EA 5IIJA 1RPLA 3OS2A 2RF2A 3ZSQA 5KFUA 1Q9XA 4DTSA 5KI6A 3ISBA 1XS9D 4PHDA 4QWDA 3OYHA 3HVRA 2ZJAA 7ICMA 3C2KA 4IRKA 5KT5A 3KLHA 2RDIA 3V7LA 4O3SA 4TUSA 4F5PA 4K4IA 5KTQA 4ZTJA 1N56A 2D0BA 3SCXA 3S3MA 1JN3A 4OGEA 3LZJA 4DL7A 3TAQA 3K58A 4RG8A 4Q43A 3ZT4A 9ICVA 5DGBA 1A5VA 3PW7A 1VSDA 3V1RA 2G8HA 4GMJB 3L2WA 1D9FA 4IQTA 3KIOA 1HPZA 3V1OA 5J0SA 3OHBA 3MGHA 5CJ7A 1VSIA 3K5OA 4Y1CA 3QLHA 4QZGA 5DQIA 2IA6A 5HP4A 2ZQBA 4OVLA 1XHZA 4R63A 4NLKA 3SUPA 1FXXA 4M6WA 3ZDBA 4HUGA 1RXVA 4CIGA 2OYQA 4FJLA 4N47A 3UPQA 5J2AA 5EWGA 3PNCA 2EX3A 3VA0A 4IQWA 3TAFA 1HNVA 4CE9A 1PZNA 2R8HA 2RN2A 4JRPA 2JEFA 5CHGA 9ICCA 3RWUA 1ZBUA 3HXMA 4XIUA 1EX4A 3S3OA 2BCRA 3NGDA 1ZQTA 4CHYA 5DB9A 4KLJA 3PUFA 4M3ZA 3EY1A 2KTQA 4DTRA 2JLEA 4KLFA 2AQ4A 1RDDA 4KLLA 4QZEA 3NHGA 4W5TA 1ZQDA 1RBVA 3MR2A 2RDJA 4M9LA 3OY9A 3C2MA 3I0SA 2FMPA 4YFUA 4MEYA 1ZQUA 4ED1A 4CFBA 1S0OA 2G8VA 5IINA 1HYZA 2UVUA 3Q8QB 3MEDA 4CF8A 4Z4IA 2PI4A 3LP2A 2YNFA 4FM2A 4CK2A 5F9LA 4R8UA 8ICRA 5KGWA 4DTXA 4FK2A 3U6FA 4CFAA 1KEJA 4RQ4A 3OVNA 5KGXA 2XY5A 4GVMA 7ICTA 5J0PA 4CGJA 4DSEA 2YV0X 7ICUA 2V9WA 3ORYA 5KFBA 3MGIA 1QHTA 4FJIA 1W9HA 3QZ8A 3JPQA 1CEZA 2ZJ8A 4YXMA 1ZQLA 4YMNA 3NCIA 4J9MA 1TKXA 4RT2A 1ASVA 3EYZA 4NLNA 4BDYA 4DL6A 4O44A 4KKOA 1ZQBA 3VQDA 3RJFA 1ZQEA 2ZTDA 3AU2A 1Z3EB 1TK5A 4I2BA 4QZAA 3VQPA 4DU4A 4BWJA 4I9QA 3UQ2A 4QZIA 4QWEA 3RH6A 3UXPA 1RTDA 3B6OA 5BOMA 4CF1A 4UB4A 3PW2A 2X74A 2DFHA 2PYJA 1DGSA 4LSNA 3JPSA 1TK0A 1TFRA 2VA3A 3NTUA 1JX4A 4PQUA 1A76A 1XC9A 4MFFA 5JS2A 9ICFA 3L2VA 4J9SA 4Q44A 3UIQA 3RJJA 4H8KA 5HRRA 3EWAA 2I1QA 4KHYA 4QW8A 4YXJA 1NK9A 3CG7A 2W42A 2Q0ZX 5J2IA 1L3VA 3KLIA 3AA3A 2C2RA 3RAXA 1NJYA 5JS1A 3JPNA 5HMMA 3PMLA 1NOYA 3M8RA 1ZYQA 4FJJA 4I2EA 4CEOA 2FLNA 1D5AA 4CJ4A 3DMJA 1WSJA 2JGUA 2E6LA 1RBUA 1JKHA 1SL2A 4YR3A 2OPRA 3L3UA 4Z6DA 3KHHA 4ECVA 1TVRA 5KG1A 1GOAA 4DLEA 1MSWD 5DLFA 4DTNA 4F4YA 4EP4A 4MF2A 4LD0A 1S6PA 4M3UA 4IRCA 1HJRA 3BQTA 4GXJA 1ZQFA 9ICWA 4B9NA 3C1ZA 5C5JA 7ICLA 4Z4GA 4KMUA 3IRXA 1RCHA 4DSLA 2GWSA 4DL5A 4B9SA 4RQ1A 3NE6A 3V6KA 2FC0A 4BDZA 3T1AA 3ZDDA 4C8NA 3GIKA 3MEEA 2XY6A 3ZDEA 3MR3A 3AVLA 1K1QA 3TAGA 4TSXA 1SUQA 2BGGA 1WSFA 1RYRA 4BE2A 4YP3A 3QEIA 4M3RA 4UBBA 5KT2A 3PY8A 3SV3A 1S10A 3P83D 5K14A 5KT4A 3TAPA 1XO1A 2DPJA 1QSLA 3VQ7A 2FBVA 2HHVA 3C94A 2G8WA 3QNNA 4FJ7A 4EBCA 1UA1A 1ZQKA 1DTQA 3OYLA 4EP5A 3C6UA 4E7KA 2ATLA 4W5NA 2NUBA 4OGCA 3VQ5A 1S1TA 2DTUA 4CJ5A 9ICNA 4TURA 3HK2A 4KLSA 1JIHA 2GBZA 2Z1JA 3V4IA 1JMSA 4F93B 3DLBA 3THVA 8ICTA 4M9JA 3OYIA 1LWEA 3LZIA 4CIFA 4JV0A 3AVNA 1TVAA 3TABA 4JS4A 1AROP 2ZUDA 4KHSA 1I39A 4FJ8A 5IIIA 2OPQA 3Q8MA 2W9BB 3DM2A 3PV8A 4IG0A 4N5SA 1DOQA 3AO5A 3OS0A 4BE0A 4FW2A 1TV9A 2HB5A 4FXDA 4M9NA 3RB3A 5DG9A 4F50A 4EEYA 3G0ZA 2P1JA 5J2MA 4PUOA 3FYHA 3O4NA 1ZQGA 5CY4A 9ICXA 2YHBA 3QEAZ 4P4MA 4RNNA 1VRUA 1HRHA 2IHMA 1LV5A 3AU6A 3ZSVA 3O4QA 4DWIA 1CZBA 4CEEA 3T3FA 3HJFA 2NRWA 4X5VA 1S9EA 2IHNA 3NGYA 5J1EA 4J2AA 3U3GA 3OGUA 2LSNA 5EWEA 2W9BA 3CFOA 2RPIA 3D0PA 4FZXC 4FS1A 4DU3A 7ICIA 3LAKA 1S6QA 4CHNA 8ICHA 4KLGA 4XA5A 4Q8FA 4CGFA 4I27A 1VSFA 3C23A 1ZQWA 4FYDA 3NH2A 4DFKA 4PHPA 1A5WA 1NKEA 3AVKA 2HHTA 3CM6A 5IIMA 2FMQA 4JS5A 4MQ3A 9ICRA 4PPXA 4FLVA 1ZQYA 3OYDA 2F1IA 4C8MA 3MDAA 2F96A 4IRDA 1NOMA 4KFBA 5L1JA 4ELUA 1C1BA 4BWMA 4F4ZA 5T7BA 1TV6A 1EXQA 3RB0A 3SUQA 4UB5A 4LZDA 5KG2A 4F4XA 4KI4A 3H4DA 4H4MA 2ETJA 4R65A 8ICAA 3GIIA 4DMNA 1ZBLA 4GC7A 2XCPA 3CQ8A 2M9NA 3VQ9A 3SPYA 2ZTCA 3UXOA 7ICQA 5EU7A 2E6MA 1J53A 2PZSA 4M9GA 1JXEA 3ETLA 3H4BA 3MBYA 3VQCA 1S1VA 2I9GA 4KI6A 4PGQA 3H8WA 2BCSA 4KTZA 4KPYA 5DG8A 4NY8A 3C2LA 1KSPA 3K59A 1JXLA 4RPZA 2F8SA 1BCMA 2PI5A 4B9UA 3Q8RB 3SV4A 3IS9A 4AHRA 1L3SA 3IHQB 1IG9A 2XY8A 2AQ0A 2ISOA 4O5EA 1QQCA 2OA8A 3I0RA 5JUMA 3BDPA 4BE1A 4PWDA 1BQNA 8ICMA 3C95A 3KHRA 1I3AA 9ICUA 4AHTA 4ZHRA 4DTJA 1ZQCA 8ICNA 2BCQA 1U45A 1X9SA 3HL8A 1IO2A 1N6QA 2B4JA 3T5KA 2HVIA 5HP1A 3RAQA 3ZT1A 1NKBA 1UT5A 4FJHA 3TAMA 3SQ1A 4FK0A 2HW3A 1VSEA 5KG7A 4O5CA 2Y1IA 5J2GA 1ZQXA 3NFAA 4KHQA 1HYVA 3DYAA 1WSIA 5DB6A 1ZETA 1VSKA 3RMDA 3GV8B 5L1LA 3LPTA 1X9WA 3EZ5A 5L1KA 4M47A 4KLMA 3HPHA 4O3NA 2IDOA 3AUOA 4NYFA 3TARA 4F8RA 4EBDA 2X6NA 1ZQOA 8ICKA 5KFWA 4E19A 3RBEA 2PFPA 