3TANA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tanA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tanA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tanA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tanA01
1J9AA 4I2HA 4QWDA 1NOMA 4AHRA 4PHAA 3H40A 1IO2A 4KV8A 1TL1A 3P1GA 3M9OB 4JV2A 4IQUA 1IKXA 4FK2A 4DL2A 2ZD1A 5HROA 1L5UA 4QCLA 4W5OA 4DOAA 5FRMA 3LPTA 1A5VA 4Z4IA 3M8SA 4I29A 1JLQA 4RUCA 3V6JA 3F9KA 4AILC 1HJRA 3ZSXA 1RBUA 4F2SA 3DLHA 3QESA 1RT4A 3KLIA 4DFJA 1RBTA 1VSMA 4JLHA 4OJRA 2ZJ5A 3UXPA 2HW3A 3TFSA 5J1EA 2FMSA 2XY7A 5J0UA 2RPIA 4PQUA 2Z1IA 3SJJA 2ATLA 3QZ7A 3L3VA 3DLKA 4DTMA 2UVRA 5CZ1A 5L1JA 5JS2A 4YFUA 5IIIA 1X9WA 4CFCA 3B0YA 1A77A 4O3NA 1WSJA 2HHXA 1JXBA 5J0QA 1KSPA 2W9CA 4DL3A 3AO5A 3MFHA 3O4QA 2ZTCA 3PR5B 3PW2A 2AQ4A 1W0HA 4Z6DA 1S97A 4EZ9A 4EP5A 1SKRA 2KZ3A 3NHGA 2IC3A 2A1JB 3V6HA 4O3PA 1ZQWA 1VSIA 3TAPA 2HHUA 4KLUA 4DO9A 1NK7A 2R8HA 4YMOA 5J2JA 1TK5A 3UQ2A 5KT3A 3I0RA 1NJZA 1D9FA 3RJKA 1YT3A 3JPPA 4FJNA 1QS4A 5J2DA 3ZSRA 1HRHA 1JL2A 4CK3A 2BQUA 1VSHA 2YV0X 1ZJNA 2Q0ZX 1FKPA 3OYEA 4AH9A 4QZFA 4QZCA 2GBZA 3RR8A 3HP6A 1VSEA 5KFJA 2YHBA 4CE9A 4J2DA 4DEZA 4YQWA 4Z4CA 2IHMA 4OPKA 3V9WA 4DL5A 5DG7A 3C5GA 4CK2A 5DKWA 1A5WA 4FK4A 4TUPA 4RW7A 3HW8A 4I7FA 4IRKA 3K75D 4C8KA 1BPEA 2FMQA 3OJUA 3ETLA 3ZSZA 2PY5A 1YTUA 1CXQA 2BPGA 3L2QA 1X2IA 3VQEA 4J9RA 4CGIA 5KFLA 3IG1A 3DRPA 3C2MA 3ZSVA 4CF2A 3NGDA 1T3NA 2W9BB 3S3NA 5BOLA 1C1BA 3O4NA 5J2EA 7ICHA 3RR7A 4UAZA 3BQ0A 5J0TA 4QZGA 1SV5A 2OPQA 7ICTA 4JV1A 4X5VA 3PY8A 4CJVA 4O55A 3AO2A 1UT5A 4TSXA 1ZQXA 3RB3A 3ZT2A 4CFDA 4DQQA 3MDCA 2B6AA 4OGEA 3CM6A 4N47A 1EETA 4FS2A 4W5RA 4CHNA 5J2GA 4IR9A 9ICEA 1TK8A 3WNGA 2XGPA 5HMMA 1ZQBA 3L2RA 4F4XA 2ZUCA 9ICNA 2W9MA 5KT6A 4O0JA 3VA3A 4JWNA 5CA7A 3QEVA 2AGOA 3I0SA 3RMCA 3LWLA 4NLNA 4DSEA 1WCNA 3H8WA 4O3RA 4CJLA 2FMPA 4GW6A 3PW4A 4DS5A 4KITB 2F96A 2Z1JA 4PGQA 3OYGA 3TQ1A 2BPCA 4BE0A 4DTNA 4KLSA 5KT2A 3RBEA 2ALZA 1ZQSA 4QZ8A 1ZQJA 3MR5A 2G8KA 2HVIA 4O3OA 3TR8A 1S9EA 8ICOA 7ICSA 4B9TA 4RQ2A 3WNHA 3ZT3A 5KG0A 1Y97A 4QZDA 3O3GA 2QXFA 4F5RA 3OS0A 4RW8A 4E89A 3GV8B 3DRSA 5KFGA 4KLOA 4R65A 1NKCA 1CZ9A 4EBDA 1Y88A 2HNYA 4KHNA 3F73A 2C2EA 4KRFA 3GQCA 3RAQA 1RXWA 9ICPA 2DFFA 1ITGA 9ICHA 4CEFA 1Z3EB 2HHQA 4IDKA 8ICBA 4I2PA 1UA1A 4N5SA 4IBNA 2YNFA 1KFDA 8ICKA 1NK0A 2V9WA 2XY5A 8ICIA 2G8VA 1J53A 8ICSA 4RPXA 1H38A 2OWOA 4BACA 4O5CA 1JLCA 3PV8A 4RUAA 4DSJA 3KHLA 1KFTA 5KFZA 2F1IA 2E6MA 1S0MA 2YNHA 4KHWA 1NOYA 3H7IA 3TAFA 4R64A 4BXOA 4DU4A 1RTIA 4JS4A 2C28A 1A76A 4I28A 1B92A 1J54A 3HM9A 4O0IA 3GDXA 2FBXA 1QSSA 1ASWA 3RB6A 4RNNA 3JSMA 1WNSA 2A1SA 4N56A 4Z6CA 4ELTA 4QWAA 4RQ1A 4DL6A 3OHAA 4FO6A 5EOZA 2ASDA 2HHVA 3KLGA 4LH5A 2IA6A 4B8CA 2VA8A 4IQTA 4BXOB 1JLAA 2EX3A 4CIEA 4K4HA 3LALA 8ICZA 3PR4A 3ZDCA 3SV4A 4M45A 4YVZA 3JPTA 1L3TA 4F2RA 4NXZA 5J0PA 2BCRA 3FDSA 4CJWA 3LK9A 3QNNA 3V9SA 2ASJA 9ICFA 1IH7A 4RQ3A 9ICKA 3HP9A 3NGIA 4PY5A 3M9NB 2KFNA 4KMUA 5KG6A 3HWTA 2R8IA 1RDDA 1A5XA 4C8NA 3SYZA 4KHSA 3RJEA 3LANA 4ED7A 3TWHA 3QLHA 2JZBA 3B0XA 4NYFA 2HB5A 4LY7A 4KO0A 4ECUA 4YNQA 4H4MA 3D0PA 3MBYA 5CY4A 3QERA 1C6VA 2GWSA 4ECQA 8ICYA 4QWEA 4K8ZA 9ICCA 3MEGA 3KIOA 4I2EA 3PVXA 4LH4A 1NK5A 5CYQA 4N41A 4DL4A 3SI8A 5EWFA 3NH0A 4P4MA 3AA4A 1CLQA 1B43A 8ICAA 1VSKA 3T19A 4E19A 4IQVA 4TQSA 5KRSA 2ZQBA 4CERA 4KKOA 1B9FA 2G8IA 4KPYA 2V4RA 3EWAA 4QZBA 5J2HA 1XSLA 2I9GA 3NE6A 4PUOA 5KTQA 1MU2A 7ICUA 5J0WA 5CWRA 5DG8A 4CF9A 3CFRA 1BGXT 2PI5A 4Z4HA 1S6PA 5J2CA 1N5YA 4E0DA 3AUOA 4DFKA 4PWDA 1NJXA 3ZD8A 7ICPA 4ED8A 5KG1A 3L2WA 3SQ2A 3B6OA 1G15A 3T1AA 1ZQPA 5T7BA 5D4BA 4ID1A 4RPYA 3JPQA 4ED1A 4I9QA 4B8AB 3Q8RB 4BWMA 1RT3A 4B9LA 8ICVA 2PYLA 1IXRA 4HTUA 2FBTA 4FJLA 3OYLA 1S5JA 2NUBA 9ICVA 4Z4FA 4BDPA 3BQ1A 4DSKA 4TUSA 3N4MB 2DPIA 1XHZA 2FPLA 2JEFA 3TAQA 2KZZA 4BE1A 2I5JA 4IFYA 1TAUA 2JGUA 4DF4A 4Q0BA 4DQRA 5DGBA 3L3UA 3OY9A 4CK1A 3MR6A 1SL0A 4MFCA 4I2JA 5BOMA 1CZBA 4DU3A 2VG6A 1C1CA 1RILA 4HCCA 4M3UA 3K5OA 4CFBA 1VRUA 3S3MA 1S1TA 4P4PA 7ICMA 3QEBZ 8ICLA 4OKKA 3VN5A 3RJHA 1BIZA 5KFIA 8ICNA 9ICWA 1TV6A 4CJEA 4M3TA 5KT5A 2FC0A 1WSHA 2FLPA 7ICGA 3KLFA 3H08A 3PO5A 4ELUA 4M9GA 2D5RA 3K59A 3MXIA 3UIQA 2NRXA 1IKYA 3NBPA 4CF8A 4J9SA 1Z26A 3OHBA 9ICGA 3VQ6A 1S1UA 5KFXA 5J29A 4MF2A 3V81A 4FJ7A 2IHNA 4YP3A 2P5GA 3VQDA 4DTOA 5KFRA 1S1XA 3CFPA 3C5FA 4I2IA 4GVMA 5HLFA 2FBYA 4I2GA 4FJJA 5EWEA 4CEZA 1BCOA 3U6FA 5KRTA 3HVTA 4RQ0A 3MEDA 2W8KA 1HYZA 1ZQKA 3IS9A 3ISBA 3RH6A 4RQ5A 5KFNA 1RPLA 1WN7A 3DM2A 1NJWA 4J9QA 4Q8FA 4QWCA 5EU7A 4B08A 2IOCA 5DB7A 4O3SA 2KTQA 1COOA 3IM1A 4XRHA 1S1VA 2ZJAA 5HRPA 5J2MA 3T5KA 3G0ZA 3G6XA 4ED6A 5HHHA 4NYNA 4Z6FA 1VSLA 3G6YA 4XIUA 4CF1A 5CZ2A 3KK1A 3JPSA 3AVKA 5IINA 3KLEA 1RYRA 2VG5A 3EPGA 3SUNA 4W5TA 3PX6A 3TI0A 4IRCA 4ECTA 3HYFA 5DB6A 5I42A 1EP4A 3KKRA 5HBMA 4I2FA 2PYJA 3AVJA 4UBCA 5IIJA 1TVRA 4IQWA 4ED0A 1U45A 4ECYA 4F5PA 3V1RA 1CXUA 8ICUA 3QEAZ 4DLEA 2AU0A 1HNVA 2AGQA 4KN7A 3K57A 1WAFA 4CJSA 2F1HA 8ICHA 1Z00B 1HQEA 4BDZA 4ICLA 1S0OA 2VG7A 3KD5E 3H8JA 2IMWP 4GXJA 2WTFA 2D0AA 3BQ2A 1C7YA 5CJ7A 3LWMA 4ED2A 