3TANA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tanA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tanA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tanA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tanA01
3KHHA 4F4WA 3DMJA 3ZSRA 1U4BA 1S9FA 3KD1E 5D4BA 8ICRA 4R65A 2ZUBA 1JLEA 4E89A 1JL2A 2AGPA 1N6QA 1TKZA 1NK7A 4CJPA 2R8HA 1AROP 4Q8FA 2YKNA 4YD1A 5C42A 3Q8SB 2Q3SA 3P1GA 1A5XA 2YNIA 4FJ9A 1SZPA 3IAYA 2BCQA 3ZDDA 1NJYA 2RDIA 2FMSA 2V4RA 4GVMA 1BI4B 4FYDA 1NK5A 2HVHA 4YMOA 3AVCA 3GIJA 5KFXA 3RMDA 1TAUA 4QZFA 1B22A 2X78A 2IAJA 2ISOA 4Z6CA 4OKEA 4RNNA 4ED7A 4O5BA 2FMQA 4PUOA 1FKPA 5J0PA 1LB2B 4KLEA 3QESA 1SKRA 2ZQBA 1ZQJA 4UB1A 5DDYA 4LH5A 1HYVA 1ASWA 4B9VA 4M47A 4IDKA 3K5MA 3ZSQA 2AJQA 1L3UA 1WLJA 4P2HA 1JLFA 2MAXA 4E7IA 4M3YA 3LP0A 3L2RA 3V6DA 1K6YA 4PHDA 8ICJA 2WTFA 1TKDA 4KHNA 1DGSA 9ICMA 3MEGA 1XHXA 2DFFA 1VRTA 3QLHA 1ZQXA 1ZQMA 2ALZA 4CFAA 3LZJA 4CGIA 3RB4A 5KGXA 9ICCA 2HMIA 3OSPA 4PGYA 3AVGA 1IKWA 5I3UA 3C2MA 2JEFA 4MQ3A 1XC9A 5J2JA 3G6VA 3LDSA 4QZEA 2MUTB 3QZ8A 4CF1A 4Y1DA 4YXJA 1KLNA 3EWAA 3MDCA 3LWLA 1S97A 4Z6DA 4LY7A 4F4ZA 2OA8A 2O4IA 3UXNA 2JEIA 4E0DA 8ICNA 3FYHA 1U9LA 2W9MA 5DK5A 5KFZA 3H08A 3MAQA 4O9MA 4CEOA 4DG1A 4KMUA 4OGCA 3RMBA 4YMNA 1U49A 4QZ9A 4FXDA 2NRXA 4DOCA 4CJWA 2RPIA 4M3WA 4R8UA 1Z00B 3NF9A 3PMLA 2G8WA 4KB1A 5KG5A 9ICKA 7ICKA 1L3TA 5KFAA 1U48A 3QO9A 3KK1A 1TVAA 3LAKA 5KFVA 3HK2A 1KTQA 4YCXA 4FLTA 3V1QA 5EU7A 1BL3A 4GC6A 3DRRA 4O55A 4CHPA 3VQ4A 3ZT4A 8ICIA 3IG1A 4LD0A 4CJRA 3ZCMA 3G6XA 4C8OA 4QWBA 3JPNA 3VQCA 4I2DA 3LDAA 3CFOA 3HSTB 5FROA 3VQQA 3LANA 4M04A 3AU2A 4CEAA 4FO6A 4UAWA 5KRSA 3PW5A 3NH2A 2FMPA 3G10A 4ECQA 1ZBHA 4BDPA 3NFAA 4E3SA 2OZMA 2PFNA 1ASUA 4I28A 1R0AA 5KG1A 8ICPA 5DB7A 3OJUA 1ZETA 3H7IA 1ZQRA 4HHTA 5J2PA 3LALA 4HYKA 4OVLA 3ISBA 3HPHA 2VWJA 4RW8A 1RYRA 5D46A 3VQ7A 1XWLA 2IHNA 2XHBA 3TARA 1T3NA 1VSFA 1LW0A 3QEIA 1IO2A 3DRPA 3O4QA 2R8KA 3MABA 4TUQA 5HRRA 4DL2A 4O4GA 5EWEA 4LVSA 4DFPA 4ECXA 8ICQA 4YXMA 7ICSA 1ZQWA 1ZQNA 3QEWA 4Z6FA 4RT2A 4ECTA 3I0SA 1KFDA 4E19A 1RT5A 1I39A 4DL4A 1S1VA 1NJWA 4QCLA 2WOMA 1TGOA 4NLNA 2E4LA 1LWCA 9ICGA 5D49A 4H4OA 4CESA 3S3NA 1NK4A 3WNHA 3RJFA 1RTDA 2C2DA 1BPXA 3TAMA 8ICCA 4FJLA 1RCHA 2ETJA 2DY4A 3RJJA 1ZBLA 4KLMA 1VSHA 4EYHB 3OS1A 3PO5A 4F91B 4C8KA 2BQRA 5KTQA 4IG3A 4O5EA 4JRPA 2W9CB 5DLGA 3C1YA 3AVMA 3MR3A 5KG7A 2HHSA 4YR0A 1BI4A 2HVIA 3TI0A 5DB9A 4JV2A 1XS9D 2FBTA 1WSGA 1S1XA 3IM1A 7ICIA 4E1NA 1TL1A 4OLBA 1J9AA 1EETA 3MEEA 5L1LA 4Z0UA 3AVAA 3C6TA 4TURA 2C28A 4RT3A 1WSFA 5KT5A 3EW9A 3OYFA 1MQ2A 1RDCA 3QEPA 9ICWA 5KFOA 3LWMA 4MF2A 1J54A 4KLTA 4M41A 3LP3A 4X5VA 3NGZA 3QEAZ 4JLHA 3OYKA 3RJEA 1RPLA 5L1KA 3SZ2A 1ZQVA 1RYSA 5J2HA 3UPQA 2PZSA 4QOZB 2AGOA 8ICXA 4ZTFA 1XO1A 3ZDAA 4RQ6A 1RTIA 5J2QA 3I0RA 2IOCA 3DLKA 4I2EA 1G15A 1S0VA 4ZH4A 1RTJA 4OJRA 3LP2A 3ZSZA 4EP4A 3WNFA 1NK0A 4YVZA 3KHGA 4CJ4A 5DLFA 3L2UA 4RQ3A 4FJXA 4FJHA 1S0NA 1KLMA 2MUTA 5KRTA 4ECYA 1DLOA 4KLLA 4B9MA 1JN3A 4LSLA 3OSNA 8ICWA 4UB2A 3PNCA 3AV9A 1KVCA 5FRNA 4TUSA 7ICEA 4DQRA 1NKBA 4PY5A 2OPSA 4MF8A 3CM5A 2FLLA 3VQ6A 5KT3A 3D0PA 3CQ8A 5CZ2A 2Y1JA 1NKEA 1ZQAA 4CERA 4QWAA 4F5OA 4NYFA 4UBCA 4KLIA 4F93B 4KRFA 1JMSA 4ECWA 2J6SA 3P83D 3KHLA 4NCBA 4FLZA 4P4MA 2AQ4A 9ICUA 4F92B 4O3PA 4E7LA 3K75D 3O3GA 3UQ2A 3BQ2A 4FJ7A 3ZSXA 5KFRA 4CEFA 3AUOA 3JSMA 1Z00A 3NGIA 4DFKA 4F4XA 5KFKA 5J0RA 5KFLA 4IFYA 5KT6A 5J0UA 2AQ0A 1S1TA 7ICTA 1HUZA 3DOKA 1QSSA 4ELTA 5IIOA 5JS1A 4J9KA 4RNMA 1D9DA 5CZ1A 3AVKA 2ZUCA 3GIKA 3PMNA 3M8PA 2HW3A 3H4BA 2BCSA 1T7PA 4UB3A 3JYTA 2F1JA 7ICJA 1JLAA 3BJYA 1RNHA 3EY1A 4F3TA 1C0UA 3DRSA 2BE2A 3SQ1A 9ICLA 2VA8A 4DSEA 5KFPA 2D0AA 4R64A 2P5GA 3V7KA 4BGDA 4O5KA 3AO4A 1QHTA 4OKJA 4M9JA 4KHWA 1ZQOA 2F96A 4F5QA 1XSNA 3MGIA 2ZTEA 2F8TA 1Z3EB 5EOZA 2BCUA 3IRXA 3NF8A 3DLGA 2OZSA 3H8JA 1QE1A 5HMLA 3RH5A 4JS5A 4M9GA 4DSFA 1D8YA 7ICPA 3HW8A 4CJUA 1NOMA 4BXOA 8ICHA 1LAWA 5IIKA 4DL6A 3K5OA 4IQUA 4IKFA 3V9SA 3GQCA 1ZQFA 4YD2A 5KFJA 4I2CA 4YG2A 4KN4A 4F5PA 3OYAA 4KLFA 2ISPA 4NYNA 7ICUA 5J2GA 5CYQA 3AVFA 3HO1A 2P6RA 1IXRA 3DLRA 3M9OB 4LZDA 1YVUA 4IQVA 4UB4A 3ITHA 4CGGA 1NOYA 4DOAA 3K58A 1T05A 1NJXA 5KFEA 3QERA 1HYZA 4QZBA 3K59A 4ZHRA 4NLZA 5J2DA 4FJIA 3V1OA 2XY5A 2W9CA 3RJGA 2J6UA 8ICZA 3KLHA 1ZJNA 4CGDA 1WNSA 3C5GA 3RJKA 3SV4A 3A2FA 9ICTA 4KKOA 7ICQA 3U6FA 4ED1A 3H8WA 3JPQA 2PYLA 3GIIA 2P66A 1U04A 2BPFA 4AHRA 4E7KA 4FK4A 4Q44A 4XUSA 3RAXA 5HRNA 1COOA 4CFBA 1C7YA 3TFRA 5BPCA 4I2AA 4CGHA 2P6UA 5KFDA 1BVSA 4ELUA 3AA4A 5KFQA 4DLGA 2I9GA 1U45A 1YT3A 5KG2A 4KITB 5EWFA 1ZQEA 1BIUA 2YHBA 4KHUA 4NM2A 2NRVA 1TKXA 4KLGA 4DTJA 1EXNA 2QKKA 1EP4A 1TK8A 4KLHA 2W8KA 2VG7A 4OPJA 5CHGA 3NH0A 4IRDA 3KLGA 4IG0A 1JLGA 2RF2A 7ICOA 1Q9YA 4Z6EA 3MEDA 4M9NA 1CZBA 3OY9A 2FPMA 4M2YA 4W5OA 4ZTJA 2UVUA 2NRZA 3HVTA 2JGUA 1XSLA 1WSJA 4F2SA 3NE6A 3RJHA 4W5RA 5KFIA 3ZSYA 8ICKA 3HP9A 4GW6A 1BPDA 4IBNA 5IIMA 2DFLA 3V1RA 3OYNA 4ECZA 2QKBA 3MR2A 2BGGA 4OPKA 3E01A 2XGPA 4DS5A 3V6HA 2G8KA 1ZQPA 3M8SA 2ZUDA 8ICAA 4AILC 2BKEA 5J2IA 3C1ZA 3Q8MA 1Q8IA 1BPZA 3O3HA 1WCLA 1C1BA 4KLSA 