4N56A 4IG3A 5KG6A 4F5RA 2VG7A 1J9AA 1SV5A 1CLQA 2A1JA 3AVCA 4IQVA 3VQBA 4HVJA 9ICIA 2X78A 1Z26A 2FPKA 1A77A 4KB0A 4I2JA 4J9KA 1X1PA 1UA0A 9ICOA 5I42A 4IR1A 5HHIA 5KFFA 1LW2A 4RUCA 4OJRA 3V7JA 4G3IA 4KLOA 1U47A 5C25A 2BCUA 3AA2A 2BQUA 2XRIA 4ELTA 4QZBA 1KFTA 5E41A 3DLKA 5C24A 3OYCA 5J29A 4ED0A 2OPSA 4Z4HA 4O5BA 4RPXA 1YTAA 2MAXA 8ICVA 1ZQSA 3CM5A 3AA4A 3IAYA 1TAUA 1U49A 1JLCA 5DQHA 5FDLA 2R8JA 3OYAA 1ZQRA 1DLOA 4QZ9A 1TK8A 4B9LA 9ICSA 5F9NA 3SUNA 4DTMA 4NCGA 4ED2A 1D8LA 4B8AB 4LVSA 5IILA 5HRNA 4JUZA 1WCNA 3RR8A 3HW8A 3SZ2A 3WNGA 5D46A 2NRXA 4KV8A 1ZQHA 1LAWA 5KFDA 3KK2A 3IG1A 1QSSA 3LWMA 3B6PA 3AVGA 1S1XA 2LYHA 4B9TA 3ZSXA 1S97A 5FRMA 4YG2A 5KFVA 4J9NA 3KD1E 3RRGA 3QEPA 5KFJA 4CECA 4F91B 2OZSA 3L3VA 2IGIA 1D8YA 5J2PA 3TR8A 1S1UA 2G8IA 5KFGA 1RTJA 4KN7A 1ZQNA 4RW4A 3GQCA 3B0XA 9ICHA 4FJNA 4MFBA 1WNSA 3C5FA 1T03A 4CEDA 3I8DA 3OYEA 4HHTA 4I2GA 3C1YA 4FLTA 2FPMA 5KT7A 5J2CA 1UAXA 2PYLA 4E1NA 4Q8EA 1C1CA 1D9DA 2GUIA 2G8FA 1WN7A 3NAEA 4KN4A 2B21A 3RJHA 3SQ4A 5J0OA 4C8OA 3KD5E 3LP1A 3AVBA 4O4GA 2C28A 2FBXA 5DQGA 2JEGA 1LWFA 1Y88A 4ED8A 5CYMA 3DRSA 4FJMA 3PR5B 3NBPA 7ICPA 1S76D 4KREA 1N48A 4MEXA 4ICLA 2W9CB 1S5JA 5EWFA 4GW6A 3L2RA 1HQUA 2IC3A 4OLAA 8ICSA 1TKZA 4DFJA 3GV7B 1S1WA 4CHQA 3RMCA 4ZTFA 5KRTA 3OYKA 4F5OA 5J2BA 4EYHB 3CFPA 4OLBA 1JLBA 2OWOA 8ICLA 2IOCA 3RJKA 1NK0A 4KLIA 3HSTB 4GXKA 4E3SA 1VRTA 2BHNA 3K75D 3MAQA 5KFXA 4L8RB 4OKKA 2FPLA 4LSLA 4M3XA 2BDPA 1C0TA 4QZ8A 5J2FA 1JL2A 1IKVA 4CJFA 3SI6A 3TAEA 4PY5A 5CWRA 4W5OA 3TANA 4KITB 1U9LA
chains in the Genus database with same CATH superfamily
1IR0A 2HS0A 4DEZA 4QZCA 1CPZA 4PKGA 1T05B 3JPPA 4ECYA 3AN1A 1YXQA 2R7VA 3QPIA 2FQQB 1VQKN 3MUTP 4I2HA 4LIRA 1Q3UA 3L4BC 4OQJA 5GMDA 2GIQA 4O3QA 3ISZA 1SQEA 1YHQN 4JI7K 3HO1A 4BR4A 4FVUA 2BABA 3EUB2 1Z00B 4DHVA 1L6NA 4MYTA 1RWKB 2HHHJ 3D0IE 2ZJQQ 2P9GA 1Z4UA 5JICA 3RG6A 4M3TA 2XULA 1B3TA 4WE1B 1J54A 4RU2A 1RT4A 1FKOB 3P5JA 4Z37A 3RR7A 4KLEA 2J8SA 2EFOA 1FWKA 3GP9A 1YJ7A 1AYEA 2Z4PA 1U24A 2N4DA 2DEIA 2RHKA 9ICJA 3KKSA 4OPHA 5AZJB 4P6QA 2FJVA 3IBWA 2HQDA 1NJWA 1K44A 1C4AA 2DGQA 2LYVA 5D4OA 5TKYA 4A4JA 3ET6A 2W9AA 2MQLA 2YNHB 4CEBA 1SBRA 4ZJLA 2VBWA 3HX0A 2JC1A 4IQXA 4DU7A 4WE1A 4DG1A 2G5IB 4A8XA 1URNA 3HSZA 4OV6A 1Q8BA 1GLCG 3AO1A 1O5JA 3T5HA 4IFYA 3SK3A 2GV9A 4NZ0A 1VISA 4MO5A 1E6YB 1YVFA 1JLEB 3QETA 2NXCA 1EARA 1R7IA 5AZJA 3J80O 4KT0C 3CC7S 1SC1B 1T6CA 2RKIB 3VC8A 4O3PA 4H5NA 1KFDA 1BVSA 2QFIA 5HMLA 1JXVA 4FJXA 4HR2A 1BPBA 3KTQA 2Q6BA 4I64A 3SPZA 4DR5J 4J2BA 2UXCK 4F5QA 1AUDA 2QX0A 3AD7C 5KFIA 3QBCA 2E5LJ 1RJJA 2HMIA 2YNIB 1WAJA 4AL6A 2HNZB 1WLJA 3PEHA 4BC3A 3RRKA 3H8MA 4USWA 5D8HB 2P9UA 1RAFB 3VTIA 1YI2N 2PY5A 3LDOA 1P27B 5F1XA 1ZJMA 4UZCA 4EFAC 4GO7X 3WX8A 3HP6A 4JN4A 5DMRA 5E33A 1V6HA 2LQBA 2LXFA 3QATA 4BDPA 3MEGA 5LT5A 1EQYA 3CJAA 3J7ZT 3HPGA 1NK7A 3K5MA 2NPFA 2GTDA 4XAKA 2V94A 4O55A 9RUBA 2QB1A 1X9MA 1R31A 1QVGM 2FJDB 4NLVA 4KB1A 3FEXB 2KK0A 1VDHA 2DR6A 3H8YA 4F0MA 3NL0A 3KJQB 4PQAA 3OYFA 1SCJB 1MQ3A 2FJ6A 5BN8A 5G5GA 1TFWA 4UY8T 2P9NB 2P9KB 4PXEA 5HLFA 4CFDA 2FVQA 1U25A 4USJC 4KAZA 5M1FA 3RMAA 3H0MB 4NCBA 2AMCB 3CIZA 2F9DA 3QGHA 4PL1A 2XYGB 4MFAA 1PG5B 2DL0A 3AVMA 4YOTA 5L1MA 2IY5B 3R3LA 5SWMA 1XWLA 3B9JA 5DETA 4DR2K 5AQPA 3E58A 2IVMA 2JWKA 4WIIA 3BQ7A 5AE3A 2ISPA 2RQMA 2VA2A 3CTRA 3VR1A 4JI1K 4EYIB 3CCSS 5J2DA 1LW0B 3VTHA 4K8ZA 3D1HA 5DKWA 4M45A 4BCAA 5ETSA 3SSQA 1Y0HA 1OSDA 2OFHX 3M32A 3KKRA 3GB0A 3QO9B 1K47A 3GU0A 1VQ8N 3K1ZA 3WHIA 3BS5A 4JI4F 1HBNB 3N6LA 3PLAA 2OTJN 2POKA 1ZA1B 4B3MK 2OM6A 3V6JA 2KLAA 2BUNA 5AQGA 4K50A 4DOBA 2EFQA 2GS8A 1T9WA 2OXOA 3CF5L 1YVUA 1IKWA 2HQIA 2EKNA 4LSZB 3MR7A 3AQOA 2Z1HA 5B0EA 3FQLA 1NK5A 2F8MA 1YJUA 2WOMA 1GFWB 1YWXA 4GVEA 3O9SA 2MZTA 5AM0A 2DVIA 2HVZA 3A5MC 1ZQJA 4X4VA 1FKAF 3KJVA 5IWAJ 4H0OA 4WYWA 2VONA 3B54A 5KOXA 2B5JB 1NOZA 3VQAA 4LF6K 3PZPA 4BREA 4NL9A 3WIVA 4BXOB 1O08A 4MLEA 4E1JA 3LDSA 3BBCA 4PG6A 3LPUA 2CZ4A 2VV5A 3H98A 5J2NB 3KLFA 2EXUA 3M8WA 4J9OA 1S3XA 4ECUA 2JFDA 3AA8A 5LSLA 1HFEL 2QK9A 4FNIA 2RSQA 2LDYA 4CJKA 4NMXA 5KPTA 4GC6A 5H9EK 3T1YK 4KLDA 4MFCA 5ALLA 3WX4A 5T41A 5BPMA 3WIUA 3J7ZO 3H1QA 1QQNA 3GR0A 4YN4A 5AHXA 2EZYA 3PMNA 