3TANA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tanA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tanA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tanA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tanA01
4NLZA 1BL3A 3MAQA 1QS4A 3RH4A 3KHGA 4FBUA 3RBDA 1W0HA 7ICQA 4W5RA 2OA8A 3CYMA 4OGEA 1L3SA 1NOYA 1YVUA 2Z1IA 5HRPA 9ICLA 5F9NA 5KFZA 5KG3A 1IM4A 4Q45A 4F5QA 4FJNA 3HJFA 4I2JA 2G8HA 4B3OA 4RW7A 1QSSA 1BPDA 2HHTA 4QZIA 2XC9A 2WOMA 4HUGA 3M8RA 3ZSRA 1Y97A 8ICOA 4E7KA 1DGSA 3HPOA 1TK0A 5J2AA 1SKWA 2I5JA 2R8IA 3OYAA 2G8WA 5SZTA 4M3XA 4CJSA 8ICPA 8ICFA 4XRHA 1BQNA 4NCBA 4IFVA 5KT7A 4W5TA 3TFSA 4O4GA 1RT3A 1DOQA 5KFXA 3PW5A 4FZXC 3LWLA 4JV1A 3I8DA 5HMLA 3K4GA 3ZD8A 2FLLA 3GDXA 5KG1A 4ED7A 1WSFA 2ZE2A 4ECSA 1XI1A 2BCUA 3VQ6A 5KFEA 4MF8A 7ICHA 2G8UA 1RDAA 1C7YA 4R8UB 4F4ZA 4FJLA 4M9JA 3V1OA 3ZDEA 3C1YA 4DTNA 3KD1E 3SUQA 1XHZA 1EXNA 3HVRA 4EYIB 2IMWP 1SKSA 3BQTA 1VRTA 3THVA 1I39A 1LW2A 2ZUBA 4BDZA 1NK0A 5KFPA 4M3RA 4RQ8A 4TSXA 1DTTA 4FW1A 4GMJB 3MFIA 3HXMA 4ZHRA 3L2RA 2HHVA 4BWMA 1K6YA 2X74A 4E1NA 4Q8FA 2BPFA 2FBTA 4OPJA 4QZDA 3TAFA 1ASVA 4LSNA 4M3WA 4JWNA 4CJQA 3M9NB 1PZNA 4M9HA 1ZETA 3AU2A 1S10A 9ICNA 2P5GA 4O9MA 3OYCA 3H4BA 2QK9A 1BI4B 1KFTA 1CXQA 2KQ2A 4UB1A 5C42A 3HT3A 1T4GA 5EWFA 3QEWA 1RT1A 4KRFA 4FK0A 1CZ9A 2UVRA 4IG3A 2J6SA 4ECQA 4BWJA 1RDBA 1B43A 1TVRA 4E89A 4DSFA 3RJEA 3SV3A 1KDHA 4Y1DA 3MGHA 3H7IA 1UA0A 3K5NA 2E4LA 3PX0A 2RDJA 4CEOA 2G8IA 2FMPA 3RRHA 2M9NA 4ED6A 3LANA 8ICRA 3LALA 3AO3A 5J1EA 3KHLA 5T7BA 4HCCA 3SUPA 1D5AA 1VSFA 3ZT3A 4M6WB 4GXIA 4N41A 4IQTA 3IM1A 3VA3A 3AO5A 3MR3A 4ECUA 3AA3A 4F2RA 4F5RA 1YTAA 4JWMA 1VSEA 8ICCA 5KFAA 4MFAA 4X5VA 1XU4A 2YKNA 3LDAA 8ICYA 3V81A 8ICZA 2GUIA 8ICVA 3MR6A 1VSHA 3E2EA 3Q8LA 2KFNA 1T8EA 5BOMA 3K58A 4M04A 5HRRA 7ICKA 3N4MB 7ICMA 1WSJA 2Y1IA 3CFOA 1ITGA 4CHYA 3HYFA 3SJJA 5KT4A 3B6OA 2IA6A 5E41A 4FM1A 2W9BA 3GIIA 1H38A 5HROA 2NRWA 2YV0X 3V4IA 2ZUDA 3HK2A 1SL0A 5DB6A 2V4QA 4UAZA 1S6PA 1Y88A 3EWAA 3ZSWA 2G8KA 5HBMA 3MBYA 2R8JA 3RJIA 3NBPA 