9ICSA 2HHVA 4J2DA 3C2LA 4I2BA 4CJ3A 5HRPA 3IS9A 3V9ZA 4BACA 4RG8A 4RQ4A 1JLQA 1RILA 4AHUA 4I2FA 1Z26A 3LPUA 8ICBA 2LSNA 3H8SA 3H40A 1ITGA 3L3UA 1RBSA 1JL1A 4P4OA 2E6MA 3U3GA 4WE1A 1WSHA 4PH5A 3GV8B 7ICFA 4XA5A 4QZAA 1VSMA 1LWFA 4KI4A 1S6PA 1WN7A 3QE9Y 4PHPA 3KD5E 3PVXA 4FW2A 4HTUA 2EHGA 3UQ0A 1KDHA 1D9FA 3ZDCA 2W9BA 1GOCA 1S0OA 4J2AA 1ZJMA 3AVLA 3Q8PB 4ECUA 3CYMA 4KO0A 4DF4A 5KT2A 1U47A 2B4JA 3B6OA 3BQ0A 3HVRA 4CK3A 3LP1A 4CF0A 5F9NA 4FS2A 5KG3A 1VSLA 1ZQQA 3SQ2A 3OGUA 3AA2A 5DBBA 4CJQA 5IILA 5J2MA 5DG8A 3RWUA 1ZQUA 4IR9A 3LZIA 3QETA 2UVRA 2JLEA 3SUQA 3VQ8A 3T5LA 4GXKA 2Z1GA 4M3UA 4UAYA 3PW2A 1S76D 4H8KA 3MBYA 2B5JA 4Q5VA 2C22A 3MR6A 1RT6A 4DSLA 3CM6A 3SUPA 4LH4A 5J0QA 4DSJA 4AHCA 5KG0A 4KHQA 4FJKA 5D3GA 1SUQA 8ICFA 4C8LA 4M6WB 3NF7A 4PPXA 2VANA 3KIOA 2X74A 3TAEA 3VA0A 5CP2A 3H4DA 4EEYA 1XI1A 3MFHA 4DSKA 4DTNA 4PQUA 2IMWP 1MQ3A 4O44A 5DG7A 1O1WA 4J9QA 4ED6A 4HUFA 2BPCA 4MFBA 2QK9A 4I2IA 4RW9A 2P51A 1MC8A 1EKEA 4CFDA 1JX4A 4FJ5A 4GXIA 4E7JA 3QNNA 4KLOA 1RBUA 4M3XA 1RDBA 3I8DA 3KHRA 2A1JA 2VA3A 4DS4A 3OYBA 1UA0A 1CLQA 4YR2A 3SI8A 3DI6A 4FJ8A 4FCYA 2YNFA 1TL3A 4W5QA 2HHXA 1YTUA 3ZT2A 1MSWD 3DOLA 1ZQHA 3VQAA 1RDDA 3KJVA 3V81A 3E2EA 2IC3A 1ZQTA 5KFWA 3AO2A 3V9UA 1KVAA 4F5RA 3C5FA 2BQUA 5J2BA 3ZT1A 3JPTA 4B9UA 4Q0BA 3PW7A 4Z4FA 1HNIA 2R8JA 4FJNA 4FM0A 4KI6A 3K4GA 2YKMA 4PHAA 5DGBA 5J29A 5BOLA 5L1JA 4FJGA 1Z25A 1BPYA 9ICAA 3HYFA 7ICGA 3O4NA 3TQ1A 4PGQA 2H5XA 2IS3A 1ZQLA 3Q8KA 3RRGA 3BQTA 3SI6A 1JXBA 3OYEA 3M9NB 3L8BA 1KRPA 1ZQSA 3AVBA 2YHAA 2FLPA 2W8LA 1X9SA 4FLVA 3LPTA 4CECA 3TR8A 2BQ3A 1B43A 3RB3A 2VG6A 2XY8A 5KFFA 4I7FA 1X2IA 5F9LA 3VQDA 2GV9A 4CEQA 1NJZA 4CJKA 3ZD9A 3V7LA 5KT7A 2V4QA 3KKRA 4K4IA 3OYHA 4FW1A 5DBAA 2RN2A 3AVJA 2Z1HA 4CJTA 2OPRA 4XQ8A 4DLEA 1S9GA 2DPIA 2PFOA 4PHEA 4RW6A 1HYSA 3MDAA 4R63A 2F1IA 3LAMA 2BR0A 4O3OA 1VSIA 2GUIA 1NKCA 4MFCA 4DTPA 3Q8QB 2DTUA 2BGWA 2HHTA 4BDYA 5C24A 4IRKA 3WNEA 4BDZA 4YNQA 3DLEA 4QW8A 4CCHA 3MR5A 4I27A 4M3RA 1TFRA 1C0TA 1FKOA 5T7BA 1UA1A 5DQIA 4O5CA 2FLNA 4FZXC 4B9LA 5KFTA 4F8RA 3QEBZ 4FZZA 2R8GA 3HM9A 1B9DA 1QQCA 1RT7A 9ICQA 5HNKA 4FVMA 3TFSA 4N76A 2AGQA 4EZ6A 1A5WA 1X1PA 5HP1A 4B8CA 3F73A 4NXZA 3KLIA 4H4MA 3ZD8A 1XHZA 5J0TA 5IIIA 4ED2A 1A5VA 4J9SA 1KEJA 4FLYA 4E7HA 4M3ZA 4QW9A 4J9LA 1S0MA 2NRWA 4C8NA 4Z4GA 3HJFA 4J9PA 3RMCA 1KCFA 2ZTCA 9ICRA 4J2EA 4CHZA 4KTZA 1B9FA 2P1JA 5HMMA 1WCNA 1HUOA 4AHVA 2JEGA 4DQIA 3TAPA 4J9RA 2KTQA 1S77D 3PR5B 3ZDBA 1RBTA 4CJSA 4UBBA 4BWJA 4DU3A 1JIHA 3B6PA 4NLKA 4JUZA 4DU1A 4UB5A 2RDJA 4PGXA 4HCBA 5J2FA 1S1UA 4ED0A 4CHOA 5HHHA 3ORYA 3EPGA 4ED3A 2DPJA 1SL1A 7ICRA 2FBVA 3QEVA 5DDMA 4IR1A 4YMMA 3GFKB 4KLUA 1C1AA 1S6QA 4TQSA 1HQEA 2I1QA 3SPZA 4KHYA 1F21A 4HCCA 3OYJA 4M6WA 3ASMA 4NCGA 3K57A 4CGJA 2UVVA 1L5UA 2WONA 1IKVA 3LK9A 4RQ7A 3ETLA 1EX4A 3AO1A 3NAEA 2HHWA 1ZQCA 1S1WA 4KN7A 4QZIA 3VQPA 4CF2A 2KQ2A 4C8MA 2G8VA 3UIQA 5KFCA 1SKSA 5J2NA 3SNNA 2PFQA 3OS0A 4I9LA 4AHTA 5KFNA 5JUMA 4HUGA 3HP6A 1L3VA 4CEEA 4CEZA 3KK3A 4QWEA 3L3VA 3PO4A 4YN4A 4QZDA 4ECVA 4DFMA 4DQQA 4I9QA 3NBPA 3HX0A 3AA5X 3MFIA 2JEJA 4RW7A 5FRMA 3OVNA 4YQWA 4KB0A 2IBKA 5KFMA 4MFAA 1LV5A 8ICSA 5CY4A 3ZSVA 4FLWA 1KSPA 4ID5A 4TSXA 8ICTA 5KFGA 9ICPA 4DTOA 3C6UA 4CJFA 4W5TA 9ICFA 4NM1A 5KFSA 2Q0ZX 3T1AA 1HNVA 4DTMA 1JXEA 1IM4A 2PI4A 3AA3A 4ECRA 3RMAA 4CGFA 2AU0A 2X6NA 1QSLA 3V4IA 3NH1A 4FZYA 2IHMA 2XO7A 3RBEA 3M8QA 3VQEA 1XU4A 3GILA 5C25A 3GV5B 9ICBA 4LZGA 4Y1CA 3MGHA 4J9NA 2HNZA 1S9EA 3KKSA 2ZJAA 4FJMA 3N4MB 1HRHA 2BANA 5SWMA 4Q8EA 4DEZA 4F2RA 1ZBIA 3FFIA 4JRQA 4RZRA 1RXVA 4DWIA 1VK0A 1UAXA 4DU4A 1IG9A 5IINA 4L8RB 4CEBA 2DFHA 4B8AB 1X9WA 4EBDA 4B08A 3V9XA 3NCIA 5KG6A 1WAFA 5IIJA 1C0MA 3HPGA 3AVNA 8ICUA 4DL5A 3GIMA 1GOAA 4K4GA 4RU9A 4JK1A 4B9TA 3Q8LA 1H38A 1JKHA 2BPGA 3B0YA 4O0IA 3P5JA 4ID1A 2Z1JA 4E1MA 1ASVA 2D0CA 4EP5A 4FBTA 4FLXA 4O3NA 1BQMA 2KFNA 1NK8A 3RB0A 4O0JA 1BCMA 3KK2A 4DO9A 3TAFA 2C2RA 1N48A 4M9LA 3PY8A 4UQGA 3OYIA 4R66A 2B6AA 3HPOA 1LW2A 3V72A 1RDAA 1HJRA 4OGEA 9ICOA 3UXOA 1CXQA 4N56A 3OYGA 2IA6A 4DF8A 1IH7A 4AH9A 4KPYA 3ISDA 4RQ1A 1VSKA 3KTQA 5DQHA 3CFPA 5KI6A 1N5YA 3L2WA 1T4GA 3KLEA 4M45A 1ZQDA 4G3IA 4DMNA 1S10A 1UT5A 9ICVA 2ZE2A 3TANA 4RPXA 3AO5A 1I3AA 3OYCA 4NY8A 2A1RA 2BCVA 2PXIA 5HHIA 2UVWA 4FM2A 7ICVA 3QEXA 4FBUA 3BGRA 1MU2A 3UXPA 4RW4A 5J0OA 4YFKA 2JZBB 3PX4A 4M3TA 1K1QA 2F8SA 3F9KA 4KREA 4PA1A 8ICVA 3EPIA 3HXMA 2ASJA 2BDPA 1TK5A 2BHNA 1ZQIA 4NCAA 5CA7A 3HL8A 1BISA 4FJJA 2KN7A 3DYAA 4DTSA 1SKWA 1LWEA 2KZ3A 4KLDA 3N97B 3V6KA 9ICJA 1W9HA 3CFRA 2PYJA 3VQBA 3RH4A 4KFBA 4CJVA 2B21A 4QZGA 8ICOA 3U3YA 1IKXA 4JWNA 3RH6A 3V7JA 3BQ1A 2A1SA 4EZ9A 4ECSA 2E6LA 1RT1A 5L9XA 3GV7B 2ATQA 4JV0A 3OYMA 2OYQA 5E41A 4KHSA 4M42A 4GXJA 2ZJ8A 3PX6A 4YP3A 4KV8A 5HRSA 1CXUA 1BPBA 1ZBFA 3M8RA 1TV6A 3GDXA 3S3MA 2FPLA 4DOBA 2ZD1A 4Z4CA 2ATLA 2NUBA 3OYDA 3L2VA 4XIUA 4CE9A 3IHQB 4K4HA 2QXFA 1A76A 4RQ8A 4DL3A 1DTTA 3ZT0A 2XY6A 1HMVA 3PR4A 3NGYA 2GBZA 3K2PA 5DB6A 4QZCA 3V6JA 4XRHA 2W42A 2C2EA 4YFUA 4UAZA 4FM1A 4GC7A 4IFVA 7ICLA 4O3RA 5DGAA 4PWDA 5J2CA 2D5RA 2FBYA 9ICXA 4R5PA 1K1SA 