1H3DA 4DPYA 2EWHA 3ONQA 3C21A 3L6QA 4AQYJ 1PJ5A 1IG8A 1Z25A 3PIPQ 5HR6A 4KH4A 5K8PA 1UEVA 3QU4A 3LWLA 2KE7A 3MZIA 1QTNB 3PSTA 2BH1A 4O0IA 1SS6A 4LF8K 3V4MA 4UY8O 4CO2A 1QM9A 1K8AT 1C6VA 2V4QA 2P9CA 4BVOA 2X3DA 1NPRA 2BW7A 4NXNF 4A5BA 1Z6RA 3EZOA 3M1VB 2KI2A 3O3GA 1N5QA 7ICNA 4BRHA 2LVWA 1NI3A 2XB2D 3CJRA 4PHEA 4AILC 2WVDA 3MDFA 4Y2JA 2R8IA 2QI2A 2FVPA 1NM1A 2WF7A 3TFRA 4P74A 2FC9A 2V2ZA 2XG8A 4LF7K 3S6EA 3E0FA 4CI0B 4Z6CA 2G09A 3F9KA 5GTIU 6FD1A 1K6YA 4M0AA 2QN6B 2O1PA 1R0BG 1HNVB 2FDNA 4E7JA 2RS2A 4JWMA 3NP5A 4UAVA 3VEOA 5CZXA 2YBVA 2KV2A 2BQ3A 4DL2A 1C20A 1FEEA 3HVTA 4FVMA 3C6TA 4Z6EA 4X4NA 2Y3YA 4P2HA 2P5GA 5BPNA 2VWJA 3AA9A 2FDRA 3B4DA 1EKSA 3F0NA 1R8BA 2H5IB 4ALZA 4IH7A 2M88A 3ISCA 3DLEB 1GLAG 3HOSA 2DISA 2CJKA 3K7RA 5AQFA 4UOCA 2G8UA 2VIHA 4FP9A 3QEVA 4LJMA 4C0BA 2O8FA 3A4TA 3RJGA 1S12A 3D4JA 3NVKA 1U1OA 5AJ3J 2NREA 4RNMA 3OXLA 3HF5A 2FLLA 3RJIA 2E2QA 3WXKA 2IS3A 4R8UB 3VAFA 3IRUA 3MXJA 1QZ6A 1RTZA 3I96A 3EW9A 1SXLA 4FNHA 2KRRA 2NXUA 2WHEA 2W4DA 4B3RF 1U26A 4RW6A 2CQDA 3DI6A 3DLEA 5TZVA 2VICA 2G08A 3ZD9A 5E5NA 4NLGA 3FVYA 5LMUF 3G6VA 4QBUA 3LGMA 2HHPA 3LP0A 1TKXB 1N0UA 2OZMA 2EQYA 2XIDA 4KKOB 3CJ0A 2HQGA 1W2BM 4KH1B 3IM1A 4BRDA 4FM1A 1RT5A 2UXDF 3NS7B 4YOYA 4IR9A 4W5RA 3QFHA 1Q8IA 4LBPA 2NRZA 4W4MA 2MKIA 3RSEB 1UPHA 1UHUA 4J91A 3UPFA 4I69A 4X4RA 5J2EA 2W9MA 3NVYA 5AKHA 2BCVA 4O9MA 2ZZMA 3JPRA 2Q0RA 5F0UA 3HSGA 3ILIA 4LFBF 5KQDA 2E5GA 1HBMB 2HIYA 3MM8A 4U7UK 1T4GA 5LXYA 3CW2C 2YMLA 4KLUA 1BGXT 2XZTB 1RAHB 1UFWA 2B9XA 3AOBA 2V0NA 1FDDA 1RSCA 4Y2RA 1IN0A 5F0XA 3MK6A 1K8AO 2HHWA 3M8SA 1UCNA 2WTUA 1ZQZA 4KX3A 1FKPA 4CJRA 1JKHB 3HRDD 1M1HA 2OPRB 1ZD2P 4TXSA 1KQSR 1ZQPA 1AUSL 3RJMB 2J9EA 5BPCA 4PGYA 1BIUA 4DSKA 4URGA 1N33K 1QQOA 2NYVA 1BD6A 1H6KX 2ZUCA 2OIHA 4OKJA 2WVBA 1GOCA 1KVKA 3IRXB 3LF0A 1SB6A 3ZLJA 2LM1A 3PKMA 1X31C 3HMJG 1HHSA 3MTJA 1IXRA 1Q7LB 1EHWA 4NO7A 4YR2A 2CNNB 3NY0A 5CZ1A 4CZHA 2AF6A 5FD1A 5K14B 1Z05A 1VQ9N 3G82B 3R5BA 3CIMA 4I6MB 1KDNA 4NLPA 3KNGA 4OLPA 4CI6A 4DR7J 4L3QA 5KPZA 1NBWA 4WP3A 1LEOA 1GLDG 3H5SA 3OL9A 2MKYA 4CP5A 2N82B 2CG4A 3C6UB 5GINA 1RAIB 1BI4A 1S1TB 1RTIA 3S9HA 3GG1A 3G6EN 2I6XA 5LMNK 2EKYA 5GIPA 1UPPA 3GJTB 1HKCA 3G71N 5ALQA 5A76A 4F26A 2QIFA 3C16B 2L08A 3MXMA 5KOWA 5AQVA 3PR4A 2FZKB 3KMQA 1QHAA 2NZ4A 1S0MA 2DFLA 1Q16B 1UVNA 4O8UA 1ZBIA 2YX4A 4DUTA 4IG0B 2F44A 4ILHA 3AD8C 1NLVA 3K5LA 3HHLD 3JPOA 1KCFA 4QPXA 4HKQA 4PUOB 5J2MB 3JB9k 2H5XA 2H3ZA 3D2EA 3N7PD 5DB7A 2VYPA 4IEEA 1H74A 5GIOA 1NPKA 1ZM2A 1HW8A 4GLXA 1XR6A 4CHOA 4Z6FA 3Q8KA 3BF3A 2BYCA 3FBFA 3LDNA 2F8LA 4I0WA 2FYXA 3TA2A 2O8DB 2K8AA 4R0EA 2XSJB 3W2VB 2XGQA 2XC9A 1S9GA 4Q45A 5FJ4A 4X62K 3KG4A 2BPCA 2IJFA 4FKXA 4X65J 2CQCA 4EI2A 4OZ0A 1PUZA 1RACB 4LF9F 2OELA 5J0QA 2FZGB 3K5NA 3UW1A 2KT2A 2FY1A 3E1YA 4CGHA 4NLOA 4PKHA 5ALHA 2DNHA 1SIJA 1UQVA 3TNVA 2F1HA 3K2PA 2EDUA 4BRCA 4PXBA 3W2WA 2MJNA 2D0CA 4NJ8A 2W01A 2J9DE 3I56N 3ENAA 4JV5K 4Y2MA 4KTQA 3V6HA 2IOFA 4DS5A 5BOLA 4OJ1A 5GAEI 1XN9A 3FZFA 1FFSB 4R66A 2MZSA 2KZ3A 4ZDNA 4UAWA 3TZXA 1O0PA 3GIJA 1KQKA 4L3NA 3ZCMA 3SUOA 2ZGYA 3BUZB 4H4MB 3BZCA 5M1OA 2A41A 2XM3A 3MM7B 3PKYA 1F5CA 4D3GA 4ECZA 2GQQA 3T1HF 2E7WA 2A18A 1RYSA 1XR5A 1T3OA 1G99A 4DQSA 1VQMS 3FLCO 2ZJPL 3AT1B 2LQJA 1ZTTA 3VZHA 3P39A 2R7OA 4U9RA 3AVFA 3R5CA 4DMZA 3LDAA 5F8HA 4NLTA 2OFGX 4RBTA 2VZ9A 3RTVA 3FJ2A 3ID6A 4C3MA 3M8YA 3RF9A 4DV2F 2Y1RI 1ATSA 2CPEA 4HUFA 2I6WA 2W40A 3A8KA 3FBEA 1Q86T 3F56A 3BDEA 2HQ3A 4LFCK 3MXIA 2ITGA 2V7YA 4QWCA 4GKJK 3LAMA 3BQ0A 4X4QA 1MU2A 5AKGA 2WVFA 2WHOA 4M94A 4PXDA 3DDHA 4CHZA 4BJQA 1H2TZ 2BE9B 4H4OA 3G4SS 1R3NA 2JRZA 3TSQA 4K4SA 1N60A 1FD2A 4AL7A 3AXKA 1VJWA 4M3WA 5DS7A 1EETA 1YBAA 4Q0BA 1TGOA 4DV0K 4EU0A 2ZBCA 3RH4A 4TUPA 4UW2A 1RT1A 1HBOA 3ZO7A 4Y2KA 1QH9A 2QYGA 4DR4F 4H0VB 4X2BA 1RDUA 3HD2A 2QL7B 5KFTA 2Z1GA 1EIYB 3OTOF 2XSFA 4QR1A 4OHZA 4RNOA 3U4LA 3PXGa 4AYBF 2RD5C 2ALZA 5IFMA 2GVZB 3C28A 1B4SA 2BM0A 3QUTA 1SV5B 2GH1A 4MIWA 2VQFF 2KZMA 4P7TA 2P6RA 4GV9A 4KBIA 4PJ0U 3ZSYA 1HR0K 8ICFA 2HHSA 1TMJA 2Z2YB 3DXKB 1FVSA 3N4MB 4FLZA 3CMAN 4F92B 2ZF5O 4C80A 3BPDA 4E1MA 4M41A 2P51A 3I5BA 1S5LU 3IO1A 4C7QA 5C25B 3LYSA 4DV1J 1Q8KA 3RB6A 2PFUA 1X4HA 2F9JA 