3TANA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tanA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tanA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tanA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tanA01
4F4XA 3OS1A 4IRDA 1TK0A 1BIUA 1DOQA 4M9LA 4QAGA 2FLNA 2Y1IA 3PMLA 5L1LA 5D4BA 3L3VA 3GIJA 3VQ6A 4GXIA 3NH2A 2G8UA 4FJGA 4R5PA 8ICYA 2VANA 3HP9A 1RT5A 4ED3A 2NRZA 3TFRA 5J2BA 3IG1A 3AA4A 3S3MA 1WAFA 1WCNA 4N5SA 3VQDA 1T05A 3ZSVA 4M42A 3PX0A 9ICUA 9ICWA 9ICSA 4DF4A 2G8IA 4QZ9A 4O5EA 4PHDA 3MR6A 3UXOA 9ICKA 3ZCMA 4QCLA 5J0RA 2FPLA 3C2LA 4DMNA 1D8YA 3QEIA 2HHXA 2I1QA 2G8HA 9ICTA 4BDZA 5J2MA 3M8RA 7ICPA 2XHBA 4JRPA 3RMAA 8ICTA 1YTAA 4DU3A 7ICVA 4NM1A 2AGQA 3GDXA 2HVIA 4LD0A 2XY8A 4BWJA 3WNEA 4C8LA 4FLZA 4M3RA 2E4LA 2AU0A 3DM2A 4B8AB 1BGXT 4DU1A 3BQ2A 3L8BA 2BANA 3MECA 4I28A 3P1GA 1BI4B 4GC6A 3QZ8A 3P83D 4TQRA 1BPEA 4YR0A 4ED7A 2BPFA 4PUOA 2EHGA 3ZT1A 4DSFA 4YMOA 1L3UA 2OZMA 1CZBA 1X1PA 1C1AA 4H4OA 4IG0A 3KKRA 5E41A 4CGFA 4DSKA 3U3GA 4CGGA 4RQ0A 2JZBB 4H8KA 4I2IA 3T3FA 4DSIA 2IS3A 3C6UA 3TAFA 1ZQVA 4KO0A 3PX4A 2R8KA 2B6AA 3H8JA 1RZTA 3NGIA 4CHZA 1BCOA 4B9UA 3OYMA 1VSJA 4FJIA 4YD1A 1SL0A 3NAEA 3QIPA 4RT2A 5CZ2A 4OKEA 3ISCA 3SQ0A 1W0HA 4RQ7A 3TFSA 1NJYA 5DG8A 4M9NA 2FBXA 1D8LA 3DRRA 4Q5VA 3SQ4A 3SUOA 4KLLA 3C23A 4J9PA 1A5WA 1NKBA 5DB7A 4Z6EA 3O3FA 8ICWA 2ZD1A 3KHHA 5FRMA 1WLJA 1ZJNA 4KN4A 1A5VA 4RQ2A 4F2SA 8ICZA 4QZFA 4O3SA 4FW1A 4F8RA 4JV0A 3SPYA 5J29A 3DLKA 4O4GA 4TUSA 5KFDA 4PGQA 3VQCA 1S1XA 5KG6A 3TQ1A 1CLQA 5KT7A 9ICFA 2O4IA 2H5XA 4EP4A 1ZQOA 4GW6A 3V1RA 2XY7A 3C1YA 4M6WA 2YNFA 4E7JA 5KG0A 4IR1A 3LPTA 3PW5A 5KFWA 4ECXA 3VQEA 5IIKA 2R8JA 1CUKA 4QZ8A 4CJLA 2C22A 3RMDA 2PYLA 3HJFA 2HNZA 1Z25A 4KLDA 1SZPA 4QWEA 3TAQA 2R8IA 4ED2A 1SV5A 1WNSA 1JL2A 3BDPA 4YFUA 1TGOA 1EETA 4FJ8A 5C24A 5DDMA 1KSPA 4M04A 1HUOA 4DTRA 4EBCA 1YT3A 3SYZA 2YNIA 4AHCA 3V4IA 3MBYA 2IBKA 4DWIA 4IRKA 4RPYA 1IKWA 8ICHA 2W42A 4K8ZA 2KFZA 4KB1A 4F4KA 3TANA 1HYZA 4B9NA 3KLHA 5HROA 3VQ8A 4KLHA 2V4QA 4F3TA 2ITGA 3V1QA 2HMIA 4KRFA 3CM6A 1JLGA 3OYIA 3AO5A 1S77D 4RW8A 4UB5A 3AO1A 4CGHA 4BDYA 1JL1A 3GILA 5EWGA 5J0UA 3AVIA 3JPSA 2FC0A 4E1NA 3L2QA 3GV5B 5JS2A 5KFUA 1QE1A 1LWCA 3VA3A 8ICJA 2HHUA 3HPOA 1HYVA 4DOCA 1QSYA 1ZBUA 2RDIA 1ZQHA 3K58A 2VG6A 2A1JB 1C0UA 2PFOA 4KLFA 3LK9A 5KFCA 4EZ9A 8ICPA 1U47A 1XO1A 3AVGA 2M9NA 3H4DA 1XC9A 4JS4A 4DL3A 5IILA 1ZQFA 1T8EA 4L8RB 4F92B 3RAQA 5DB6A 4CF9A 4RQ3A 4YP3A 4DQQA 3IM1A 4R63A 4YFKA 5HNKA 1WSFA 4ZHRA 4O3NA 1JIHA 2V9WA 8ICBA 1TV6A 4F3OA 4J2BA 3ORYA 5CB1A 3OYGA 3NFAA 2NRWA 1WSJA 5KG3A 1WSEA 1VK0A 2PFQA 3VQQA 9ICVA 3DLEA 3ZT4A 3ZSOA 1L3TA 4M2YA 2BCSA 3B6OA 4NLZA 3M9MB 3MGIA 2UVRA 4BACA 1XI1A 4JV2A 2F8TA 5J2PA 3DLHA 2C2EA 4CJSA 2GUIA 1IKXA 3EPGA 3HL8A 1GOAA 1ZQKA 3ZSZA 1AROP 2UVWA 1XHZA 1A76A 8ICGA 5J0SA 4JWMA 3NBPA 2JGUA 2HHTA 2FPMA 3EW9A 4BDPA 3ZDAA 4DTJA 3FDSA 2D0AA 3IS9A 1TVRA 4FW2A 4Z4EA 4KB0A 1NK9A 3JPPA 4EYIB 1WSGA 3V9ZA 4IKFA 5J2FA 8ICIA 4JV1A 4FLUA 2XRIA 4PGXA 3LALA 3PO5A 4M47A 3RJJA 2FMQA 4FXDA 8ICRA 1RDDA 2G8FA 2BCVA 3AA2A 2DFEA 5HRSA 5KRTA 4BGDA 4BXOA 4DTPA 3KHRA 3OYLA 4O3RA 4EBEA 1A77A 3Q8PB 4CHOA 5EWEA 4Z4HA 3LDSA 2P51A 3VQ7A 1HJRA 4P4OA 3DRPA 4KHYA 1J5OA 4FJMA 2FBTA 3MEDA 4RU9A 3ALYA 3ZDBA 2PYJA 2BQUA 4YR2A 4FYDA 1BL3A 5F9LA 5DQIA 4XQ8A 2F1JA 4I2PA 1TAUA 4PGYA 3PW2A 4GXKA 3C21A 3CFRA 5DMRA 9ICIA 4BE0A 2NUBA 1KVAA 8ICKA 4QW9A 4FLWA 5L1IA 1SUQA 1IKYA 4KLGA 5J0QA 2Z1GA 3OHAA 4O0JA 3QZ7A 4DQRA 1LWEA 3O4NA 4CERA 1IG9A 4CK3A 4UB3A 3UXPA 1HMVA 4I27A 3NGYA 1RNHA 1U04A 2XO7A 3AA3A 1D5AA 5KI6A 4CK2A 3QEWA 4KTZA 3T5LA 3CM5A 2WONA 3NH1A 3NF6A 3ZSRA 4FLYA 1GOCA 4YMNA 4DFPA 3OS2A 4HUFA 4OLBA 5DBCA 3HYFA 1VSLA 1BPXA 3OJSA 2Q0ZX 3GV8B 4JS5A 3JYTA 3KK1A 4CHNA 1DTTA 3AO3A 1J53A 3IRXA 5DKWA 1JLCA 8ICLA 1H38A 4CJUA 4W5OA 1BHLA 4BE2A 2BPGA 3CG7A 1ZQSA 1IH7A 1NOZA 4PHPA 4CGDA 2BGGA 1KCFA 1RBTA 2V4RA 4N47A 4M3XA 3RAXA 4DFMA 1XSLA 1RBVA 4ELVA 1S6QA 3AVFA 3ULDA 4B3OA 1KEJA 3UQ0A 3LWMA 2W9CA 4ED0A 1VSMA 4J9OA 5J2GA 4P2HA 1K6YA 1JKHA 2KZ3A 4FM2A 2PI5A 4ECTA 3LP0A 3O3GA 1TK5A 2MUTB 4LH4A 1VSHA 2KFNA 5KFRA 5KFAA 3LAKA 4LVSA 4PHEA 4ECYA 2J6UA 2I9GA 4OKJA 4FJKA 1HQEA 1ZQDA 2XGQA 3ISNC 3NHGA 1I39A 2WTFA 2FLLA 3VQ4A 5BOLA 4FBTA 7ICNA 8ICUA 3HX0A 3KLIA 4YG2A 3CFPA 1YTUA 1Z00B 4DTMA 3UQ2A 3LANA 3RTVA 3NF8A 4J9KA 1VSEA 3DRSA 3SQ1A 4FJJA 4PHAA 1B9FA 5DLFA 3AVLA 3AVJA 1NOYA 5KFMA 4N41A 3MFHA 1S10A 5IIIA 1BCMA 4RQ5A 4ED1A 4CF2A 3V9UA 3PO4A 4M9HA 1HJPA 3RH5A 2FPKA 3QEXA 1VSFA 4QZBA 4FZZA 3RBEA 1ZQLA 4F91B 4CGIA 3UIQA 3H40A 5KFXA 4RT3A 4DLEA 3MDAA 1JLQA 4Z4CA 4J2DA 2ISOA 5KFLA 7ICIA 1HYSA 1LAVA 3DMJA 1ZQCA 4JRQA 3Q8RB 4OGEA 4I2QA 2Y1JA 2PZSA 3FFIA 4QWDA 4KLSA 4IQVA 4JUZA 1ZQJA 3IHQB 3VQPA 3V6HA 3I0RA 2OPSA 3LP3A 1C6VA 1MQ2A 5I3UA 5IIMA 5DG7A 5J0TA 2X78A 2ASJA 4O9MA 5L1JA 7ICLA 3KJVA 4F4YA 2IC3A 1RYSA 3KKSA 1NKEA 4KLIA 9ICEA 4NLNA 3DYAA 5TZVA 1TL3A 4CIEA 3AVHA 1JXBA 3JPQA 4I2AA 1X2IA 3TAGA 4C8OA 2B4JA 2D0CA 2MAXA 3V1OA 3QIOA 5J2NA 2OPRA 1S1VA 4IRCA 3RB4A 2Q3SA 3HVTA 4CJRA 2ZJAA 4FZYA 1JLAA 