3VQ9A 3S3OA 3VN5A 4CJEA 1VSJA 2VWKA 1W0HA 3PW4A 5K14A 3C95A 2EX3A 1B92A 1TK0A 1VRUA 2V9WA 3DLHA 3K5LA 3NHGA 1PZNA 5BOMA 4LSNA 1QSYA 2HNYA 5CB1A 5TZVA 3PW0A 3OHBA 4MFFA 3PV8A 3TAGA 3T19A 5KG4A 1V9PA 7ICMA 4BXOB 1UWBA 4QAGA 4CHNA 3SUNA 1KFTA 1JXLA 3C21A 4CIGA 4RPYA 4EYIB 3NDKA 4CEDA 1JLCA 1WSIA 1ZBUA 5I42A 3SCXA 1EXQA 4KTQA 3SJJA 3G6YA 2IGIA 4CIEA 1RBVA 3DM2A 1BPEA 4CIFA 1ZQZA 5KFUA 3QIOA 9ICHA 4Z4IA 4O3QA 4DQPA 4N41A 1ZQBA 1NK9A 1D5AA 3VQ5A 1KVBA 4FK0A 2O4GA 2XRIA 5DMRA 3WNGA 4QWDA 3NTUA 5DBCA 5FDLA 4RNOA 4RQ5A 3TABA 1D8LA 4CHYA 4YR3A 1ZQGA 1TVRA 4K8XA 1FXXA 4DTXA 2HB5A 1RXWA 2FBXA 3Q8RB 4DSIA 4HUEA 2YV0X 3OHAA 1A77A 2KFZA 1FK9A 1REVA 4J9MA 3JPOA 3NGDA 5J2EA 2ZJ5A 4RPZA 3SYZA 2PFPA 1BHLA 4BE0A 1Y88A 1RTHA 4J2BA 2GWSA 1JLBA 2XCAA 4CHQA 4F3OA 4GLXA 5EWGA 1QTMA 3FDSA 4B9NA 2X6SA 4QZ8A 3T5HA 3ALYA 3MXIA 4JWMA 2KZZA 3C23A 4IQTA 1J5OA 4EBCA 3SQ4A 2PI5A 4GMJB 4AHSA 5CR0A 2PY5A 2HHQA 2M9NA 2G8HA 4CF9A 4KLQA 1QLNA 5HLFA 3JPPA 3ISNC 5HROA 3ISCA 1HQUA 3PUFA 5J2KA 1YTAA 4FS1A 4QZHA 1UT8A 4ED8A 1XSPA 3QIPA 1IKYA 3AO3A 5JS2A 4CFCA 1RT4A 5DQGA 3RR7A 2IDOA 2VA2A 1SL0A 2G8FA 5J0WA 4HVJA 4TQRA 2R7YA 5J0SA 1L3SA 1Y97A 2Y1IA 3PX0A 4W5NA 2VG5A 1TKTA 3SV3A 2OWOA 5DB8A 2XGQA 9ICIA 2JZBA 4MEXA 2ITGA 8ICGA 3ZSOA 5HP4A 4CK2A 3OS2A 4B9SA 2J6TA 1NK6A 3K5NA 1TV9A 4DFJA 4O3SA 4MEYA 3C2KA 1WSEA 1ZQYA 2W9AA 3G0ZA 4DL7A 4IRCA 2NRTA 3ZSWA 3RRHA 4CF8A 1X9MA 5SZTA 1VSEA 1T8EA 3B0XA 4F50A 3RTVA 4DQSA 3T5KA 4M9HA 3C94A 4ELVA 4I2PA 2ASDA 4G1QA 5HBMA 3SQ0A 8ICLA 2KW4A 3RB6A 2ASLA 4I2QA 4EBEA 4RQ2A 3HT3A 1DOQA 4CJ5A 1CUKA 1N56A 3MXJA 1ZQKA 5J0YA 5DKWA 3MXMA 5J2AA 1BQNA 3O3FA 1SV5A 3L2QA 2ZTDA 1BIZA 3AVHA 1QS4A 2G8UA 3T3FA 2G8IA 3V9WA 8ICEA 3NF6A 3S9HA 4Q45A 3SUOA 4JV1A 5DG9A 5CWRA 5KGWA 1Q9XA 2KZMA 5L1IA 3D45A 4F5NA 4N5SA 1NOZA 1C1CA 4KLJA 1RBRA 1RT2A 2LYHA 4Q43A 5KT4A 1WAJA 1LAVA 4M0AA 4KAZA 4R8UB 4BWMA 2W9BB 3AU6A 2OPPA 3ULDA 4QWCA 2HHUA 3RBDA 3RAQA 4DTUA 4KTWA 2Z1IA 5KFHA 5KFBA 4FLUA 9ICNA 4J9OA 4F4KA 2YNGA 4TUPA 1RZTA 1ZYQA 1S5JA 3HWTA 1T03A 2RKIA 4RUAA 5C5JA 7ICHA 3TWHA 3BDPA 3JPSA 1SL2A 4CK1A 1DTQA 4I2GA 2YNHA 5CJ7A 2R8IA 1BGXT 2XCPA 9ICEA 2D0BA 4Z4HA 4JS4A 3SPYA 2FPKA 4CJLA 4Z4EA 1C6VA 3QINA 7ICNA 4OKKA 4FK2A 1CZ9A 1J53A 4IQWA 3THVA 2XC9A 3KLFA 2P5OA 1CEZA 1RT3A 2F1HA 3JPRA 3EYZA 4BE2A 3RR8A 4I2HA 1VSDA 3MECA 4P4PA 3TAQA 4DTRA 3VA3A 4B3OA 2XY7A 1KFSA 2FC0A 3DLBA 1UOCA 3AVIA 5J1EA 3T5JA 4I2JA 8ICYA 1TAQA 1HJPA 5J0XA 4RQ0A 1BCOA 4K8ZA 2DFEA 3M9MB 4ICLA 3ZDEA 2OPQA 4BE1A 3EZ5A 3QZ7A 3OJSA 8ICMA 3CG7A 4NLGA 5CYMA 2A1JB 4F4YA 1GOBA 1HPZA 3ZT3A 3QNOA 4I29A 4N47A 3RJIA 2BCRA 4OLAA 5KFYA 3OYLA 4RUCA 2HNDA 2I5JA
chains in the Genus database with same CATH superfamily
3BYRA 2H9ZA 3DMJA 1U4BA 1PCAA 3FEXB 4K5SA 5AQZA 3EWGA 5D4BA 1WF0A 1W25A 4YHHF 4FWRA 4CGZA 4M7YA 4DCJB 4E89A 3BUZB 1JL2A 1VJ5A 1CG2A 2I0XA 3V81B 2ABYA 5LL6Z 2R8HA 4IG3B 4A59A 4ZLLA 2GQCA 1AROP 2YKNA 4YD1A 1W97L 5C42A 3ONNA 1KVKA 2ZIUB 1A5XA 2UXBK 1SZPA 2AJ4A 2UZAA 4JBCA 2HGMA 1NJYA 3RW6A 4LRDA 4BRNA 2V4RA 4GVMA 3AVCA 2XMUA 3GIJA 4BR9A 3RMDA 1TAUA 3M1VA 4WIQA 4RNNA 4O5BA 3GJQB 2FMQA 2ODGA 3D3BJ 3P4IA 2QGFB 3VAMA 4KLEA 2ZQBA 5KPTA 1X4DA 5DDYA 1HBNB 3BZQA 3I87A 4LH5A 2OSRA 3IWNC 3A3OB 1FFGB 3R6LB 4IDKA 2KMDA 2RIJA 3ICXA 4AYBC 1BNOA 3BBFA 3VF4A 2DH7A 4P2HA 1JLFA 5KPRA 5FLXU 3ENAA 3IR5B 3O5TB 1SBRA 4KC5A 1K6YA 3LVVA 5ETTA 3MWBA 1DGSA 9ICMA 4PL7A 3HSGA 3LGMA 1RDRA 2OPRB 1NG9A 1ZQMA 2ALZA 3UVJA 3LZJA 2DVIA 4CGIA 3HI0A 3RB4A 1QDUB 1TTHB 3LW5C 3GBTA 2F3NA 1V4SA 3C16A 4DV2F 4PGYA 1YRUA 4P71A 2ZIVA 3AVGA 4WF9L 5I3UA 1Y9OA 4RUHA 3C2MA 3VGSA 2AMCB 5J2JA 3G6VA 3DHXA 3LDSA 1UW9A 5E5NA 2E44A 3A5OC 1DLOB 3JXOA 3A8YA 2GS8A 1SZ2A 2FF6A 4LSZB 3IBPA 3OXFA 4GY2B 2OA8A 2IOFA 4JI3J 4UTGA 1DFDA 4MKVA 3VAHA 3QRRA 3F44A 2P9GA 2RD5C 5AK5A 1FEEA 1N36F 5KFZA 3EJMA 4J91A 1X4GA 3MAQA 4O9MA 3GYNA 2YHWA 4HH0A 3G96A 4JI5J 3R2DJ 4CJ7A 2V4JA 4BRDA 1SJ1A 1XJWB 4DOCA 4ZJQA 3ZNUA 2RPIA 5BYSA 4LF1A 4JKGA 1Z00B 3T1YF 1IXKA 9ICKA 2FYXA 5EGYA 1U48A 3L9ZA 3VZHA 4IFYB 3MEKA 1DY3A 1KTQA 4LQ9A 2B4PA 4YCXA 2ZOMA 2FJEB 5ETNA 3VAGA 1KAYA 4ZLNA 4GC6A 5BYQA 1BL3A 3DRRA 4KH0B 3D5MA 3RSEB 2JFDA 3BF3A 1VGYA 3PCOB 3VQ4A 1ATNA 8ICIA 4LD0A 1IM6A 3FSYA 3G6XA 4C8OA 3TA1A 3Q8YA 2KJ8A 1NGHA 2B43A 3N79A 2HK3A 3LANA 1WTBA 4CEAA 2KP7A 1SV0A 1H3DA 4UAWA 5KRSA 3QUBA 5F1XA 3DRSB 4OYIA 3NH2A 4PKGA 4FF4A 3C6HA 2O1PA 4I64A 4ECQA 1ZBHA 2W03A 4BDPA 1KHWA 1RYUA 4K2JA 1XMOJ 3BB5A 3OJUA 1GLFO 4DUZJ 4CF5A 5AKEA 3HPHA 1YJ9S 1RYRA 4NCGB 4JOUA 4FWNA 2I7NA 2IHNA 3PYDA 4BGAA 3BEXA 1M5KC 4BVOA 2H3ZA 3UO0A 5HRRA 4IO9Q 4DL2A 4CW7B 5A2QO 4ECXA 8ICQA 3BPDA 5ETRA 4CO5A 4A62A 3HD2A 4M5KA 3CC2S 4ZVSB 4DV6J 4RLEA 4DB3A 1YWXA 1ROFA 2B3TB 3SAGA 3C29A 2FIUA 2E4LA 3R7NB 4F9OA 4CH7A 1Q7LB 3S3NA 3WNHA 2HGLA 3DGVA 4DR1F 8ICCA 2MA1A 1RCHA 2ZH4A 2Q1NA 5ALIA 4KLMA 4EX7A 4EYHB 1ZAXA 1K5OA 3BN7A 4HHUA 4V19S 2HGNA 3EGWB 3WUHA 2W24A 4RO0A 4O5EA 4QYZJ 2W9CB 4UZBA 4OZ0A 3RZAA 3M8QB 1E6YB 5C25B 3FCWA 5B7WA 2IVOA 2D8CA 3QYYA 2IFXA 2FSJA 3TW0A 4Y0FA 4AL7A 3TI0A 4LBHA 1QM9A 2FBTA 