3NH0A 4KI6A 2FLNA 4DQIA 3DLGA 4RG8A 5D4BA 1S1WA 3WNHA 4I2GA 5HRSA 3BJYA 2ASJA 3NDKA 1AROP 4YCXA 4O0JA 4CHPA 2AGPA 1U47A 3V9UA 4FLYA 1IG9A 1I3AA 3MEDA 5DB7A 3M9OB 4B8CA 3PNCA 3NH1A 3RMBA 4PUOA 4EEYA 2HVIA 5CZ2A 4Q44A 5EU7A 1RT7A 3MEGA 4LH5A 4ELUA 4DLEA 5J2HA 4Q43A 3LP1A 4L8RB 3KLGA 4CF8A 5HLFA 3UPQA 2HHXA 1HUZA 2UVWA 3LP3A 1TV9A 5FRMA 4XIUA 1CZBA 2AQ0A 2RKIA 4KLTA 2HHQA 4FK4A 5J0YA 3LP0A 4LZGA 4H8KA 2JEJA 4I2AA 5KFHA 4KHYA 3T5LA 4M45A 1O1WA 5J0OA 9ICGA 4Z4HA 2AGQA 2BPCA 5DQIA 4DL6A 4B9LA 2X6NA 4CJUA 1GOBA 4O55A 4RW8A 4F93B 4CF1A 4ZTFA 5J2JA 3QZ8A 5EOZA 2HHSA 3KD5E 1ZQHA 1JXBA 3UXPA 4RPYA 3C5FA 4ECTA 4QCLA 2D5RA 1L5UA 4YD2A 1ZQVA 4Q5VA 4EBCA 3TWHA 4DOAA 4QAGA 4DU3A 8ICTA 3HX0A 1TFRA 3AA4A 4IBNA 4DTMA 3MDCA 1ZYQA 4B9NA 1NOZA 4O3QA 8ICQA 4M42A 9ICUA 4AHTA 3EPIA 1NK7A 4DQPA 5KFUA 1K1QA 2DTUA 4OKJA 5KRTA 3V6DA 2YNFA 4O5BA 3L3UA 3GV7B 2FLPA 4RZRA 3DI6A 4CEBA 3OYNA 2W8KA 3H08A 3V7LA 3OYBA 1RT6A 4CJWA 4KTQA 7ICUA 2ISOA 1Z00B 4CGJA 5FDLA 5BOLA 1ZQBA 4CF2A 3AVLA 4F8RA 1NK4A 3H8SA 3OS1A 4RQ3A 3ZSYA 1HJRA 1JLBA 3IHQB 4QZHA 3V1QA 3C6TA 4K8ZA 3QLHA 3ZD9A 1VSIA 3AA5X 5J2MA 5KG0A 2EX3A 5C25A 3BGRA 4CJ4A 5IINA 4CGDA 2BHNA 1A5XA 3TAMA 1ZQQA 3L3VA 4OLAA 4J2DA 2C2DA 4N76A 3NFAA 5J2KA 3OGUA 4KLGA 3SUOA 4CHOA 4GC7A 4KTWA 4QWAA 4FXDA 4KN7A 4I9QA 5KG4A 4DFPA 4IG0A 3OYDA 5DG9A 4FM0A 4RW6A 1VRUA 1Z25A 4B8AB 2JGUA 2PYJA 4DTOA 3G6XA 5DBBA 1U49A 3I0RA 5KFSA 2FBVA 3K5OA 2MUTB 5KFFA 4TQRA 4YR3A 1JLFA 4RQ2A 3L2UA 2W9MA 4HYKA 3K5MA 3S3OA 1HMVA 4GLXA 3NF8A 4AILC 4NYNA 3FDSA 1X9MA 3DMJA 2OWOA 1RT2A 5KFQA 4F2SA 3K57A 5J0XA 1TAUA 4CJEA 4KLMA 1CXUA 1RBVA 3QEIA 1Z3EB 4F5OA 3VQ8A 5DDMA 4NXZA 3F9KA 4ID5A 4J9KA 4YR0A 1IKXA 2IHNA 4OJRA 3KLHA 3V7KA 4LSLA 5KFCA 4F50A 1RYSA 3RMDA 1ZQRA 4PA1A 2PY5A 4JK1A 5KFBA 1KFDA 1RTJA 4RW4A 2D0CA 4MQ3A 3AV9A 1WSEA 1TL1A 4M3ZA 1JLEA 3SQ0A 4ECWA 3TAEA 3P83D 1HRHA 2BKEA 2GV9A 2W9CB 2J6UA 7ICPA 1RXWA 4DQRA 1WSGA 9ICRA 2FMSA 4LVSA 1X9WA 4ED8A 1S1TA 4IFYA 5CB1A 3JPOA 1HQUA 4BE0A 4DL2A 1A5VA 1VSDA 1LW0A 2JEGA 2QXFA 3VQDA 3O3HA 