3RB6A 3MR2A 4F2RA 4QOZB 4O55A 4UAZA 1XSPA 3HVRA 2O4GA 4DL4A 7ICOA 1UT8A 2P5GA 2BE2A 4K8XA 3K5OA 2GBZA 3T5HA 3PW7A 2XCPA 5KFHA 1T3NA 1RDBA 2LSNA 3KLEA 2BCUA 4YCXA 7ICHA 1EXNA 4KLJA 3ITHA 4KITB 3AU6A 1KFDA 1ZYQA 4FM1A 3RB3A 1VRTA 1KVBA 4CHQA 4R64A 4MEXA 3VQ9A 3M8QA 1FKOA 4DFKA 3K4GA 4DSLA 2DPJA 3GIIA 4HCBA 3KD1E 2HNDA 3C2KA 2PXIA 4B08A 2HHVA 1KLMA 4KHWA 1U4BA 3KK2A 3AUOA 4RUAA 1NJXA 4DQIA 1FKPA 3SI8A 1BI4A 1WSHA 4MQ3A 9ICLA 1L3SA 2JEGA 4TQSA 4K4IA 1NJZA 3PR4A 3GIKA 3NH0A 4DOAA 5HBMA 4PH5A 1COOA 1NK4A 3O4QA 1BPDA 3HPGA 1QHTA 3AA5X 8ICFA 1B92A 1RDCA 3D0PA 3LZIA 2OPPA 2ASLA 3OYCA 1MU2A 4KV8A 8ICCA 3TAEA 7ICKA 3H8SA 4Q43A 3RBDA 3S3OA 1UOCA 2JZBA 5FROA 1RCHA 2G8VA 1BPBA 1SKSA 3EY1A 1REVA 3EZ5A 2AJQA 2EX3A 4E7HA 3Q8SB 5D46A 3KTQA 5HHHA 5KFQA 2BGWA 1NJWA 4ECZA 4J9SA 3SCXA 4FBUA 3N4MB 4XUSA 2KTQA 4FK4A 4UB4A 4IG3A 4LSNA 4AH9A 3OJUA 1ZQIA 8ICEA 2F1HA 2YNGA 4B9SA 3H4BA 4ID5A 3V72A 4QZGA 3FYHA 5DGAA 3PMNA 5KG2A 2QKBA 8ICAA 3V9WA 4UBCA 3LP2A 2JEJA 2VWJA 3KIOA 2ATLA 4KHNA 1TAQA 3OYDA 3HM9A 2AQ0A 3QETA 1RBUA 3WNHA 4YXMA 3OY9A 7ICGA 3K5MA 3B0YA 3V6KA 4Y1DA 2X6SA 3SUNA 3M9OB 2RDJA 1UWBA 1RT7A 3OGUA 8ICNA 4I2BA 3DOKA 2IMWP 2ZUCA 4CHPA 5KG7A 4F5OA 4Q8FA 1HNIA 4G3IA 3ETLA 1RXVA 1ZQZA 4E1MA 5KG5A 4O44A 4DG1A 1NOMA 3QEPA 5J0PA 4RQ6A 2D5RA 3RRGA 2OYQA 2IDOA 4DSJA 5KT4A 8ICQA 4RW6A 2NRTA 4RQ8A 2R8GA 1C0MA 3KHLA 5CZ1A 4DTSA 4F5RA 3MXIA 2FMSA 5K14A 3UXNA 2PFNA 3UPQA 1GOBA 4CJVA 4X5VA 1TK8A 3L2RA 4FJ5A 3AV9A 3C5GA 3HSTB 4ICLA 4O3OA 1Y97A 3PW0A 4BXOB 3MGHA 3O3HA 1S0OA 4CFDA 3OYJA 4I2FA 4DOBA 2JEFA 4IFVA 3QESA 4B9LA 3I0SA 1ZQQA 4RW7A 5J0WA 1HUZA 1KTQA 3JPOA 1PZNA 5CYMA 1LV5A 2ISPA 1HNVA 4M3ZA 2AGOA 4F4WA 3T5JA 1VRUA 4LH5A 4M3YA 4CJEA 3SNNA 2B5JA 1S1WA 1NKCA 3NE6A 3VA0A 1NK8A 4HTUA 4Q8EA 3KD5E 3EYZA 4IQWA 2A1RA 5J2AA 4AHUA 1ASVA 4J2EA 4I9LA 1BPZA 7ICUA 4CFBA 4NLKA 3A2FA 4QZDA 3OS0A 3V6DA 3AVBA 4J9QA 4FLVA 1U48A 4OLAA 2FBVA 7ICMA 4E7LA 4KHQA 1D9DA 3M8SA 3D45A 3GFKB 4NYFA 2D0BA 4YN4A 4CJ5A 8ICSA 2P6RA 3RWUA 4R8UA 5F9NA 1N6QA 2P5OA 1Z3EB 4KLMA 3H8WA 3ZT3A 3B0XA 1ZBHA 3BQ1A 4O0IA 2NRVA 3WNFA 5J2HA 1T7PA 2GV9A 1QQCA 4CK1A 3U3YA 1RT3A 2ZQBA 1RBSA 4CFAA 1ZQPA 4RPZA 4RNNA 2FLPA 1DTQA 2VG7A 3C94A 2BKEA 3S9HA 8ICXA 4I2CA 5KFVA 4PA1A 1NK0A 5CYQA 4Z4FA 4JWNA 3ZDEA 4M3TA 4DQSA 1O1WA 4ECQA 1S5JA 3OYFA 1EX4A 4QZAA 2E6MA 4FVMA 4KTQA 2IA6A 1S97A 2F1IA 1ZQBA 3MR3A 2FBYA 1ZBIA 2RPIA 4DTUA 1N48A 5CR0A 3AVMA 5DB8A 1KDHA 4DF8A 3EWAA 5J2KA 4GXJA 1ZJMA 1X9SA 1EKEA 5HP1A 3LDAA 1S9FA 3GIMA 3MXJA 1XWLA 3BQ0A 5HRNA 4FZXC 4NXZA 2BCQA 3LAMA 5HRRA 4F5QA 2W9CB 1CZ9A 4RQ4A 3C2MA 3MEGA 5KGXA 3V7KA 3B6PA 4M41A 4KLOA 3K5NA 3G6VA 1SKRA 4MFFA 2BHNA 1A5XA 4HCCA 3V7LA 2W9BB 4CECA 3L2WA 1WSIA 4E7IA 9ICPA 5J2DA 4PPXA 4Z6DA 3V9SA 1NK7A 2XY6A 4DTNA 4CESA 3TI0A 5HLFA 2ZUBA 2DTUA 4CEOA 1WAJA 4KHUA 2Z1IA 3THVA 2IGIA 3G6YA 1WN7A 2ZE2A 1KLNA 1LWFA 4KREA 4KLUA 2IHNA 1ZQYA 2YNHA 1ZQEA 4M0AA 3ZSWA 4B9VA 2ASDA 4HUGA 2RF2A 3Q8LA 3IAYA 5DDYA 4P4PA 1T03A 4IQTA 5J0YA 1N5YA 2C2RA 2W9AA 1ASUA 2YHBA 2PY5A 3L2VA 4UQGA 3ZT2A 3V81A 4UAYA 5KT2A 2KZZA 1RTDA 3QO9A 4J9LA 1HQUA 5CWRA 4NM2A 2P66A 2C28A 1CXUA 1JLBA 1ZQXA 4EZ6A 3HO1A 4HUEA 5CA7A 4M3UA 3AVCA 3HWTA 2VA3A 3KK3A 1NK5A 2WOMA 4E7KA 4FS2A 3CFOA 1RPLA 3K59A 4M9GA 4O5KA 2KN7A 4MF2A 5HHIA 1XS9D 9ICAA 2DY4A 4AHSA 5J0OA 3ZSXA 3RH6A 5D49A 4B8CA 4EEYA 2AGPA 5EU7A 3LPUA 5C25A 1ZQUA 3ASMA 2XC9A 4CHYA 2ATQA 1R0AA 2I5JA 3KHGA 5T7BA 4FJLA 1Q8IA 4FK0A 2ETJA 4CJKA 4OJRA 4Z4GA 1EP4A 3PUFA 2DFHA 3BQTA 4M3WA 5SZTA 4FO6A 1KFTA 4I2EA 3S3NA 4M45A 1QSLA 3AU2A 3C95A 4HHTA 4GLXA 1UA1A 1BPYA 4CEAA 4F5NA 1QSSA 4QZCA 2ZJ5A 1UT5A 1RTHA 5CP2A 1JMSA 5L9XA 5HMMA 4QZIA 1LW0A 5L1KA 4H4MA 4CJTA 4MFCA 4O5CA 4FLTA 2AQ4A 5J2EA 2KQ2A 4DQPA 3LWLA 4OKKA 3MDCA 1ASWA 4OGCA 4BWMA 2Z1HA 3G0ZA 5KFFA 3PR5B 3RH4A 3RJKA 1C1CA 4RW9A 8ICMA 4K4GA 7ICSA 3VQBA 5J2QA 4YXJA 4K4HA 3HK2A 3AVNA 2DPIA 5KRSA 1Q9YA 3MEEA 4R65A 1B9DA 2R7YA 3GQCA 2MUTA 2RN2A 5KTQA 3M9NB 2UVVA 2HHWA 3BJYA 4XRHA 1VSDA 5J2JA 4F5PA 2XGPA 2B21A 3SV4A 2KW4A 3U6FA 4ECUA 4CEZA 2BQ3A 1SKWA 5IIOA 4M6WB 3VQ5A 3HXMA 4ELUA 4Z6FA 1JX4A 3QEVA 2QK9A 3RMCA 4KAZA 4FK2A 4MEYA 5I42A 1IXRA 3L2UA 4I29A 9ICHA 1LB2B 3RMBA 3DI6A 4CEBA 4DL6A 3OYBA 1Z00A 4Z4IA 2NRXA 5CJ7A 2C2DA 1S1UA 3NF7A 4ID1A 3TWHA 3E2EA 5KFNA 3RRHA 1JXEA 1K1SA 2W9MA 5DG9A 2E6LA 2OPQA 4OPKA 4Z0UA 2DFLA 4TURA 4B9TA 4FCYA 4QW8A 1SL2A 4CEDA 2FMPA 4G1QA 5FRNA 4TUQA 5KT6A 5C5JA 4AHRA 3RB0A 5FDLA 4EYHB 4UB2A 1D9FA 3MFIA 4J9MA 4J9NA 4M9JA 1RTIA 3ZDCA 1S76D 3SV3A 2IAJA 1L3VA 4DTOA 5DB9A 3QEAZ 3OSPA 3KLFA 4F4ZA 3OHBA 3TABA 4WE1A 4CEFA 3QEBZ 4E3SA 4RNMA 3QERA 4CIFA 4KFBA 4ZH4A 2YV0X 3SJJA 5KFJA 5JUMA 3I8DA 1MC8A 4IBNA 1N56A 5DQGA 4DLGA 4AILC 1JN3A 4YVZA 4C8MA 5KFBA 1KVCA 3SUPA 3T1AA 1ZQWA 3RJIA 5C42A 1TFRA 4NCBA 3T19A 1BQNA 5BOMA 4ECWA 3NDKA 2ALZA 9ICRA 7ICEA 4YR3A 2J6TA 4FJHA 4RW4A 3DLBA 4CF1A 2BCRA 3ZT0A 2QXFA 4KLTA 5KFOA 9ICCA 4IFYA 3NGZA 1QTMA 3G6XA 5J1EA 2ZTDA 1U9LA 3HT3A 4ELTA 4UB1A 4NYNA 4QZHA 2HHQA 1KRPA 1FXXA 3K57A 4RG8A 1FK9A 2IHMA 3RJFA 4FLXA 4TUPA 5KFGA 1X9WA 