1WSGA 3UNGC 3WK5A 3IM1A 2FXUA 1V97A 1RFQA 1EETA 3MEEA 3FFIB 3AVAA 4HT5A 1ZZFA 3NRBA 4EWTA 1VQON 1WSFA 3TTFA 1F9EB 3EW9A 2XLIA 5CZVA 3W2WA 2OMOA 1CBKA 2MU2A 4PG5A 4GO7X 1NNLA 4B3MJ 4JI2K 4KLTA 4X64K 3HHLD 2Q0RA 4CP5A 1JKHB 1HKAA 1U2VA 5L1KA 1RYSA 1HNXJ 1XERA 2KL8A 3H2UB 4NLVA 4EO6A 3ZEUA 3UKRB 1RTJA 2JV3A 1NK0A 4NLYA 1UFKA 3FGUA 5EE1A 1AFIA 3I55N 4CJ4A 3EVOA 4KH6A 5DLFA 3H0MB 2HWHA 1BWEA 4MKAA 2Z56B 1S0NA 1BO5O 3C66A 3TX8A 4JI4J 3CD6S 2MUTA 1NB7A 2F63A 1S59A 2ZBRA 3HVWA 3MPYA 1K8AO 4UB2A 2L9DA 4ACOA 3G2XA 1XEZA 3E01B 4EMDA 1PC4A 1N5YB 1EQ0A 3WEEB 1FF2A 4JI2F 3U1NA 1KVCA 2VQEF 4TUSA 4U67L 4KX5A 1S72S 1NKBA 1WG1A 3LA0A 2R2TA 2XB2D 2ZE2B 4MIAA 4TYBA 3J80Y 3CM5A 1ZC6A 5KT3A 3CQ8A 2CXYA 4EELA 2Y1JA 1WOPA 4GKJJ 2V5HG 3SSRA 5AQRA 4UBCA 2YX1A 2RAQA 1JMSA 3AAPA 5BREA 3P83D 4P4MA 1S49A 9ICUA 1NMDA 3UQ2A 4WBFA 5KFRA 2YKPA 2POKA 3JSMA 1FKAF 4DFKA 4YOWA 1RAEB 1VQSA 5KFLA 3H45C 3TA2A 2YBVA 3RJMB 2J7KA 4Y2JA 1S1TA 1Y3KA 4I6AA 4LRAA 4CYUB 1QSSA 4ZPTR 2KG0A 4C6AA 3MM6B 2E2QA 1KDNA 4AM7A 4OJPA 1B0XA 3MC1A 5CZ1A 2ZUCA 3GIKA 4QYRA 3M8PA 4DHYA 2JRSA 2CQ3A 1U09A 4JI6J 2WB1C 1T7PA 3R3LA 4DV3K 2P9NB 1JLAA 2YMQA 1CULA 3GU3A 2NZCA 2Y1LB 2V2VA 4PL8A 2XI9A 2HS4A 4CZLA 2P5GA 3RAMA 3R2CJ 1FFSB 4O5KA 2ZD1B 4KHWA 2F96A 2LQ9A 1NCLA 4F5QA 1XSNA 1WC4A 2FVCA 2UUCJ 3NF8A 3IRXA 2Q31A 4QNLA 2GVDB 4M9GA 7ICPA 3HW8A 2KIVA 5G5GA 2XS2A 2V52B 3GQCA 3Q8VA 1VK3A 2YX8A 2C3OA 4YB1P 4M5JA 6FDRA 4OI2A 1HBMB 4E2FB 2HBKA 4F5PA 4PWDB 3GB0A 4LJMA 3CDAA 3VEVA 4AQYK 5CYQA 4DV3F 2YWFA 4NMLA 2HHHJ 4FPRA 2G07A 3M9OB 4LZDA 2MMYA 1S7IA 4UB4A 1WSRA 4CGGA 1NOYA 4M5MA 4MFBB 3NRWA 2HS3A 4H0TB 2RP5A 1TUVA 4C7QA 2KG5A 2LI6A 3AOAA 3QU4A 4QZBA 2RHKA 3WBZA 3J81Y 4JKEA 4FJIA 2XY5A 2J6UA 4OX6A 4CGDA 4FZNA 9ATCB 5JVHQ 3DXSX 3C5GA 4RWTA 4KKOA 1KOOA 2FHOB 5KOWA 1GK8A 1H98A 3I9ZA 3JPQA 2V8HA 4CBUA 2K7KA 1KOHA 1GMWD 2IC3B 4RX6A 5HRNA 4PKHA 2CJKA 4I2AA 4CGHA 4AQYF 1BVSA 1IV8A 2I9GA 1HD1A 3CETA 4GV9A 2YKMB 4K0KK 2YHBA 5EWFA 4KHUA 2XICA 1H7XA 2ASPA 1EXNA 2QKKA 1EP4A 4XTTA 4DUTA 3PLAA 3JQMA 4C97A 4B3TK 5CZXA 1L3KA 4OYXA 5LY3A 1REVB 4DV1J 4MKBA 2HDOA 2V8DA 1VJWA 4IRDA 1CQNA 1JLGA 1NGIA 3MEDA 1YJVA 1CZBA 2AJFE 1NZPA 3RRKA 2FPMA 3MCSA 4JD2A 4X66K 3AB4B 1B0PA 1PVRA 2U1AA 4LFAK 5AZJB 5CCLA 3BM7A 4QIVA 4FE3A 2KHVA 3RJHA 2KSOA 4B1ZA 4W5RA 1EAYC 5KFIA 3ZSYA 1PYSB 3HP9A 3T1HF 1RQNA 5DS7A 1DK2A 4YOYA 2FHKA 2BGGA 4ZLJA 3QBCA 2XGPA 3V6HA 2G8KA 1ZQPA 4J90A 2GX8A 4K0KF 2EPIA 4ZJLA 3O3HA 1D9AA 2H4YB 1C1BA 4MHVA 2HFNA 1EO1A 1T6DA 2N7CA 4I2BA 4CJ3A 1N52B 1WC1A 2FTRA 1X3NA 1C0TB 4UB8U 4RQ4A 2AYGA 1NAQA 2Y9HA 1NPRA 1EQMA 1Z26A 3O2IA 2LSNA 2KU7A 1MWMA 1WACA 3IGNA 2MPUA 4A2AA 3SJHA 1X40A 3KJQB 4A8WA 3DXMB 4X66F 1JL1A 4P4OA 1KAXA 2P9LB 3DNCA 1F9HA 4XA5A 1VSMA 3ED5A 4KI4A 1WN7A 4GKKF 1X66A 2YHXA 1GXUA 5AICA 4JAXA 5BYRA 2G09A 3UQ0A 1KDHA 2MKYA 3CD5A 3GWCA 2RSQA 3SK3A 1DAXA 1YDLA 1NEEA 5FJ4A 4ECUA 1OW5A 4UB6U 3AD9C 5DJBA 2B4JA 4CK3A 3OT9A 1OYEA 5HK4A 1T9TA 1A7GE 4CF0A 1J6ZA 1LFPA 1Z6RA 2F4FA 3CCES 2JL9A 2RU9A 4N8NA 3LYSA 3MXHP 4C4SA 3F2DA 4J03A 1I51B 1DKGD 1LWXA 4DL0C 4PPZA 4IR9A 3BQ7A 1VS3A 1K47A 3SUQA 3VC8A 4PXDA 1JMTA 2B4UA 2HWTA 2RH3A 2WBMA 3M7VA 5C2CA 3VQ8A 1EWQA 4OJ3A 4ILGB 1C1CB 1S1UB 2Z1GA 4Y2QA 3MBYA 2B5JA 4YB6A 3MR6A 2ZG6A 1NGGA 3MN7A 2QEXN 2R9LA 3OVAA 3W1YC 3FC9A 5FPNA 1S6QB 4DSJA 2HRYA 4KHQA 3CDUA 5DZ6A 4GVBA 4NEZA 4M5GA 3NF7A 4PPXA 5D6GA 4ZVEA 3KIOA 2X74A 1VQ5N 2C2ZB 1U1OA 5CP2A 3H4DA 4HTJA 3MFHA 3ENOA 4DTNA 4Y2KA 1WBBA 1I94F 4O44A 3ICLA 1ZAWA 4QR2A 2VJUA 4I2IA 4CZIA 1EKEA 3W60A 3HD1A 1DTQB 5ETKA 3JXUA 4KLOA 1F0XA 3AY9A 1IBKK 2VA3A 4LT6A 3OYBA 3SEIA 1BUPA 2D74B 3NBPB 1NGAA 1CLQA 4A8EA 3DI6A 3GJSB 1T6CA 1TL3A 1M1KO 2EFOA 5AQKA 4LJXA 2VU5A 4RPFA 5ALQA 4OZ3A 3HFZB 4C11B 3K2YA 2JNJA 1ZOTA 3AO2A 2C2KB 3AHPA 1GLJO 4QIWC 3V9UA 3C5FA 2BQUA 5J2BA 3DAWA 4Q0BA 4K4SA 1LFWA 1KC8T 2QTDA 1S4FA 3K4GA 5DGBA 2GO8A 3E66A 1N34F 3W61A 1VQ8S 3WQUA 1Z25A 1QTNB 1J27A 2DKOB 5D4NA 4Y2VA 2I38A 2VKRA 4PGQA 2JHDA 2WRMA 2ZWHA 2JSXA 5F0UA 3M9NB 1KRPA 3JTNA 4DKWA 1BQXA 3THTA 4Z7CA 2W8LA 1X9SA 3NGTA 1N6QB 1TKZB 2RB7A 4PZOA 3BDEA 2JZ5A 1RQ0A 3VALA 5KFFA 4L76A 2FPHX 4NPOA 2GV9A 1GX6A 1YIJS 3KKRA 4CZMA 4K4IA 1JNZB 1FRIA 3WT0A 2DGXA 5JVHL 3CIMA 1XBWA 4DR5F 2FY8A 5BJRA 2Z1HA 4B1YB 3WC2A 4HH1A 3NS7B 4CJTA 2C2MB 5E84A 4Y2IA 3Q2TC 3ZX3A 1Q79A 3WU2U 4RW6A 5M1NA 2NUHA 1MWQA 1LNQA 4DV4K 4MFCA 1VISA 2M70A 3MTJA 3MM8A 1MA7A 4DV5J 4AF1A 2H5IB 4YOUA 3UM9A 4FSVA 1FVSA 2K89A 3MR5A 2BACA 1NNDA 1FKOA 3OUYA 4JV5F 1UA1A 4DR7F 3HHDA 1HBOB 4U7UD 4BRLA 4F8RA 3NS6A 4FZZA 3KLEB 3HM9A 1VYAA 4Y2YA 3VZIA 3HFVA 9ICQA 1PAUB 5HNKA 2AGQA 3OVBA 3BEGB 4F3MA 1CJKA 3O80A 2IRXA 3N9UC 1TL7B 4P74A 3PJWA 1X5SA 3HF5A 3O6WA 3MM5A 1L6NA 3HSCA 4H5TA 2MZSA 3OTCA 4J9LA 5E33A 4A8SA 4OX9K 1UPHA 4F26A 2M0NA 1COKA 3CRXA 4DV4F 4C8NA 2DK2A 2QWOA 2MSTA 4J2EA 2CRLA 3UB5A 5A0YA 1WCNA 1PVQA 5AKGA 1HUOA 4AHVA 5GAGI 3DGPB 1U0HA 1FX4A 4J9RA 5HAOA 1RBTA 3FBEA 4CJSA 4BWJA 3TJ8A 4M5NA 2KH9A 2VPXB 2WF8A 1UZHA 4JUZA 2OTJN 2DH8A 2JXJA 3FEZA 5J2FA 3BYPA 2DF4B 2HFOA 2F9TA 3A5NC 