4RPZA 4DSIA 4M6WA 1TK8A 1TK5A 1GOCA 4FJ9A 5L1IA 1BPYA 3HPGA 2BQ3A 1BCOA 4I2BA 3OYIA 3PV8A 4CJVA 4Z0UA 4DWIA 3Q8KA 3GV5B 1QTMA 4I9LA 1U04A 2KZZA 1C0TA 4F91B 4RW9A 1T7PA 1SZPA 3T5KA 3ZDAA 4TUQA 4PHPA 3QZ7A 3PVXA 3C21A 4I2IA 2B4JA 3O3FA 4BDPA 1BCMA 1QLNA 4QW8A 1X9SA 1XSLA 1B9FA 2Q3SA 2VANA 1U45A 2PFQA 4B08A 1S9FA 1RBTA 3JPTA 4N5SA 4NM1A 2W9BB 4KLLA 1ZQCA 1EX4A 4DTXA 3DLKA 5L1LA 4KLIA 3UIQA 4UBBA 4CHZA 3AO2A 4RT2A 1TGOA 1Q9YA 9ICXA 4P4PA 3KTQA 3O4QA 4KLSA 4J9SA 4I7FA 3OSPA 5DG8A 5J2PA 4DS4A 4UB3A 4QZFA 4O0IA 2QKKA 2H5XA 1SKRA 4G1QA 3C2KA 4IRCA 3PUFA 1NOMA 1KTQA 1R0AA 5CY4A 8ICWA 4LY7A 4CJTA 2A1SA 4PGQA 4NLKA 4FO6A 7ICTA 4DTPA 4FJ8A 4F92B 1G15A 1KCFA 4CFBA 2HB5A 3GIKA 2BGWA 4FZYA 2KW4A 5J2FA 3ZSZA 2KZ3A 1RBRA 1T3NA 3IS9A 3TI0A 4JV2A 1HYVA 3NE6A 3ETLA 3AUOA 4QZ8A 2FPLA 4DOBA 2F96A 3DYAA 3EY1A 3T5HA 4Q8EA 4NLGA 5J2IA 1BGXT 3TARA 3OYMA 4FLXA 4CK3A 2UVVA 4TUPA 3C5GA 2ZTDA 8ICHA 4B9VA 4QWBA 4EZ6A 3MXJA 3C2MA 5HP4A 4YMOA 1J54A 1WSIA 3NH2A 4JS4A 4FYDA 4KLQA 4W5OA 3AVFA 1HJPA 1EKEA 3UXNA 4ECVA 5IIOA 4Z4CA 4C8MA 1JLAA 5KT2A 2F8SA 2P6RA 4IRDA 8ICEA 2XGQA 4LD0A 1SL2A 1RYRA 4PPXA 4KHNA 1S1UA 1VSJA 4AHSA 3SYZA 9ICFA 4YN4A 4RQ7A 8ICBA 4R63A 1D9FA 1C1CA 4OPKA 1FK9A 2NRZA 1C6VA 3QESA 2VA2A 3RRGA 3KKSA 2PYLA 4ED0A 4K8XA 3SUNA 4Z6DA 5DB9A 3PO4A 3RR7A 4M9LA 4I2QA 4FJ7A 1IKWA 7ICFA 4BGDA 1MQ2A 1RXVA 4E7IA 2BANA 1QSYA 3RJFA 3OJSA 4UB4A 3Q8RB 1KLMA 4FM2A 3SI8A 7ICOA 3TABA 5D3GA 3VQ7A 3V7JA 5J2GA 3JPQA 4KO0A 3SQ2A 2AQ4A 3KLFA 4DSKA 1JIHA 2YHBA 3HP9A 1L3UA 5FRNA 4CIGA 4F5PA 4ZH4A 4LH4A 2RF2A 1IH7A 2F8TA 1S97A 4QW9A 3HO1A 4QZAA 2D0AA 1MU2A 1JXLA 4PY5A 4F4XA 2Q0ZX 2FC0A 3BQ1A 3QNOA 1LV5A 4DMNA 4I2DA 4E7HA 1RPLA 4DF4A 5J0TA 9ICKA 5KG7A 5KGXA 4IQVA 2C2EA 4N47A 8ICUA 1RTDA 3SZ2A 4AHVA 3V72A 3KK1A 3CFRA 1RTIA 2XY8A 1UA1A 2JLEA 4HUFA 4FK2A 5KI6A 1XC9A 4J9NA 4KHWA 4FLTA 3DLRA 5J29A 2KZMA 9ICOA 5KFRA 1HQEA 2A1JA 4YQWA 2BCRA 1KSPA 3DLHA 4H4MA 1RDDA 4YXMA 1ZBUA 1LB2B 4CJKA 2ZJ5A 4IKFA 4Z6EA 1QSLA 3O4NA 2XGPA 5L1KA 2JEFA 4H4OA 3AA2A 1NJWA 2BCSA 