1HRHA 3V9XA 4KN7A 1T4GA 2PFPA 1C0TA 3ZD9A 4YD2A 5IIJA 1Y88A 4LY7A 4DS4A 4N76A 4IQUA 2BQRA 3P5JA 4O3PA 4YMMA 1MSWD 1S6PA 9ICGA 2KZMA 5J0XA 3PX6A 2W8KA 2P6UA 1BISA 8ICVA 5DGBA 1QLNA 1IM4A 1JLEA 4W5TA 4XA5A 4FJNA 4I2GA 4F93B 3G10A 4KLEA 8ICOA 1S9EA 4CF0A 2HW3A 3OYEA 4AHTA 3E01A 3RJGA 2YKMA 4O5BA 3PVXA 2BDPA 1V9PA 3LP1A 4O3QA 1SL1A 1L5UA 1UA0A 1C7YA 3CYMA 4AHVA 4PQUA 1J54A 4I2JA 4J9RA 2A1SA 4E0DA 4TSXA 2VA2A 1BQMA 3JPNA 4HYKA 3H08A 3OYNA 4FS1A 4NCAA 1DLOA 1VSIA 4W5NA 3PY8A 4CE9A 2VG5A 1ZQGA 3V6JA 4MFAA 3BGRA 4DL2A 4KLQA 4J2AA 5KFTA 1RILA 2OZSA 4R8UB 3OSNA 3PW4A 9ICOA 1B22A 4QWAA 1TVAA 3SUQA 4I9QA 1TKXA 1C1BA 4ED8A 2IOCA 3M8PA 4QZEA 3K75D 1S0MA 3RJHA 1TKDA 1ZBLA 4DU4A 4P4MA 1RT6A 4PWDA 3K5LA 1S0NA 1RBRA 1G15A 1LW2A 4CIGA 4Q0BA 3TAPA 2DFFA 4ZTFA 4RNOA 3JSMA 3QE9Y 4CEQA 9ICBA 1S0VA 4KMUA 1IO2A 9ICQA 5J2CA 1TKTA 4CGJA 4GC7A 3RJEA 3MAQA 4GVMA 3SQ2A 4PY5A 2PI4A 2RKIA 1MQ3A 4W5RA 5DBBA 3EPIA 2HB5A 3NGDA 3ZSYA 4DTXA 2GWSA 5KFSA 3NCIA 4JLHA 1UAXA 2HNYA 5DK5A 4IDKA 1TL1A 4C8NA 1CXQA 4LSLA 4Y1CA 2ZTEA 4KTWA 1RTJA 3ZD8A 1RXWA 4I2HA 4FM0A 2JEIA 4GMJB 5KT5A 1VSKA 1Z26A 3Q8KA 4EP5A 4DFJA 4ECVA 5CHGA 3OYAA 3HP6A 1XSNA 1NK6A 9ICXA 1J9AA 4CF8A 3Q8MA 2LYHA 4Q45A 5J2IA 2A1JA 1ZQMA 1BIZA 1I3AA 4CFCA 4W5QA 4QWCA 2ZTCA 3F9KA 4YQWA 5KFEA 4LZDA 3NTUA 3LZJA 2HHSA 4CJWA 4YNQA 5DLGA 1ZQRA 4I7FA 3DLRA 1U45A 2X6NA 4LZGA 5DBAA 4NY8A 2F8SA 4QWBA 3JPTA 4NLGA 1ZETA 5DQHA 4N56A 1X9MA 3CQ8A 3AO4A 3NF9A 2BR0A 1Q9XA 1BVSA 3ISBA 3WNGA 1EXQA 1ZQTA 3QLHA 7ICJA 4BE1A 4RUCA 2QKKA 5KG4A 5D3GA 3C1ZA 4RQ1A 4CJQA 5IINA 3MXMA 4KI4A 3MABA 3C6TA 2BPCA 3VN5A 3HPHA 1RT2A 1F21A 2X74A 4KI6A 3L3UA 2R8HA 1U49A 5HRPA 5KT3A 2YHAA 3C5FA 5KFPA 3ISDA 4CJPA 4E19A 4Z6CA 4ZTJA 5HP4A 1XHXA 2Z1JA 4C8KA 4KPYA 4DL7A 4OVLA 3Q8QB 2YKNA 5KFYA 4IR9A 3VQAA 4OPJA 7ICQA 4JK1A 3GV7B 3N97B 3QNOA 3RR7A 2G8KA 3DOLA 3SZ2A 9ICMA 3OVNA 4MF8A 1RYRA 5SWMA 2W8LA 4KHSA 3ZDDA 3H7IA 1JXLA 2HVHA 4FJ9A 4CJ4A 5KFZA 1YVUA 7ICTA 4MFBA 4B9MA 7ICRA 3AO2A 3T5KA 3AVKA 4I2DA 2JLEA 3F73A 1ZQNA 4CJFA 2OWOA 5EWFA 3QNNA 3RR8A 4HVJA 1K1QA 4FJXA 4Q44A 3K2PA 2ZUDA 1ZQAA 3QINA 1S1TA 1HPZA 5KFIA 1DGSA 2VWKA 4E89A 5JS1A 3KLGA 1IKVA 7ICFA 4CJ3A 4ECSA 5CY4A 3PNCA 4DO9A 4DS5A 4R66A 3SPZA 3OYKA 1TV9A 4CEEA 1KFSA 4ECRA 3V7JA 3TARA 4UBBA 1TKZA 2G8WA 4DSEA 2P1JA 2UVUA 3DLGA 2OA8A 4EBDA 1ITGA 4ED6A 4RPXA 9ICJA 5EOZA 3TAMA 5BPCA 4KKOA 3SI6A 1ZBFA 1B43A 1XU4A 4NCGA 5KFKA 9ICNA 1RT1A 4CCHA 3MR5A 1JLFA 1W9HA 3OYHA 3TR8A 4FJ7A 1QS4A 3AVAA 2F96A 3PV8A 1LAWA 2XCAA 5HMLA 4DEZA 3ZSQA 2ZJ8A 1RDAA 4XIUA 1RT4A 2VA8A 4DL5A 4F50A 4RZRA 4UAWA 5KG1A 2J6SA 3JPRA 1WCLA 3HW8A 5KGWA 2W9BA 1CEZA 1S9GA 2XY5A
chains in the Genus database with same CATH superfamily
1J2MA 4K0KF 1DOQA 2F8KA 2Z2LA 1NG9A 2WAQF 2FLNA 2K60A 3MMJA 5G0RA 1CPZA 3HP9A 3WIVA 3TFRA 1RAHB 3UDEA 3S3MA 2PDAA 1FT8A 4DV3F 4IH6A 1O13A 3PACA 3ZSVA 3Q8VA 2E1AA 3PX0A 5ETNA 5ALQA 2BE2B 9ICUA 4OYMA 9ICWA 5D0EA 4B1WB 4ZVOB 4QZ9A 8AT1B 3MR6A 3UXOA 2QA1A 1DQ9A 3J7AP 1OS5A 4A59A 5FDLB 4Y3CA 4BR7A 1GLCG 4ZLJA 1IQZA 3C2LA 5FLXO 2MY8A 3MPUB 2HRTA 1VCTA 3M8QB 1FKOB 1YBTA 4FP9A 4BDZA 1K0VA 5GMDA 2J7KA 5G5HA 2D41A 5E0OA 3EE8A 4BWJA 1OY6A 1UJ4A 3RFAA 4C8LA 2AA4A 3KK2B 4DU1A 5C2DA 1FKPB 3MECA 3L0QA 2ASPA 4CNYA 4LT6A 5I3PA 4TQRA 2WB1D 3CHWA 2WB1C 2IMOA 2F8EX 1SAZA 4DSFA 2ZBRA 2OZMA 1CZBA 3NG8A 2WZ1A 4RKUC 3DXMA 3NNHA 3A8KA 3MAAB 4C4SA 3KKRA 1ZC6A 5E41A 4KV8B 4CLLA 3ZXWA 3BPDA 3TA0A 2KVQE 1JI7A 4DSIA 3T3FA 3B4MA 3C6UA 2IS3A 3TAFA 3WZ0A 1V9OA 1ZQVA 3UE5A 4KO0A 2R8KA 3OR1B 3KKAC 1RZTA 3ZX2A 4YDXA 3OUYB 3JAMO 3QRRA 1VSJA 5FD1A 4YD1A 4AYBD 1SL0A 1Y11A 4AYBC 4HR2A 4B3RJ 3SQ0A 1H2TZ 4RQ7A 1NU0A 1W0HA 2YNGB 5SUHA 3TFSA 3ZTSA 1NJYA 5DG8A 1R3NA 2H5EA 4ZIVA 4M9NA 1D8LA 4QIGA 3C23A 5B0CA 1A5WA 2Y0BB 4JI1K 3O3FA 8ICWA 5FRMA 1ZJNA 1QD1A 4KN4A 4CF5A 1IUJA 3IDHA 1J2NA 2N4DA 5AI6A 2FVPA 3QUTA 3BDEA 3D68A 8ICZA 4A47A 2KV2A 3DRXA 4TUSA 3IAM9 3LP1B 3VQCA 5KG6A 1CLQA 5KT7A 1KOOA 2RRDA 1QQ7A 2ZH6A 4GW6A 3VGTA 1F0XA 4NRUA 2E2OA 3C1YA 1JNRB 1RAAB 4JK7A 4BRMA 2D3DA 1GH8A 1GMWD 3L3CA 1PK1A 5IIKA 3HFVA 3ZTPA 2R8JA 4JI5F 4QJVA 4QZ8A 1HWIA 1G99A 4B1YB 4CJLA 1D4XA 1D9AA 3H45C 2PYLA 3VTIA 4US9A 4PQAA 1HR0J 1Z25A 5C2GA 2OXOA 3B78A 1SZPA 5K14B 4I6WA 1R89A 2F4FA 1AZSB 2V52B 3SAFA 1HFEL 1UETA 4RX6A 2D3O1 1SV5A 3BDPA 2RQ4A 4NLTA 5AQYA 1ZAWA 2C2ZB 4EBCA 2R7QA 3OVAA 1A0OB 4MO4A 2VJUA 3BGUA 2JWLA 2NCKL 5IT0A 2DRAA 1IKWA 8ICHA 3GJSB 2KFZA 3MWPA 3T6JA 3KLHA 4WYBA 3TYTA 1B70B 2XHWA 4XAKA 4UB8U 5AE2A 2W6LA 1FX2A 1XNRJ 1RAGB 1TUVA 2OKQA 4JYAF 2Q0UA 3CM6A 3FEXB 2HBZB 5HVGA 3OYIA 1S5LU 4A8XA 3H0LB 3AO5A 2N1RA 5LJVA 2GHPA 4UB5A 4FVCA 2EPIA 4BDYA 2BKNA 3WQUA 2JOQA 3V6DB 4K4XA 4LF6F 2L9WA 3GILA 1N5TA 3GV5B 2GVDA 3QRPA 2GQ2A 4WZMA 2DO4A 1ESVA 2MKIA 3W62A 2RJZA 3OR2B 3K58A 1F2HA 2RHQB 5AM2A 4FWNA 2LLZA 1OYEA 4KLFA 3LK9A 4EZ9A 3EE3A 2E9ZA 2FY1A 1U47A 2CUYA 5AJ3K 4LF4K 2ZGZA 4RR5A 1OH6A 1XC9A 2RLTA 2CVIA 3K0JA 5IILA 3ILLA 2IJNA 3P49B 4P72A 4L8RB 2AP6A 5GIOA 4CF9A 3CJ1A 3MCSA 5AQUA 4DQQA 4R63A 1Q95G 4IJNA 4YFKA 2FJDB 3CMQA 3UMCA 2DGSA 