2A1AA 2CQ0A 1GLLO 4NLTA 4C23A 2DPJA 1SL1A 2EFGA 3KNGA 2P9PB 4IR1A 4YMMA 1C1AA 3CB4A 1AUDA 2B7BB 1O5JA 2B56A 1RZMA 4MMOA 1OQ3A 1N32F 1UHUA 2MKCA 4JNEA 4OX9F 2GCFA 2UVVA 2KN4A 3LK9A 3L09A 1EX4A 3NAEA 2HHWA 1ZQCA 2HHPA 2BBEA 1GMUA 2QWPA 3MCAB 4KN7A 4DR4J 3KG4A 2XVTA 4C8MA 2DISA 2QXLA 1VC0A 5LMUK 1EX8A 3SNNA 4FVCA 4NLDA 5JUMA 3HP6A 1L3VA 2Q79A 5ITHA 4CEZA 4R25A 2ZJPL 3L3VA 5H9FK 1XNSA 3DCAA 4XO0A 5L1MA 4BRAA 3NMRA 4KHPF 4ECVA 1NHUA 1NGDA 4MDBA 3GYGA 3CD0A 3MFIA 2J76E 3OVNA 5C12A 3DC2A 1LV5A 8ICSA 4LR8A 4NLUA 3T69A 4FLWA 2DGQA 4ID5A 3OQ2A 2LYVA 1Q8BA 1YLXA 2R7WA 4TSXA 4W5TA 2OHDA 3T1AA 1REGX 3HX9A 3LDPA 2P9SB 5JMVA 1SKUB 4CGFA 5A8WA 2MDAA 3V4IA 2KJVA 2XO7A 1XU4A 4H5RA 4P0QA 1P7DA 2WW8A 2J0WA 3VWSA 3MGHA 3TU5A 4DV7J 2X3GA 1S1VB 3N4MB 2CNOB 3HHEA 2QFJA 5SWMA 1ZPVA 1O51A 4QS9A 4XEIA 5HO4A 3GONA 7FDRA 1SIJA 2CPXA 4RZRA 4DWIA 3CCQN 1S6OA 1UAXA 5IINA 2XMTA 3H5UA 3V9XA 4B08A 2YKOA 1N5WA 5I3QA 1P27B 4P72A 1IBCB 1P6TA 1JWWA 1QUPA 1HARA 3W3SA 4X62J 4UT4A 1IBMJ 1GTEA 1HWIA 4O8KA 3JB9k 4K4GA 2RQ5A 1SQEA 3QT8A 2M88A 1KHVA 4B9TA 2CYYA 5TKYA 1ICEB 2BPGA 2W2QP 3B0YA 3P5JA 2E5IA 4C0ZA 5LXYA 1ASVA 1D4XA 1FXLA 2ZKTA 2D0CA 5A8KB 1GT8A 2LM1A 4JK7A 4K4UA 1UAWA 4L3KA 3BO3A 1VBXA 3KK2A 4DO9A 4ZVFA 4UAUA 1S1XB 2FJ6A 4ITSA 1QQ5A 1HWJA 1YHQS 1TL1B 4DR6K 1BA0A 4UQGA 1SXEA 3ELHA 3OTEA 3CJKA 3U7JA 1KAZA 1LW2A 1K9MT 2CG4A 1J5OB 3R1LA 1PK1A 3CNHA 2MJUA 4FKYA 2DR9A 2I2YA 2HCFA 4KPYA 2DNYA 2YTCA 3FRZA 1VSKA 3KTQA 2R4FA 3CFPA 1QUVA 2RHFA 2CQGA 1ZQDA 4DMNA 2DH9A 3MN5A 2WK4A 3M05A 3OW2M 3IUCA 4QIFA 2OEKA 3TANA 4RPXA 2EZYA 1YJNN 1OY9A 5LMNF 3PM9A 5HHIA 1TELA 1R59O 4JI0J 5E3QA 2PD1A 1Y3JA 1TKTB 3QEXA 3BGRA 3LP2B 1MU2A 3BGLA 3UXPA 1WNEA 4YFKA 4USJC 1BDGA 2F8SA 4URQU 4KREA 5KL8B 1FERA 3UDEA 8ICVA 2C2NA 4TU8A 1KQFB 4FZMA 2E2OA 4DR6F 1L8LA 3VVUA 3THWA 1BISA 2A6MA 1U6FA 4LSLB 1OH7A 4TVAB 4TKTA 3CVKA 3M6XA 5AQOA 3V6KA 1W9HA 3S1TA 1M90T 3VQBA 2O8FB 1QH9A 1NI3A 1TYQA 4KFBA 4DN0A 1F3VA 4QZGA 8ICOA 1IKXA 4JWNA 3V7JA 2C3UA 4ECSA 2B9EA 2E6LA 1RT1A 1RB0A 1R6VA 1WUAA 4U96A 5B0BA 5H2FU 3GV7B 3LOUA 2NV3A 4X4PA 3OYMA 1U1MA 2DEJA 1MG7A 2G06A 1ZM4A 3DLLQ 2RNEA 2L5YA 1CXUA 1BPBA 1UVKA 1TV6A 3GDXA 1KQQA 3OYDA 5BN9A 4CE9A 3TJ9A 1WG4A 4QIWD 1Q7YT 3TACB 1A76A 1DTTA 4HI2A 2A6OA 2MKJA 1N60A 3EICA 3KLVA 1TU0B 3AAQA 2ZF5O 5MLCV 2V50A 4WKYA 1DQ9A 1VQLS 2YB1A 2G5HB 3PR4A 1UFWA 3WQTA 1K0VA 3VQTA 1JALA 2NRRA 3FCHA 3NVVA 4QZCA 4KH4A 2M4MA 4XRHA 2W42A 2WSEC 1WWHA 2RILA 4I68A 3VGLA 2HBYB 2XQCA 3P5TL 1QAXA 1KC8O 2D5RA 2GAHC 4DX6A 5GVQA 3QFWA 5GMDA 2AP6A 1VSJA 2J8SA 2Y0SD 1W0HA 3PW4A 2RKIB 3PTWA 1T3OA 4KSEB 2DB1A 1IVZA 1YQHA 1LOTB 1SJ4P 2IRUA 4QYZK 2BZFA 3I9V9 2RRAA 2DGTA 4UOGA 3ZZYA 4U95A 5EE0A 1PZNA 5BOMA 4QJVA 3ZTSA 2J9EA 2YNHB 2E1FA 3PW0A 3OHBA 2A10A 1CI4A 4M7XA 3OPXA 1GXTA 3CJ3A 1YITN 2QZ8A 4WK3A 3HILA 4DR2J 4QAGA 1KFTA 3CF5Q 5AM3A 2HFUA 1JXLA 1DBDA 1EIYB 1NGBA 3I28A 4CIGA 4RPYA 4EYIB 1PGZA 1V9OA 3NDKA 1NGJA 3MMCA 3GR0A 3I56S 2QLTA 2QJ3A 5G0RA 3P6YC 5I42A 4QJFB 5HL7L 3D0IE 3WX4A 3ZETB 4URGA 3G6YA 4NASA 4EO8A 3OV7A 1OKJA 4PJ0U 2OD4A 4B3OB 5LSOA 5F8LA 3QIOA 4Z4IA 3L3FX 3ITHB 4O23A 1FDDA 1ZQBA 1NK9A 1L7OA 7FD1A 1Z05A 2DHXA 3SCJE 1VQ7N 2C3YA 2XRIA 1VQ6N 3WNGA 1SAZA 3MUMP 2J9DE 4QWDA 1Z4NA 4TY8B 3NTUA 4IOBA 3GG1A 4RQ5A 5GAEU 4CHYA 4YR3A 1ZQGA 3NAHA 1CJVA 2YVSA 3Q8RB 1FK9A 2KFZA 5ALWA 3MMBB 1YAGA 1KS2A 3B8HA 4HHJA 4DPUA 3QMQA 3AM9A 3J80U 4YMEA 1N5SA 2W54A 2F9JA 4FYXB 1F2HA 3WX8A 4J2BA 4TLQA 1RSCA 4KB7A 4FWQA 1HHQA 2YKNB 2X6SA 2KZZA 2YWEA 2XMAA 4MK7A 1LKYA 2PI5A 2VYPA 4GMJB 3VESA 5CR0A 3POTA 2R18A 2HHQA 2M9NA 2G8HA 1Z1BA 4CF9A 4KLQA 3QT5A 1QLNA 1FE4A 1W7AA 3JPPA 3ISNC 4GKJK 1HQUA 2DHGA 2RE1A 1CJUB 4MH8A 2MB0B 1TKXB 2RQKA 4ERDA 3HSZA 1YTAA 2ZC4A 3FAHA 1SC1B 1XNRK 4FS1A 1B99A 1UT8A 3G86A 2MQ8A 3DXKA 1IKYA 3P49B 3MM7A 4CFCA 1RT4A 2P6SA 1HKBA 3SFGA 3RR7A 2XYPB 1TUWA 2K1RA 2FC8A 5AR0A 2E1EA 1K73T 5J0WA 4HVJA 2LKYA 2AYBA 1YBTA 1L3SA 2UUBJ 3PX0A 4FKXA 2Z30B 1IQZA 3M3ZA 2OWOA 3TQEA 2Q66A 1YVFA 2R7UA 2LM4A 3C7NA 3ZSOA 4M94A 2W6KA 3L7OA 3ZZRA 4B9SA 2V2ZA 2J6TA 1B70B 4C4TA 2V6AA 4H0YB 1ILYA 1TV9A 2E9RX 4DFJA 2ZZNA 3AXMA 5K5MA 4Y2AA 4P2SA 4MEYA 3GU0A 1ACMB 3VAKA 1WSEA 2W9AA 4JI6K 1NSQA 1RA6A 2CPZA 2NRTA 3D2FA 4BRKA 2LYAA 1L7PA 4QR1A 1N61A 1MN8A 3B0XA 3KD3A 1R31A 2HVEA 5I3UB 3RTVA 1WDDA 4NXMJ 4BRCA 1W7WA 4M9HA 1QVFR 4F0MA 4UW9A 5IWAK 3CULA 2RHSB 3SQ0A 3CO0P 1XNRF 1HEKA 1OIAA 3IS9B 4I2QA 3EKUA 1T02A 1JLQB 3LM9A 4J9VA 1CUKA 1KL9A 2XLJA 3Q8UA 3FEYB 1BQNA 4LIRA 2KICA 3DWLA 3L2QA 4YUDA 1WC6A 5ALOA 4BUGA 3AVHA 2KLAA 3H3OB 4DBQA 3DHWC 2G8IA 3UDCA 2A5XA 1FTCA 4WE1B 2QSFA 1B3TA 3BBCA 4WQ4A 1X42A 2HOQA 1LWFB 3JSRA 4N5SA 3IA0A 1S6PB 4BG8A 1RBRA 1RT2A 2LYHA 4Q43A 5KT4A 2E5LK 3BS5A 1Y7PA 4EU0A 1I3OB 3CCLS 1WAJA 4CZJA 2VFUA 4KAZA 3G6ES 4I6MA 2HIYA 4BWMA 2GLEA 2OPPA 3J81U 3MPUB 2ROPA 4B1WB 2H3VA 2UV8G 4QWCA 5CCMA 2JGAA 2Z1IA 3PNIA 2CPFA 1RWPB 2QLJB 2YNGA 1HL6A 5AXLA 4QS7A 2MQMA 5J2MB 2OTLS 3JTPA 3N7SC 3TWHA 1RG6A 2IYGA 1SL2A 3B4MA 4ZPCA 2R8IA 2GVZB 1BGXT 4Z4HA 9ICEA 3V5RA 2V7YA 2K4HA 4JS4A 