3MTKA 2ZBPA 2A40A 3OS2A 1RPLA 4Z4EA 5KFUA 4DTSA 4QIEA 3R6MA 4RNFA 3MCPA 2DH9A 4O4RA 4MK9A 3HVRA 5HI7A 1FJGJ 2HHHK 3C2KA 5DDQC 2RDIA 1R8AA 3CMES 1NHKL 4TUSA 5KQ8A 4ZTJA 1VI7A 1YZ7A 4JI2F 3TW0A 2D0BA 1JN3A 1F2HA 4OGEA 3LZJA 2KH9A 3OW2M 3D3CJ 3T69A 3TAQA 1JB0C 3K58A 4Q43A 5B0DA 3ZT4A 9ICVA 4X4SA 4HI2A 4DR1J 5DGBA 1VSDA 3BM7A 3BREA 1S1XB 1D9FA 5IT9Y 2QE5A 4ZN1A 5CJ7A 4JKEA 4PRFA 1VSIA 3F53A 2EZZA 1B70B 1FXDA 3QNMA 3CCQS 5DQIA 4OVLA 4NLKA 2IIHA 3W60A 4A5AA 4M6WA 2OYQA 1RXVA 1B7FA 1S1UB 4FJLA 5E7OB 1G6BA 1BNOA 3CCLN 1PO6A 3BGUA 1Q86O 3J7AN 4F04B 3PYEA 2IM3A 5A8KA 1H98A 1OY9A 1PZNA 2R8HA 4AM6A 3C29A 3EXCX 1FRJA 3UMGA 5CHGA 5H1SV 2OEMA 1HD1A 4IWVA 4JK7A 4RWWA 1COKA 1HQ2A 3D6JA 2DTJA 3U26A 4CHYA 4F4AA 4FWLA 1YBTA 3AGKA 4M3ZA 4DTRA 3X3UA 4JI3F 3VAIA 5MLCV 5ADXH 1NZPA 2DNLA 1VQ6S 4KLLA 2HZAA 4DR5K 2H3EB 4F71A 4QZEA 2ZGZA 1ZQ1C 1RFQA 1VLBA 1PC4A 4ICLB 4M9LA 3GWCA 3I0SA 1IBLJ 3OY9A 2E5LK 1QUPA 4YFUA 4ED1A 2E9RX 5KNIA 1B4FA 1HYZA 5HATA 3D1OA 3F9MA 1JMTA 4JKHA 2MQ8A 2F76X 4CF8A 2W04A 1TKZB 4Z4IA 1S1WB 3LP2A 3C14A 3H0PA 2CVEA 4DCOB 5F9LA 1IBMF 1JLBB 3Q0AA 3L7UA 1VK3A 3CDWA 4Z7YA 4EGLA 3TTCA 3OVNA 2XY5A 5AIAA 5J0PA 4DSEA 2YV0X 3GCWP 1VRTB 2LDIA 5KFBA 3MGIA 1QHTA 5JU5A 4FPIA 1ZQLA 4YMNA 3VETA 2ZDOA 3POTB 4RT2A 4M7YA 3ZZZA 4BROA 1MMLA 4BDYA 1F3VA 4O44A 2VKZG 7AT1B 2HFNA 1VQLS 2ZH9A 4P0QB 1UMJA 2QGFB 1TK5A 3LDQA 2EFPA 3NNCA 2DT9A 3M2RA 1E3MA 2WB4A 3SCJE 1RAGB 1HNXJ 2DFHA 4WIQA 4LSNA 1WSRA 3TVZA 4JI6K 4FWNA 4C0ZA 4X84A 3OVBA 2DHXA 1JX4A 3M6VA 4PQUA 1B99A 2VJUA 3L2VA 4DCPB 3RJJA 2AYBA 3IBPA 4P73A 3G25A 5AFUH 1NK9A 1SKUB 1WC6A 2W42A 2Q0ZX 1NPPA 1LFPA 2ZBRA 4J5OA 5J2IA 1HI0P 5THWA 2XQCA 5HSPA 2QB0A 3C66A 1FX2A 3RAXA 1KTVA 2HG4A 4BC5A 3PMLA 1ZYQA 3QUQA 4I2EA 1QAYA 3H1VX 4KH6A 3BBBA 3GG4A 2E6LA 1NM2A 4CM0A 1X3NA 4QYRA 2I2YA 4YR3A 2E1MC 4CF5A 2ZIXB 5KG1A 4OI3A 4DLEA 2MZQA 2EK1A 2GJIA 2D4WA 4LD0A 4IRCA 5ALEA 3Q22A 1HJRA 4DV7K 4GXJA 4MO4A 4J9UE 5AI8A 3SAHA 1VFJA 5CCLA 4Z4GA 5JLHA 1ZZFA 2GAHC 5RUBA 1RCHA 3UE5A 3THWB 3C7NB 3IUCA 2FC0A 4H5TA 3T1AA 2BJ3A 2EG2A 4C8NA 3MEEA 3SFGA 1ZH5A 4C3LA 3KZBA 1WHWA 3AVLA 3PEJA 5C0YA 1FEZA 1WTBA 4KHRA 4E8UA 5C2DA 2MSTA 3FR0A 4C23A 3TAGA 2WAQD 3GG0A 4KC5A 1IR1A 1WSFA 2BGGA 1ZBTA 2ZIXA 1RUSA 1WOPA 4IL6U 5KT2A 2VB6A 3PY8A 1ZZNA 3FE1A 2C2KB 5IWAK 4EUVA 2JHDA 1HMVB 2K60A 1JJ2M 1FJEB 4IFVB 4NPOA 4KBOA 3NRBA 1NDPA 5AFUA 3BN7A 2F3JA 1UFLA 3C7NA 1YJ9N 4WU3A 3NASA 3BSAA 1NGJA 2QTWA 1H1VA 3J7AP 3KJFB 1ZQKA 3O4WA 4JKFA 4YORA 4L76A 2K89A 5CHCB 2ATLA 4W5NA 2LKYA 3E3XA 4OGCA 2DTUA 3HK2A 5B66U 3WU2U 3V4IA 4A8QA 2K4EA 3G8TA 4F93B 3FZBA 1KC8T 3AOAA 3OYIA 3TABA 1TVAA 1CS4B 2AJ0A 2EFGA 2F63A 3BKFA 3JQJA 2RHSB 3HT0A 2GMHA 1PK3A 4C4WA 3NCPA 4FJ8A 5IIIA 3C15A 3MCAB 4AQYK 3W5YA 1RT7B 4A8WA 4N5SA 1DOQA 4BE0A 4YOWA 1TV9A 2HB5A 4FXDA 2VCPA 3OR2A 3T6BA 2YB1A 4V19J 4EENA 2WW4A 1YRTA 3S6JA 1XNQF 4EEYA 5IV4A 2JH7A 2P1JA 1ZQGA 5AM4A 3DXMB 2AEJA 5EE3A 2YHBA 3QEAZ 5ALYA 4P4MA 2VFSA 1VRUA 1URRA 3MWPA 3A8YA 3AU6A 3O4QA 3VEZA 2CXYA 3DRXA 3EGNA 1WORA 2F4VF 1VGYA 3T3FA 3MUMP 1T95A 5EDWA 1S9EA 3UDCA 5EWEA 4PWUA 1HYSB 3CFOA 1VC0A 1C1BB 4DU3A 1U6FA 3LAKA 1S6QA 1TFYA 3HFKA 3I55S 1UEUA 3NOGA 1VSFA 2IVNA 2ASOA 2C2NA 1ZQWA 4FYDA 3DXMA 4FPRA 4DFKA 1NKEA 1TKTB 3O9UA 5EXWA 2FMQA 4DUZF 2A3JA 2RP5A 3NUQA 5BYQA 4PPXA 2QSWA 1WNEA 5C2CA 4FLVA 1ZQYA 3Q8YA 4CD3A 3DN9A 1ZAXA 4IRDA 3GYXB 1OXJA 2NLWA 1C4CA 1LKYB 3ETOA 1PJ6A 2B7BB 2E66A 3NKYA 2I5HA 4ELUA 1C1BA 4ILRA 2EI5A 1L7NA 3KZIU 3LVVA 1HNWJ 3BGRB 2E5SA 4F4ZA 5T7BA 3HHNB 1TV6A 2M52A 4LZDA 5KG2A 3AB4B 2LP4A 1B0VA 4DL0C 4FOEA 2YVSA 2ZOFA 3GIIA 1SQFA 3SQGA 2M9NA 3VQ9A 5E84A 3NS1A 4CYUA 4ANDA 1HWJA 2PIIA 3QIPB 3MBYA 4I7FB 2WF8A 2VGNA 2OEHA 4GMKA 5B0CA 4FL9A 3GFYA 5KAIU 1H73A 1NH8A 3FC9A 1R89A 4X64J 3MWTA 3K59A 1JXLA 4FSVA 1SV0C 2PI5A 3UCUP 3VGVA 4QR0A 5ALJA 1I5OB 4WZQA 5IT9U 3BDPA 5C7PA 3W61A 1BQNA 3R9PA 3C95A 1KC8O 3ZI4A 4ZHRA 4C4TA 3ZC4A 3ILJA 2BX6A 2WONB 1UWBB 2B4JA 3T5KA 2DK2A 3RAQA 4R79A 3KLGB 4P52A 2WSEC 1I94J 3TAMA 2HW3A 2Y1IA 3QX7A 2Q3PA 2APOA 1ZQXA 4KHQA 4I68A 3IWLA 3F2KA 1IM6A 1ZETA 3UMCA 4OX9F 4I6AA 3M2UB 4WYLA 3GV8B 3LPTA 3EZ5A 1GLFO 4KLMA 1CULA 2ZITA 4NYFA 3U1LA 