1KLMA 4KHQA 4C8LA 4CJ4A 2F8SA 4IKFA 4E7KA 4UBBA 4M3WA 5C24A 3TAEA 3RJGA 1LWCA 2QKBA 2LYHA 4M04A 4YMMA 4GLXA 3LAMA 4FZYA 5D49A 3H4DA 3PO4A 2BANA 2ETJA 5FROA 3L8BA 2QKKA 7ICOA 3DLBA 5KFSA 4B9NA 4ECSA 1GOBA 3PW0A 9ICXA 1RNHA 1Q9YA 4F5NA 3AA5X 1XU4A 4XQ8A 2JEGA 4N76A 4M41A 4FLWA 4W5NA 1RTJA 4MFBA 3AVBA 4DG1A 2V4QA 4M47A 1S9GA 4I2DA 2VWKA 3ZD9A 5KFKA 5KFBA 1DGSA 4B9MA 4M2YA 4O5EA 4QZHA 9ICQA 1X1PA 3ZDBA 4RU9A 2Z1GA 1BISA 3V1QA 3EW9A 2EHGA 4YD2A 3NF6A 3GV5B 1WSEA 3VQ8A 3AVGA 5J2KA 4J9KA 3TARA 2HHSA 9ICJA 3DI6A 5L1IA 5SWMA 8ICMA 5DLGA 4NY8A 4OVLA 3HT3A 4KLMA 3OYBA 4LSNA 4J9LA 3M8QA 1L3SA 4F91B 3DLRA 1ASUA 1HYSA 1L3VA 3AO1A 5KFVA 5K14A 2ISPA 2IAJA 4PGXA 2GV9A 5KFCA 4CESA 1T8EA 4ZTJA 3OYFA 3AO3A 3K5NA 4R8UA 1NK9A 3KKSA 2UVWA 3OYKA 2DFLA 4RNOA 9ICLA 2ZUDA 2A1JA 4FJKA 1LV5A 1S0VA 4RT3A 3AU6A 2ZTDA 3MGHA 4M9NA 4F92B 4P2HA 2JLEA 3OYNA 9ICSA 1F21A 3PX0A 2B4JA 2XHBA 3QETA 4M9JA 1JIHA 4J2AA 3C1ZA 1TKDA 4JRPA 3NF7A 1EKEA 2PZSA 1RT7A 1TKZA 1C0MA 3MGIA 4PHDA 4Z4EA 3K5MA 4O5BA 4NM2A 4K8XA 4LZGA 4KAZA 2QK9A 2KZMA 1XC9A 3V9XA 4UB2A 3OSPA 3DLEA 5KT7A 3RJIA 7ICJA 2LSNA 4F3TA 2ZE2A 1NKBA 2D0CA 4PHEA 2XC9A 4F50A 3Q8SB 3EYZA 5J2IA 3MECA 4KLDA 5FDLA 8ICWA 1RT1A 4JK1A 2HHWA 3RH5A 4OGCA 4MEXA 3RH4A 4CECA 5KFTA 4IG3A 4YXMA 4PPXA 1AROP 4DTPA 2RKIA 4JV0A 1JLEA 4MFAA 4DOCA 1ZQUA 5KGWA 2D0BA 4O5KA 4QZ9A 3U3YA 1JKHA 2RF2A 1JLGA 5DDMA 1NOZA 4DTSA 5DBAA 3V6DA 3QEWA 2IBKA 4FM1A 3UXOA 3O3HA 1S10A 1IKVA 4Q8EA 3QEPA 1KDHA 4Q43A 2J6SA 2HNZA 5L1KA 3ZCMA 4I2QA 2Q3SA 3VQQA 1U47A 3OYHA 7ICFA 1BVSA 5J0OA 5F9LA 3KHRA 4CJFA 1YTAA 2XRIA 4O44A 3VQ4A 4F3OA 7ICIA 4NCAA 4Z6EA 4RPZA 4E7LA 3QO9A 1MSWD 4CEOA 3AVCA 1LAWA 4FLYA 2KFZA 4YR2A 4MQ3A 4KREA 3IHQB 5CP2A 3AVLA 1GOCA 1VSFA 4FK0A 2X6SA 1VK0A 4YR3A 3LZJA 4FLUA 4EYIB 3S3OA 4M3XA 3EY1A 3Q8KA 5J0RA 1B22A 4Q5VA 5C25A 3KLHA 3IRXA 1JL1A 3RBDA 4FBUA 5KFWA 4DTXA 1BQNA 4M42A 2AQ0A 4W5QA 5HHIA 4UAWA 2W9BA 3ISNC 3K58A 3GILA 5KFQA 4GMJB 1U04A 3MAQA 3CG7A 4DU1A 1DLOA 2OPRA 4CGJA 1XSPA 8ICTA 1UWBA 2FLLA 1XS9D 4UQGA 1SL1A 3JPRA 2Y1JA 4YD1A 1D5AA 4FJXA 4DQPA 4QOZB 4RW6A 3ORYA 1SL2A 5KFEA 5D3GA 4LZDA 4TUQA 1WLJA 3Q8PB 2WONA 4AHSA 3ZDEA 5SZTA 3RMBA 4F4KA 7ICEA 1TVAA 2BCVA 5KFOA 3NH2A 3RJFA 3QINA 4LD0A 5TZVA 1XWLA 4FJIA 4NLGA 2E4LA 3AO4A 1RYSA 4O3QA 4DMNA 1ZBIA 4B9UA 1EXNA 5KG2A 3RMAA 3E01A 3SQ0A 5DB9A 2X78A 2DY4A 1ZQRA 4ECXA 4FS1A 2J6TA 3OSNA 4QW9A 3OS2A 1UT8A 4KLHA 1HPZA 3ZT4A 3MR3A 1QSLA 2F1JA 4QZIA 5IIMA 1KVBA 1SKWA 1RT5A 3K2PA 4OKEA 3AU2A 1ZQZA 2PXIA 3BJYA 2HVHA 3OYMA 1ZETA 2DFEA 2PFQA 1VSDA 3JYTA 1ZQLA 4CEDA 4PGYA 4E7IA 1IM4A 1LWEA 2DPJA 1HYVA 4OLBA 4QZAA 4FLTA 1ZQCA 3V7KA 4G1QA 1S77D 3AA3A 1D8YA 5CR0A 8ICQA 1WCLA 1LB2B 1T4GA 5CB1A 2ISOA 3AVAA 1NK8A 4DFMA 4M9LA 1MQ2A 2XO7A 1BQMA 2IDOA 5KFPA 4CIFA 2IGIA 2WOMA 4B9VA 7ICRA 3GIJA 4Q45A 3THVA 1BIUA 4CEAA 1LAVA 2XY8A 3HK2A 5DB8A 5KG5A 3PMNA 4DF8A 3HSTB 5HNKA 2DTUA 4O4GA 3NGZA 1K6YA 4Q44A 4J9NA 3NH1A 4BDYA 3DRRA 5KG7A 5J2FA 3UXNA 4EBCA 5HP1A 2OA8A 5HRSA 2BGGA 4RQ8A 4OKJA 1HNIA 1S6QA 1ZQQA 4YCXA 2ATQA 2PFNA 4KLLA 4ZTFA 4KHYA 4ELVA 4FBTA 4KB1A 1RDBA 3L2VA 4DTRA 3V7LA 5FRNA 3RRHA 1X9MA 5C5JA 4CJ5A 2B21A 2BQ3A 5L9XA 2BKEA 3Q8QB 1U48A 4NLKA 3A2FA 4L8RB 2XGQA 3V72A 9ICRA 3N97B 2VWJA 3TANA 2KQ2A 5L1LA 2IS3A 1BL3A 4DQSA 4OLAA 4M6WB 3C23A 1KVCA 2C22A 4CJKA 1K1QA 5DQIA 5KT4A 4ZH4A 4F4ZA 4NM1A 3C6UA 3OJSA 3DYAA 2G8WA 2E6LA 2BR0A 2XCAA 3CM5A 3QIPA 4TURA 7ICLA 2DFHA 1C0UA 3BDPA 4EEYA 1TAQA 4CJUA 1NJYA 4UB1A 5KFYA 4DFPA 5C42A 2RDJA 3P5JA 3SNNA 4PH5A 1U4BA 5J2NA 4IR1A 1EX4A 1RTHA 1REVA 1ZBFA 3TAMA 3RB0A 4CJQA 2BQRA 5HRNA 1FK9A 1RXVA 4OPJA 4E7JA 3ZDAA 3SUQA 4WE1A 5KFUA 3KHHA 2W9AA 3PW7A 4CJTA 4B9SA 4TQRA 2YKNA 2KW4A 3NAEA 4RZRA 4RW4A 4CHOA 4QW8A 4MFFA 3LZIA 4F93B 5IIKA 1HJPA 4KFBA 4FM0A 7ICKA 1ZQAA 1ZQDA 2P1JA 2X74A 2OZMA 9ICTA 1IG9A 2G8FA 4CIGA 5DGAA 1QE1A 3TABA 2P6UA 3DLGA 3C94A 4ECWA 4H4OA 3NTUA 1SZPA 4CFAA 2FBVA 4C8OA 3SI6A 4IG0A 4RQ7A 2YNIA 4CJRA 4CHPA 1BI4B 4KLGA 3JPOA 1KFSA 2VA2A 2W42A 1SKSA 1QSYA 2OPPA 5J2BA 3AVFA 5E41A 5JS1A 3QE9Y 4HCBA 5DK5A 3LP3A 1CUKA 3T5JA 1ZQVA 2BCUA 3QNOA 4JUZA 4J9OA 4CJPA 4G3IA 4GC7A 4KTQA 4M3RA 1LWFA 4CF0A 4KHUA 3HXMA 2ZTEA 3MDAA 2HHTA 3VQCA 1EXQA 3C6TA 3PW5A 4CJ3A 2X6NA 1T03A 3HPGA 4JS5A 4R63A 4NCBA 4B3OA 1TL3A 1RCHA 2W8LA 5DDYA 1BCMA 1ZYQA 4FW1A 4FJMA 3VQ5A 2BDPA 4KB0A 4EYHB 1BPXA 1RDAA 4DOBA 1T7PA 5KI6A 5DLFA 1ZQGA 4FLZA 4EBEA 3ZT1A 3RAXA 5KFHA 3RWUA 3HPHA 4XA5A 4I2AA 3QEXA 1MQ3A 5J0SA 2W9CB 4FJ8A 3WNFA 3LP2A 1TGOA 2R7YA 1TFRA 1N56A 2NRWA 3H4BA 3RB4A 1RZTA 1MC8A 4GC6A 3AVMA 3LP0A 4RQ6A 3PX4A 1RTDA 2F8TA 1Q8IA 3ZSOA 4CEEA 3S9HA 5J2AA 3QEIA 2PFPA 3RTVA 1UOCA 5J0YA 4CEBA 4CHQA 1RDCA 2ZJ8A 2YHAA 4F8RA 4QZEA 5DQHA 4P4OA 1UA0A 9ICBA 4M6WA 5D46A 1KTQA 1ZBLA 2OZSA 3K5LA 4KLTA 3HX0A 3ZDDA 4KTZA 4K4IA 2Z1HA 4CHZA 4AHTA 5HRRA 3MXMA 4UAYA 1C0TA 4ECRA 2NRTA 3LDSA 3C95A 3AVIA 3ZSQA 5KFFA 4M9HA 3SCXA 3HPOA 1BPYA 1RT6A 2FPKA 3KJVA 3H8SA 3VQ9A 2O4GA 4F4YA 3BQTA 3SV3A 4DWIA 3V7JA 2ASLA 3T5LA 3ULDA 2C2DA 4ZHRA 4ED3A 2JEIA 4MF8A 4ID5A 1I39A 1ZQNA 1TK0A 3O3FA 