3SPYA 2DHAA 3IO1A 2IYIA 1C6VA 3AGRA 1EZZB 3GLJA 4C0BA 3MMVA 5B0DA 3DLLL 2VOPA 5M1PA 5A8RA 2FZKB 3WK9A 1UJ5A 2E5LF 1OO0B 4X4OA 3H1QA 5E79U 2CNKB 1SUQB 2BEFA 3MDQA 4BE2A 3RR8A 3MECA 5ALRA 2P9IB 4DTRA 2VCPA 1AQ6A 2G1HA 3AVIA 5J1EA 3LL3A 8ICYA 2LQ8A 4ANEA 3M8ZA 2LMIA 2DYAA 1BCOA 3ZDEA 2OPQA 3JTOA 2UXCF 1O8BA 3QZ7A 1YJTA 3OJSA 1UL3A 2A1JB 3PSTA 1GOBA 1HPZA 3ZT3A 3QNOA 5HMXA 4QIGA 3W2VA 1ZD4A 2M3DA 2BCRA 2W43A 5KFYA 2LECA 2ZGZA 3OYLA 2H54B 4RBTA 4X84A 1KVJA 3SQGA 2UYTA 3KHHA 3ZSRA 3KD1E 7AT1B 3UCZP 1X4FA 2IVFB 4EHTA 1Q16B 2G4BA 5CR4A 4ICAA 1U8WA 3NS5A 4YHHJ 1MWKA 3Q8SB 4BC4A 4BX9C 2Q3SA 1Q3VA 4DX5A 3UD4P 5AK6A 5ALMA 2BCQA 1CLFA 2KKVA 1TL4A 2RDIA 3AY0A 2HAFA 4CH0S 4YY3K 1NK5A 4K43A 5EN1A 4H54A 2O8BA 3KK7A 5KFXA 4NB4A 2QKQA 4QZFA 4IO1A 4OZNA 2AWZA 1EETB 3OL7A 3HOTA 4ED7A 2CJ9A 1FKPA 4PXCA 5J0PA 1RAGB 1LB2B 5GAHI 4K4ZA 4H0PA 2W41A 4UB1A 2YX4A 3HCXA 3I31A 3MX2A 1HYVA 3NGKA 4B9VA 3FKBA 2CH5A 4LF9F 5BN8A 1JJ2R 1VIOA 1Z1ZA 2M9KA 2IVYA 2MAXA 4E7IA 3CJ5A 3LP0A 1U2VB 3L2RA 1X4BA 3V6DA 2ASYA 1S6UA 5B08A 3J81j 3MOZA 1TKDA 2HLUA 5ALUA 2Z2ZA 3MEGA 2DFFA 2CPJA 2JWNA 3D2EB 4A8YA 2CGKA 2E2PA 1FX2A 4P73A 4Y3CA 1Q7YO 4ER8A 2HMIA 3OD2A 4B6JA 4Y2PA 4YY3F 4BS2A 4DV2J 1GNKA 2JEFA 4K50A 5IQQA 4QZEA 1Y5IB 2MUTB 1WKKA 3ZTOA 4NOHA 4ANDA 3MDCA 2WVFA 2EBGA 4LY7A 4F4ZA 3R1XA 2XZTB 2QYGA 4K8RA 2JEIA 4ZPBA 3JS6A 4Z2XA 4E0DA 1FRKA 3NL0A 3NMAA 1XC3A 1RT7B 5AQMA 2JVOA 5TISU 4HHHA 5D8HB 4DG1A 3N6NA 4KMUA 4OGCA 1R3NA 3RMBA 4YMNA 3PEHA 3OR1A 4ZIWA 3TPQA 4QZ9A 4R0JA 4FXDA 2ALYB 2NRXA 3VMFB 3JSMB 3F53A 4FZVA 4USUA 3PMLA 4IXCA 2B0GA 7ICKA 1L3TA 2QX0A 3T1YJ 2G2YA 2DCLA 3QO9A 5FLXY 2GO7A 1F5CA 1M5OC 3O6QA 1T9WA 3KDOA 3KKAA 5F41A 3IG1A 2RDDA 3I4PA 3IRWP 4CZFA 4CJRA 3ZCMA 3KUGA 3M8PB 1HBUB 3LDAA 4V19X 1VFJA 3CFOA 3HSTB 4OJ1A 1OJ4A 2ZXIA 4PXEA 4FO6A 4IQXA 1JLAB 3W7BA 1IG8A 5DDOC 5CRXA 2F65A 3NFAA 4E3SA 2PFNA 1ASUA 4I28A 4H5NA 5KG1A 2QMUB 5DB7A 1ZETA 1ZQRA 1AW0A 5J2PA 4NA3A 1FRHA 3CJ1A 2VWJA 2VFSA 3IRXB 3TARA 1VSFA 1SJRA 1IKVB 4JI8F 4Z37A 3DRPA 3O4QA 3N5FA 1S1WB 3DOMB 4BVPA 4DFPA 3ISND 2LVWA 5J2NB 1ZQWA 1ZQNA 3QEWA 2JDJA 2WVCA 4Z6FA 5GTIU 3PHTA 3IR6B 4E19A 4G6VB 2B9XA 3VTHA 5CYQB 5D49A 4H4OA 4CESA 3CCVN 1NK4A 2JMGA 4RW7B 3RJFA 4MYUA 2DR7A 2YX7A 1U2CA 1RWUA 3KNAA 2R7VA 1NHKL 3FR0A 4FVUA 4ZOHC 2QI2A 1K73O 2HG4A 5F3TA 4F91B 4J7CA 5EXWA 1T95A 3NNCA 3IBFB 5ALGA 2E8PA 3T41A 1UCVA 3IDHA 5DLGA 4IOXA 1NGEA 3MR3A 3T6JA 4DV5K 2HHSA 4CNQA 1BI4A 2PSZA 2BANB 3QUTA 1NO8A 4E1NA 2GQQA 4HDGA 4HR2A 3WHIA 3B82A 1R89A 1NJIT 4TURA 3B4DA 4Y28C 1FDNA 1HIYA 2HYIB 5J8YA 2W2PP 1KQSR 1HFEL 5LJWA 9ICWA 5KFOA 2DXFA 2C3MA 2WF6A 4ALZA 1J54A 4DCHA 4M41A 3LP3A 3QEAZ 3HM8A 1RPLA 4F4AA 1EP4B 3HJVA 4YDUA 4DI6A 2ZUGA 4QOZB 1ITPA 2AGOA 5CHCB 3Q22A 2GQ2A 8ICXA 2ZJRQ 1PAEX 3MF5A 1RTIA 5J2QA 2QMWA 3I0RA 3FZKA 1WHXA 3DLKA 4I2EA 2HFSA 1S0VA 1GO3F 3NRZA 4F72A 1HKCA 3CJQA 4OJRA 3ONQA 5RUBA 3C14A 4YVZA 3PSPA 3GCWP 1FESA 1U1PA 4OI3A 3QAEA 4RQ3A 4FJXA 1WSVA 1O0PA 1FJEB 4FJHA 3SBGA 1KLMA 4F02A 4MKYA 4NWIA 4ECYA 1GLEG 3PXGa 4KLLA 3TADA 2AW0A 4EHUA 1JN3A 3ZYYX 3OSNA 3H25A 4FO0A 2RRBA 3AV9A 2IM1A 3R5GA 3MCOA 3OFHA 3MPDA 5K8OA 1KW4A 5FRNA 1VLOA 4PY5A 3A3NB 4JI2J 3D6JA 1PSDA 4OYOA 1C1BB 4CERA 4QWAA 4DQ8A 4F5OA 4NYFA 3K0SA 4F93B 4A8OA 4KRFA 3D2NA 5AKJA 2ERRA 2J6SA 2GELA 3KHLA 1SVDA 1LQ9A 1XO0A 4OV6A 4RW4B 1KQKA 3Q0AA 1GXLA 4FJ7A 2HBQB 4IYQA 4NRUA 3LDNA 4Q2MA 3IC1A 2B9YA 2I1RA 4WP3A 1U7LA 4F4XA 3GR1A 5J0RA 2WFBA 4FWMA 1N63A 2XZDB 3NWGA 5EX0A 2HZVA 2CZ4A 5J0UA 3EVMA 1LWEB 4FZLA 2PC6A 3DOKA 2NXUA 1TMJA 4AL5A 5AK4A 3VGTA 3PSFA 4FOIA 5B8HA 4J9KA 3FK4A 3NKYA 4B1UB 1M5HA 3M32B 1EARA 4M5DA 2ZH3A 2BCSA 3HULA 2WHEA 3M2UA 2EZXA 2IRYA 2YHYA 1G4CA 5ALNA 1U0SA 1I5OB 3EY1A 4F3TA 3J7A1 1VAZA 1C0UA 1VRQC 3F5EA 2P9UA 2BE2A 3SQ1A 3HSDA 4JKCA 9ICLA 1FWLA 2UP1A 2VA8A 4DSEA 2XG8A 1O13A 3CJ7A 4L3NA 1ATRA 4KV8B 4BGDA 1UETA 3SSQA 5EE3A 2UUAK 4M9JA 1ZQOA 1RBLA 3EUNA 3R1HA 2IPOB 2ZTEA 1Z3EB 4NJ8A 4L3QA 3DLGA 4FWOA 5HQLA 2QLWA 4BC2A 1QE1A 5AQLA 4US9A 3RH5A 4X4UA 2DRDA 3QU7A 3FZLA 2FDRA 3ZX2A 1NOMA 2E3TA 4BXOA 1LAWA 2B5JB 5IIKA 4DL6A 3K5OA 2F4VK 4I6WA 3K8WA 4YG2A 4GVBB 2QYCA 4USTA 3OYAA 2P2CB 5AQSA 2ISPA 4NYNA 3OFEA 3QJPA 7ICUA 5J2GA 3WKBA 3AVFA 2GIRA 1N33K 3HO1A 4X62K 2P6RA 4I4BA 2KYZA 1ZOLA 1SIZA 4DV3J 3D0GE 5K14B 1IBMK 5K8NA 1YVUA 4IEIA 3I5AA 1WJ9A 3ALRA 4OZ2A 1H2TZ 3CCSN 4DOAA 4OL8A 3AA9A 2RS8A 1Q1KA 1T05A 4DCPB 2ZJQL 2ROGA 4DPOA 2EI5A 4A61A 2UXDF 1HYZA 2HURA 2E29A 4ZHRA 4NLZA 3V1OA 2MQOA 3SR6A 2CJQA 1ZJNA 2RQ4A 2J9DA 3NVZA 5JMNA 1TL3B 5JVGQ 3KWGA 3E1YA 5DDPC 3TJAA 2R7QA 2DRAA 4OO1J 4ED1A 3B8AX 2DIUA 2PYLA 2F4VF 3GIIA 2P66A 2FC9A 1U04A 4AHRA 4E7KA 4FK4A 1OXJA 1WEZA 4Y34A 3R3TA 1QVFM 5JICA 3DM2B 1C7YA 3TFRA 5BPCA 2FZCB 2N3OA 5BRHA 3HFKA 1Y0HA 1VK8A 5KFDA 1HR0K 1N33F 3OHRA 2ILZA 3PYGA 3AA4A 4AQYJ 5ETQA 1U45A 1ZXIA 4PAAA 3VERA 2DXDA 4KITB 2WBNA 1XQSC 2NRVA 3UW1A 3NCPA 4DTJA 4JI0K 5SUHA 1VQOS 5IOLA 4KLHA 4C98A 4JHDA 2VG7A 3AGKA 3ISZA 4OPJA 4HWIA 5CHGA 1A6LA 4IG0A 2Y0SF 2E1MC 2RF2A 1Q9YA 3GZFA 4GNIA 2UVUA 2C1EB 2BJDA 2KHCA 