1MROA 4Y2CA 4TXSA 4ZN1A 1WBDA 2J0WA 1U0HB 4ZHRA 3ED5A 4F3OA 2KG5A 3ORYA 2E7XA 4NMLA 4NLSA 1ZTTA 3OYGA 2ZH3A 2NRWA 3BEXA 1L8OA 1FFWB 1T9TA 4WXOA 1WSEA 1QVFR 5ALOA 4OQJA 3TNVA 1S72S 2GX9A 3M5RA 3EX7B 2B4UA 4ER8A 2VPXB 4BRGA 5A8KA 2DR6A 4JV2A 4IQMA 5D77A 2C2EA 3DLHA 5HP1B 4OX6A 1ZXOA 4NLRA 4JI6J 1N5QA 3OXGA 1VQSA 1AUDA 3SK3A 3Q2SC 2ZH7A 3G82B 3HL8A 1SC4B 1GOAA 3POTB 1ZQKA 1ZRMA 3ZSZA 2MLZA 3C3LA 3MUTP 3QMLA 2ATCB 8ICGA 2V4JB 3WBZA 2ZJPQ 1RQNA 4C1NI 3FCWA 2JGUA 4ZPCA 3EW9A 1E4FT 4K25A 2G4BA 1JCEA 5F3XB 4C98A 1VQ5N 4B3SF 3LDLA 3IS9A 2P9SB 4CM0A 4Z4EA 1NK9A 1IWGA 1JJCB 2J9DA 4EYIB 4CVNE 3V9ZA 3WIUA 2E1YA 5GAEP 5GADP 8ICIA 4AT1B 2XRIA 1I51B 4USHA 5A8WA 3N9UC 2HKEA 1QQ5A 3AA2A 4P71A 1RE1B 4CI0B 2DFEA 4G9ZA 5AQOA 4DTPA 3KLGB 3OYLA 4O3RA 2FDRA 4RJVA 4NLCA 1JJ2M 4EBEA 1N5YB 4Z4HA 1F44A 3VQ7A 4N8NA 4P4OA 3DRPA 3WXKA 4KHYA 1J5OA 3E0FA 1LOTB 2JHDA 3MEDA 2PMZD 4RU9A 2PYJA 5F8HA 2PMZC 3QO9B 1SIZA 4RBUA 5KQ8A 4YR2A 4FYDA 4KMOB 2JLFA 5F9LA 2F1JA 4I2PA 1U6BA 1FA0A 2HSEB 4U95A 3MMAB 4WKYA 2ZIUB 5EDWA 4HKQA 2ZIXA 2E29A 2Q6CA 3C21A 2HAFA 3M1VA 4IOBA 4NCGB 4A8QA 1K8AT 2OFHX 1U2RA 3EZOA 3GYXB 3ULEB 5L1IA 4RNHA 5GMKa 1IKYA 2L9DA 1N60A 4OJGA 3PG9A 2Z1GA 3GSDA 3F2KA 3IBWA 1VQ9S 2HS3A 1IG9A 2BE9B 2HAIA 5IC4B 3M30A 4I27A 3CC4N 2HS4A 3C16A 2R7RA 1U04A 1RWPB 2EG1A 3AA3A 1O6XA 5ALYA 2XSFA 1TUGB 3QEWA 3OQ2A 1HBNA 5AIAA 2WONA 2WW8A 3LA0A 3H90A 3NH1A 2F8MA 2HBYB 5CXTA 3H98A 1AW0A 4OLBA 5GAGP 3KXDA 4IOXA 3MN6A 3BO2A 2EH9A 1NGIA 2CQIA 3PFOA 1DTTA 3CCEN 1VJQA 1H1VA 1JLCA 1H38A 2YQ1A 3Q89A 3CG7A 3AD7C 2UUWA 1EAYC 4NLOA 2ZKTA 1ZQSA 2F8LA 3MGJA 2J8SA 1IH7A 6AT1B 3CJSA 1CS4A 4X62K 1PCAA 3M7VA 1NBWA 4AE5A 3JB9k 5LT5A 4LFAF 1N32F 5CA5A 3PKMA 5AI8A 2RRAA 1VYAA 1RBVA 4P6QA 1FXLA 2D6FC 1ZOTA 1KEJA 3BS9A 3UQ0A 3D2WA 2JH7A 5CCMA 1VSMA 5J2GA 2EI5A 3H25A 1ZM4A 4UARA 1KC8O 3W2WB 3O4WA 5TKYA 4LH4A 2KK0A 4H54A 1X9XA 5KFRA 5KFAA 5DDRC 1IG6A 5HI7A 4CH0S 4ECYA 4N8OA 2I9GA 2FDNA 4FJKA 2A3JA 1U1KA 3M2RA 2ZWPA 3H8YA 2FY8A 2CQ4A 5AQHA 3NS1A 4IOCL 2ZH8A 3UR3C 4K8RA 1Q7YT 3H2VE 3R7NB 4WF9Q 1GMVA 2ADBA 3KDOA 3S6JA 1CJKB 1RWKB 4DTMA 2NQPA 3LANA 2R42A 3RTVA 4BRHA 3T1HJ 2O8BA 4P2MA 5LSOA 2EC0A 1BXNA 3KUEA 2OPQB 3CCWA 3PXGa 4A8YA 3C6UB 4ZVFA 3BY5A 1S4EA 2OYYA 2OHDA 4MO5A 3FSXA 4ED1A 5ETSA 2G2ZA 2P9LB 4M9HA 3I5BA 2K3IA 4ZPDA 3QEXA 3J80O 4GO5X 3UIQA 3H40A 2WSFC 4DLEA 4DPOA 4J2DA 5FP0A 3UKRB 3HOTA 3IA0A 3DMJA 4JRQA 1SB3C 3Q8RB 2HLTA 2LA4A 5D0GA 3PDNA 2Y9UA 1V6HA 2PZSA 3WT0A 2DQNB 4IQVA 1SH3A 2XYGB 3C46A 4Z7CA 2OPSA 3LP3A 1N4LA 4PG6A 5I3UA 5IIMA 4FNIA 5LMUJ 1C20A 3MX2A 2QZ8A 4UZCA 5C42B 2W3RA 2QJ3A 3BN4A 2VC1A 1GX5A 1CQNA 3BB5A 4KLIA 1SWWA 1NAQA 4NLNA 2FZCB 5TZVA 4OZ2A 1JXBA 3M32B 4RW4B 3JPQA 3NS6A 3TAGA 2JH1A 1X4BA 2D0CA 2H5IB 3DGVA 2MAXA 2F77X 5J1EB 5J2NA 2OPRA 3R1XA 3HVTA 2NRRA 3FCVA 3JAMY 1CJTA 4ZN3A 1RCXB 1IBLK 2K4IA 2FVSA 1SC3B 3TSUA 1AUSL 2ZBPA 4UAZA 2R7SA 1XSPA 4DL4A 4HTIA 1PYSB 3CSKA 4LVOP 3UE2A 1X4GA 3DLJA 3TJ9A 2AJ0A 1S6PB 3KLEA 2IFXA 5EE0A 2BE7D 3AU6A 1KFDA 1ZYQA 2WSEC 2N3LA 1GEHA 1KVBA 1HBUB 4MEXA 2DKZA 1SXLA 2GWJA 2E9TA 4DX7A 3KLHB 4OD0A 1Y3KA 2EAOA 2O1PA 2OHFA 2PXIA 2HNDA 1WSVA 5B0FA 1WC6A 3AD9C 2HWHA 4NLVA 4QR0A 1KKHA 1N63A 1KLMA 3WK9A 1BLUA 1VK3A 3WDOA 2A40A 3WK4A 1BI4A 4JKFA 4C6AA 1WG5A 4K4IA 3IBFB 3D4JA 2FD2A 3GIKA 2DRBA 1KR4A 1COOA 3BGRB 1UEUA 1V5VA 1NK4A 3N4PA 3O4QA 3HPGA 4FWRA 1QHTA 2B43A 3MDQA 2V68A 1RDCA 3D0PA 2C2MB 1ZPVA 5ALWA 2C42A 1C1BB 3S3OA 3W8GA 1BPBA 3EY1A 1REVA 3PCOB 3U1LA 2HGNA 3JSMB 5KFQA 5DM7L 1NJWA 5U47A 1NM1A 3VEOA 3V4MA 5BR8J 3NMUA 3VCBA 4J9SA 2VODA 3SCXA 2K1RA 4FBUA 3N4MB 3GFHA 4FK4A 1M5VC 5CD4A 1WF0A 3PJ9A 5J8YA 3K8VA 4ETZA 2E5IA 8ICEA 2DEIA 2F1HA 2KIWA 4U67L 3H4BA 2ZGYA 2HOQA 3FYHA 2DF4B 3N7PD 5DGAA 5D4LA 3PMNA 4HT7A 2RU9A 2QKBA 5F8IA 1LK5A 5AQFA 4JI7K 2PN6A 3LP2A 3V9WA 2JEJA 1JRPA 2VWJA 4J91A 4OV6A 1L7PA 1TL5A 2O8DB 3ZZYA 4WTOB 3H0RB 5HQ8A 4YXMA 1WI8A 3K5MA 3B0YA 1Z4OA 3V6KA 3VVUA 2RDJA 3HOSA 3OGUA 1MN7A 2IBOA 2GJ2A 1FRMA 4ZVQB 3E8OA 4JI1J 5KG7A 1JJ4A 3MM5B 5L46A 4PXCA 3ETLA 1VQNS 1RXVA 5AKIA 2EFQA 5K9FA 4RQ6A 4CZMA 1VRQC 3RRGA 2QIFA 2MSSA 4RW6A 2NRTA 4RQ8A 2R7TA 5CZ1A 4K41A 4DTSA 4WYWA 3HZGA 3UXNA 3UPQA 3UB5A 4X5VA 1TK8A 3L2RA 3CJ9A 4P0PA 3J7Z5 3C5GA 2DUYA 2ZNZA 3BF1A 4ZP9A 2YJEA 4NA1A 4GVLA 5BN8A 1P90A 3MGHA 3U8XA 1WORA 1WF1A 2HVDA 1S0OA 3NCPA 4CFDA 3AQEA 3THTA 2HDOA 2DXFA 1T3QA 3IR5B 1C0FA 2E5HA 3I0SA 3VAGA 2DHHA 2QLBB 5GAEU 2VB6A 2ZH4A 3CDWA 5ETQA 3U1NA 4CJEA 3SNNA 1N34K 1S1WA 4PG4A 1NKCA 3D0IE 4LRDA 4RNFA 4HTUA 2V6AA 3EYZA 3BGOP 4I2PB 4KAIA 2A1RA 2YKNB 4AHUA 4ZCKA 4ZVEA 1BPZA 7ICUA 4JAXA 3M8WA 3B54A 1RGIA 2DIVA 3LH2S 4NX9A 1WKKA 2FF6A 2G9OA 4EWTA 2AXTU 3AVBA 2XVTA 1IKYB 4DPYA 2DNMA 3GE1A 1HD1A 2FBVA 2DO0A 4K0KK 1D9DA 2XZDB 1BHNA 2CNNB 8ICSA 3MK6A 1UFWA 3FC4A 2E8MA 3RWUA 5F9NA 3DOMB 1R43A 1N6QA 4KLMA 3K7RA 2DR9A 1MWQA 3M6XA 3ZEUB 1ZBHA 3BQ1A 2GQCA 3M30B 5CABA 3QT6A 3GSIA 4MK8A 2H3GX 1A9NB 1RWVB 1QQCA 4DV3K 1VOMA 3QSYB 2WONB 3AB2B 5IM0A 4DV2K 2NS1B 3D2EB 1M5PC 2MHEA 3UKUB 3UCGA 1CQMA 4NLXA 2FLPA 4F71A 2VG7A 3C94A 