3CJ4A 3R7BB 1XTZA 3AOCA 1ZQOA 8ICKA 4OHWA 2R9LA 3C3LA 3UE2A 2R7QA 5C24B 3DLGB 3P96A 4IG3A 1Y10A 3FKBA 5KL8B 2CQ3A 5HBMB 3R9KA 5KG6A 3R3TA 1FF2A 3S1TA 2A1JA 1YK9A 4B3OB 2P9EA 2PEHA 1Z26A 4DOZA 2YQ1A 1KN5A 3KJNB 2FPKA 4CZCA 4KB0A 1U8WA 3VWSA 2YB4A 2DR8A 2XO6A 9ICOA 2KMDA 4IR1A 2GX9A 5HHIA 1VQOS 4OJRA 3M2VA 3EX7B 4HT5A 3NS6A 4NI2A 3BBFA 3OR1B 3C2PA 2OJ3A 3UM9A 3AA2A 4YOEA 1BQMB 1T44A 2RU3A 2AP6A 3X1LB 4K8RA 1J5EF 5C24A 3EO3A 3MURP 5HAOA 2VG5B 2Z2MA 1OS5A 5B5EU 8ICVA 2LHTA 4BRFA 4XPCA 4DR7K 2QL9B 4I4BA 3VCDA 1P1LA 2W7PA 2AIRB 5ALUA 5F9NA 3KOOA 5DDPC 5M1NA 4NCGA 3I33A 2QWRA 1B64A 1ZBSA 5FIIA 4WFAQ 3V6DB 1WCNA 2AEFA 4KIAA 4NRTA 3HHLA 5D46A 5CH7B 4MLHA 5AQKA 1YQHA 1LAWA 4FVCA 3AAQA 2AJ1A 3LWMA 2LYHA 3M8QB 5FRMA 4X66F 4YG2A 3OVAA 2FLOA 2XWYA 4DBQA 5BRDA 4RBUA 2DKZA 5IT9O 4F91B 1BLUA 3L3VA 2IGIA 2YJFA 1D8YA 2W11A 5HMYA 4FZNA 2EC0A 2C1EB 1VR6A 2CQBA 3TR8A 3H2VE 2ZBIA 4KE5A 1RTJA 3HJVA 5BR9A 4KAIA 2HZCA 5A8WB 3EZUA 1KKXA 1NMDA 4FJNA 3M7VA 3TUIC 2UV8A 4V19X 2FGOA 3D2QA 5ETOA 3VEWA 2F7VA 4HHTA 3J7A1 2X51A 1FO4A 4DJBA 5D3GB 2YI1A 4AXJA 5J2CA 1P90A 3QAUA 1C1CA 4CIOA 1F44A 3TPQA 3RJHA 4C8OA 4IOAQ 1Z1ZA 1KVIA 3PIPL 1O51A 3OBIA 3TEGA 3B8HA 4JI4J 2ZBQA 3F5TA 4DHYA 2FBXA 2JEGA 3PJ9A 4JYAF 4EFHA 4X65K 4ED8A 5CYMA 2ZH7A 1IV0A 7ICPA 2XLKA 2ZM6K 1S76D 2CPYA 4MEXA 2NYHA 4DR3F 4WK1A 1S5JA 4CZFA 3HHLC 4WFNL 4J90A 2FJEB 3T79A 2R2RA 4G9ZA 3JSMB 3VENA 2ZHBA 4RWTA 4F5OA 5J2BA 3A3NB 2YQ3A 1TL1B 2E1ZA 2RQKA 1ICEB 5AQLA 1JCEA 1HL6A 1UW4A 3DDIA 2RILA 4IDKB 4F3MA 4P0PB 2YMQA 1ZC6A 2IHR1 2AHOB 1LWCB 2BDPA 1C0TA 4QZ8A 5D77A 2MKCA 2OHDA 1IKVA 3O9QA 4KHPJ 3MM5B 4CJFA 3W63A 3OFHA 3TAEA 3TVYA 3K8WA 2UU9J 4W5OA 3TANA 4ILLA 3MPVA 2DR7A 4IEIA 2C3OA 3AFGA 4F3TA 2VG6A 3GFKB 3ENWA 1OY8A 3SYZA 3LPYA 3ALYA 4FYXB 3MM9A 4E2FB 4OPKA 2R8GA 1ZRNA 2H3IA 3QINA 4HI1A 4DO9A 1HHTP 3E01A 1PK1A 1RYUA 4DPWA 3JXUA 1KLMB 2B4UA 1SIWB 2XHBA 1U2RA 4MH8A 2J76E 2H48B 3H25A 1H38A 4KH5A 2V5HG 2UV8G 1HKBA 1RT3B 2YKMA 2B9YA 3MPUB 2LU2A 2CUYA 3EDRB 4H5RA 4Z2XA 5C2GA 4CH7A 2IDLA 1T94A 1XMOJ 3HI0A 1RNHA 3NCRA 2UUBJ 1RDWX 1X6IA 2KKPA 5J0YA 3MFIA 3JTPA 2U2FA 1L7PA 3R1LA 3A8IA 1N88A 4LF1A 1FE4A 3IMXA 1FXRA 2BKNA 1O03A 5DGAA 2ZJ5A 3ULEB 2YJEA 2ADCA 2O6KA 2PDAA 3OUYB 4JD2B 4OZNA 2EANA 4C7ZA 3A5OC 3PW0A 5JRTA 2MUTB 2DBYA 4O5KA 7ICEA 2PFNA 1V5VA 3BO2A 2C2DA 2PFDA 3ZEUA 2L9WA 2J6TA 3CJ2A 3G96A 4I2PB 1CJKB 1WG5A 5HROA 4JI5F 3FUYA 5KG4A 3WK8A 3WQPA 4USUA 1HNIB 1M5PC 3DXSX 4AFFA 5C2FA 1EXNA 2UXCF 4R64A 2I0XA 2BANB 3SCIE 4JV1A 2WK4A 4CEZA 5BYRA 4CHPA 1YSJA 5AICA 1WG8A 3M9OB 2CAJA 3SIPB 4RW8B 2RQCA 4ZLLA 2KQ2A 1R0AB 3NF7A 2GVDB 2A6MA 4AHVA 2QYCA 3AARA 2ES6A 2DFEA 3ICLA 4ZKAA 4RTFD 1IKXB 4CF3A 7ICHA 1T8EA 3TZWA 4I29A 3DU6A 4IOCL 3CCRN 1JLAB 3PVXA 4FZMA 3RAMA 2KN4A 3C8YA 5AR0A 5E3PA 3D7EO 3VAMA 2BANA 3OL7A 3ZSZA 5E3QA 4DV1K 2OPPB 2ZC4A 4NLBA 1VDVA 3I82A 1OYEA 2QL5B 3HSCA 2K1RB 4M5DA 4Y2IA 3L09A 3ZTQA 3RRHA 4DSJA 2HNDB 3L8BA 1VAZA 1KVAA 5IIOA 3SQ2A 3H5UA 2J6UA 4RT3A 2PFQA 2I38A 1Z4OA 3EEQA 3CD0A 2WFAA 3ENHA 4Z4CA 4KO0B 5ALVA 1SC6A 4URQU 3Q2TC 3MECA 4JKAA 3Q89A 1X5OA 1N5TA 2F40A 1L5UA 3GL1A 3QU9A 1VMBA 1HLWA 3U9ZA 2B4VA 3H0LB 2GV1A 3KUHA 1Q9YA 5HMXA 4OJLA 1IKYA 3T5JA 4ZIWA 4CLWA 4DR1K 2FHKA 2G07A 1RTHB 5ALFA 4NA1A 2K1RA 3UKRB 5DBBA 2PMWA 4B02A 4DR2F 3HZEA 5JMNA 4XO0A 3BKTA 2P66A 1U04A 3UMBA 2ZG6A 3M8PB 2JSXA 3M5RA 3Q8UA 3ZSRA 4JI1F 4DN0A 3O44A 3BYPA 3AL0B 2AJQA 3L2QA 4I2QB 1WF2A 4FLUA 1BY9A 3U1MA 2GOLA 2JEIA 3B0YA 2UUAJ 4I9LA 1W7WA 2V2KA 4FLYA 3OYGA 3GV5B 2B4PA 1S0NA 4B3MF 5AQTA 4FK4A 3MMBB 2IBKA 3UKRA 1AW0A 3VQQA 3CRXA 4CWBA 1FT8A 4MKBA 5L9XA 2ZH1A 3Q23A 4DOAA 4TNOA 1R59O 3WKAA 2BW2A 2HVEA 4CLKA 3HKZF 1BUPA 3MF5A 3NF6A 3T1HK 1X4GA 1BA1A 1BPYA 3GDXA 4ZVUB 4UB3A 3IXQA 1IBLK 4CGZA 2BQRA 4OX6A 2MY7A 1Q0NA 5I3UB 3DRRA 5KFCA 3PACA 5GAGP 3F5EA 4LF6F 2UVVA 4DV6J 2BJ8A 2HOEA 3HPOA 2G2OA 1PYOB 2RIJA 1AZSB 2QLWA 4I6WA 3EUNA 5DO2A 2DBBA 3QWPA 4C8ZA 3ZSWA 5HNKA 3U3YA 2YKNA 4TKTA 3T1YF 5M1KA 2Q36A 5M2RA 2Y8WA 4JK8A 2DNKA 1MDUB 4GVBB 3ZT3A 4KYZA 2QWOA 4CF0A 2GGPA 2JZBB 2ZIVA 1V85A 2CJYB 5KFHA 3DAWA 3BSOA 4DCHA 2J7UA 2F4FA 3W9IA 4UAZA 1K8KB 5AI4A 3ONNA 1F9EB 2W2MP 1RHMB 2N4CA 4FLWA 