1WSJA 3NE6A 4MO5A 1TR0A 1TZ0A 5A2QU 2E20A 2NZ4A 2VKQA 2V0NA 5M1FA 1O6XA 2NQPA 3CI5A 1FFWB 5HLFB 3V1RA 1VQKN 4ECZA 3MR2A 1HR0F 3I55S 3T1HJ 4RW6B 5F8IA 2CNLB 1LXJA 3M8SA 2ZUDA 3PIOQ 2B9WA 3SAHA 4AILC 4WU2A 1KD1O 4ZK7M 2EKYA 3UN3A 2AZ1A 3SIPB 4K0KJ 1FJGF 4J2DA 3MAAA 1FRMA 2P9KA 2XNRA 3V9ZA 1WI6A 3UE5A 2VJVA 3N5BA 3R6MA 3VENA 2MEWA 1FKOB 2ZDOA 3OUYB 3ENBA 4B3TJ 4FPBA 2H5EA 3LPUA 2LXIA 8ICBA 1YKWA 3H40A 4W98A 3ID6A 2LCWA 1RAFB 2FJDB 3VTIA 3BS9A 1OQ6A 5ALDA 4N8OA 5T41A 5F3XB 4X66J 4OYZA 4JI5F 3GV8B 7ICFA 2KK0A 2B51A 2I6WA 1MW7A 1APSA 4BRQA 2XWXA 3M2VB 2BABA 2NCKL 1R0BG 2EKNA 1V5VA 3MM5B 4WFAQ 5F8HA 4LFCF 5AQQA 2JVRA 2Q6BA 6FD1A 4GV3A 2MRLA 3Q8PB 2XNQA 1RBOB 4KO0A 3CC4N 2FGCA 4G1PA 1KN6A 4KPCA 2CDQA 1SV5B 2HQIA 3MMAA 2JH3A 3BH6B 2WAQD 4AFFA 5IV3A 1Q81T 3D7EO 3N7RC 1ZQUA 2WUSA 2ZH6A 4HVZA 4KT0C 2F8KA 2DUYA 2N3LA 3T5LA 3BN4A 4M3UA 2VIXA 4UAYA 3VCBA 2J0XA 2C22A 1E4FT 4DSLA 4XK8C 5DM6Q 1T0TV 2AHOB 1DURA 4LH4A 3FFKB 5C0YA 3IN5A 5J0QA 3MN9A 2RS2A 3G82B 3IAM9 3H7HB 1OVYA 3BSOA 2BV3A 2OI2A 2EANA 2WB4A 4WFYA 5IM0A 2HMPA 1Q5VA 5LT5A 3VA0A 2J7UA 1XI1A 2RQMA 4DSKA 1VQ9N 3S6JA 4HUFA 2QK9A 4RW9A 4PHTX 2P51A 1JJ2M 4KH5A 4OI6A 4CFDA 3N0VA 3JSBA 4FJ5A 1G7CB 3QNNA 1RBUA 1RDBA 2BDUA 3HSJA 3MI7X 4ZPVR 5M2PA 4Y00A 4CD3A 1FXDA 3SI8A 2YNFA 4W5QA 2HHXA 3KLFB 3CC7N 4C7YA 1MSWD 4DR3F 1NMEB 4B3SF 3VQAA 4P9SA 2G13A 4DU7A 3A8JA 3KJVA 2AX1A 3V81A 1M5SA 1ZQTA 2EK6A 2XMWA 3SEOA 3QSIA 3SMPA 5A8WB 4CBWA 4PCQA 3AL0B 2ZEJA 1JCGA 2MY7A 4P0QB 2HLTA 1GMWA 2IVPA 1DK3A 3DLJA 3JPTA 5CXTA 3PW7A 1HNIA 4FJNA 4KI6A 4CM2A 5AI0A 1E3MA 4DFDA 4AP9A 5BOLA 2ROEA 5L1JA 5AKXA 2KO1A 1BPYA 1H0HB 3D6FB 3HYFA 2OM6A 1RHJB 7ICGA 4B17A 1N34J 2KT3A 2W6LA 1C0FA 3O4NA 3TQ1A 4OJOA 1C2PA 2W4DA 2I7PA 2CZ9A 2DEIA 1NXIA 4GVLA 1PO6A 1SXDA 1ZQLA 2A41A 3RRGA 1U1KA 2V67A 3C8YA 3O44A 1IBKJ 3R97A 1HBNA 1GH8A 4USWA 2AJ2A 2QMXA 3AVBA 2LEAA 4N77A 3LPTA 4WF9Q 1MMDA 2VG6A 3OTOK 1X2IA 3QIDA 4NL9C 4J9UE 2YNIB 3ZD9A 5KT7A 2V4QA 3L7UA 4WTOB 3OYHA 1WI8A 2HWIA 3AVJA 1NU0A 2MJNA 2JX2A 4CO3A 2XS5A 4RJVA 2OPRA 4WYWA 4WQ5C 3PHEA 2PFOA 2W55A 3KK2B 3MDAA 3KHYA 4R63A 3LAMA 4O3OA 4H0XB 1VSIA 1ZS6A 3M6KA 3Q8QB 2W25A 2SXLA 3WXMB 2F8LA 2HOIA 2NRHA 2HHTA 4BDYA 3CJKB 3WNEA 4L72B 3ENQA 1LW2B 4YNQA 3DLEA 4CCHA 1MMNA 3MX5A 4CO1A 4KX3A 3E0FA 1UKUA 3NY0A 3A12A 5GAGU 1N0UA 3VF2A 4FZXC 3ZZUA 2VFTA 4JV5J 5KFTA 3C28A 4EENA 2XHWA 3KG1A 3ZZZA 4DR7J 5AQVA 2R8GA 2R42A 5KQ8A 5J1PA 1QQCA 2QWNA 4FVMA 5J1NA 2Q0UA 3OTOF 3EE8A 1VRTB 4EZ6A 4CH1A 1S57A 3MCNA 2KVIA 4B8CA 2CPHA 3F73A 4NXZA 1BE4A 3KLIA 2JLGA 4ES1A 1WB9A 1J97A 1HPMA 1XHZA 4AM6A 1MU2B 5IIIA 4X2BA 3CCRN 1QAIA 4DV0F 4MTPA 2CN1A 4E7HA 3CJTA 3KUHA 1TFWA 1YK9A 4DZDA 1Y64A 1YGYA 5AKZA 4Z4GA 3THWB 5AQYA 1HI8A 4DV4J 4CHZA 4WFBL 2OKQA 3ATVA 2CFXA 4MAKA 1B9FA 2QA4N 4OI4A 5HMMA 2OP5A 3TAPA 4G65A 1TYQB 3HHLC 1N8RO 1HI1A 4KQZA 4XAKA 3HHNB 3B6PA 2KVSA 1RT1B 4AUKA 3ILLA 4DU1A 4UB5A 2RDJA 4ZKAA 3N28A 3IG5A 2BOPA 4KR0B 4K41A 4ED0A 4CHOA 5GINA 1YJUA 2KVCA 3K0JA 1GFWB 3EPGA 5GAEP 4ZN3A 3C15B 2EFQA 2FBVA 4UF4A 1TV6B 2WW4A 4KLUA 3I33A 3KZBA 2WFAA 4TQSA 4LBIA 1EJ7L 2I1QA 1HQEA 2A18A 5KPZA 3KWMA 3KK1B 3M30A 2NO5A 4ZCLA 4HCCA 3ASMA 4NCGA 1DTTB 4OZ1A 1N32J 5D78A 4OX9J 3AO1A 2OCEA 1Q78A 3PKYA 3H8MA 2QEXS 4C4RA 2EEYA 5EE9A 1KQSM 2KQ2A 5BRDA 2G8VA 4PG4A 2PFQA 3OS0A 4WZMA 4I9LA 2OAUA 2Q4TA 5KFNA 2G5IB 4HUGA 4LFBF 3HTVA 2ZBPA 5AI6A 4QU7A 1VQ5S 3PO4A 3N01A 2CPEA 4A8FA 2HBRB 4DFMA 2UV8A 4I9QA 1U1RA 4QZVB 5FRMA 2V69A 2M8HA 3L4PA 4ID8A 1R0AB 5KFMA 2KXFA 3I82A 5ALZA 2ADBA 5CY4A 4C3LA 4A48A 1QQOA 4RW8B 2AYEA 4IZ9A 4CJFA 5H1SV 2Q0ZX 2B6GA 3U9ZA 4DTMA 1JXEA 3S01A 2PI4A 3R6GB 1QSLA 3NH1A 3M1YA 2OEHA 2XSFA 4O4GB 3M8QA 4NWBA 5C10A 3PG9A 1UVIA 3GILA 5C25A 4NL5A 2VASA 4H0OA 9ICBA 2MYFA 5AKYA 2IIHA 4JB8B 4J9NA 3KKSA 3I0SB 4IQMA 3MMCB 5C2FA 3TOQA 1VDHA 4Q8EA 5GMKa 4BREA 1LWCB 4UUWA 3FFIA 3MZIA 1RXVA 2H3FA 2PDAA 3TAMB 4DU4A 1IG9A 3ZLJA 2ZOGA 4CEBA 4NRTA 1X9WA 4EBDA 2Q97A 4A8QA 3HPGA 4N7TA 4IOAL 4M5LA 3VGVA 5BR8K 1VDVA 2DNNA 3GIMA 2HRTA 1GOAA 2GOLA 4RU9A 1H38A 1JKHA 2N7YA 1UPMB 5IT9Y 1ZA2B 4O0IA 2HQDA 1YVNA 1RHRB 4ID1A 2DPNA 4E1MA 1FK9B 1JXVA 4DV2K 4LF6K 4EP5A 4FBTA 2NXCA 5AKIA 3UQSA 4B3RF 1NK8A 1XMBA 3TAFA 4TN2A 4OD0A 4U67Q 1OSDA 4M9LA 1N54B 1NLKL 2ZHBA 2DT9A 1GLDG 3OYIA 3H0LB 4IDHA 3AODA 4FYWB 4DUYK 3V72A 1RDAA 1SH0A 8AT1B 3WXKA 4N56A 2PN6A 2IA6A 4G9BA 1RHUB 2R7XA 3FM9A 5HMWA 4AH9A 1URNA 1JJ4A 2NREA 1N36K 1NZAA 1A9NB 1N5YA 4AE5A 1T4GA 4M45A 3VEWA 4G3IA 9ICVA 5DM7L 2FQQB 5BR8F 2HFZA 2ZE2A 3H5XA 2K1RB 3MD3A 3AO5A 1Q81O 2A1RA 2BCVA 1NH8A 5C15A 3FBFA 5AKKA 5LMNJ 4FM2A 3T1YK 7ICVA 5KQDA 3H46O 3NG8A 4LF6F 3CQYA 1S48A 2Z8QA 1LKZA 2WF7A 4DPXA 3HXMA 1H2UX 2ASJA 2K60A 4Y2SA 3P96A 3EDRB 2FI1A 2BHNA 4NCAA 5CA7A 3HL8A 4JKAA 4FJJA 2KN7A 1CC8A 3DYAA 4DR6J 4DTSA 5C7PA 2C3PA 1RGVA 4I67A 3GE1A 4CYUA 1NWKA 3A0BU 4DUYF 3ZZ0A 4K25A 2E5SA 3MM6A 3M1FA 4WU3A 2AF6A 1HJOA 2WTUA 5EY4A 2RUGA 5HSPA 4BC3A 1CZAN 4I2QB 2P9NA 2R3VA 1WWVA 2E1AA 2I8EA 1K8KA 3M6ZA 2OYQA 2MQLA 4KHSA 3MOJB 2D4WA 4KRWA 2QWMA 1BQNB 4Y6IA 5GADI 2K8AA 