2FLNA 3MEEA 3GFKB 2ZUBA 1V9PA 3ISDA 1XO1A 1O1WA 1LW2A 2BGWA 5KFDA 4DTUA 1Z25A 8ICCA 1ZQIA 3NF8A 4FZZA 1XHXA 5BPCA 3VQBA 1ZQEA 3MABA 4I2CA 5CHGA 7ICQA 5KFMA 4Y1DA 3FFIA 3QIOA 4BGDA 3JPNA 2AGPA 4J2BA 4KLEA 3LDAA 1T05A 4FLXA 4K4GA 1ZBHA 1BPBA 5DMRA 1ZQHA 1TKTA 4HHTA 3SPZA 4EP4A 2PFOA 3G10A 3SQ4A 3WNEA 4KLIA 2YNGA 4F5OA 3SZ2A 3IAYA 3RRGA 4HVJA 3SUOA 4ECVA 7ICNA 4YFKA 2B5JA 3ASMA 3CFOA 4HUEA 2A1RA 1HQUA 4YG2A 1BI4A 4Z0UA 4RW9A 1QHTA 4HYKA 1TV9A 3VQ7A 3V1OA 5HMLA 4J2EA 8ICEA 8ICGA 3DMJA 3LAKA 1WSGA 4LVSA 4KTWA 4FVMA 2AJQA 4DSLA 1QQCA 2RDIA 9ICIA 3B6PA 3ZT0A 1UAXA 1B9DA 2BE2A 4CGDA 4FM2A 9ICUA 1R0AA 1X9SA 3NDKA 4YR0A 3AVHA 1DOQA 4JWMA 3UPQA 2UVVA 1RT2A 2FPMA 1C1AA 4UB5A 4C8MA 2MUTA 4PA1A 2M9NA 2G8HA 1WAJA 4HUFA 1W9HA 3V9UA 4BWJA 5J2PA 1XSNA 2R8JA 3HVRA 3T3FA 2BCQA 5KGXA 3L2UA 4PHPA 8ICJA 4DSIA 3Q8LA 1FXXA 2O4IA 3NFAA 4E1NA 4YMNA 3P83D 4HUGA 1ZQMA 3C2LA 3DOLA 4FXDA 3K4GA 1JMSA 4UB4A 1HUOA 3ZSYA 4AHUA 4YN4A 1ZJMA 4KI6A 5DBCA 2MUTB 1RBVA 3OGUA 5HP4A 3G6VA 4CEQA 1LW0A 4FJ9A 1L3UA 9ICMA 8ICPA 2ITGA 4E3SA 3ISCA 1S76D 3HJFA 5CYMA 4GXKA 1JLFA 1GOAA 3T5HA 5J2QA 1N6QA 1SUQA 5KG4A 1D9DA 1JX4A 1YVUA 1KRPA 1K1SA 5IILA 3AV9A 3KD1E 4DL7A 1JN3A 1IKWA 1KLNA 1JXLA 2P6RA 3VQAA 1RBSA 2KN7A 4KN4A 4BE2A 1ZQFA 2NRZA 1KEJA 8ICFA 1N48A 5KFAA 1Z00A 3OVNA 1NKEA 3AA2A 2HMIA 4O9MA 4CGGA 5J0XA 3M8PA 1BPDA 4ECZA 5EWGA 4GXIA 3C2KA 1HUZA 4QAGA 3V6KA 4KI4A 4R8UB 2XY6A 4M3ZA 2H5XA 1QTMA 1KCFA 5KG3A 1BHLA 1S0NA 3E2EA 2NRVA 3OYAA 5DG9A 1NK6A 3PNCA 3ALYA 3GIMA 3DOKA 5DBBA 3C21A 1S1WA 4IRDA 1DTTA 4RNMA 1JXEA 1S9FA 4LSLA 4IFVA 4M3YA 1ZQYA 3OYDA 3V9ZA 5F9NA 4F5QA 3GIKA 1QLNA 3CYMA 2P66A 9ICAA 2MAXA 2VA3A 1CEZA 3VA0A 1U49A 4Z4GA 3FYHA 1KVAA 2GUIA 2JZBB 1D8LA 4RG8A 3MXJA 1WSIA 8ICRA 3HL8A 5JUMA 3NGYA 4DTJA 2BHNA 4I2BA 3KK3A 4UB3A 4AHVA 3NCIA 3U3GA 4KLFA 4I9LA 3PUFA 4J9MA 1TKXA 4EZ6A 4CGHA 1I3AA 4E1MA 3MFIA 4RQ4A 2G8UA 3M9MB 3CQ8A 4H8KA 2JEJA 2P5OA 4FCYA 1J5OA 2PI4A 4YXJA 3AVNA 1ASVA 3KK2A 1Q9XA 3OYJA 3TAGA 3ZSWA 1JLBA 3QZ8A 1ZQTA 4FZXC 4XUSA 3V4IA 2UVUA 4KLQA 3C1YA 2YKMA 1PZNA 1VSJA 4DSFA 1WSFA 2P51A 1XI1A 2R8KA 3D45A 4E7HA 3RMDA 4AHCA 4Y1CA 3M8RA 3OYCA 2Y1IA 2OPSA 3HO1A 4MEYA 3Q8MA 2HNDA 1VRTA 4FYDA 3LP1A 4CGFA 4FJGA 4FLVA 1HMVA 4DLGA 2R8GA 8ICXA 4FJ5A 3VQPA 4I27A 4CHYA 3NF9A 4CCHA 1NK4A 4FJHA 4R66A 4KLJA 2J6UA 3PMLA 1BPZA 4RT2A 3KHGA 3LPUA 3ITHA 2VANA 3RJJA 4NCGA 4FW2A 2C2RA 2OYQA 4F4WA 3MR2A 3OYIA 1ZQOA 2XCPA 4M0AA 3SPYA 5IIOA 4NLZA 5I3UA 3SUPA 2BPFA 3I8DA 4J9PA 3TFRA 3EPIA 1U9LA 3GV7B 4QWBA 4JRQA 4R5PA 9ICOA 1ZBUA 3EZ5A 4DS4A 3BGRA 3SQ1A 5DQGA 3UQ0A 1RBRA 2BCSA 3KTQA 2I1QA 2RN2A 3OS1A 4DQIA 1FKOA 3GIIA 7ICVA 1DTQA
chains in the Genus database with same CATH superfamily
4J37A 1G4CA 3I4HX 1ZAXA 1NOMA 3PJXA 4K43A 1FRXA 1UAWA 3N0VA 3A4TA 1X3NA 2IC3B 2D1CA 2FJWA 3GJTB 2RHSB 4FK2A 5HROA 4CLSA 4R5PB 3P49B 4CJ7A 1QZ5A 5AQNA 2B3TB 1A5VA 4Z4IA 3M8SA 3SDEA 3FBCA 1YJNS 2A3ZA 3D1OA 4WTYA 1NB7A 4OYXA 4F2SA 4OZ0A 1KAZA 3MAAA 4CH7A 4KGKA 3KLIA 1RBTA 5IWAF 2ZJ5A 5CCLA 3T1YK 2LP4A 3SCJE 4PL1A 2XY7A 3GMGA 1VR6A 3H0LB 3IWLA 2YKMB 3HKZD 5J8YC 3TUPA 2DHHA 2LKYA 1YJWS 1X4HA 3B0YA 1X3MA 4FDFA 1JXBA 1KSPA 3FBEA 4C0BA 5F1XA 2KU7A 2WSCC 2ZTCA 1CJKA 3PW2A 1W0HA 4Z6DA 1RT4B 3QGHA 1XNQK 2RQ4A 4I67A 3DAWA 3QXGA 2IC3A 2QMUB 2A1JB 4US9A 3BGLA 4LSLB 1VSIA 1R31A 2HHUA 2G09A 2BE2B 3GE1A 4YMOA 2BUPA 3UQ2A 3H3OB 3H8YA 1NJZA 3K8WA 4CP5A 1D9FA 1OQ3A 3EMTA 4KHRA 4FJNA 1U7LA 2V52B 5J2DA 3QMQA 3ZSRA 2DH8A 3ZNJ1 1VSHA 3MN9A 3D0IE 2Q0ZX 4YDUA 4AH9A 3L95X 5EE1A 1HNXJ 1VSEA 4P7VA 3TP2A 3VCDA 4J2DA 5EE3A 2H3VA 2U1AA 2GELA 3UD4P 1Z6RA 4MJKA 4BVOA 3DDKA 2QWMA 2D4WA 2FHJA 2CYYA 3K75D 2FMQA 3OJUA 3ZSZA 1YTUA 1CXQA 4JI2J 3AARA 4RUHA 3MMJA 3VQEA 4J9RA 4QIFA 3U8XA 2OIHA 2JGAA 2F9JA 3GSDA 3R5BA 1N0UA 2XB2D 3C2MA 2MKSA 1VAZA 3ZSVA 4Y0WA 3NGDA 1LOTB 2HVZA 2W9BB 1RAGB 2UXBK 2E1AA 1SB6A 5J2EA 3WQTA 1JLCB 3ATVA 3RR7A 3N6LA 2DR5A 3MMBA 4DHYA 4P2SA 3BPSP 3TUZC 2RS8A 2QL5B 2HSTA 2OPQA 4UAVA 1FWPA 1ZAWA 4JV1A 5HMXA 2ZJPL 4IH6A 4X5VA 1VQ8S 4IOCL 5AKKA 4O55A 1UT5A 2WW4A 3M2RB 1JWWA 3DKDA 1KXPA 3CJCA 4LIWA 3GG0A 1N34K 3Q86A 2F8LA 3H59A 2EDUA 4LVOP 3NNAA 3OFFA 4N47A 4OCZA 3GYNA 2CPIA 3DXSX 1W97L 3ZYYX 2IOFK 5IM0B 4DV3F 4IR9A 1N5XA 1D8ZA 1VQKN 9ICEA 1TK8A 4F4XA 3U1MA 2ZUCA 9ICNA 3GYXB 1WNEA 3LL3A 4O0JA 3H2UB 4B3RK 2AGOA 2UXDK 3RMCA 4TY8B 5AQMA 3W65A 4DSEA 1WCNA 3H8WA 4O3RA 4DR1K 2FMPA 5J2NB 4X4TA 4KBOA 2WB1D 4KITB 4CI0B 3VENA 1RK8A 4PGQA 3OYGA 5ELZA 2POKA 1HNXK 3N28A 3C3LA 2FVCA 4P0PA 3BDEA 5DDRC 2DR6A 3D2SA 4CDIA 3CJ0A 4USIA 3KYLA 4J90A 1FKAF 4B9TA 1YDLA 2Y1LB 1TYQA 4WKYA 2E8AA 3VEYA 4E89A 4WJBA 2ODGA 2NREA 2FJAB 4KLOA 5AI6A 1NKCA 4EBDA 3H5UA 4C9DA 4JNEA 3QUQA 4CZCA 3F73A 2E1MC 3QDKA 1MMLA 4KRFA 2J9DA 1TKXB 1QVFR 2ATCB 8ICBA 3H1VX 4N5SA 1JUDA 4CI6A 3C6UB 1BQMB 3UE5A 3PSFA 1OH8A 2G8VA 1SJRA 3MCPA 8ICSA 1FDNA 2HAIA 4QQBA 2OHDA 3SSRA 2FZKB 5LSRA 1FF2A 1YJWN 2J7UA 4RUAA 2GA7A 4IOXA 3OT9A 2J9CA 2QA4S 3FSXA 3CULA 4G1IA 1KFTA 2G1HA 5KFZA 3I33A 2IM0A 1R3NA 2M0NA 3GG4A 4WWSA 4BXOA 1JLAB 4JI7K 1RTIA 1WHWA 3S6JA 