2X3GA 2BKEA 3S9HA 1X5OA 3LOUA 2ZC3A 8ICXA 1JWWA 3LDPA 1WC3A 3ZNJ1 3H46O 3M2VB 4DR1F 1VQ7S 1K9MT 1JLCB 4ECQA 3QT5A 4C97A 2ZH2A 3G25A 2EK1A 4OL8A 2LKZA 3B4DA 3DLGB 1NHUA 4LF4J 4YUDA 4NL5A 2RPIA 4H5VA 5GAGU 4LFBK 4LFCJ 5CR0A 4UY85 4LF8F 2XS5A 2W25A 1ZJMA 2LM4A 1S9FA 3MXJA 1A6LA 2W4CA 3D2FA 4FDFA 2FC9A 4BQLA 4U7UK 3C2PA 1EHWA 5AKXA 1QH9A 1K0TA 1HHQA 4ZCIA 1IBKF 1YAGA 1BWVA 2OP5A 3B6PA 4FKYA 1F9FA 2ZHAA 3TUIC 4KLOA 3T9ZA 2W03A 2HQIA 2XB2D 2N4CA 4WU3A 1ZXIA 4M5GA 4MFFA 2W41A 4C4WA 4EX7A 1A5XA 1OH7A 3CJ5A 4HCCA 5ALFA 2KE7A 1N52B 4CECA 4DV4F 3I5AA 4F4AA 5LL6d 2E2PA 3PJXA 4ENOA 4F26A 1S72N 3ZETA 5HVHA 2DNRA 4CESA 4ES2A 3A13A 1RWWB 4CEOA 1CJUB 5AK3A 4R5PB 2J0XA 3THVA 3F53A 2ZE2A 3IG1B 1LWFA 4HDGA 1ZQYA 2H48B 2YNHA 2CQ0A 4CZEA 5AR0A 2O8BB 4Q7AA 1L3KA 4B9VA 2HLUA 2RF2A 3R8EA 3MM9A 4P4PA 2KNJA 4IQTA 3Q8UA 5M2RA 2C2RA 3HF5A 2Z2MA 3G96A 1NU4A 4DR5F 3S41A 1RTDA 4J9LA 2A2CA 1S49A 1VBXA 2P66A 3OHRA 2XYHB 4U9RA 2X1AA 3HO1A 1W7WA 1RBAA 3AVCA 1UJ5A 1NK5A 3KYLA 1SC6A 3THYA 2O8FB 4E7KA 4FS2A 3CJ7A 1MA9B 1S79A 4O5KA 5ALRA 1CJVA 5E33A 3DU6A 2XI3A 1FDNA 4KIAA 3MD3A 2E8PA 5HHIA 2YQEA 3DM2B 3RH6A 4BC9A 5I3UB 2AGPA 5EU7A 2UP1A 4YOEA 4JI5K 3BBFA 2BJ1A 1SV4A 2LQJA 1VC6A 1LEOA 3KHGA 2ACMA 1Q8IA 4FJLA 4FK0A 3CCSS 2CQ1A 1U2FA 3OTEA 4Z4GA 4TVAB 4BRLA 3F2DA 1FFGB 4IG0B 3BQTA 1BO5O 5A2QO 3TTDA 3J7YP 1QZ6A 3CF5L 3CDEA 1XNQF 3S3NA 4I2EA 3JTOA 3AU2A 2XYPB 3C95A 2HOFA 5J1PA 4WFAL 5J2NB 1YDLA 1RG6A 4JK9A 2W01A 1R0CB 4F5NA 4QZCA 2ZJ5A 3L09A 3J80Y 2QARB 2B6AB 2VIXA 1LW0A 5HMMA 4H0OA 4LQ9A 3KJFB 2HFOA 4FWPA 9RUBA 1Y3JA 3OXFA 4UQTA 3CDAA 4YOYA 4E8UA 1ZAXA 1NHKL 2KU7A 1RAFB 4NRTA 1KW4A 4TKTA 1VQ9N 2AQ4A 2CXYA 4JNEA 2FTRA 4NLWA 1QAJA 4DQPA 4OKKA 1ASWA 3A8YA 4KGXB 3KLEB 4B3TF 4C1NK 4JYAK 4BWMA 3QU9A 5BYQA 5JRTA 1RBOB 2Z1HA 1VDHA 2A6MA 3DRRB 2AEJA 2EBGA 3D7SB 5KFFA 3PR5B 4EHUA 2B0CA 1FO1A 3QGPA 4OX8A 3QT7A 4LF6K 2YKQA 3VF0B 3FUYA 4K4GA 3VQBA 2MA1A 2ZH5A 5J2QA 1QVGM 5L1MA 4K4HA 4RCHA 2RQ5A 3K9KA 4R65A 3IV6A 2CQDA 4CLYA 2FF3B 3R8YA 4X62J 3NVKA 2RN2A 1UCVA 1S1XB 4WKRA 3EUB2 5J2JA 1NDPA 3IXQA 5E84A 3SV4A 2YKOA 1SKWA 5IIOA 4EGLA 3HFZB 4YEAA 2EW9A 2MGZB 3VQ5A 2DGTA 2BMBA 4CNQA 3QEVA 1CI4A 4ZOHC 5AQJA 1KN6A 1E4GT 9ICHA 4OLOA 3CJ3A 4ALZA 3JSYA 1Z00A 4R25A 1S6OA 4NI2B 3NF7A 4C3KA 4V19X 4ID1A 3TWHA 1NGAA 5KFNA 3RRHA 4P75A 1RDWX 2QLTA 2FVRA 1OMSA 4Z0UA 2AJ4A 2K4HA 4G1IA 4G1QA 2KG1A 5FRNA 2RP5A 4K5RA 4TUQA 5F1XA 2YMLA 4AHRA 3RB0A 4FF1A 4ILRA 1RQLA 3MFIA 5T7LA 4J9MA 5DDPC 3BS5B 1S76D 1RP5A 2NO4A 3T1YK 2VIHA 2BW7A 3OSPA 1U8SA 5HROB 3QEBZ 4RNMA 1D8ZA 4YB7A 5AFUH 1COKA 4KFBA 1YGYA 2IOHA 1VQ4N 3DDKA 5JUMA 3I8DA 1MC8A 4IBNA 3CCRS 1FEHA 3QFWA 4DV1F 2NV3A 3RSEA 1FVSA 2R18A 2NLXA 2H3EB 3R1HA 4B3SK 5AQZA 1LWCB 2ZOFA 4CZCA 2H3FA 3TW0A 4NE9C 1JMTA 1FCAA 2PBDA 2J6TA 1SBRA 4QYRA 2BCRA 2VG6B 4FF3A 3WKBA 5KFOA 4UT4A 3G6XA 3HKWA 2OTLN 1WOQA 3MPDA 1U9LA 2VKRA 3LM9A 1PJ6A 1WC5A 2HHQA 1UFKA 1KRPA 1PG5B 4RG8A 4MN4C 1Z4NA 5IT9U 2YMMA 5KFGA 4RW6B 1DQAA 1AFIA 5KOXA 3ZD9A 5MAOA 1NSAA 4HHHA 4DS4A 4IQUA 2BQRA 4O3PA 4U7CA 2KZMA 3MX5A 5JVHQ 1M6YA 2LYBA 2DY1A 4MKBA 3VCDA 2KVCA 1FJEB 2P6UA 4KX3A 1IBLJ 8ICVA 5KPRA 4F93B 5AXNA 1Y4ZB 1S9EA 2GV1A 1WJ9A 3B82A 4AHTA 1JK9B 4CO0A 1VIXA 2DR5A 3U9DA 3DNCA 1SV0A 1VS3A 5H1SV 4JI8K 1ZS6A 4PKGA 1SL1A 1SPBP 4USVA 2KM8C 1DRGA 2K7KA 4AHVA 3CYMA 1O8BA 2LXIA 4PQUA 1J54A 4J9RA 4E0DA 1MMDA 4TSXA 1BQMA 3VQTA 1SJQA 4HYKA 3H08A 5HN0A 5B66U 2Q43A 1W2IA 1DLOA 1F2GA 2MQQA 3FZKA 4YOVA 3V6JA 4J2AA 1RILA 2OZSA 3R5CA 1K5OA 3OSNA 1GK8A 4I6YA 2OEKA 2QA4S 3P5BP 4I9QA 3AH6A 3WKAA 1RWXB 2P9IB 3K75D 1NZBA 1XMQF 2YWWA 4HAIA 4DU4A 5AQVA 1RT6A 1Z1ZA 5IM0B 3G6ES 3TKAA 1S0NA 2LVWA 4Q0BA 3TAPA 4ZTFA 3QE9Y 2MKYA 3LM2A 1WF2A 1PK3A 1KQQA 4A2BA 4K4ZA 3W9JA 4Y2QA 4O23A 4LFAK 1N32K 4UUWA 4CGJA 4NWIA 4GC7A 2HG4A 4FN5A 3HRDD 5AZIA 4OZ1A 5BRDA 1MQ3A 5DBBA 1K8KA 4XH1A 3ZSYA 2RRBA 2OEMA 2VQFK 1KNZA 1Q7YO 1SQEA 3SENA 1Q81T 1M1KT 5DK5A 1BDGA 5M1QA 5AKYA 5AQNA 4P0QB 2F4VF 2HVEA 4LSLA 1HW8A 2KM8B 2CQ2A 4NA3A 3ZD8A 1SUQB 3EZWA 1RXWA 3D2FB 3WHIA 4GMJB 2MLYA 1VSKA 1Z26A 1RWUA 1K73O 2PFDA 1DK2A 1NK6A 4BRDA 1GTEA 2LYHA 4Q45A 2A1JA 4JI7J 1ZQMA 2KVIA 5AKEA 2GFFA 4W5QA 2WVEA 3FEYB 2UUCF 5AM5A 5KFEA 1F9HA 3FMWA 3D6RA 2HF3A 4CJWA 3AOCA 4YNQA 2AWZA 3BSOA 3O9UA 1U45A 2X6NA 4NY8A 3WQTA 2LI6A 3JPTA 1MW7A 1B7FA 3JYTB 5HQLA 2UU9F 2XO6A 1W2BR 1O51A 1BVSA 4DR6J 3WNGA 2W6KA 2YHYA 3TZZA 1ZM3A 2M5YA 7ICJA 3PZPA 3MM9B 2QKKA 4RQ1A 4KI4A 3SAGA 4Y6IA 2I6WA 3UWTA 3I4HX 1RT2A 1F21A 2X74A 4KI6A 2ZJPL 1PVQA 3KMQA 3PJWA 1B0TA 4PZOA 2R8HA 3HZ6A 3L3UA 4XH4A 3A0IX 3AAQA 2JLGA 1VQNN 3CIPA 1S6QB 1TL7B 3KWIA 4E19A 4X66K 2BVZA 2IM0A 1XHXA 3UDLA 4KPYA 4WP3A 3GOIA 4CO5A 1HBOB 3CP8A 2DTJA 4CF4A 4YORA 2L3MA 2W2PP 1ZA2B 2YH1A 9ICMA 1YJWS 1UW4A 2JRSA 3MCNA 2JVRA 2YJFA 2EKNA 3H7IA 1NGGA 1YBUA 4J03A 2GC8A 1NM2A 2X3DA 1N34J 4JI3F 4FJ9A 4JD2A 2BXJA 4MFBA 2DXEA 4URSA 5TISU 4PRFA 4CJFA 2OWOA 3QNNA 3RR8A 2YTUA 1HQ2A 1YI2S 4HVJA 3DGPA 3A5LC 2ZUDA 1M90T 4QBUA 4K0KJ 3SFGA 4RL1A 3QINA 1HPZA 3D54A 2VWKA 4E89A 5JS1A 1RU1A 1W25A 3QJPA 