2FPLA 3H42A 2ZD1A 3L2VA 2QG9B 2OTJS 1FRXA 2LQJA 4EGLA 2QXFA 2MKIA 4ZA1A 2IOFK 4DL3A 5EUHA 2BKPA 2GVDA 2E7WA 3N4PA 2E1RA 1RT2B 2ASMA 3AA8A 3C0BA 2BM1A 2XYGB 2GBZA 3K2PA 4R79A 4PWUA 1VHXA 2C2EA 5B5EU 2OEMA 5HI7A 4I6MB 4YFUA 4H4KC 5E3PA 1QQ6A 1F5SA 2OPPB 2FF3B 4GC7A 2KKZA 3VEYA 2EG2A 4IFVA 7ICLA 4O3RA 1X31C 3ETMA 4DR1K 4PWDA 2W2OP 2J7WA 9ICXA 4R5PA 1OS5A 1K1SA 1BHNA 3S3OA 3VN5A 4C3MA 3R8YA 2VWKA 4HT7A 3LDQA 2BRLA 4LR9A 2QB1A 2GJIA 2ZGYA 3QBWA 1EKSA 1RDUA 4OV1A 3DLHA 4EFHA 2PAVA 1S99A 4M5HA 1OMSA 1JJCB 4KIAA 3CDBA 3PV8A 4KHRA 3TAGA 3T19A 2KHDA 3K8VA 3GYXB 4HTIA 4OHZA 4CHNA 1B7YB 2CADA 3S8SA 3N4QA 3D0HE 5A8RB 4CI6A 2EH9A 4CEDA 1V85A 1JLCA 3GL1A 3SCXA 3FNNA 1EXQA 4KTQA 3SJJA 4CIEA 1U8SA 3IMXA 4CIFA 5KFUA 2V34A 3IXQA 9ICHA 3MDFA 5D77A 4N41A 1D5AA 1KONA 3E9LA 4U7CA 3CQXA 2OPQB 3UNYA 4JN4A 5CD4A 5DBCA 5FDLA 4GO5X 2ZKUA 2E1YA 5BPLA 2FVPA 3J7YI 3CCQS 2GMHA 1FXXA 4P75A 2HB5A 1RXWA 4DSIA 2CZVC 4HUEA 3OHAA 1REVA 2JFKA 4J9MA 3NGDA 2YCHA 4NE9C 1LVHA 2ZJ5A 2GJ2A 4IH5A 2ZIXA 3KWIA 3D6RA 4IKAA 1D8ZA 1X5OA 4FDFA 4YDDB 2PMZD 2E5HA 2PFPA 3TO8A 1BHLA 1RTHA 4C8YA 1JLBA 2CKWA 3CJAA 5EWGA 1Z1VA 4QZ8A 2ZM6F 3ALYA 3U02A 4IQTA 4ETZA 4AHSA 3RBZA 3WQPA 1RHMB 4I69A 2VQEK 2JLFA 2NLXA 3HDSA 1NM1A 2O8BB 1D1UA 2D3OR 2ESEA 2G08A 1M1KT 1UEUA 4IH7A 1VQPN 2AEJA 3DDHA 4X65K 2Z7JA 4TQRA 3KLGB 2QB0B 1Y11A 4WFZA 2AEMA 2QL7B 5I3PA 1JRPA 4UQTA 2CG8A 2JZBA 3G25A 5AT1B 1FFVA 5HP4A 3WIUA 3OS2A 4KBIA 3DXMA 3K5NA 1GTHA 1YJNS 5ELZA 1MA9B 2P9LA 4O3SA 2YMMA 2DNGA 1ZQYA 5AFUA 3H8YA 1M1GA 2Z2MA 3RRHA 4CF8A 2DBYA 4O5FA 4OJ6A 1DARA 2PFDA 3J7YP 2OHFA 1T8EA 1PBAA 1SI9A 3IR7B 3U1MA 1C4CA 2GGPA 2GEMA 1RXOB 5HBMA 1SS6A 2QWLA 3F5TA 3BF4A 3FVYA 3RB6A 2CQ4A 3GFHA 1XNRJ 1TUYA 4X65F 1Y5LB 1HNWK 3QICA 2M2BA 3NCQA 1OH6A 1ZQKA 2VONA 2E88A 5J2AA 3O3FA 3GZ7A 1QQNA 5KAFU 1NZBA 2HZCA 3W9IA 1QS4A 2G8UA 2LDYA 8ICEA 2HPUA 3NF6A 1HLUA 2F8MA 1RABB 2MHEA 5DG9A 1Q9XA 2KZMA 4DG1B 1IQTA 3OR1B 1NOZA 1C1CA 1YI2N 5T7LB 3ZZOA 4IS7A 2I6XA 1CSJA 4M0AA 4GMKA 3QT6A 4PWWA 4CLLA 2K3IA 2W9BB 3TEGA 3AU6A 2Q43A 5E2QA 3J80O 1V3RA 2XTJP 4J9OA 4XDDA 4TUPA 5IWAJ 3A8KA 3M7DA 1ZYQA 3KFWX 4LREA 4BRIA 3VAJA 5AJ3F 3HWTA 2CUYA 3OPKA 1G99A 3NP5A 4RUAA 5C5JA 1HNWF 2V8GA 2BM0A 2DGZA 4JKFA 4ILLA 1DTQA 5HQMA 2VQFK 1EQYA 2A3VA 5CJ7A 5BRFA 1ZD5A 1X4AA 2OIHA 4CJLA 1NPKA 2WF5A 2KV2A 7ICNA 4FK2A 5DDQC 1CZ9A 1RT6B 3H20A 4IQWA 2XC9A 4CLYA 2B8QA 2CIMA 3MD1A 3CW2C 5J2PB 1OWXA 2OEJA 3L0QA 3BV8A 1RT3A 2F1HA 3RU0A 3DJCA 5M1QA 2E5LJ 4O8UA 2GIFA 3JPRA 3M6UA 1VSDA 2KRRA 1YITS 3NOGA 3DRPB 3VA3A 2XY7A 3M8WA 5L39A 1FD2A 5A6WA 1UOCA 2O8EB 5ALYA 4C7ZA 2RVJA 4RQ0A 1HJPA 3VGMA 1FDBA 4ICLA 5D0RA 4BE1A 3SMZA 1YBUA 4Y2CA 3EZ5A 5HANA 3UPFA 3RW7A 3HT0A 1FHTA 2VPWB 5CYMA 2UXCJ 3SCLE 4H4OB 1GEHA 5GAHU 4N47A 4KE5A 3IWXA 3OXGA 2V8VA 4TYAA 2OFHX 2VQFF 4OLAA 4RUCA 3DOLB 2HFVA 1VQ7S 4F4WA 5CD4H 3D2SA 1VQ6S 1S9FA 1GLCG 8ICRA 2U2FA 1N6QA 1TKZA 3MGJA 1NK7A 2WAQF 3I4HX 3K7RA 4CLWA 1RWNB 3FSXA 4Q8FA 3T1HK 3P1GA 1XTZA 3VVTA 2GMLA 1BNPA 4NYPA 3HZ6A 4FJ9A 3WXLA 4YOXA 3IAYA 5E3AA 4MDAA 2QLBB 2FMSA 5B0FA 4FYDA 1BI4B 2WMMA 2KM8B 2HVHA 4YMOA 2E66A 1HLWA 1NDLA 1B22A 3QYPA 2I9SA 2IAJA 2ISOA 5B0EA 2E8NA 4OKEA 4M1KA 2AZ3A 3L4IA 3J81O 1E4GT 2NYHA 8RUCA 2VPYB 3BY5A 2BYCA 1ZQJA 2B8PA 1FO4A 3D67A 2RE2A 4UY85 4M47A 3WK7A 3SSSA 5AI8A 3K5MA 1VBZA 2AJQA 3BGOP 1L3UA 4LF9J 4CT9A 1OY8A 4DPTA 1ZTTA 4M3YA 2XULA 5AKHA 1P1TA 3J7Z5 2ZH5A 4PHDA 8ICJA 4KHNA 2IM0A 4GKKK 3QLHA 3VCDA 4NLCA 1RTIB 5J2QB 2D1CA 4P2FA 1TL7A 1U1LA 5CABA 4LF7F 4KH1B 5KGXA 3CJ2A 2YKAA 3OSPA 3C14B 5D15A 4JYAK 4LF5K 2CDRB 4MQ3A 5AFUH 4YY3J 4JKDA 3GFZA 3F56A 1KLMB 1MNEA 3QZ8A 4NEYA 4OYWA 3CXCR 4CF1A 3KDNA 4G9ZA 2FGOA 2OANA 2W2MP 1KLNA 5F8NA 1S97A 3BBBA 4Z6DA 2KM8C 3OBYA 3G4SN 2N82B 1FEZA 2O4IA 3UXNA 4NYZA 3DGPA 4LF2A 2DGUA 3I6PA 2W40A 4ZIVA 4LF4F 1U9LA 3B54A 2W9MA 4AXJA 2VJ4A 2NPIA 2P6TA 5JLFA 3CCZA 1WOSA 1U49A 5ADXA 3SQIA 1WYGA 2B7CB 4HLBA 1VQ4N 5HATA 3W66A 2P9PA 1SJQA 2IJFA 4UW2A 4KB1A 1R7IA 4YOVA 2R7SA 2ZJPQ 4JYAF 5KFAA 4MT1A 2ZH7A 4LF5F 1P1LA 4ZCIA 1TVAA 2VD3A 3LAKA 3HK2A 2DO0A 4FLTA 3AAWB 2K4EA 3TZWA 5EU7A 1I94K 1KXPA 3SMVA 4O55A 1RQLA 5GIPA 1YZ6A 3ET6B 2UU9K 1Y00A 3QT7A 3VQCA 4UY8T 4I2DA 3CMEN 3M2UB 5FROA 3VQQA 1JNRB 1U2FA 2Z4PA 2O8DA 4OI1A 4CM0A 3QUQA 4PZVA 4Z94A 3J7ZT 4OPAA 3G10A 3QFUA 2F44A 3OL6A 9RUBA 3IFRA 5C2GA 8ICPA 2NYIA 2O8CB 3H7IA 4HHTA 1FDAA 2MQPA 1Y4ZB 3DRYA 4LQ3A 4P6QA 1A6SA 1KR4A 1B4SA 1T3NA 3DLGB 2WONB 4A8MP 3D1HA 5D4LA 1QE1B 1IO2A 2DNOA 5JJBA 2P9SA 2E1PA 2R8KA 3MABA 2EZZA 4TUQA 4JI8J 2BE7D 5EWEA 1Z2ZA 2L9WA 1N34K 2QA2A 3IM8A 7ICSA 2CQHA 1J2NA 4RT2A 4ECTA 2V2QA 1RT5A 5HJXA 1I39A 2UU9F 1S1VA 1RBAA 2WOMA 4OHWA 4NLNA 1JUDA 5LXRA 3CT9A 2DNHA 1NBEB 2FDNA 3KMQA 2MGZB 4USHA 4PR6A 3RJJA 2PA3A 4OI0A 5FIIA 4CRXA 1T05B 3OS1A 3GIRA 4C8KA 4OHYA 4FPAA 4DR5K 2BJ8A 1HW9A 4ZPWR 4ZHRB 4JRPA 3QWPA 3S6EA 4PG8A 4BRPA 3WKDA 2YPYA 4ENOA 3C1YA 3SD7A 3MAHA 1N5TA 2BJEA 5KG7A 3ZTRA 1NLVA 3PRDA 1FTRA 3PKMA 5B66U 1XS9D 1QZ6A 2D6FC 5HVHA 1S1XA 3P31A 3U27A 3JAMY 3GP9A 4USIA 1TL1A 3L6QA 1J9AA 3UFCX 3QFPA