4JS4A 2C28A 4KGXB 4O3MA 2NXNA 4QIWD 1WTFA 5GIOA 2FBXA 2VPYB 3HI9A 3A8IA 1WNSA 4N56A 2A1SA 4Z6CA 1D09B 4QWAA 3F41A 4A5BA 4RTFD 1WC0A 1X5TA 1SC4B 1JLEB 3LTOA 3OHAA 2ZC4A 3IRUA 2ASDA 4BROA 5SUHA 4LH5A 3JTNA 2IA6A 2VA8A 2MGZB 4Y2RA 1M0SA 4IQTA 4AQYK 1HHSA 2IRYA 4CIEA 4K4HA 2YKQA 1R8BA 2QX0A 3W3DA 4NJ8A 4WTOB 4S0MA 2W41A 1I51B 2IIRA 2G4BA 1YHQN 1LW2B 3PRVA 3FDSA 3V2UC 4OI0A 2ASJA 4WBFA 5LL6d 9ICFA 2HSZA 1IH7A 9ICKA 3M9NB 3OTOF 5KG6A 3HWTA 1DY3A 3ZLJA 2VIHA 3SYZA 3GJRB 3RJEA 5BYSA 3OR1B 1TMJA 3MD3A 3TWHA 1ZD5A 1RAHB 3QPIA 1VQPS 2VB6A 2X51A 2P9IA 3WKCA 3RVCA 2C2KB 2JWKA 4YNQA 3MBYA 2RQCA 2RRBA 1C6VA 4QWEA 1T05B 4YY3F 2KG1A 3MEGA 3KIOA 3TQEA 4ZIWA 3GFHA 5H1SV 2MU2A 4DCPB 2KRBA 2IA0A 1HX1A 3W5YA 4DL4A 1UP1A 3SI8A 1N33K 5F8JA 3AA4A 3R9LA 1B43A 4RR5A 3O8MA 3UDCA 4CM2A 3CGIA 2UXCK 3BP8A 5KRSA 4CERA 2DNPA 3DOMB 4KKOA 5ETOA 1B9FA 3MPUB 3KOAA 1XSLA 2I9GA 4JI1J 4IYQA 3G6EN 1ZQ1C 3H2VE 2KK0A 5CWRA 5J0WA 5DG8A 1P8ZA 2QTDA 3IRXB 1BGXT 5JICA 3CCZA 4Z4HA 1N5YA 4E0DA 3AJDA 3ZETA 4DFKA 3DMJB 3M6KA 1NJXA 2EZXA 4URGA 3ZD8A 3L09A 1WBDA 4ED8A 5KAKA 1RU1A 5KG1A 1UWBB 2NQPA 1ZQPA 5T7BA 5M1KA 3GR0A 2XI2A 1HYSB 3O9SA 1FJEB 3SMSA 4RPYA 4F02A 4AQYJ 4I9QA 3GONA 4USKA 1IR2A 4LF7F 3HOSA 4B9LA 8ICVA 1WUUA 1IXRA 4HTUA 5A0YA 2PYLA 2FBTA 3CC4N 5C0YA 3T1HF 2IYGA 4U8YA 2XNRA 2NUBA 4Z4FA 4J8FA 4DSKA 4TUSA 3VQTA 3BO3A 1XHZA 2FPLA 3CJ3A 2KZZA 3NVYA 2JGUA 1XQIA 5C2DA 4F67A 4OZ3A 3CIMA 1HWUA 1VLYA 1PVRA 2W25A 4DQRA 5DGBA 3CD7A 3NGTA 4KQZA 1Z05A 4LF7K 3OY9A 4CK1A 2Q6BA 3HHLB 4MFCA 2IMOA 1HFEL 2VG6A 3SFGA 4K8RA 3A13A 4M3UA 3GU3A 1RDRA 4NXMJ 4DUYF 1YVFA 4P4PA 4OFZA 1SWWA 1TFYA 1O08A 3L5KA 2B7CB 3C16A 3QEBZ 3TTCA 4OKKA 2HOQA 3FRYA 2KYZA 3I5AA 1BIZA 1CI4A 3JQMA 1E6VB 5HMYA 2QV6A 3AXMA 1AB8A 3NS5A 3AOCA 4CJEA 2FC0A 2FF6A 1MN8A 4F25A 4MYTA 3PO5A 1Q7LB 1XMQK 1QVFM 2OEKA 3K59A 3MXIA 3UDEA 4A2BA 2GMLA 4XPCA 3OHBA 3ZTRA 2EC0A 2V2ZA 1I94K 5J29A 3V81A 2NYIA 2KV2A 2O8FA 3IM8A 1PYSB 3VQDA 3JSRA 2OH2A 1QAXA 3CFPA 3PYGA 2CQ2A 2PT0A 4M5NA 1H1VA 1XC3A 4I2GA 2UUCJ 3U6FA 3DYAB 3PEHA 5KRTA 1UHUA 3SAHA 3HVTA 1UVMA 4RQ0A 3MEDA 4B3TF 1ZQKA 1RPLA 1YJRA 3I1YA 3NUQA 4O4GB 3L6QA 3FR0A 4ZOHC 2H1YA 5DB7A 5U47A 2KTQA 4XRHA 1FFVA 3ENAA 4NLBA 4JKCA 3NLCA 5BR8F 1ELOA 1NGBA 1IJFB 3M2RA 1NJIT 2F9WA 3G6XA 4IJNA 1U0SA 2AV5A 2IBOA 4NYNA 4Z6FA 1VSLA 3G6YA 1Q0NA 2BKPA 2KRRA 2C3MA 3PX6A 1PIEA 3M1YA 1L6NA 1BMQB 1NGJA 2KVQE 4UB6U 1WG1A 4XDCA 4I2FA 4UBCA 1Y5NB 4CT9A 2EFOA 4ED0A 1U45A 2Q0RA 4A8SA 5IC4B 2P9LB 3HVTB 4BJQA 4HL9A 4KN7A 1Q4RA 2DXDA 5L1MA 2V6AA 2F1HA 4BRKA 8ICHA 3MM7B 3K8VA 1S0OA 5DZ7A 2IMWP 2R2RA 4GXJA 2DNMA 1HARA 2HK2A 2D0AA 2WF5A 2K7KA 2IJFA 5CJ7A 3DC2A 2PSZA 4IKFA 3BGOP 3M2VB 1NMDA 1ZTWA 2GQQA 5C24A 1VK3A 3KLGB 2FXUA 2FI1A 4MKVA 4KJIA 3PDNA 1LWCA 2G2ZA 1EP4B 4M04A 2GJFA 4ZVUB 4CBWA 4YMMA 1F6TA 4GLXA 5LMNF 3NMUA 4FZYA 2ACYA 4BBYA 5FROA 3H5YA 4B3OB 3IBWA 2ZHBA 1ZM9A 5CE3A 2EFVA 2ZWHA 4FN5A 2W43A 3PW0A 9ICXA 4DR1J 3OVSA 1AW0A 1BDGA 1U2CA 3RJMB 5BPMA 4FPAA 2AYMA 2F2AB 2GFFA 3AVBA 4DG1A 4M47A 4KX3A 1S1VB 4CLUA 2VWKA 2IFXA 4HT5A 3HLUA 4BGAA 2CDQA 4P73A 5KFKA 5KFBA 4O5EA 4WCEQ 3D54A 3T1HK 2DGQA 3ICLA 2K3KA 1X1PA 5ETPA 2UZAA 2Z1GA 2F63A 2EHGA 4C23A 3CPEA 2H65B 2KXHA 3TACB 3GV5B 1WSEA 1VQ7N 4W92B 5J2KA 3CC7N 1VHXA 4IOAQ 5AK5A 2BX6A 3UKRA 5DLGA 1NH8A 2YX6A 4NY8A 4MKBA 3HT3A 4KLMA 4XTTA 5E7OB 4LSNA 3OYBA 3D7EO 2WTUA 2ADCA 3KZXA 2P8IA 3TUJC 4F91B 1IR1A 2YXLA 1HYSA 1ASUA 2XBPA 2Q79A 3AO1A 2HMPA 4H4KC 4USUA 5BXIA 2YMLA 2ISPA 2D1KA 3H90A 4GV3A 4KHMA 2UUAF 3O1LA 3DDHA 4X64K 4HACA 1P8GA 3D2EA 4R8UA 1T3QA 2E9ZA 2A1JA 1YRTA 5AQIA 1QQOA 4ILHA 4P2HA 2PAVA 2BZFA 4WFAL 2KN4A 3OYNA 2B4JA 3PX0A 4JHDA 2DD8S 3L4IA 1IUJA 1JIHA 4NEZA 4ZVOB 4LBHA 2OM6A 1TKDA 1HQUB 2DF4B 1U25A 3EJMA 2DHAA 1RT7A 3TSQA 1ZPWX 4DV6F 4NLDA 2HYIB 2VQFF 2LPEA 4PHDA 5AQVA 4WFZA 4NM2A 4LZGA 3OTBA 1E6VA 4TU9A 1NGDA 4EU0A 2UYTA 3CE8A 4RNHA 2IPOB 3WXKA 1S9EB 3O1BA 3ETOA 2J4RA 2OJ3A 1X7VA 1JLFB 3DLEA 4JI1F 3UCGA 4GV6A 3VF6A 2XC9A 4F50A 4FWSA 2JXJA 1SV5B 3D1HA 3RH5A 1EQ0A 4BC5A 1VGYA 4CECA 2E1RA 4YXMA 1KAXA 3EDRB 5CZXA 1MROB 3O8WA 3N5BA 3C6HA 4R0JA 2PMZD 3THXB 4MFAA 4FWMA 4L6V3 1ZQUA 3D6RA 2D0BA 2BJEA 1WI6A 2N4CA 4QZ9A 4Y28C 3U3YA 4RW9B 3CEDA 3DRRB 5DDMA 2MKJA 1MWZA 4PZOA 5DBAA 3DLLL 1U1NA 3QEWA 1NXIA 3QYPA 3UXOA 1ZAVA 2ZDOA 3O3HA 4Q8EA 3R7NB 3QEPA 4H0VB 3TADA 2J6SA 1OPIA 3MPYA 3U26A 1NLKL 3HDSA 5C7PA 5L1KA 3H46O 4X4QA 1SIJA 1V9OA 2GVDB 2GUPA 1LKYB 2NO5A 5J0OA 5F9LA 3I6PA 2P9KA 4O44A 1KEKA 4K4XA 3VQ4A 4F3OA 3WK8A 1AZSB 2AX1A 3QO9A 5HVFA 4JKDA 1MSWD 4FLYA 2KFZA 4KREA 3M7DA 3F9MA 2MJUA 4FK0A 4J91A 3LZJA 2A6AA 2Z56B 3THXA 4Q5VA 2RJZA 1VQMS 2XULA 4X4UA 3KJQB 1BQNA 3T9NA 3FRZA 4W5QA 3D3BJ 3AN1A 4B17A 3DGPB 2O8EB 1N5TA 1D8BA 2WUSA 1DLOA 2OPRA 3SMZA 4CZEA 4C8ZA 1RTJB 1X31C 1UWBA 2AJ4A 3WKDA 1SXEA 1XS9D 1SJQA 3JPRA 1RT6B 1OKJA 1D5AA 2FC9A 4FJXA 5CD4A 1LFPA 1N61A 1XJWB 1WC6A 4DV7J 1IBKJ 3TO8A 2V2KA 3SEIA 3R8EA 5D3GA 3HI0A 3TADC 1D3WA 5M2PA 2CQ4A 1WLJA 4K25A 2BJ3A 5GMEA 4EELA 2RVJA 4AHSA 7ICEA 2VBZA 1PK1B 3SFUA 1YAGA 1J97A 4FWNA 5B5EU 