2D9OA 2M9KA 7ICFA 3EGNA 4LUBA 5CY4A 3PNCA 4BR2A 1NLVA 1IXKA 4R66A 3LDNA 3OYKA 4H0XB 1WUDA 1TZ0A 4GKKF 1RKIA 1KFSA 3V7JA 4H4KA 4UBBA 4DV3J 1UVLA 3WUHA 2WHOA 1XTZA 5GMEA 2UVUA 2OA8A 4EBDA 3J7YU 4DR2K 4DV2J 5EOZA 2PO4A 4JBCA 3TAMA 1HYSB 4KKOA 2ZWHA 2GVZB 2M88A 4F02A 2PE8A 1NXIA 4MAKA 1OVQA 4Y00A 1RT1A 2ZBIA 3MR5A 1AQ6A 4CIOA 1EWRA 2MTLA 2I0XA 1JROA 2XCAA 2JR5A 3FM9A 3T6BA 5J2QB 5IS2A 4NL9A 1RDAA 4Y2AA 3B6BA 4UOCA 4RZRA 4UAWA 2P5VA 2RS8A 3VC8A 1WCLA 4Y28C 4WK3A 4EO8A 3KFWX 4LFBJ 1VQ7N 3VZHA 3EXYA 3BSCA 2W9BA 3CPWM 1TL3B 1X7VA 5FJ4A 2MU2A 2DGVA 1M5KC 4F67A 1E6YA 3OS1A 3C0BA 4YOXA 2MKHA 3L3FX 2Y1IA 3PMLA 5L1LA 4BLGA 2WF5A 3HSJA 3VQ6A 1GFWB 5AQSA 2G8UA 4FJGA 1NJIO 4BRIA 4CYUB 1RT5A 2NRZA 5E7OB 1OSCA 3N5FA 1WCNA 2JMGA 1MG7A 1RWMB 2GEMA 2Q0RA 1T05A 3VQDA 4Y2YA 4M42A 2RILA 3P3DA 2AZ1A 2BRLA 1FJ7A 3D28A 2Y9TA 1FFUA 1T3VA 4G1QB 2XLKA 3VEVA 1WHXA 4EAHD 1RU2A 4CZHA 5AICA 3ZCMA 3F5EA 1GLFO 2RHKA 2QYGA 4KX5A 2FPLA 4JB3A 4FXVA 2R2UA 1RAIB 1V4SA 7ICPA 1NBEB 4IFEA 2XHBA 1GO3F 3RMAA 8ICTA 1YTAA 7ICVA 3MM7A 3THPA 3CCJS 4LD0A 4K4TA 2PA8D 5BR9A 3SMSA 4WF9L 3NAIA 1X4HA 2P9EA 1CVJA 3WNEA 4FLZA 4P9SA 3WK6A 2XI9A 2K3KA 4CD1A 2HS0A 2UXBF 4B8AB 1ZM9A 1RHRB 3BQ2A 2AYBA 2AEMA 1JJ2R 1SV0C 2BANA 1X8DA 1JB0C 3W65A 3RSEB 3P1GA 3VGMA 1F6TA 2OANA 4LMZA 2PFUA 3P83D 3Q0AA 5HBMB 4NV0A 1BPEA 1IBCB 2V2ZA 1SJFA 4PUOA 3CJ8A 1YRUA 1X1PA 1C1AA 4BJQA 3D6FB 4H4OA 1QVFM 1QCKA 4DSKA 4BRNA 4RQ0A 3VESA 2QKQA 2JZBB 4I2IA 1MMLA 3SBMA 4JI5J 3UDVA 2HFVA 2DHSA 5F0XA 3SQGA 2CJKA 1KN5A 3PX4A 4GIBA 3H8JA 2E5LF 2KXHA 5AKLA 2W11A 2YTCA 3NGIA 2LPEA 4B9UA 3OYMA 2BUNA 1HHSA 3OL7A 3HULA 1ECWA 4IG3B 1X0PA 3ISCA 3W5YA 3TEHB 2ZOMA 2QMXA 4ID5B 2VJ5A 4ZJOA 2FBXA 1Q18A 2MQLA 3CCSN 3A0HU 2QSWA 1NPPA 4KLLA 2K7JA 4J9PA 1NKBA 5DB7A 4H5WA 5K8OA 2QWPA 2PIIA 4CTAA 2ALYB 4RQ2A 4IS7A 1GAOA 2HYIB 4QZFA 4JV0A 5J29A 4O4GA 2O5DA 3KWMA 4OI6A 4JYAJ 3DDIA 4USWA 1WKLA 2CPRA 5HSPA 1RT7B 3ICXA 4AP9A 1ZQOA 2XY7A 4PQUB 6FDRA 2AYMA 2HOEA 1BQMB 1U6ZA 4E7JA 4PXEA 2VGNA 4LF6J 4IR1A 1DLOB 2CNKB 4RTFD 1R8HA 4O44B 2C22A 3PYFA 3MXHP 2VV5A 5C7PA 4OZJA 3HJFA 5H9EK 4DR1K 2Y3YA 4KLDA 1HKCA 4QWEA 3RZAA 1Y7PA 4ANEA 2R8IA 4ED2A 2V2QA 1OUQA 4ICLB 4Q0BB 4YFUA 1TGOA 2GGPA 5DDMA 1KSPA 4W98A 4M04A 4DU7A 1NNLA 3NGTA 4LF8K 1MWKA 4IFVB 1M0SA 5E3PA 2YNIA 4UF4A 1NZAA 4RW7B 3W7BA 4IRKA 1KQKA 3S7RA 3J7ZT 4UASA 4B9NA 1VRUB 4DX5A 3D1OA 3W2VA 4FWMA 3WC0A 4DR3F 4F3TA 2ITGA 1CC8A 4MKVA 2HMIA 3Q2TC 2HQDA 1ILYA 2HEKA 1JLGA 5KQDA 2IIRA 2MHNA 1I1GA 2DGXA 3CMES 1S77D 4KH6A 1FWKA 2K89A 2JX2A 4LBPA 2ACYA 2PFFB 4DV4K 3T1YJ 5EWGA 5J0UA 3AVIA 3JPSA 4DUZK 4B1UB 3OV7A 3A4TA 2VFVA 5A0LA 2CQGA 4H0YB 1QE1A 2XWYA 3HPOA 1HYVA 2B0GA 4D3GA 1V3ZA 2OH2A 2Z57B 2KJ5A 2WF7A 1ZBUA 2FJ6A 1ZQHA 2A1JB 1C0UA 4OJPA 2DISA 4BRFA 1SQKA 3ILJA 2PGCA 5A0YA 2I7PA 2QL5B 1RT3B 3AVGA 2M9NA 2NZCA 4OZ3A 3H4DA 3UDCA 4B3SJ 4JS4A 1ZQFA 2WC9A 5GADI 1DTQB 2CGKA 5ETKA 5AKZA 4ZCLA 3MM8B 3GYNA 5HNKA 4DR4F 2C1EB 2QWMA 3LO3A 1NEEA 2GZOA 4O3NA 1JIHA 2V9WA 8ICBA 1TV6A 2Z58B 4OHWA 4J2BA 4DV0F 3TQEA 3ENBA 1WTBA 2DGOA 2PFQA 5F41A 3VQQA 3FNNA 9ICVA 1QQNA 1L3TA 4H4KC 2XEXA 3FMBA 3B6OA 3M9MB 3LDOA 4CNZA 3MGIA 2UVRA 4BACA 4G9BA 2J76E 4CJSA 5EE1A 2A6AA 1N2XA 1SIWB 4MT1A 3VGUA 2A3VA 2L9NA 1XK8A 1AROP 3P38A 2UVWA 3BZCA 4UY8T 3CJAA 5FPMA 1I5OB 4LF5F 1A76A 4JWMA 4NL9C 3ETMA 1VQON 1NGDA 1FTRA 2FPMA 1XNQK 1WC0A 3VAMA 3ISZA 2D0AA 4PG5A 2YWKA 5JJBA 4JD2B 1TVRA 4FW2A 4C4TA 1FNXH 3AD8C 3QU4A 1WSGA 4NLDA 2ROGA 5J2FA 3NXZA 4M5LA 3PO5A 4GV3A 4OJHA 3ZZPA 3DGPB 4PZNA 2ZKUA 3W66A 3OPXA 1RDDA 2BCVA 3O9SA 4QIEA 5GAGI 5HRSA 3O1LA 1MLAA 5KRTA 4BGDA 1WUUA 5A76A 2I5HA 4B3TK 2CDRB 4IOAQ 5AZJA 4YHHF 1YWXA 4ZVTB 5CYJA 2YWEA 5K20B 1OQ6A 1KHVA 4HDHA 1HJRA 4IEIA 3BZKA 5EUHA 1URJA 3V81B 1XMOF 4OI2A 3ALYA 3ZDBA 3IBPA 3RW6A 2N7CA 3CCMS 1RM6C 2CPJA 3NMRA 2M4MA 2D7SA 3AY0A 4B3MF 5DQIA 2QA4N 4XQ8A 4RQNA 3UVJA 2M3DA 4PGYA 3PW2A 2HCFA 4BC4A 4IH5A 3G71S 4C7YA 4US8A 4NXNF 4CJ7A 5ALVA 5DMRA 4LFAJ 1N32J 2NUBA 1KVAA 8ICKA 1DT9A 2ZJQQ 3WXMB 4KLGA 4CDIA 5EXWA 3G6EN 5L8RC 1LKZA 3OHAA 4A8KA 1BOTO 1BUPA 3QZ7A 1WG8A 2VQFJ 4DQRA 1LWEA 1DGKN 4NEYA 1RWNB 5C25B 2VH7A 2QLXA 4UB3A 3EICA 2P9PA 1R0AB 1HMVA 2ZM6F 3GE9A 1D5AA 2DJWA 2YPZA 4KTZA 2GIFA 3T5LA 4OV1A 1PJ5A 1E6YB 1FNOA 3ZSRA 4X64F 2OSRA 4YMNA 3OS2A 3C14B 3GV8B 4FNHA 3KK1A 3O6WA 3AO3A 2D0OA 1RAEB 8ICLA 2KHCA 4X4TA 4K7QA 4BE2A 2BPGA 5C0YA 3D1QA 4UOHA 4AQYF 1RABB 3IMQJ 3OLAA 3OFGA 4PL1A 4PHPA 1U24A 2CPYA 1RBTA 2R7OA 4M3XA 5B0GA 1T9YA 2NRHA 5HJXA 2GJIA 4ELVA 3AVFA 1F5BA 4B3OA 3ULDA 3MUMP 2IVFB 1Q46A 1QAXA 1IJFB 2QA2A 2W9CA 1XQSC 4ZPBA 1GLAG 2A0FB 4OJ6A 3LP0A 3O3GA 1TK5A 1WI6A 1XR7A 2GO7A 2MUTB 1BWFO 3LAKA 2V94A 2E5JA 4I6MA 2RE2A 4XEIA 4X66J 1HQEA 5C15A 1SXDA 1L8LA 3NHGA 5JXSA 1SQFA 2FGOA 1R6VA 2FLLA 5BOLA 5JLHA 3SMZA 3BF3A 5ETRA 4FBTA 4DOZA 3KLIA 3IP4B 2NYIA 2D4WA 1VSEA 3DRSA 3O80A 4B3RK 5KL1B 3AM9A 1SCJB 2VJVA 3WU2U 3EMTA 4OHVA 4PHAA 5KOWA 1B9FA 4Y65A 4F3QA 5KFMA 2G5IB 4N41A 3K0SA 1YJWN 3OL8A 1S10A 5IIIA 1BCMA 1MWMA 3ET6B 1VMBA 1DHMA 5ALUA 2CZ4A 2FPKA 3BV8A 1ZQLA 5KFXA 