1ROFA 3KWIA 1M5KC 1UT8A 1YRUA 2RRBA 5CP2A 3J8AA 4OJPA 1HNXK 2M9KA 4ECQA 4G6VB 5IM0B 1VSJA 2BEFA 1W25A 2ZH8A 3ZT2A 2MQMA 1XSLA 1FA0A 3O8WA 3H46O 8ICIA 4J9QA 4AXIA 2Y1LB 1D3WA 2WB1F 2D5RA 3BQ2A 2KHDA 4ID1A 3RJEA 8ICCA 4MTPA 2KVQE 3KLHB 1KP6A 4ZVHA 8ICBA 4JMUA 4ZVRB 3THPA 3SNNA 4UT4A 1CVJA 2B9WA 5L8RC 1V4TA 4FW1A 3CC4N 9ICQA 2VODA 4DPXA 5CZ2A 5AI0A 1NSPA 2HBRB 3A3OB 4LF7F 2VQFK 4GKKJ 2B56A 1O6XA 1D8BA 4RQ2A 2VC0A 4X4PA 4RW7A 3L4IA 4UB8U 4DV3J 1ZQIA 4PGXA 5BR8J 2BA9A 4K7QA 2RVJA 2O66A 4DOCA 4CT8A 5IT4A 3HWTA 3Q24A 1LNQA 2AGPA 1FESA 5EE1A 1W26A 1SJ1A 5K20B 1K73T 2B0CA 1KKHA 3WEEA 1VK0A 1WKKA 4OZJA 4K25A 2B43A 3IC1A 2F2AB 2P35A 4ETZA 2UUCF 1ZPVA 3MCNA 2QMXA 3QFWA 1VBKA 2X6SA 1SQKA 4JHDB 4B9MA 4G1PA 2AP1A 4LF5J 2XI3A 3DGPA 3FRZA 4J9LA 4CZLA 4RQ6A 4CRXA 3A0IX 4OIXA 2PXIA 1CXQA 5G0RB 4BG9A 1TYQA 4NM2A 7ICRA 3IG8A 2AW0A 2DB1A 3EPGA 4Y2SA 3IFRA 3OYMA 3M7DA 3H8JA 2WF5A 1WHXA 5AQHA 2Q3SA 3PX6A 2HEKA 2HGLA 4JHDA 5KFKA 3MEDB 4DX8H 4CVNE 1F0MA 4P4PA 4O8KA 5BRFA 3MR5A 1X5SA 3A2FA 2ASLA 2MHEA 2C2MB 1GNKA 4C0HA 3D0GE 7ICOA 2X3GA 4QYZJ 4ES2A 2WAQC 4LVNP 4BRNA 5J0XA 4E89A 4IO1A 2PMZF 1U1LA 4C8LA 1TP7A 2HNYA 4I2IA 4QNLA 5AK6A 3H8SA 1S7HA 4UF4A 2Z57B 4PZVA 4IH6A 1CC7A 3D28A 4OHVA 1FWPA 2KFNA 3WK7A 2HOIA 1F2GA 2KJ9A 4A59A 3BJYA 2BPGA 1JLFA 1RZMA 4QZVB 2O4IA 1SZHA 3DDNA 5LL6d 3OXFA 3VN5A 3JTNA 1BE4A 3GJQB 2WTFA 4WCEQ 2FHMA 3E9OA 2ZXHA 1LOUA 5H9FJ 4Z7CA 5J2JA 5EOZA 4JI8J 5KFEA 3OJSA 1NEEA 4Y65A 3FSIA 2J8AA 2RAQA 2HHQA 1EKRA 3V81A 1IBMK 2E20A 1T7PA 3PO5A 3OYNA 1NXIA 1YJRA 2VOPA 5DG7A 2HRTA 5D6GA 4B3TJ 1OKJA 2MKSA 2YQ0A 4KRFA 4AL5A 5TKWA 3UKUB 4EX6A 4P2FA 4AHSA 2KW4A 2G8KA 2W9CA 3DMJB 5KFQA 5AKEA 2MZJA 4PYDA 1J6ZA 4E98A 4F4WA 1TVRB 3AO3A 1K0VA 1RWPB 3TX8A 1S6PB 4QIWD 4ZPCA 1IBKJ 1K73O 4CLUA 3WNEA 4LF4K 1OH6A 2V8DA 2V2VA 8ICZA 4CESA 3CCJN 3F2DA 2K4HA 1HNWK 1GEHA 2CJBA 3HD1A 4RU9A 1X8DA 3DLHA 5DK5A 1RDBA 4CJPA 2ZZNA 4Y2QA 4HACA 2HBLA 2VC1A 2WVEA 3NWGA 3LTOA 2AX1A 2GJFA 3HHEA 1VBYA 3EE9A 2EHGA 1WG4A 4N76A 3VF2A 2FJAB 4KLTA 3O1LA 2Q0UA 3MFHA 3PHTA 3HRGA 1SUQB 4Z0UA 4M3YA 1MLAA 3DKDA 3SQOP 5B09A 3FBCA 4FWRA 5LJVA 3MDQA 3DHXA 1RZTA 3WK5A 2RUGA 4O0NA 2F1JA 3GOIA 4ISEA 4HHUA 4N41A 2NNWA 5LMNF 4X64K 2QKKA 2MLYA 3N7SC 3G9CA 1CI4A 1XUPO 2AEMA 4OI2A 3Q8PB 2YX6A 2ZOGA 3N6NA 4OYWA 2NV3A 4A62A 5AXNA 2ZD1A 4OJGA 1V3ZA 3SQ0A 1DTQB 5CB1A 3WK4A 4TY9A 2QG9B 2MB0B 1BPZA 7ICKA 1RBSA 1DTTA 4MF8A 4WXOA 4M2YA 3GIMA 1RWNB 5HMWA 3L0QA 4P4OA 3CO9A 4BQLA 4QWAA 1L3UA 2N1RA 1YLXA 5ALZA 3NGZA 4H03B 1I94K 2ACMA 3LVWA 1VQKS 3M9MB 2F65A 2UZAA 1CJTB 1XMBA 4YY3J 3ILOA 4XEIA 1RBAA 2AH5A 2C3PA 3PJWA 4QJVA 1HBUA 4F67A 4USIA 2OPQB 3UO0A 4CLLA 2JXJA 1SZPA 4DLGA 1R6VA 3AODA 5JMVA 3MXHP 4XQ8A 5B8HA 2HVHA 4UBCA 2N7CA 4WP8A 3GMGA 3ZXWA 2M7SA 4DX6A 2P9IB 4RNHA 3N4QA 3QEWA 3DDKA 3QGIA 1ITGA 3ZT0A 3LL3A 4X62F 4FO0A 1FRKA 2DPIA 4Z94A 4I2CA 1HEKA 2ZTEA 1F21A 4UB2A 4JV2A 3TQ1A 3MX2A 8RUCA 4UAYA 4JI3J 1KN6A 2Z7JA 3FZHA 4O3OA 4Q7AA 1YAGA 3KK7A 3Q7BA 5CR4A 2P9PB 5J1EB 2ASMA 3OSPA 3E51A 3OBWA 2LECA 1HWKA 4I2FA 4K2XA 1REVA 3BH7B 1BCOA 1U0HB 4M5NA 3L9ZA 4K4UA 3GIRA 4DX5A 4JV5F 5GAHU 3QNWB 1KQSM 4K4ZA 2RHQB 2DIUA 3RVCA 1DARA 2C42A 4Y2UA 4NZ7A 4DL4A 3OXGA 4IBNA 4M9HA 5DDYA 4LFAJ 5AK5A 1WAFA 1XNRJ 4ED6A 4B9VA 2IAJA 2HLUA 1IXKA 4OI4A 5B08A 4N7TA 2F9WA 3K2YA 1EKEA 5J8YA 5J2QA 4XTTA 3US5A 4C6AA 5ELZA 4ELVA 3ZETB 4ED3A 1N32J 2J6SA 4RW9A 4UB6U 3NF9A 3SBGA 5ETQA 1ZM3A 4WTOB 3ZZPA 3VGUA 5C42A 4KFBB 1W7AA 5AQYA 4DR6J 5KT6A 2YXLA 3G4SN 3RBZA 4YD1A 2FGCA 1GTHA 3O3FA 3ENOA 1JCFA 3ASMA 5AZIA 2AA4A 3WXJA 3RU0A 2YKPA 4BGDA 3VZIA 3HLUA 1AT1B 1EP4A 5HRSA 3IN5A 4CE6A 1RWMB 1RWOB 2YNGA 3J81Y 4UAUA 3GFZA 3MMCB 5HANA 2RH3A 3WZ0A 1S1VB 5DJBA 1QVFR 3WKCA 1YI2S 3VOVA 1E6VA 4FWQA 3VEVA 2EVZA 3WNHA 4LRAA 4LFCF 2WVCA 2C2EA 3MDCA 4FWPA 1BU6O 3CCJS 4GKJF 3ISND 3IS9B 3M4XA 2OTLN 2IRYA 4DV5J 3H7IA 2XI2A 1JLGA 3EE8A 4ZJQA 4M63A 4FZZA 4PWDB 2O8BB 4A2BA 4KRWA 2YTUA 4YVZA 1GX5A 3VCBA 3RB4A 1C0UA 3OHAA 1CUKA 5J8YC 1FEHA 1P7DA 4DV0F 2MSSA 1OH5A 4IUFA 3KUEA 4FM0A 3G87A 3LDLA 2IMOA 4NXZA 3HDSA 3GDQA 1SKRA 4EZ6A 2LEBA 3UFCX 3N0VA 3VV2B 2I1RA 1BHNA 3AJ2A 3QGPA 4ID5A 3SD7A 1KVBA 4P2MA 2F8TA 1A0PA 