4LD0A 5TZVA 3PYEA 5AM1A 1V4SA 1RYSA 2L08A 1Q3VA 3S8SA 3K0JA 1UQVA 4EO6A 5KG2A 4CLPA 1W7WA 3E01A 3SQ0A 2LFVA 3I55S 2MQ8A 2RKIB 2DY4A 4EX7A 1YJUA 4U6PA 3CPWR 5CHIA 4YB6A 2O8EA 1RAFB 1Y3JA 2E7XA 2O8DB 1FXDA 3OD2A 1GXTA 2GWJA 1CJTB 1RKJA 3C0BA 2ES6A 2VBXA 3C6AA 2LI6A 3AU2A 1ZQZA 2PXIA 3BJYA 2DIVA 2HVHA 1CS4B 2PFQA 3JYTA 1ZQLA 4FYVB 4E7IA 3F5EA 2PFDA 3SK3A 1OQ6A 2OFGX 3MCSA 2DPJA 1B7FA 4M1KA 2F4VK 4FLTA 4OV6A 4LFCK 5H9FJ 3V7KA 1S77D 4EUVA 1D8YA 3W62A 1R6YA 5FPEA 3KLVA 3AVAA 4JD2B 4M9LA 1MQ2A 2IDOA 1O0PA 2R7OA 2K8CB 2WOMA 4B9VA 7ICRA 4Q45A 3THVA 4CF4A 2VFSA 3MUTP 3VZIA 1LAVA 2FJBB 3CJRA 7AT1B 3S6EA 3C28A 5ADZA 2P6TA 5GTHU 1ZOTA 2ZNZA 3NGZA 1K6YA 1QUPA 4Q44A 4K4UA 4KIAA 4J9NA 2QWOA 3N79A 4KC5A 4ES2A 2DGVA 5KG7A 1QUVA 4B3SJ 5AQZA 3VAIA 3VTHA 1S6QA 2LVWA 3FMBA 3EZWA 2ATQA 2PFNA 4KLLA 4Y34A 4ZTFA 4DUTA 4ELVA 4FBTA 3BYRA 2R7RA 4FF3A 3J80O 5AM4A 4JI8K 1TV6B 4DV2J 4Y2SA 5C5JA 1EHWA 2B21A 2OELA 4WKRA 5IWAK 2DRDA 3A3OB 2RRDA 2BKEA 3Q8QB 4NLKA 2MSSA 4QPTA 1NZBA 3MZIA 3A2FA 4CO2A 4RW8B 3I4PA 2GNKA 1NO8A 1WKKA 1T6CA 1ZOLA 1B0TA 1IR0A 1FXRA 5AJ3J 2KQ2A 5AHXA 3ZX3A 4RBVA 1KVCA 1C2PA 1ZM3A 3THWA 2EG2A 1K1QA 3EE3A 5DQIA 5KT4A 3CIPA 5DRKA 1HBOB 1DZ5A 3BKTA 4MO5A 4F4ZA 1UW4A 3T79A 1X4EA 4DV2K 3NGRA 1N5WA 1U8WA 2D3OR 2E6LA 2MZRA 1PYOB 3QIPA 1YLXA 3KK7A 2MZSA 3BDPA 3IS9B 3Q2SC 3C66A 3CNQP 2CQ0A 2BKNA 4Y2QA 3OTOJ 4WP9A 2CPZA 5J2NA 4IR1A 1RTHA 1PBUA 4FPRA 3T6BA 4IFYB 3RB0A 4C4WA 2G5HB 2IJRA 5HRNA 4DV2F 2DCUB 5I9EB 4BRCA 4WE1A 5HQ8A 5CABA 4MDBA 4R25A 3MEGB 2AYBA 4CJTA 2VPWB 3CCRN 4RX6A 4TQRA 1OH5A 1H72C 4RW4A 5ETSA 5E2QA 1RTDB 5IIKA 3VQSA 4KFBA 2WAQD 4FM0A 4OIXA 2M0GB 3MMAB 2CPYA 1Q82T 2OZMA 3DLKB 5M1QA 2WCXA 3BZQA 4TLQA 5G5GA 5EHHA 4P75A 2XWYA 3FC9A 3DLGA 1F5CA 5LJ5Y 2ZWOA 3NTUA 2MRLA 4LF7J 1HKGA 2FBVA 2X7IA 1FTCA 4C7ZA 5IWAJ 5HR6A 3WXIA 4RQ7A 5FPNA 3TZZA 4KLGA 3JPOA 1KFSA 3B82A 1SKSA 1KLMB 4ETZA 2KEYA 4ENOA 4F36A 5AQLA 3BR8A 4KHPK 3CTRA 3LP3A 5A0YB 1CUKA 1T9YA 4D3HA 3CXCR 4GC7A 3M32B 3WK5A 2JNJA 4KTQA 1TUWA 4M3RA 2HQIA 3MGJA 1ZXOA 1RISA 2X1BA 2G0JA 4K4VA 2GHWA 5HQLA 4USAA 2OAUA 2ZH8A 3MI7X 4JD2A 2E5HA 4JS5A 2AIRB 2OEJA 2GGPA 5DDYA 5IV3A 4FW1A 3W8GA 2BDPA 3CCUN 4LUBA 4HT7A 4BRQA 1GK8A 1BPXA 2MMYA 4M95A 1TL7B 1RDAA 1R43A 4DN9A 2HRTA 5A8RB 5KI6A 4FSVA 2AT1B 1J5OB 1ZQGA 1OY9A 4FLZA 5K20B 3ZT1A 1PG5B 1TKZB 1VQLN 1P90A 1MQ3A 5J0SA 3RBXA 3LP2A 1TGOA 3R1XA 3S1TA 2A0FB 4JI2K 2NZ4A 1MC8A 1UVKA 3LP0A 1ZD4A 3B6BA 4KX5A 4CEEA 1XMQF 3S9HA 5J2AA 2PFPA 4B3MK 3HKZF 1FFSB 3RTVA 1L7NA 4DUZJ 4CEBA 3LDLA 2CZ4A 2D0PA 4GKJF 1UA0A 3CETA 2DBBA 1QQNA 5D46A 1ZBLA 2DHXA 2U2FA 3HX0A 2YKNB 1N32K 3ZDDA 3Q23A 3LPYA 1SZHA 1ZRNA 2XWXA 3NVWA 4ATNA 1YSJA 1D1UA 4UAYA 1C0TA 3ISZA 5E3CA 2VFUA 2HQFA 4ECRA 2W4DA 4PCQA 4WU2A 2FJXA 2IVPA 3SCXA 3MR7A 4PPZA 2Y0SD 3UD5A 4B6JA 1RT6A 4DV4J 4JB3A 1UKUA 2H3QA 2ZKUA 1F3FA 3KJVA 3W66A 2XZWA 2KVSA 3QUCA 4DUZK 4WFNL 2LYBA 3HJEA 4YB1P 3SV3A 4NA2A 2VUGA 2DH9A 4KY3A 2C2DA 3LP0B 4ZHRA 4KE5A 2JR5A 4X4SA 2JEIA 3IA0A 4ID5A 3G25A 1TK0A 2NLWA 3I76A 1TUUA 4DR6K 2ZUBA 1XO1A 4CLKA 1S22A 3CDBA 4TYAA 2DNOA 3DV9A 3QT8A 4DTUA 1Z25A 8ICCA 1VQOS 3QX7A 2NPIA 1ZQIA 3NF8A 5DM6L 2LECA 1XHXA 5BPCA 3VQBA 1S48A 4ZCIA 1S8OA 7ICQA 1KC8T 5KFMA 4Z94A 2WAQF 4Y1DA 3GBTA 2CRLA 2KFYA 3FFIA 1J5EF 3QIOA 1K73T 1BA1A 4MLEA 1HKAA 2YWGA 2HQDA 3NMAA 4IOCQ 4BRPA 1BPBA 2PKEA 4C8YA 3K1RB 3QBXA 3AB2B 4OL8A 1XR7A 3OLAA 3WNEA 2YNGA 3SZ2A 3IAYA 4NMXA 1EKRA 1HW9A 4LF8K 5JLFA 1SQEA 1QVGM 2P5VA 2B5JA 3C65A 2VV5A 1NRKA 4YG2A 3VV2B 2CJQA 3ZZZA 2G06A 1U1PA 3VQ7A 3JSMB 2GJ2A 3FCWA 3GLJA 2IJNA 4USMA 5TKWA 3C19A 3RFAA 2AEMA 3ZZYA 1R6VA 2ZC3A 4YHHK 1OO0B 2VQEF 2AJQA 1OH7A 2CAJA 2RDIA 3QATA 3A0HU 2M8HA 1UAXA 4ZITA 5AI8A 1WC1A 2B4OA 1MMDA 4NZ6A 1NPPA 5BRDA 3NS6A 4PA1A 1JALA 2CXYA 2O8DA 4A8MP 4AYBC 2YNGB 2OTLN 3LP2B 2GMJA 3HILA 4NLWA 1W9HA 3V9UA 3TW0A 4BWJA 2RUGA 3ZZUA 5GIPA 1RGVA 3T3FA 2BCQA 3L9ZA 2K2PA 2MJNA 2IM1A 5AQTA 4K4SA 4ETXA 2R42A 4M5HA 5ETKA 1K8AO 1RWXB 3Q8LA 4J03A 1GT8A 3RW7A 2O4IA 2Q31A 4Y2CA 3D2WA 3HZGA 3FEXB 1ZQMA 5BR8J 3NAHA 4LF4K 3K4GA 1JMSA 3D6HB 2X3DA 1S72S 1FEZA 5DBCA 2MUTB 2VOPA 1RBVA 4NASA 2C2MB 4CEQA 3G6VA 2ZIUA 4V1Ak 1L3UA 2G0CA 2Z4PA 2VKQA 1NGEA 4QR0A 4CDGA 1X6JA 1M5OC 3JQJA 4GY2B 5K5MA 2OEMA 4F04B 4OX6A 4QYZK 3F56A 4X84A 4GXKA 4BR5A 2AEJA 5J2QA 1SUQA 5KG4A 1D9DA 1J6ZA 1Q78A 2QC3A 1YVUA 2O8CB 2BUNA 1XO0A 2W4CA 3KD1E 2HWIA 1HR0F 3QU7A 4FF1A 1BQNB 1IKWA 2UUBF 2ZIVA 1KLNA 1VS3A 2OMOA 1VCTA 5CQGA 4CT8A 3U4LA 3VQAA 1N33F 2KN7A 1RBSA 5DM7L 4LSNB 5CA5A 2D3O1 3MPDA 1CJVA 3I0SB 3MWBA 3NRBA 3UVJA 5AKXA 1Z00A 1H6KX 3OVNA 3LW5C 4OHWA 1RACB 2KJWA 3M8PA 4GXIA 2W3RA 2VICA 1HUZA 5AI0A 4BG8A 4KI4A 4R8UB 1KC8O 5A2QY 3UD3P 2B56A 5KG3A 5FD1A 1DLOB 4DPTA 5D0EA 1NK6A 5AQJA 3PNCA 2KO1A 3C21A 2L5YA 2XS2A 3KG4A 5HI7A 2VKZG 2OFHX 2MSNA 1DTTA 4JK7A 3D1QA 3A5OC 4RNMA 1JXEA 3P8BB 3ULEB 4LRDA 2E88A 4CQ1A 2PBDA 4EO8A 1IBLJ 2CJBA 1D9AA 3MOJB 2VA3A 2HZVA 1U49A 2B4UA 2KT2A 2GX9A 1KQKA 3K0SA 1KD1T 2ZZNA 1FDDA 3NGYA 5JUMA 4I2BA 2CQGA 4UB3A 3C15B 4ZHRB 4GNIA 4BUGA 4BY9C 4KLFA 4I9LA 