4RT3A 1JLQA 4Z4CA 4EFHA 5H2FU 2ISOA 3D5MA 7ICIA 3TX8A 4LRFA 4ZOSA 1J6ZA 3C65A 5AM0A 4OGEA 3E58A 4ICAA 2KOBA 4I2QA 2K06A 2Y1JA 1YI2N 2NUUG 3R27A 4KLSA 1X42A 4JUZA 3IHQB 1PC5A 5EX0A 4AM6A 4IL6U 4EELA 1RAOA 1WYGA 3R5GA 5J0TA 4CLSA 2W2MP 5AM4A 2MZRA 4F4YA 4MDBA 1RYSA 3KKSA 2Q1NA 3DYAA 6FD1A 2Z56B 4C8OA 1XMQK 2EZYA 1S12A 3V1OA 3BR8A 4IFYB 3BF4A 4KH0B 3BBCA 1S1VA 2L48A 3RB4A 1XIQA 1R31A 2E1RA 4FF2A 2W4PA 4FZYA 3VMFB 3DHXA 3RB6A 3EKSA 3SQIA 2EG2A 4O55A 2DXDA 1UT8A 4OYPA 2P5GA 5LL6Z 2BE2A 3E3XA 3EWGA 2BABA 3PW7A 2XCPA 3N28A 4FWSA 2EVZA 2MJUA 2VBWA 4YCXA 2GGPB 4IO1A 2F4VK 4FM1A 3RB3A 4ZKAA 3FSYA 4ZMMA 2G06A 2LP4A 4PWUA 4R64A 3M8QA 1FKOA 4DFKA 3K4GA 1FJGF 3ENHA 1T3OA 2NSCA 2GELA 1UPMB 2J8AA 3UFCX 4EI2A 3W2VB 1TP7A 2MQOA 1B0VA 4TLRA 5ELZA 2LA6A 3A3OB 1NGHA 2Z8QA 4B08A 1NGFA 3IRUA 1HNWF 5IQ6A 1F3FA 2LXFA 2UUCK 3KK2A 3AUOA 3MURP 4KH1B 3PRDA 3L95X 1FKPA 2RT3A 5LXYA 1WSHA 1T02A 1VGYA 2MQPA 1EARA 3CRXA 2VG5B 2R9LA 4QPTA 2CFXA 1BPDA 3QJLA 5E3CA 3GJTB 2CADA 8ICFA 3WK5A 2UU9K 1C0UB 2IA0A 2XHCA 1TKXB 3MAAA 2VU5A 5DZ7A 3OA9A 3LZIA 1MU2A 4KV8A 8ICCA 7ICKA 3M8PB 3H8SA 4X4PA 1Z05A 3QT8A 4AL5A 4BR0A 2MZJA 4X4QA 2G8VA 4ITSA 1UZHA 3CCJN 3D3BJ 2EX3A 1FRXA 4PWDB 1FE4A 4PG8A 4Y2XA 1VHFA 1VAZA 3FGVA 3OR1A 5HHHA 5ALXA 4BVPA 3UO0A 3LVWA 3OUYA 5EE9A 2YX8A 2DGUA 3UD5A 1KC8T 4XH5A 3FKBA 3CI5A 2SXLA 4XUSA 1IR1A 3CJTA 2GO9A 2CPEA 2YNGA 2Y1LB 2GIRA 3NOCA 3V72A 3MCOA 1T9VA 2ITMA 4ZP7A 3KG1A 5FLXU 3L4IA 2QM1A 1B4FA 2FJXA 1N33F 3KIOA 3GU0A 3IWNC 1YUWA 1RBUA 1RK8A 3WNHA 4JI3K 3M8YA 4OZ0A 2OTJN 4DV7F 2F1FA 4Y1DA 2X6SA 3SUNA 3M9OB 1P1LA 3PIPQ 2OMOA 4I2BA 2IMWP 4FZLA 3O9RA 4CHPA 4O0NA 2DR8A 1HR0F 4Q8FA 2J9DE 3MUVP 1HNIA 4FWQA 2F65A 3C66A 5JVHL 1TVRB 5J0PA 2D5RA 4QQBA 2W04A 1FIQA 2OYQA 5KT4A 1FTCA 3MPVA 4DMZA 4M5JA 4KGVB 5K14A 1GOBA 4GKKK 4CJVA 1AZSA 3M6UA 1LVHA 1QUPA 5D0RA 2FHKA 4O3OA 2BJ9A 1FJCA 3GL1A 3O1BA 5K8NA 3PW0A 3O3HA 2BUPA 1ZZNA 4KRWA 1PVRA 3JAMU 2H3VA 3SJHA 2JEFA 1OY9A 3QESA 1ZQQA 5J0WA 5H9EJ 1Z1VA 1PZNA 4DR1J 1LV5A 3ALRA 2ISPA 1LXNA 4M3ZA 2J7UA 4LH5A 3J81O 1S8OA 1NO8A 2E5SA 1ACMB 2FSJA 3NE6A 3VA0A 1NK8A 3CEDA 2V67A 4L72B 1KQSM 5HR7A 5J2AA 2LBOA 4DCJB 4J2EA 4I9LA 3CERA 2KKHA 1VLYA 5DS7A 4LF8J 2HFUA 4NLKA 3G87A 4ZK7M 3A2FA 3DOLB 2NSBA 1TFYA 3OS0A 3V6DA 3P31A 4J9QA 2V0NA 2H54B 4OLAA 1X9JA 1APSA 4E7LA 3IG8A 4NYFA 4YN4A 1RLDA 1RADB 4R8UA 2DB1A 4O4RA 3GR1A 2J9EA 3QFUA 3B0XA 3OR2A 3W5XA 4JEPA 5CR4A 4OYAA 4J9UE 1KVKA 3CC7N 5F8LA 5J2HA 1HD0A 4DV4J 1V4TA 4CO2A 2DKXA 4LR9A 5AI9A 2Y8YA 2RUGA 2C2OB 4JI0F 4CFAA 2MYFA 1YJ7A 4A5AA 4OZNA 3CMEN 3H42A 3HFKA 3L4PA 1X60A 4JK8A 5HMZA 4K2JA 4Z4FA 3UM9A 1DZ5A 4DQSA 1O1WA 1U0HA 4V19J 2H4WB 1TKZB 4DPTA 2IA6A 1G4CA 4DXLA 4ED4A 4JI6F 2F44A 3PIOQ 1IV0A 3WX4A 5B0BA 4DTUA 3W8PA 1VK8A 3KFUF 2XSJA 1GLJO 1NSQA 3I8BA 1DQ8A 2B9EA 3EWAA 3K1ZA 5J2KA 4LF9F 2BM0A 5ALKA 3LDAA 5HP1A 5AKJA 3GIMA 4Y2MA 2XI2A 3LAMA 1P27B 2W9CB 3G82A 5AXKA 3EVWA 1P9QC 4YY3F 3POTA 1DEJA 1RT4B 3F5AA 4BREA 3THWA 3SCKE 3K5NA 5AQTA 2FI1A 2V4JA 3LGMA 4NB4A 3U9ZA 4CLUA 4I6MB 1S9GB 1URNA 5TKWA 3AMZA 3SDEB 1HQEB 2P9SA 2DHGA 1H72C 5HMWA 4P7TA 4GVBA 1XUPO 3TI0A 2ZUBA 1HWKA 2IM2A 2LMIA 1WAJA 2E5LK 3M6GA 3G2XA 2DGQA 3TADC 1M1GA 2IGIA 5BYSA 3J7YI 4UB6U 5ALJA 4KLUA 2IHNA 2ZIVB 1ZQEA 2AT1B 1XNQJ 3VF4A 3W5ZA 1UQVA 5HANA 1FWLA 4BR4A 1UHUA 4Q2LA 2WK4A 2PC6A 5AI0A 3IAYA 4FOIA 3TZXA 3CD6N 2COLA 1T03A 1N5YA 3P6YC 2V69A 2PY5A 1NCLA 2Z4PA 2EWSA 1G1XA 2ZUAA 3H2LA 2M0GB 3QO9A 4C7ZA 2FXUA 4NM2A 2HURA 1CXUA 3CETA 1JLBA 4EZ6A 2NXEA 1WNEA 4WIQA 1RHQB 3HWTA 2VA3A 2UUTA 5GIPA 3MMAA 2ZIUA 3FBBA 2P6SA 4B3TJ 1IV8A 4KR0B 3FJ2A 3CFOA 3ULEA 4GRSA 3GZ7A 1XS9D 9ICAA 2V34A 3ZSXA 2HSTA 5D49A 3D66A 1NGJA 1T11A 4OJOA 4O5FA 3VALA 2IJFA 5IWAF 3E9PA 1VC5A 4LSZB 4ZJLA 2XC9A 1Y5LB 2E1PA 3IFEA 3TWZA 3R5BA 1WOPA 1CSJA 1ZD3A 1M5HA 3CC2S 2ETJA 2IYGA 2XWXA 4XTTA 3PUFA 1KVJA 2DFHA 2P6TA 4M3WA 4CLTA 4M45A 1QSLA 2CDQA 2AJ1A 2GMLA 4HHTA 3G71N 3TOQA 1S1VB 1DXSA 1RB0A 2WFBA 2KSOB 3I55S 2YY3A 4CEAA 4O8UA 3IUCA 5ALSA 1X0FA 5L9XA 4Y2VA 1UVKA 2BYCA 4MFCA 2GMHA 2QWNA 4O5CA 1FRLA 4M5DB 3QIPB 2KQ2A 4DR3K 3LWLA 2Z0GA 3MDCA 3K2YA 3HZEA 1M5OC 4OGCA 3ETRA 4A57A 2ZD1B 5E2QA 3D6TB 5KAIU 3RJKA 3ZNUA 4AL6A 5C2FA 1I94F 3AA9A 2KJWA 2CG8A 1JQGA 4CZLA 4AUKA 1X4CA 2AMCB 2ASYA 2Y1RI 1YVNA 1RLCL 5EN1A 2CPFA 2MQ8A 2IM3A 4WPAA 1PILA 3W2WA 3GQCA 1X4AA 5B7WA 1HARA 3M9NB 2UVVA 3Q24A 1WHYA 4OZ5A 3QUBA 2IOFK 3GFZA 1OW5A 4OYWA 4Y2SA 1N5VA 5THWA 2WTUA 2KW4A 4ECUA 4CEZA 2BQ3A 2LEAA 3AL0B 4M6WB 3R7SB 2W40A 3MPWA 1Q78A 2YNFB 4ELUA 1VISA 1JX4A 2QK9A 3RMCA 3CCLN 1FKAF 4MEYA 3KD3A 3L2UA 2O8CB 4I29A 3VWSA 3RMBA 5BR8K 4OJ1A 4JN4A 2X1BA 5HMXA 1YHQS 2FZGB 3IDWA 4DL6A 5ETTA 3OYBA 1CJKA 5CJ7A 1TR0A 1S1UA 2HNZB 3H7HB 1MU2B 1IIPA 3MAHA 2JH3A 4HLBA 4X84A 1JXEA 1LWXA 5DG9A 2E6LA 2JDJA 2OPQA 3O6QA 5DJBA 4DV0K 2E88A 1EKSA 1EKRA 2DFLA 4X65F 4J8FA 4QW8A 3SSQA 4UY8O 1RUSA 2M8DB 2JV3A 1EETB 3EO3A 5C24B 5J1NA 3ZI4A 4UB2A 1REGX 2P9LA 3V4IB 5F0UA 5C12A 3SV3A 2OELA 4DTOA 2FSKA 3QEAZ 1VI7A 4K43A 1GTHA 3UKRA 3OHBA 7FDRA 2VYPA 4CEFA 3W9HA 4I68A 3MC1A 