3VVUA 4CTAA 4F5NA 4NYOA 3SMZA 2IJRA 1BMQB 3DYAB 4O0JA 2Q79A 2FIUA 2LYBA 1KDHA 1T3QA 1XIQA 5ETTA 1X0PA 3RMBA 8ICPA 1HWLA 2VKRA 4RPYA 4LH4A 1LFWA 1IWAA 2F1FA 5AKZA 1KD1T 1S7IA 4CFCA 3UR3C 4F36A 3VPZA 1HR0F 3HJEA 2V6AA 4IJNA 4M5HA 4CJWA 4IKFA 1CQNA 4C7YA 5F8MA 1DHMA 3PNIA 2CGJA 1NGDA 2IVOA 1NG9A 2RF2B 3MD1A 4NRUA 3M6XA 9ICLA 3O6QA 1IVZA 3IR6B 4OFZA 2K7KA 4B08A 3Q2SC 2ZIWB 1VQ8S 3UN5A 2A1SA 1SJ3P 3DRYA 5I42B 3KDNA 2OTJS 4M63C 1LW2B 3KK3A 4KHPK 3CJKA 1GXLA 1G4CA 4N77A 2A3ZA 3Q83A 4FJ9A 2YHWA 2Q97A 2GHPA 4XUSA 2HHHF 7ICSA 4YEAA 5IXUA 4DPTA 3M8ZA 2IMWP 1NJZA 2IOFK 4OZ1A 1WSGA 2NRVA 4WFYA 4R5PA 4XPEA 4DQRA 4B1WB 4U8VA 2B51A 1HPZB 2KKVA 2KSOA 5IIJA 1WEYA 2RF2A 3ZSQA 1RKIA 2W55A 5KI6A 3WXIA 1U6BA 4DFDA 2YKQA 1JLCB 5FDLB 4CO3A 1BA0A 2DQNB 4PHDA 1DLOB 2PMHA 3I87A 3I31A 3MMAB 2MGZB 3OLAA 1ELOA 3NGUA 2P9LB 1VQ6N 7ICMA 1WYGA 2GZOA 3DNCA 1BWVA 4IRKA 1Q1KA 5KT5A 3V7LA 4P71A 5BJRA 5KTQA 1XMOK 1OJ4A 1KS2A 1RA6A 4RCHA 1URJA 5E3AA 4RG8A 3E8OA 5EY4A 4DB3A 2G8HA 3PW7A 1Z1BA 2PGCA 2V8HA 3V1RA 1EAYC 2JHEA 2MLZA 4IQTA 5ALMA 2GA7A 1GMWD 1HPZA 3V1OA 4BR0A 5J0SA 3OHBA 3MGHA 3MHYA 2D69A 2MQQA 3D2WA 2PA3A 5MAOA 2ZEJA 5F8LA 3QIDA 3QLHA 4QZGA 3QFUA 2IA6A 2MGZA 1XHZA 1UVJA 2WZ1A 2HQFA 3SUPA 2PMZC 4OYXA 4DUYJ 5J2PB 1FXXA 4CIGA 3VAHA 2EX3A 3PNCA 3VA0A 4RW4B 2EK6A 3JXOA 2HGMA 1VQLN 1VK8A 4YDXA 2HBMA 4N8OA 3NMRA 3DEEA 4CE9A 4DR5F 2RN2A 1YG0A 1M90T 3ZTOA 2E5LF 3RWUA 3WQTA 1W97L 1ZQTA 2CQ1A 4K43A 4LR9A 4JAXA 3BR8A 1VQPS 3KKFA 1FI4A 4DV4J 2AYEA 1VQNS 4U8YA 5JTIA 2DY1A 4ICAA 1KQQA 3N28A 4ZK7M 1PSDA 1ZM9A 2HS4A 3NBPB 3VERA 2RT3A 1KD1O 1ZQDA 2HLTA 2RDJA 4C11B 3C2MA 3K9KA 2FMPA 4MEYA 1NB2A 4XDDA 4CFBA 1S0OA 4K4TA 5IINA 1WOOA 2PI4A 4FYVB 3KNAA 3THXB 2FSKA 3EDQB 2YNFA 5HL7L 3KFUF 4A8EA 3PRDA 4CK2A 3CDUA 8ICRA 5KGWA 1UPMB 2B0GA 4ZS6A 2HBYB 4RQ4A 3IRWP 7ICTA 4CGJA 5E2QA 5BRHA 3ORYA 1RLDA 4TY8A 2MYFA 2FSJA 3BSNA 3JPQA 5B7WA 1TL7B 4YXMA 1V3SA 3NCIA 1ED1A 2GIRA 3H3NO 2WC9A 1ZQBA 4A8KA 3I5AA 3I9ZA 2Y9TA 3QICA 2ZTDA 4OYZA 3AU2A 3TSUA 3D54A 4LT6A 3JAMO 4PABA 4QZAA 3VQPA 4DU4A 3BZQA 4QZIA 4QWEA 1A6LA 3UXPA 1RTDA 1PAUB 3I8BA 1SQGA 1BUXA 4QPTA 1MWMA 4UUXA 3JPSA 1DZ5A 1OW5A 2RRDA 3KXDA 1IWGA 5M1PA 5IV3A 4MFFA 5JS2A 9ICFA 4WFAL 3EM1A 2B6GA 2NRRA 1XMQJ 2I1QA 4KHYA 2W43A 3FQKA 4YXJA 3A13A 4BGBA 2RUSA 3CG7A 2UUAK 2Y9HA 3LDPA 4C8YA 4DV7F 1SH3A 1RT4B 3KLIA 3AA3A 2C2RA 4OZ5A 1NJYA 3M8RA 1OYDA 3R5AA 3IDHA 4TN2A 1D5AA 1WSJA 2YX1A 2JGUA 1VIXA 5EX5A 4HDGA 1QAJA 5I4MA 1SWWA 2DPNA 3KDOA 4CH1A 4ECVA 5ALPA 1DRZA 2X7IA 4JKCA 4EP4A 5FPNA 2VPXB 5A2QY 5E3RA 3ET6B 3IBCB 3BQTA 2J7WA 3EGZA 1UP1A 5B0GA 2CPIA 7ICLA 4KMUA 1I3OB 5IWAF 2MEWA 1F9HA 4DG1B 1ILYA 4RQ1A 3NE6A 3SBMA 3ZDDA 2AZ3A 2WF9A 1M90O 3FCWA 1CG2A 4DV6K 2FVRA 4IFYB 2JOQA 4IOAL 1K1QA 5ALKA 2XEXA 2Y0SF 5ETLA 4TSXA 2DXDA 1JJCB 5DDOC 4USTA 3WXMB 2K2PA 1DXSA 1U1PA 5KT4A 4F0HA 2QW9A 3TAPA 1XO1A 1Z2LA 1WUAA 2ZNYA 2FBVA 1SZ2A 4WWSA 3QNNA 4FJ7A 1X40A 1NJIT 5B0FA 2DEJA 3J81U 4O23A 4EBCA 2CPZA 2HMIB 2E1EA 3SXLA 2YWFA 4CZIA 2DD8S 4NLXA 2C3YA 2AJ4A 1A7GE 3L5KA 3WKEA 4PXCA 2P9UB 3OYLA 5HVFA 4AQYF 3SMSA 1JIHA 2Z1JA 5FLXY 4ZVQB 3DLBA 4O5FA 3THVA 1M5OC 4JV0A 3AVNA 3MEGB 4QR2A 1OH7A 4JS4A 3WKBA 5HVGA 4BRGA 2Q31A 1AROP 3TP2A 4JI5K 2ZUDA 3CCES 1VQ9S 2QRRA 3Q8MA 2W9BB 1WG1A 4L75A 1F0XA 2A42A 1N36J 3RW6A 4CLYA 5JVGL 4F50A 3G0ZA 2DGUA 3FYHA 1T9YA 3O4NA 2CQIA 3IGVA 4RNNA 2KHCA 5HLFB 2IHMA 2W7OA 3U27A 3G6ES 4JKGA 3ZSVA 4DV3K 2IM2A 4NLDA 2CZ9A 4DWIA 5BR8K 3PYFA 3G71S 2EW9A 1YTYA 3HJFA 1RHQB 1FNOA 2NRWA 2IHNA 4JYAJ 1IG6A 5G4DA 3D6FB 4PZNA 1MMDA 2JC0A 2W9BA 2VFUA 2NUUG 1D1UA 1UEKA 2M2BA 4FS1A 4C1NK 2W41A 2DCLA 1APSA 8ICHA 4I27A 3VGLA 3NGKA 3ZZRA 4BHQA 2NO4A 1TZ0A 3C23A 4WF9L 4LUBA 4PHPA 3LH2S 3AVKA 2E2PA 1CZAN 2KO1A 1I6JA 5AJ3F 2VPYB 9ICRA 2UUTA 3M32B 2Q2RA 4OYMA 2DNPA 3DC2A 4K4YA 4NYZA 2F1IA 2W2OP 1UJ4A 3BS5B 1NOMA 2R42A 1DK3A 5L1JA 4KJIA 4BWMA 4JI7J 1IKWB 1OWXA 4DU8A 4S0MA 3WC0A 1Y11A 4F4XA 4EAHD 3H4DA 3F2CA 4PHTX 2BXJA 1BQXA 8ICAA 2VD3A 1ZBLA 5ALDA 4GC7A 2XLIA 2WOMB 2XCPA 3CQ8A 2JNJA 1YJNS 1PGZA 7ICQA 1FFVA 2E6MA 2I8EA 2HWIA 1J53A 3J7YP 3W8GA 4QYZK 3J81O 1CJUA 1A0OB 3KJVB 3T9ZA 2BCSA 3HM8A 5L9NA 4KTZA 4BRMA 2G0AA 