2ITMA 2H5IB 1TKXA 2QSFA 2J0QD 4E1MA 3KLIB 4RQ4A 1XNSA 2G8UA 2QB1A 4OZ2A 3CD6S 1J5OA 1WG4A 3AQPA 1N36F 4YXJA 5EUHA 2K89A 3R7BB 1ASVA 1Q9XA 2I1RA 3D2FB 4Y2UA 3TAGA 2LQ9A 2XTJP 2C3OA 3ZSWA 3TSUA 3LGNA 5AQPA 2KKPA 1P27B 5ALXA 4QIGA 2E7WA 2HBYB 2HF4A 4J9UE 4OI2A 3R2DJ 1VSJA 1N36K 1WSFA 3MTKA 2VH7A 3VESA 2HPUA 3RMDA 1EJ7L 2GV1A 5H9FK 1Z2LA 1F3VA 2DNRA 1C4AA 4MEYA 3QT7A 3IC1A 3QFUA 2ZBIA 4NYPA 4WK1A 4DZ6A 4MT1A 3JXUA 2YKPA 3DLJA 4FJHA 5KAIU 4R66A 4FWQA 1VQ5N 1FKOB 4OYOA 2VGNA 3JTOA 4LFCJ 5IOLA 5FLXY 3H45C 1KHVA 1RAOA 2MPUA 2VANA 2DGWA 4NCGA 3HFVA 3KD3A 2C2RA 4I64A 2VWBA 2H5EA 4PHTX 3A8KA 2RP5A 2OYQA 1VC6A 2H4WB 3MR2A 2CQIA 5A8RA 3QFPA 2XCPA 4M0AA 4NLZA 1DGJA 4WXOA 2VIXA 1GEHA 2BPFA 3I8DA 3FNNA 2HCFA 3GV7B 5LMUJ 2BJ1A 3D7SB 2YY3A 2KIWA 3DXMA 2V5HG 1UPHA 3EDQB 4IG0B 4PXDA 2CRXA 1FRKA 1S4EA 5HAOA 1F9HA 1DTQA 5KPRA 5AKIA 4I2HA 3ENQA 4PG5A 4WYBA 4OZNA 4UZBA 4CLLA 2V51B 4L75A 4DB3A 1SV4A 2K4HA 3F2KA 4DL2A 1L7MA 1L5UA 1B0PA 5ALVA 4DOAA 5FRMA 2YWWA 2DGZA 1WACA 2CPHA 2DNLA 5THWA 4RUCA 1HJRA 4ZS6A 2NXEA 4QR1A 5AIAA 4DFJA 1COKA 4AP9A 1C0TB 5ETMA 2MKKA 4LFBF 4JLHA 4OJRA 3UXPA 2HW3A 1VK8A 5J1EA 3D6FB 2FMSA 3N4PA 4PQUA 1LK5A 1FXLA 2RDDA 3SJJA 2XMMA 5G4DA 3JAMU 4A8WA 3L3VA 4Q7AA 3DLKA 2KJ9A 2UVRA 5JJBA 4JI0J 3UI3A 3DWLA 4DV5J 2YNFB 5IIIA 2ZH7A 2YNHB 4USWA 4CFCA 1WSJA 2HHXA 3NWGA 2DEJA 2F9DA 2BE7D 2DL0A 4ICAA 5ALKA 3LUYA 1MG7A 3T7ZA 3MK6A 1VIOA 1S97A 3F0NA 2R7SA 4EZ9A 1IV0A 3QRQA 3A8JA 4DKWA 2HHHK 2QXLA 3DXBA 4O3PA 1OUQA 1ZQWA 2FVSA 3EX7B 3OVAA 4DO9A 1NK7A 2CVEA 2BOAA 5KT3A 2PIIA 1WEXA 2LXIA 1CJUA 1YT3A 4P2FA 3UW1A 5A8WA 1HBOA 4CK3A 4MIBA 2BQUA 1RBAA 1Q95G 2HGNA 1FVSA 4QZCA 3RR8A 1KN6A 3HP6A 1G3OA 2JOQA 1I94F 1KOOA 4CZIA 1EO1A 5EN1A 3C16B 2XICA 2IHMA 2R3VA 4NA1A 3V9WA 4DL5A 3C8YA 5DKWA 2JVRA 5LT5A 4FK4A 5H2FU 3ETMA 4E98A 1YIJS 5K8NA 3UDVA 3ETLA 2PY5A 3G96A 3HD1A 3L2QA 1X2IA 2K60A 2SXLA 2KKHA 1SWVA 4CGIA 3ZO7A 1JNZB 2Q3PA 3HSGA 3N9UC 1NNDA 1S1WB 4WCEL 3BBFA 2FUG9 1T95A 5IV4A 4UAZA 2P9PA 5B8HA 1Q7YO 1NSAA 1GQEA 2XG8A 5ETQA 4K50A 1SV5A 3F5TA 3VF2A 2V7YA 3VTIA 4DV0F 3QNMA 2QGFB 1BY9A 1S49A 3LQVA 4CJVA 3M1VB 2AXTU 4C1NK 1ZQXA 3BS9A 4AM6A 2J0WA 4ZIVA 2ZH5A 4OGEA 4Z7CA 3CM6A 2VJ4A 3UWTA 3UQSA 1EETA 4FS2A 4W5RA 2VDIA 2MQNA 2GH1A 2J7KA 4DJBA 2ZOGA 4B1YB 4CNYA 2NUUG 5HMMA 3K7RA 2CXEA 1TE2A 2W9MA 4UAUA 3QEVA 2VFTA 2EK6A 1CJVB 3I0SA 2UU9K 4I4BA 2OTLS 3MTJA 3BF1A 3TQ1A 3VC8A 4DTNA 1UJ4A 3RBEA 4I6MB 4QZ8A 3MR5A 2G8KA 2HVIA 4ICLB 1L7OA 1S9EA 3W64A 8ICOA 3OXGA 3WNHA 5ALIA 3NVVA 1HNIB 2QLFB 2QA4N 4FWKA 4F5RA 4RW8A 2PFUA 3Q7CA 2YQEA 3DRSA 3FCVA 2BDUA 1NCLA 2HNYA 2JWLA 1QQMA 3W5ZA 2XS7A 3RAQA 4JBCA 5HMZA 2IAJB 3UCUP 3LGHA 4QS8A 3VGMA 2YNFA 4KKOB 8ICKA 3H0MB 2V9WA 1FIQA 4QYRA 3ZZ0A 2JDJA 2C2NA 1HJOA 1EB0A 1KQFB 4RPXA 3C6TB 4URQU 3ZFVA 4BACA 3PV8A 4DSJA 4K0KF 2CGJA 3FZHA 4OZ1A 5B7WA 4IUFA 2E6MA 3SCKE 4XEIA 1K47A 1IBMJ 2BTFA 4KHWA 1NOYA 4DUYK 3J7YP 4DU4A 4CNQA 5GAEI 4YHHJ 2XLIA 1HD1A 1OYDA 3SBGA 1H74A 3B9JA 3GDXA 1QSSA 4HDHA 1ASWA 4Y00A 2V67A 3JSMA 3PCOB 3CMQA 2E5JA 1X0FA 2QARA 3ZTOA 1VQ4N 3NGKA 2BJDA 3PEJA 3MDQA 4B1WB 2WZ1A 2HHVA 2NS1B 2XIDA 4GO7X 3IBFB 2VG6B 1FFUA 1XMBA 4UW9A 2F65A 3N6MA 3UCZP 1X40A 3MM6A 2M9KA 1YIJN 2F8HA 1GTHA 8ICZA 2CG4A 3DGPA 4CF5A 3SV4A 2JMGA 4M45A 4JI8F 3FQLA 3JPTA 2XVTA 4NXZA 2ZIXB 1ZS6A 3PACA 3HTVA 3Q83A 3LK9A 1NHUA 5CYQB 3V9SA 4PJ0U 1S3XA 3V6DB 5ALHA 4RQ3A 2CUYA 4HTLA 2KFNA 4KMUA 1RDFA 3GIRA 1WG5A 3G8TA 3PKMA 4YMEA 3MMCB 3O1WA 4HH0A 2YH1A 3CCEN 4C8NA 4DV6K 3FBBA 2V2QA 2JZBA 3B0XA 5C10A 4M7XA 2HB5A 3W60A 3I5BA 2NRHA 5EX3A 4I6WA 4H4MA 3LDPA 3D0PA 1EQMA 3QMLA 5AM5A 2GWSA 3WKEA 1UCNA 1FJ7A 3BS7A 5ETVA 3WIVA 1RAEB 4YDDB 2VJUA 1MWKA 2IRUA 1FRJA 4H5RA 2J9DE 5EWFA 4DUYJ 4P4MA 5AZIB 2F4VF 2FSJA 4PQAA 3VGKA 3T19A 1VSKA 2DYAA 4TQSA 2BBEA 2YB4A 2L48A 2G8IA 2HFSA 4KPYA 2V4RA 3EWAA 4PUOA 5LJWA 5AXLA 3NE6A 3QU4A 5JRTA 2KJ5A 7ICUA 5EOYA 2FY8A 5JVHQ 4DR4J 2JSXA 1NEEA 2M2BA 3CQYA 3FGUA 7ICPA 2FGCA 4BR2A 1X4FA 3SQ2A 3B6OA 4KMOB 1RKIA 1G15A 5D4BA 2YHWA 1FEEA 3T1HJ 2G1DA 3JPQA 1LXNA 3BSAA 3ZX2A 2AJ0A 4Q2LA 1C0UB 2H5JB 3NCPA 4DV5K 3OYLA 2ZBQA 1S5JA 1DQAA 1FNOA 5CD4H 2B9YA 3N4MB 2DPIA 4WQ5C 5FLXU 3OBIA 2JEFA 4NL5A 2I5JA 3M30B 3CCLN 3JSYA 1TAUA 2F77X 2H54B 1HKBA 2E20A 3L3UA 3TSPA 4KT0C 3OXFA 4I2JA 2FGOA 2J5AA 2E1CA 2UUCK 1MMNA 3IAM9 1C1CA 1RILA 4HCCA 8ATCB 3K5OA 1VRUA 3GJQB 1S1TA 3CO0P 2K7JA 7ICMA 1TELA 2Q43A 2NSBA 1TTHB 4F0HA 1B7YB 2E8OA 4NZ0A 8ICNA 2EFGA 3VAGA 2CFXA 1UJ6A 2FLPA 1EX8A 4WQ4A 3KLFA 2GCFA 3H08A 2ZZTA 2UUCF 4M9GA 2BACA 1PBAA 3UIQA 1R27B 5HL7L 1XNQJ 1HIWA 2ROGA 4OI1A 4CF8A 4HH1A 3RUBL 2CJXB 2MEWA 4A61A 4MF2A 2J8AA 3D9BA 5BJRA 1VRTB 1WC4A 1IG8A 2RILA 3PIOQ 1B64A 2ZH4A 4DTOA 5GINA 3ONQA 2OMLA 3MN6A 4I2IA 1NGIA 2HBLA 5HLFA 4FJJA 1NGFA 1YZ7A 5EWEA 2P6SA 4DN0A 2QFIA 3IWNC 3T1YJ 2HS3A 2CWXA 2ZVIA 1HR0K 3IS9A 4P2MA 3RH6A 4NX9A 1NGCA 2KICA 4B3SF 3U9ZA 3PFEA 5HATA 4JYAF 2Q0UA 4B08A 2QN6B 4ZPDA 1COOA 3IM1A 4ZPVR 1R8PA 2XMTA 1DGKN 1TL5A 1S7HA 2L9WA 3ADAC 1VJWA 5ITHA 3T5KA 5L46A 5LL6Z 3VGLA 5AI4A 4DV4F 2IOHA 2ZD1B 3CCRS 4YOUA 