3R7BB 3QERA 1VJ5A 2VASA 4LF5K 2Z7JA 3NGSA 1N56A 4RW8B 2KVSA 5A8RB 3TRGA 1JN3A 1HWLA 5JICA 4C8MA 5KFBA 3TSQA 1ZQWA 3RJIA 5C42A 1W2BM 4P74A 4Y2IA 3EJMA 4DUYF 1H74A 3L5KA 3OLBA 2F8HA 3HLUA 2GA7A 3M32A 4RW4A 3ZT0A 4LR7A 3ZZ0A 2ZEJA 4OPAA 3ELHA 5CEHA 3I82A 2PKEA 3VGVA 2VFTA 1WOOA 3NGZA 1QTMA 5J1EA 3D9BA 1HNIB 4XK8C 3AY9A 3HT3A 4H5NA 1YQHA 4IDHA 2FZKB 4NYNA 1YKWA 2O6KA 2YI1A 4YHHK 3C7NB 4LJXA 4TUPA 3J7A1 2JGAA 2WSCC 5B5EU 4KN7A 1XMOK 1VQKS 4F7VA 4YD2A 1Y88A 1XMQJ 4JKAA 4N76A 1U1MA 1AXQA 3HKZD 2DH9A 1S6PA 4B3MK 3HKZC 9ICGA 3CPWR 1D0EA 4IEEA 4GMKA 2W8KA 4NASA 4NXNK 1BISA 1YJRA 5DGBA 4KHRA 3J80U 1QLNA 1IM4A 1HBUA 1KAZA 3G10A 3HHDA 4CF0A 2EFPA 3KUHA 4AL7A 2KXNB 4HTJA 2YMQA 2ZJRQ 3RJGA 1UTAA 1WWHA 4O5BA 3AARA 2IVPA 3CNHA 4ZVSB 3GG4A 3HTVA 2DYAA 3CJ0A 2I1RA 1IKXB 2B56A 4NZ0A 1L5UA 2ZM6K 2F4VJ 1UA0A 1C7YA 3O5BA 2A1SA 4BROA 4WQ5C 3JPNA 1NNDA 2JRZA 3NBPB 2EDUA 4CE9A 4X64K 4RBTA 3BGRA 4DL2A 4KLQA 4DQ8A 3QATA 4R8UB 2CPZA 3PW4A 5L38A 3ILIA 1PYTA 2E1FA 1YJNS 1HBMB 1PJ7A 2YX6A 3OW2M 1C1BA 2UUCJ 4GY2B 3MDFA 3C8YA 1HKAA 1S0MA 1N0VC 3D2NA 3RJHA 2UXDK 4AQYK 3K5LA 1PKUA 1R27B 5E79U 3JSMA 3V2UC 3FZLA 4KMUA 1DK3A 4LFCK 9ICQA 5DZ6A 5J2CA 3AJ2A 4C0HA 5CRXA 1X4FA 2FC8A 3J81Y 2U2FA 3O0FA 4ES3A 2UU9J 4PY5A 4TY8B 1YITS 4NLPA 2HB5A 2BV3A 1ZD5A 3P45B 1TFWA 1V5IB 2QEXN 3MCMA 3PSFA 3A1YG 4JLHA 4GV6A 1UAXA 1GLBG 4L3QA 3L4QA 2XSJB 4LRCA 1HIWA 1TL1A 1Z4UA 4C8NA 1CXQA 4Y1CA 4LIRA 2QC3A 2ZTEA 2O8DA 4G6VB 3LGHA 4JB8B 3FZHA 4I2HA 2MSTA 2JEIA 1RA7A 3ADAC 2EFOA 5T41A 5E3RA 5CHGA 3SSSA 3HP6A 5AQRA 5BXIA 4FXWA 5KAKA 3N79A 2WB1F 5HL7Q 3VF6A 4DR7F 2DGWA 3THWB 4P10A 4KB7A 3MM5A 4FYWB 1I3AA 3AXMA 4QWCA 2ZTCA 5MLCQ 3F9KA 4P2FA 3NTUA 1LK7A 4LR8A 3LZJA 4JI3J 4S0MA 5DLGA 1JXVA 5E26A 2LDIA 2G0AA 3P8BB 4GVBB 3QMQA 2A3ZA 2F8SA 3RAMA 5B09A 1ZETA 2VDIA 2ZG6A 3DWLA 4YDDB 4W92B 2QT7A 3IRXB 3AO4A 3NF9A 1Q9XA 4DKWA 4AYBF 2Z2YB 1Q8KA 4FVUA 1F5AA 3QLHA 1TL4A 4P7VA 4CQ1A 5B08A 3O44A 3MPYA 2KG0A 2PT0A 4IWVA 4RO0A 1T03B 1XEZA 3O5TB 1TE2A 3QIDA 3VN5A 2AH5A 1UVJA 3HPHA 1RHMB 3LDQA 1E3MA 4BR5A 2EAPA 2XLJA 4UAVA 3C5FA 4GKKJ 4RWTA 4CJPA 4MMOA 1B7YB 1JLBB 4C8KA 2VFRA 3Q8QB 2YKNA 5KFYA 3CCTA 1HL6A 3PRBA 7ICQA 4TYBA 2RQKA 4USKA 3TUZC 3GV7B 2VZ9A 3RR7A 4YB5A 2DHAA 5I9EB 5SWMA 1OXJA 1QTNB 3ZDDA 5C10A 1OO0B 5IOLA 4BQZA 1PYOB 5EX3A 2MZSA 1UJ6A 4CJ4A 3CCQN 1UP1A 1X6JA 3NRZA 2JZ5A 2O01C 4NYZA 3P39A 3DOMA 1IJEB 4B9MA 4IOAL 1S99A 2ERRA 3ZEUA 1NNEA 1WTFA 3AVKA 2JLEA 3F73A 1ZQNA 4F3MA 1U6FA 1RSCA 1TELA 3HVAA 3RYLA 3I56N 4CW7B 2KEYA 2D9PA 2W43A 4Q44A 4L75A 3K2PA 1JCGA 4L3KA 2HZCA 1FRJA 4BC5A 3D2EA 3CD0A 2A2DA 5KFIA 4F72A 3CGIA 5AJ3F 1GXTA 3UKUA 5F3TA 4CJ3A 4ECSA 4USIA 1NDLA 3KJQB 2WBMA 3QBCA 3M2VA 2ZJQL 3QX7A 3SPZA 2OMLA 4K42A 2ZH9A 4OI0A 3IM9A 2KRRA 1FJGK 2L08A 3DLGA 4L6V3 1FESA 1GT8A 4M7YA 4ED6A 3FLCO 1L6NA 5BJRA 3FQLA 3RGIA 1KXPA 3TJAA 9ICNA 3QAUA 3BUZB 1HNWK 1BE4A 3SSRA 3FFIB 3GU3A 3OYHA 4FJ7A 3AVAA 1TYQB 2F96A 3PV8A 3I0RB 3NAHA 3VEZA 5DDQC 3ZSQA 2ZJ8A 3L7OA 4HEA9 2VA8A 2MDAA 3THXB 1UEKA 4U8VA 4FKXA 3BO4A 2MJNA 4OYZA 2A19A 2UXBJ 4KHWA 2XY5A 4YMEA 2JJ4D 3A12A 2IVYA 2VPYB 1TK0A 4HT5A 4M9LA 4QAGA 2IDLA 1HUXA 1T44A 3K5PA 1BD6A 1S3XA 5D4BA 3C15B 2F7VA 2BDUA 3GIJA 2OAUA 3UN5A 4DZ6A 2MKCA 4GXIA 1XBWA 1CJUA 3NH2A 2Q6BA 4R5PA 2VANA 2P9UB 1JLAB 3MCPA 3AJ1A 3IG1A 3AA4A 1S1UB 5C2CA 4PCQA 3ZTOA 2KMDA 2JFDA 1OH8A 1SB6A 9ICSA 4PL2A 4DF4A 3AXKA 2G8IA 4O5EA 4OX7A 1TMJA 4PHDA 1K73T 9ICKA 4PABA 2E5LJ 4QCLA 5DDOC 1N33K 2KIVA 1VRTB 4WBFA 1O08A 1X5SA 3QEIA 4P2SA 2I1QA 3IWXA 9ICTA 4DV7K 3M8RA 4AF1A 3QBWA 4JRPA 2JL9A 2O8FA 3ZC4A 4NM1A 2NR0A 2LU2A 3GTYX 2KFYA 4KJIA 3NP5A 4M3RA 2AU0A 3DM2A 2EQYA 5GAHP 3LGNA 3DC2A 2ZH1A 4I28A 5IQQA 3F2CA 4GC6A 4QS9A 4E2FB 3QZ8A 1QY7A 4QIWD 3UCUP 2BPFA 3ZT1A 4QIWC 1DFDA 2CYYA 2RMLA 2ZFHA 2LCWA 4IG0A 2OPPB 2FB0A 3L7UA 2CWXA 2EBEA 3U3GA 2QMWA 3PHTA 2NNWA 4CGGA 4M94A 3KNAA 3GB0A 4H8KA 4QNLA 2VFSA 3UN3A 2QARA 3QU5A 2B6AA 3CJQA 2BW2A 4MYTA 3M3ZA 1BCOA 4Y2TA 4HACB 1R7IA 2PMZF 4PKIA 4LSNB 4N7TA 3ZX3A 1YLXA 2W2NP 4RT2A 4ZPTR 5CZ2A 1TUYA 4OKEA 3AODA 3CC2N 3TVKA 4ISFA 4MK9A 1WUAA 4X62F 3DRRA 3SUOA 3SQ4A 1BQXA 2JHEA 1GXUA 4Z6EA 2PSZA 2HMPA 1WLJA 3IGVA 2EC2A 3BO3A 4GV9A 2H1YA 5K4LA 2ZNYA 1A5VA 2K8BB 2H9ZA 2XMAA 4F2SA 5G4DA 3VAIA 3I55N 4O3SA 5FIIA 4BC2A 4DR3J 4CDGA 1NDCA 4PGQA 4U67Q 1S1XA 3TQ1A 5M1FA 2O4IA 3PYEA 4KPCA 2H5XA 2KRBA 1DY3A 4EP4A 3DOKB 3IG5A 4DX6A 3CNQP 2MGZA 1VIOA 3LPTA 2NXCA 3S8SA 4JI0K 5KFWA 1ZBSA 3VQEA 3OL6A 4K50A 1Z19A 3WQPA 4DG1B 3FZMA 3RMDA 1V97A 2IRXA 3IBCB 2G08A 2DNNA 3PTWA 4LIWA 3QGHA 3D7EO 2P9CA 3GDQA 4M5HA 4HI2A 5A2QU 3D0HE 1AYEA 5AI4A 4NI2A 2C3YA 5F8GA 2FHJA 1T6CA 2HSZA 3HD2A 1PUZA 4FO0A 2DR7A 2FJEB 3R1LA 1U0SA 1WNSA 3R6LB 1JJHA 1UVMA 2D1KA 3H8MA 4J90A 1Q53A 1X40A 1VQ5S 1P1TA 3IGNA 2Y0SD 4LF9K 2IBKA 4DWIA 2D0PA 3BS5A 4RPYA 2Y0SC 4FWKA 5CYMB 4DR4J 1L7OA 2W42A 4K8ZA 4F4KA 1HNVB 1HYZA 1GXLA 3R9PA 1GLEG 3UNGC 5HROA 3VEWA 4V19S 4DV0J 2B5JB 4XPCA 4KLHA 4YY3K 2V4QA 2LM1A 2A41A 3DRYA 1YHQN 3SFUA 5HK4A 2G1DA 4JHDB 3T9NA 1TL1B 2M52A 3N4WA 3DHWC 5AQMA 1NJIT 3U26A