3I56S 1NJIO 5DG8A 5ITHA 2JWNA 2JGAA 3C2LA 1KSPA 4RPZA 2F8SA 3BS7A 3Q8RB 3SV4A 1KNZA 3KLFB 3S41A 4MJKA 1IG9A 4FXWA 2XY8A 1QQCA 1KAZA 1M0SA 2O67A 1TMMA 1VQON 2K8BB 1Z4NA 3CT9A 4P7VA 4BE1A 1NZBA 8ICMA 3T9NA 1V38A 2OANA 1I3AA 5KAKA 4AHTA 4HT7A 4DTJA 2HF3A 5H9FK 3HL8A 3DXBA 1N6QA 2HVIA 4UQTA 5HP1A 4JI8K 3ZT1A 1NKBA 2KD1A 2DHGA 4HEA9 4FJHA 2D41A 3A12A 3SQ1A 1VSEA 2CGKA 3LM9A 3QAEA 1DAXA 3NFAA 3MWBA 4TLRA 1ECWA 1WSIA 2BKPA 1MA7A 4B3TK 1VSKA 4BUGA 3N9UC 3WKDA 1QQ7A 2H51B 3CCUS 3R6LB 3W66A 3TA1A 3KMSA 1PCAA 4LRCA 3PHEA 3HPHA 1QDUB 1QCKA 1BDGA 5KL1B 2AV5A 3CB4A 3P4IA 4P2XA 5M1QA 1MWKA 1RWWB 4F8RA 3UD4P 3P6YC 2LI6A 3AQPA 3JS6A 2ZDPA 1IBKK 3RBEA 3MI7X 5LJWA 2V67A 4K5RA 4NYPA 1PKUA 2PFPA 3THTA 5DM7Q 1X4FA 4K0KJ 4HH0A 4I67A 4F5RA 2VG7A 2UXBJ 4Y00A 1CLQA 3AVCA 2VJ4A 1S5ZA 4IQVA 3DWLA 3FM9A 3VQBA 9ICIA 4DI6A 1LVHA 5GADP 5I9EB 4YN3B 2WBRA 4J9KA 2IM1A 1UA0A 4BS2A 4HLBA 2RB7A 4RUCA 4DR7F 3V7JA 1I1GA 3HZ6A 2HAFA 1RI7A 3HVTB 4L73A 2E1RA 1VC5A 3C6TB 2WBMA 3TA0A 4KLOA 1C2PA 1NGAA 3QWUA 1RWUA 4HWIA 2F5GA 2BQUA 3H42A 3B78A 2XRIA 2W2PP 2JH1A 2KM8C 3BO4A 1HNZJ 1KFTA 1QAXA 5GVQA 3DLKA 3MAAA 3OT9A 3OYCA 4YS2A 2OPSA 5HQLA 4NZ6A 4PR6A 4NL9C 4NA3A 2G0CA 3AA4A 2ATCB 1NGBA 1D0EA 4NXMJ 5DQHA 1YJTA 1WC1A 1VQ7N 1T11A 2CFXA 4QIWC 2R8JA 1ZQRA 3O1BA 2O8FB 1TK8A 9ICSA 2QARA 3CWJA 3SUNA 5LSRA 5AE1A 4B8AB 2HFUA 3THYA 3CDBA 5IILA 2FVSA 2BACA 4JI0J 2DNQA 1YJWS 2KXFA 4ED5A 3MCOA 3CMAS 2QA2A 2DYAA 2HFVA 3GZFA 3WNGA 1XQSC 4AYBD 4HAIA 4KV8A 4FKYA 1ZQHA 4XH1A 3KK2A 5CAAA 2CQHA 3IG1A 4OO1J 2X1BA 3B6PA 4RW6B 3AVGA 3DI6B 2UUCK 4B9TA 2DH7A 1S97A 5KFVA 4J9NA 4YY3K 4UZBA 3TJ9A 3LA0A 4ZPTR 4UASA 3LP0B 1RK8A 3FGVA 4Y0WA 2OH2A 4CECA 5BPLA 1PBAA 5HMZA 2DIVA 2BOAA 3ZNJ1 1S8OA 1YIJN 4W98A 1FNXH 2H3GX 1RT5B 1KL9A 3JS9A 3VVTA 3EMTA 1IJJA 2CJAA 4X65F 4MFBA 2DHAA 3CXCR 1JJ2R 3C5FA 1T03A 2ZM6F 3OYEA 3O08A 5A2QU 1N5SA 4I2GA 2CYYA 4FLTA 2FPMA 5KT7A 6FDRA 3GTYX 2PYLA 4Q8EA 3K0SA 1GLJO 2G8FA 4KN4A 2B21A 3MM8B 2GUPA 4FPBA 2RQ5A 3KD5E 2V4JA 4O4GA 2PO4A 2GCFA 3M6UA 3R1XA 1SJRA 1Y88A 3DRSA 2V52B 1M1KT 4ZLJA 2J0XA 4CO5A 2IRXA 3JSYA 4OJ5A 2DGWA 1N48A 2BUPA 4LFAK 2EC2A 3GJSB 1FKPB 1XNRK 3GPAA 3L2RA 2W7AA 1HQUA 4OLAA 3ZX2A 3CHWA 8ICSA 2B4OA 1IIPA 3PIOQ 2D74B 1L8LA 3TU5A 4DFJA 4CHQA 2FTRA 3EVOA 1WD6A 4ZTFA 1N32K 1JK9B 1PVPA 2MA1A 5H9EJ 1KWMA 4EYHB 2NXEA 3DOMA 2OWOA 1RQ0A 1B7YB 3C19A 1NK0A 4DR6K 2NXNA 7FD1A 4E3SA 2O8EB 2RS8A 5KFXA 2E8NA 2GO7A 3CE8A 2M8DB 4ER8A 2ESEA 3IM9A 2XMUA 4LSLA 4C98A 2IIRA 2CA9A 4M3XA 5J2FA 1JL2A 5FLXU 2IA0A 3NMAA 4KITB 1GO3F 1XR7A 3QRPA 3UB5A 2UUWA 1JLQA 4TYAA 4QW9A 2JRSA 4G1IA 4KGMA 4LF8J 3OTDA 3N4PA 3V9ZA 1WEZA 3CDAA 3CC2N 3QNOA 1LAVA 2O8EA 4I2AA 3O1WA 5A0YB 3VQTA 2RMLA 2YWWA 2J7KA 4V1Ak 4DV5K 1BNPA 4OMFG 5GTHU 4IQUA 2RLTA 1OPIA 2QWNA 4LZGA 2R7TA 3F41A 4PG4A 3AXMA 1BI4B 2WCXA 4CNQA 1NNLA 1MG7A 1LXJA 1RTIB 2E5HA 3CD5A 5DM6L 3VQSA 2YPZA 1QTMA 1NB7A 2L48A 3FFIA 3U9DA 3ADAC 3O3HA 1EZZB 3SSRA 3J80Y 3IAS9 3A8EA 1NSKL 4WKYA 2KJ5A 4HHHA 3SMVA 2YWGA 2ZE2A 1JJ4A 1Y64A 5A0YA 1ZD4A 1VLYA 4C48A 3PX0A 4CERA 2G4BA 2V50A 4YCXA 3ULDA 2P6UA 3ISNC 8ICEA 5EE9A 2ZJPQ 3QDKA 3VQEA 4CZMA 5CHIA 5AM1A 3D2EB 1WSEA 5A0LA 2K3IA 2JL9A 1TL3A 3V9XA 3IAM9 4CJ3A 4E7LA 4CEQA 4PL2A 3R97A 5T7LA 1WF0A 3IM8A 3MAHA 2DWQA 3VAGA 4FYYB 5IOLA 4CZGA 1WC5A 1KAYA 4K4GA 3RH5A 3GYNA 2HK2A 2BDUA 1S9GB 4DQQA 4DV1F 1HUZA 4CT9A 2QWPA 1M1KO 3AVJA 4ACOA 1ASWA 2ROEA 2G0JA 3ZTSA 4CEAA 3BN4A 4I2DA 1RKJA 2DHHA 4QU6A 1ZQMA 5KT3A 1JNZB 5EOYA 2ZNZA 1WBBA 1F60B 3W2WB 5CXTA 2FPHX 1IM4A 4DQIA 5ADZA 1VHFA 5A8RA 1N34J 3NVZA 4DR1F 3H08A 4KHWA 2HF4A 2VANA 2XMAA 2XMVA 4ZOHC 1GMWA 1KHWA 1EB0A 4WFBQ 3L7OA 5HHHA 2XO7A 3WT0A 2E9TA 2XMJA 2VBYA 5DBCA 2RE2A 4AF1A 2XYHB 2BPFA 2KG1A 2KFZA 1WOQA 1O13A 5U47A 3I4PA 4DCJB 3O8MA 4DFMA 4CW7B 2FE9A 4M5LA 3CCMN 1N5WA 2BKEA 4WBFA 4NWBA 3P5TL 1IUJA 2R4FA 1RU1A 2FHJD 3J7Z5 1S0VA 1S59A 1P8GA 2CPRA 1UVIA 2C2ZB 4JWNA 4KQZA 4NYNA 4P9SA 2D0OA 1Q78A 5HQ8A 1FFWB 3TWHA 3PW4A 4PKIA 1RILA 2ZH4A 1N33J 4DUYK 4UTGA 1HLUA 1RT6A 4MYUA 3AO4A 2K8CB 3NGSA 5LL6Z 1RT2B 3D2FA 4UY85 3H40A 3QSYB 3FZKA 2H4WB 3L95X 4J03A 4DSFA 4JB3A 3PG9A 4Y3CA 1IBLF 4H5WA 2NXJA 3CJCA 3N5FA 2KL8A 1MU2B