2AX0A 4ED6A 3HCXA 1HWJA 1T9XA 3RYLA 1X5SA 3KK1A 3JPSA 2A2CA 5EX5A 5IINA 4OMFG 2KMDA 2XNQA 3KLEA 2HQGA 3EPGA 3SUNA 1RCXB 4C7QA 2KH9A 4LF5K 4CWBA 4ECTA 3UB5A 1T9VA 1VOMA 1JI7A 1DAXA 2FLOA 5I42A 1U2VA 5T41A 3ULEA 3W8PA 5IIJA 1TVRA 2GX8A 4IQWA 1SV0A 3TR5A 2AU0A 1GH8A 1C4CA 2GVZA 1HNVA 2B9XA 2JZ5A 2DNNA 1WAFA 4CJSA 2VG7A 3CJSA 5LY3A 3KD5E 1C7YA 4KHQA 1ROFA 4HI1A 4CJ4A 2F8SA 3FEYB 4UBBA 4IO9L 2AWZA 2D3ZA 2QLTA 2HOFA 4IEEA 5EVZA 3VEZA 3EUB2 4LR8A 3TAEA 5C42B 3OXLA 4IXCA 4HR2A 2WHOA 3N7RC 1Q8LA 3I0RB 3H4DA 2BANA 1URNA 4K2JA 1C1BB 4YS2A 1H7XA 2CZ9A 3BH6B 4B9NA 3T69A 3TTDA 3CCJN 4PYAA 5GAGI 1F1BB 1TL7A 3LF0A 2XLKA 1NBWA 1XU4A 1UEKA 1KKHA 5LXRA 4M41A 4FLWA 5KPZA 2P9CA 3DCAA 2FQQB 3UNYA 3ZTSA 2QSWA 2YMPA 3OR1A 4NI2A 1WB9A 1RZMA 5AIBA 3ZD9A 1VRUB 1DGSA 4B9MA 4DV3J 4QZHA 4BREA 6FDRA 4RU9A 4NLQA 4CLTA 5JU5A 3V1QA 3C14B 3EW9A 3IR7B 3NF6A 4AFFA 4ES3A 2JVOA 3VQ8A 4C97A 4J9KA 4FOIA 3A12A 3VAJA 5J1EB 3MCAB 2HHSA 9ICJA 2BA9A 1YK9A 5AE1A 2FVRA 5L1IA 4Y2TA 5CYMB 3D3CJ 2CVIA 1YXQA 2Z7JA 5J8YA 1GLCG 2ZZMA 4J9LA 1HNWF 3QO9B 3W2VA 1BWVA 5HP1B 4ZPTR 3M8YA 5BN9A 1WD6A 1E6YB 4CZMA 3P6YC 4DX8H 3N7PD 3M8PB 5KFVA 3DU5A 3HHDA 4A8FA 2IAJA 4PGXA 2W1BA 3QB0A 2GV9A 9ATCB 5KFCA 4CESA 2F8EX 1T8EA 5LMUF 1VLBA 5K8MA 4DR6F 3K5NA 4CO5A 2Q97A 2DFLA 3L4BC 2ZUDA 3ET6B 2UXBF 1LV5A 1S0VA 2MZJA 4GVBB 3AU6A 1UCVA 2UU9F 4P2XA 3T6JA 4F92B 4N8NA 3W1YC 2JLEA 2GAGC 2HDOA 1WOPA 1F21A 2Z30B 4M9JA 4WE1B 4FO0A 3NF7A 3CWJA 2BM1A 1MN7A 2AZ3A 1UVJA 1C0MA 1TAMA 4JI8J 3R27A 1SC3B 4X65F 2B0GA 7FD1A 4K8XA 1MWYA 2A42A 4KRWA 3IGNA 4BRMA 3KDOA 4LMZA 5GAHP 4FYWB 4KAZA 2QK9A 4ZMMA 2KZMA 3QU5A 3V9XA 2CPJA 4UB2A 4PWWA 1A6LA 2YMMA 1URRA 3OSPA 7ICJA 1FFWB 1NKBA 2D0CA 1PYTA 3BZCA 4UB8U 1RWUA 4BC9A 4OYPA 4JI5K 2DR7A 1GLBG 1L7PA 4JK1A 1RT1A 2EZZA 4OGCA 4PUOB 4LF1A 3J80Y 4KH4A 4DTPA 4FP9A 3A0BU 3SJHA 2RKIA 4OX9F 3EGVA 1SZ2A 4DOCA 4HVZA 2MY8A 2WVFA 1VQ8N 2EPIA 1JLGA 4K2XA 1N8RO 1CJTA 1GLDG 4OJ5A 3V6DA 4ZN1A 1WI8A 4L73A 2GZOA 4Q43A 4ZVTB 4CTAB 4DR7F 5D6GA 3GZ7A 2Q3SA 3VQQA 2BVZA 1U47A 4OZLA 4JKFA 3LPEA 1BVSA 5AQXA 4CJFA 1B70B 2OSQA 1R0AB 2XRIA 4TYBA 2CDRB 2LLZA 3B8AX 4NCAA 1KQQA 4Z6EA 1GX5A 3KK3B 4H0TB 3AVCA 1VQNN 3M2UA 4MQ3A 4DR5K 4K41A 4USVA 4CZFA 1N4LA 2X6SA 2RIJA 1VK0A 1RQ0A 5AE3A 4CYUB 4FLUA 2ZXHA 1VBYA 3EY1A 2UUWA 5J0RA 1B22A 4LSZB 2GVDA 4A8XA 5C25A 1X4CA 1HWKA 3IRXA 4DOZA 3F5AA 5KFWA 4RU2A 5GADU 1TR0A 3OL9A 5F8GA 2W9BA 3K58A 2P9KB 4OO1J 4NE9C 5KFQA 2QWLA 5F0WA 5GAGU 2H3GX 3CG7A 4MFBB 2ZEJA 3QBWA 4CGJA 3Q89A 5DZ6A 1WEZA 3MC1A 1K44A 3WQUA 3ILLA 1SL1A 5B0FA 3J81U 2LA4A 2MHNA 3NCQA 2LHTA 4LR9A 1ATNA 3P5TL 4DQPA 4OLPA 5CR4A 3M3ZA 1WG8A 4CE6A 2DGOA 5IT9O 4UT4A 4RBUA 4IL6U 5BPNA 1T3OA 3ICXA 1E3MA 5A0LA 4LZDA 4NXNF 2P9NA 2QWQA 4H5NA 4J9VA 3Q8PB 4KAIA 4F4KA 3H3NO 3I87A 3X1LB 3NH2A 2YTCA 3QINA 3IM9A 4JV5F 1Q7YT 3MM8A 2E4LA 5CRXA 3AO4A 2GTDA 2HRYA 4JKGA 2XI3A 3R9PA 4B9UA 1EXNA 3RMAA 4OYMA 1ZQRA 1VBZA 4ZPAA 2GQ2A 2VQFK 4ECXA 2PEBA 1V85A 4QW9A 4BRFA 4FOEA 1UT8A 1T9TA 1HPZA 1QSLA 4QR2A 3VVTA 3AY0A 3DRPB 4UY85 4LF9J 5IIMA 1RT5A 4OKEA 4BG9A 3U1NA 1RA6A 2J7WA 2C3UA 5HVGA 2DFEA 1VSDA 1QH9A 4GIBA 4HTJA 4CEDA 3TPQA 3ZZRA 3AMZA 5FLXO 1RXOB 4CD1A 3GJSB 2WBMA 5F8LA 5RUBA 3MMCA 3AA3A 4LRCA 1YI2S 1T4GA 2ISOA 1AUDA 5ALYA 3EE9A 4DFMA 4U7BA 2D6FC 2XO7A 1BQMA 4QU7A 3NVMA 1RWVB 4EHTA 2KJVA 4MH8A 4YHHF 2ZF5O 3GIJA 3K1ZA 2VG7B 2W11A 4OX8A 2LYAA 1SB3C 2XY8A 3MEKA 3HK2A 5KG5A 2YWKA 2ZNYA 3KUHA 3PMNA 1RA7A 1FDAA 3QGPA 4O4GA 2YKOA 3DRRA 5J2FA 2IVYA 3ALRA 1QE1B 2OA8A 5HRSA 3O2IA 4NL9A 2EBEA 4AQYF 2BGGA 4K0KK 4RQ8A 3OBWA 3QUBA 4YCXA 3MEEB 2E8PA 1MROA 4KB1A 1RDBA 3L2VA 4USJC 3V7LA 4ALZA 1PO6A 2VJVA 3M8ZA 2E1ZA 2DO0A 4CJ5A 4DI6A 2R7XA 4BQLA 4X62F 2JRZA 2BQ3A 5KQDA 1KOHA 2QLJB 4USTA 1VFJA 1O8BA 3ISND 4TU8A 2CGLA 1IQZA 4URSA 2IS3A 2BJ9A 4DQSA 4OLAA 1R7IA 4M6WB 2C22A 2VOOA 2QJ3A 4WFBL 5BREA 3CCES 1HI8A 4NYOA 1HNVB 1OPZA 3ZEUA 4I56A 3AQFA 1TUVA 2MQMA 3QFHA 3DYAA 2G8WA 1KBUA 1QTNB 3DI6B 2BR0A 2HGMA 2XCAA 5L39A 2AYEA 4ANDA 4EEYA 3KWMA 3SCLE 4UB1A 3WU2U 1TL1B 5L9NA 2RDJA 3P5JA 3SNNA 4RW7B 4PH5A 1U0HA 3H5XA 4BRGA 1RWMB 2HVDA 3H25A 3BM7A 2AF6A 3KHHA 1QAYA 4B9SA 4M5DA 1Y11A 2YKNA 4ZP6A 3NAEA 2BKOA 3M6WA 1C20A 4CHOA 2MQLA 4QW8A 4MFFA 1DHMA 4UUWA 4F93B 2RB7A 2MB0B 1BWEA 1ZQAA 5B08A 2G8FA 4Y2JA 4CLYA 1GLJO 3O44A 3TABA 2OI2A 2E1FA 3AAWB 2NYVA 5B0DA 1SZPA 4A8KA 3KJVB 2RRAA 3PSTA 4U67Q 4YOEA 4LF9K 5K4LA 5FDLB 1GLLO 2YNIA 4U95A 4CHPA 1TL3B 3DGVA 2W42A 2VA2A 3KG1A 3QICA 8RUCA 4ZJOA 4AD6A 5J2BA 2DO4A 2QFJA 5E41A 1RB0A 5JS1A 3FK4A 4DR1F 4HEA9 3AY9A 3QE9Y 1OXJA 1RWOB 5DK5A 1QM9A 1ZQVA 2BCUA 1RI7A 4J9OA 4U8VA 3G8QA 4G3IA 3Q7BA 4CJPA 1LWCB 2E1PA 2MHEA 5HSPA 4H4MB 1UEVA 3BO2A 2J9EA 4CJ3A 2X6NA 1VQKS 3HPGA 2HFZA 3U7JA 1WOQA 1LNQA 3BPDA 4QIVA 2R4FA 2F1FA 4NCBA 3KVGA 1CS4A 1RG6A 2W8LA 3M8WA 3WXLA 2YX4A 3I5CA 1U1LA 1NH7A 5ALUA 1PAUB 4ID8A 1XK8A 4GVEA 5KFHA 3KFUF 4XA5A 4I2AA 3MM6B 2QA4G 2W9CB 4J5OA 4L72B 5F3ZA 1U6BA 1N56A 4DXLA 4M5JA 4WFAQ 1RZTA 3VEOA 4WFNQ 1Z4OA 4F26A 4RJVA 3PX4A 1Q8IA 2Y0SC 3W9JA 3VEXA 4H0OA 1TL4A 3JXOA 1UOCA 3L7PA 1Q79A 5J0YA 3MD1A 1GAOA 3P31A 2YB1A 4F8RA 5DQHA 1VQ9N 1X60A 1KTQA 3K5LA 3PIPQ 5DM6Q 2Z1HA 4OHVA 4AHTA 4DX6A 5HRRA 5ALOA 4P71A 5KFFA 3CT9A 4JI3J 3MMVA 1ILYA 3HPOA 3H1QA 5D0HA 3HBTA 3VPZA 3DHXA 2HFUA 3VQ9A 5A2QU 5I3PA 1DARA 3BQTA 2ASLA 2W4PA 4OPAA 3AJ2A 3M6UA 3T5LA 3ULDA 5AQUA 2WVDA 4ED3A 1ZQNA 3MEEA 2KI2A 1RWWB 4X64F 1V9PA 1SC6A 1D4XA 2UUAJ 5TISU 3PRBA 2G13A 1X4GA 4C4SA 2BGWA 5KFDA 2G2YA 5E26A 3ZI4A 5AQWA 3ATUA 4FZZA 2R2UA 2JC0A 3MABA 4I2CA 1FK9B 4CRJA 1YBAA 2DGTA 2VGMA 5LMNK 3H6EA 2JFDA 3FZKA 4LVNP 2LQBA 4BGDA 5C25B 4LF6K 1UETA 2OCEA 4YDXA 1H2UX 4P72A 2YN4A 2DT9A 4OJPA 4ZVFA 2JRSA 2WB4A 4OZJA 3EGWB 4KHPF 3SPZA 4EP4A 3SQ4A 3ILIA 4IG3B 1V5IB 4G1QB 4O0NA 2VPXB 2AZ1A 4DR3J 7FDRA 1AA1B 1JJ2M 3HZ6A 3CFOA 3PJWA 1K9MO 1Z1VA 2A1RA 4ILMA 4QIEA 4HDGA 1WDDA 1W26A 5E3QA 4EFHA 1TV9A 5IC6B 3MPVA 5HMLA 2G5IB 1NBEB 4DR5F 2R7WA 5I4MA 1WSGA 4LVSA 5MAOA 3RGIA 4H5VA 4FVMA 3H42A 2HNYB 1IBLF 2W54A 1S99A 4DSLA 4NPOA 4DU7A 3B6PA 3CMAN 3R5CA 1HNWJ 2VQEJ 9ICUA 1R8AA 2RD5C 1X9SA 1RCOB 2FHJD 2WONB 2ASMA 1DOQA 1NPKA 2COLA 1RHMB 2FPMA 1C1AA 4O8KA 4UB5A 4I2PB 5HLFB 2E29A 4C8MA 3J81O 3HULA 2ZM6J 2DGSA 4CO4A 1KTVA 4H0YB 2G8HA 1WAJA 2RHFA 5MLCQ 2DXEA 3O08A 3G82B 1QJHA 3TA1A 1I1GA 3VMFB 1IWAA 3HHKA 3HVRA 4FYYB 2ZFHA 2H3EB 4PHPA 1U6ZA 1X0PA 3O5TB 1VIXA 4E1NA 3F2DA 4IQMA 5JMVA 3BGUA 1J2MA 5AQYA 3P83D 4HUGA 4NYZA 2W2NP 2WC9A 2I8EA 4FXDA 1RUSA 1NM2A 1BNOA 2HBRB 3IUCA 4UB4A 1KQSM 3ZSYA 2M70A 3E3XA 4JI7F 4B1ZA 4CW7B 2LQ5A 3QIDA 2NO4A 4FJ9A 4ZDNA 4FE3A 5GADI 2LEAA 4EMDA 3CCQN 4B1UB 4Z37A 2OO4A 2VPZB 4BC2A 3NOGA 3KG0A 1S76D 3HJFA 2JHEA 4FPIA 2FE9A 4DR2J 4JAXA 2WF9A 1GO3F 2KLAA 2HI0A 4WZQA 3AT1B 2VONA 4IWVA 1GMWA 2BEFA 1UFWA 1WBBA 3QQCD 4DCHA 3TA2A 3QT5A 4K59A 1RTIB 3EUNA 1ZD3A 3HZEA 4ZLNA 4WYLA 1O6XA 1DJ0A 2NRZA 3FLCO 3FGVA 1HI0P 4FWRA 1N48A 5KFAA 3OFHA 1NKEA 3AA2A 2HMIA 1GMWD 5EWGA 5AKYA 3C2KA 3D5MA 4QAGA 1C0GA 4KGMA 3CJBA 2XY6A 3M2VA 4M3ZA 2OP5A 5AKGA 4ZLPA 1HBUA 1KCFA 2NRVA 5IZHA 1DURA 5DG9A 3BKFA 3FM9A 4CD3A 1EKSA 1CG2A 1YUWA 1SCJB 3C7NA 3TZYA 3OYDA 3TWZA 3HMJG 2FJ6A 2I7NA 4CNZA 4B3RJ 2NSCA 3AL0B 1CEZA 4Y0FA 1YG0A 2GUIA 1D8LA 3MXJA 2W3SA 8ICRA 2BHNA 5AXMA 1NAQA 3NCIA 2AP6A 3U3GA 3PUFA 3MCNA 4EZ6A 3GPAA 1KL9A 2CQHA 1I3AA 4LF5F 4P7TA 3MFIA 2D9PA 3CQ8A 4X4NA 2JEJA 1HW8A 4H8KA 5ALPA 4DV1J 4PKDB 5HMWA 2GIQA 3F2BA 4DL0C 4PKGA 2HIQA 2HNDB 2VL1A 3OYJA 4NRUA 3M4XA 4IDHA 1ZA1B 3OL7A 5ALWA 1JLBA 5AFUH 3QZ8A 2VASA 1YJ9S 1YITN 4UARA 3CERA 4FYXB 5B0AA 1FT8A 3QSIA 1X5PA 4XUSA 2UVUA 3HKZC 4FVUA 3C1YA 3P45B 4ZJQA 4DR4F 5CZVA 2OTJS 4PR6A 4DSFA 2XZTB 3ZETB 3E66A 2Y3YA 1IBKF 2Z8QA 5LMNJ 3MN5A 1TP7A 3SSSA 3CPWM 2M8DB 2CQDA 3FVYA 5AQRA 3NKYA 2FSNA 4YORA 2QYCA 4PXCA 3BBBA 2ZH1A 3M8RA 3OYCA 2Y1IA 1DQ8A 4ANEA 2OPSA 3Q8MA 3QWUA 2NR0A 4FLVA 1HMVA 2B6AB 4DLGA 4FJ5A 2KM8B 2KM8C 3VQPA 4CHYA 3NF9A 1NK4A 4DDFA 1QAJA 3U02A 3AH6A 4NXNK 4DG1B 3MDFA 1EIYB 4UOGA 3ZXWA 3RJJA 4FW2A 2WRMA 2V4JA 4M5IA 4CM0A 4RUBA 2W2OP 3L7UA 3OYIA 1LCUA 5HL7Q 3SUPA 2K8GA 3TFRA 3EPIA 2CJAA 4XDDA 1U9LA 3MCMA 4R5PA 9ICOA 1ZBUA 3TZWA 1SJFA 1Z1ZA 4CBUA 3JSBA 3BGRA 3SQ1A 3SENA 1RBRA 5E84A 4HI2A 4DCCA 3KTQA 4O23A 2RE2A 3RU0A 1FKOA 3GIIA 5BYRA 3SIPB 7ICVA 2KHCA 2V63A 4AHRA 3UKUA 4BRLA 4PHAA 3DJCA 3H40A 3AGKA 2HAFA 3EGZA 5C15A 4KV8A 1TL1A 4NLXA 3M9OB 4M5MA 4XH4A 2K4EA 3LH2S 1L8OA 4IQUA 1IKXA 4ZLLA 2ZD1A 1XMQJ 1U0HB 4QCLA 2MGZA 4W5OA 3AOAA 3LPTA 4O8UA 4QZVB 1R0CB 2JLFA 3KK1B 1RDUA 1JLQA 4TLRA 4XH1A 4AILC 4LJXA 3ZSXA 2Z0GA 2AJ2A 1N5YB 1T44A 3QESA 1RT4A 1J5EK 4GVLA 2ZKTA 2YX8A 1VSMA 4LRFA 3V4IB 2MKCA 3TFSA 3MM7A 4YOTA 1FW6A 5AQFA 1HI1A 2PMZC 5J0UA 2RH3A 1LWFB 3CHWA 1WUAA 4FNIA 2H51B 1NNLA 1MWMA 4DTMA 5AKEA 5JS2A 4IQXA 4LF8J 1XR5A 1X9WA 3M8QB 5LSOA 2GO7A 4O3NA 4KO0B 3AO5A 4DL3A 4X4OA 4GKJJ 3CDUA 4OPHA 3VEVA 1JJ2R 3O4QA 5F8NA 1CVJA 3MAAB 3QWPA 4EP5A 3NHGA 2FC8A 4U96A 1H73A 3V6HA 2CN1A 3FKBA 3LM2A 4FVCA 3CCTA 4X62K 3UFCX 3Q8UA 3SR6A 2GO8A 2WB1C 1KP6A 2G0AA 5CAAA 5HK4A 1TK5A 2E8NA 2BZ2A 3I0RA 3TJ8A 2XMVA 3U1LA 2D3DA 3PTWA 3NRWA 2KHVA 1HRHA 3QBCA 3J81j 4LC9B 1ZJNA 1FKPA 3P5BP 4ZOSA 3ELHA 2BABA 3G87A 2YHBA 4CE9A 2ILYA 4DEZA 4DMZA 4DPYA 4YQWA 3I9V9 1FDBA 4Z4CA 2RHQB 4QPXA 3C5GA 1EARA 3NASA 1S9GB 2QG9B 4TUPA 4RW7A 3HW8A 1URJA 1BPEA 4DR7K 2YI1A 2FIUA 4NMLA 4UY8O 2I6XA 1AZSA 2BPGA 1UFKA 3GSIA 3FQKA 5KFLA 3IG1A 2NV3A 3DRPA 1UFLA 4DCJB 1BNPA 3BZKA 3THTA 3T9ZA 7ICHA 2ROEA 2O1PA 1G99A 2GAHC 2QKQA 3OR2A 5J0TA 4QZGA 1QAIA 3EVOA 4DV4K 1VQON 4JV5J 1N6QB 2JH1A 3AO2A 4TSXA 4PEOA 3ZT2A 3UE2A 1DXSA 2YQ0A 3IXQA 2RT3A 4DQQA 3ENVA 3I56N 2VBWA 3KBBA 2GHVC 2GLEA 3CCWA 3AHPA 2Z2ZA 2EANA 3CJ2A 1G7CB 2G9OA 1H7WA 4ZVQB 5J2GA 2CADA 4OLOA 3WNGA 3OVBA 2IY5B 3L2RA 3PG9A 3GL1A 4A8EA 5KT6A 3CJ8A 3VA3A 2L3MA 3DXKA 4Y2XA 3ZTPA 3CJKB 3PNIA 3EXCX 4CJLA 1RQLA 4OZ5A 3PW4A 3Q0AA 1PK1A 2Q2RA 2Z1JA 3D2FA 2VC0A 4BE0A 1CLFA 2XEXA 3H0PA 4KLSA 1OS5A 1ZQSA 2ALZA 1ZQJA 4BR4A 5E33A 3PYDA 3TR8A 3CCUS 1NDPA 4WXWA 7ICSA 1RWKB 5GAEU 3NNCA 4G9BA 4RQ2A 2UXDF 3ZT3A 5KG0A 1Y97A 3OTQA 4QZDA 2CNKB 1O03A 3HT0A 4B3MF 3I55N 2FTRA 3LDQA 4EEKA 4CYUA 1W2IA