1HNVA 3JPRA 4CJ3A 4DTRA 4CESA 5KFDA 1EP4A 4J9PA 2OZMA 5D49A 4W5QA 3WNGA 4M3YA 5DGBA 4AHCA 3QINA 1ZQAA 1BPZA 2FMQA 4J2AA 3NGYA 3PW2A 9ICCA 5D46A 5IIJA 5KFTA 4RQ1A 4FJKA 3QIOA 4CIFA 3RB4A 1N5YA 5L9XA 1MC8A 1JLQA 3Q8PB 1ZQFA 4RU9A 2LSNA 5J0WA 3PR5B 2Z1HA 1S5JA 5DK5A 2A1RA 2JZBA 3FYHA 2XCPA 3P1GA 3PO5A 3AVKA 3G0ZA 2W9CA 3AVIA 2HNZA 4KLJA 1LWEA 4YMNA 2PXIA 3VQQA 4Z4FA 4E0DA 5KRSA 4CFDA 2VA3A 4EZ9A 4FS1A 3C1ZA 3EYZA 1UWBA 4ELTA 4CCHA 9ICEA 1HNIA 2DPIA 4UQGA 4CGIA 3KK3A 2VG6A 4PHAA 1JX4A 3ZT2A 1NK6A 4DTJA 1S1XA 3TAGA 3KK2A 4ED3A 5CHGA 4CGHA 4DF8A 7ICRA 1S9GA 4MFCA 4EP5A 1ASUA 3S3MA 3NF7A 3ZDCA 4IRKA 2ALZA 3QIPA 1YTUA 2Z1JA 3UQ2A 2J6TA 5JS1A 1S76D 1L3VA 3CQ8A 4NYFA 4XUSA 5JUMA 1RTHA 4B9TA 3NGZA 4OGCA 1ZQPA 3V9WA 1T05A 3V6KA 3ISCA 5DBCA 4CK1A 4NY8A 3HM9A 2ASLA 5KFIA 3RMCA 2ZTEA 3HW8A 3OYEA 4M9NA 1BIZA 4KHSA 1KFSA 2PFPA 4FJHA 4DLGA 4CK2A 3BDPA 2C28A 2IBKA 3TFRA 4JLHA 1WCLA 5KFYA 4R65A 3OYKA 1X2IA 2NRXA 1ZQOA 4FJJA 4Z6FA 4CE9A 5EWGA 5KFWA 4NM2A 2W8LA 3HPHA 9ICWA 4AHRA 2D0BA 4B9UA 1NJXA 5KFLA 1JMSA 3LPTA 2KN7A 1BPXA 3ALYA 3QETA 1BHLA 1BI4A 2ITGA 3VQAA 1ZQKA 4DSLA 3K2PA 3D45A 4YXJA 4DTSA 5EWEA 3L8BA 8ICGA 4FJXA 9ICIA 4E1MA 8ICNA 4C8OA 4ECYA 3SPYA 5J0SA 3MFHA 1B9DA 2ISPA 3QNNA 1JXEA 3BQ2A 1ZQUA 1N48A 2R8KA 7ICLA 4KLUA 3ZT4A 5DGAA 2I1QA 4CJRA 3ZSOA 1ZJMA 1BVSA 1WAFA 4KHUA 4FLZA 4CHNA 2P5OA 1N56A 2UVUA 4J9LA 3T3FA 1HYZA 4GXJA 4M0AA 2KFZA 2WONA 3Q8MA 1ZBFA 2I9GA 2KTQA 2VA8A 3AVAA 4TQSA 1EXQA 1ZQYA 3GIMA 3G6YA 4BXOB 3VQPA 5DKWA 3C94A 4MFFA 1BISA 4EBDA 4W5NA 8ICKA 4Z4EA 1W9HA 1S1VA 4FJIA 1XWLA 1NJYA 4RQ6A 1XHXA 3ZT0A 3LPUA 9ICVA 5KGWA 4QWEA 4FJMA 4HVJA 3ULDA 3MABA 3OHBA 3LAMA 4F3OA 4JS5A 4M47A 3DRPA 4J9OA 1UOCA 8ICLA 4UB2A 4BXOA 1IO2A 2VWKA 3DRSA 3QERA 4KN4A 5KG5A 3L2QA 4I27A 2BR0A 4J2BA 4JV0A 1RBSA 4FJ5A 1WSHA 3TANA 2XY5A 1KLNA 2PFOA 1BPEA 1CUKA 2G8VA 4OVLA 5KFMA 3AVNA 2GWSA 4DS5A 7ICEA 3TAQA 3RR8A 4CFAA 4M2YA 5C5JA 4O3PA 4IR9A 3NHGA 8ICXA 5KT3A 5DB8A 4QZCA 3D0PA 4F4YA 1D8YA 1JLGA 3MR5A 1NKCA 1BQMA 2V4RA 1A5WA 3CFPA 3RH6A 3UQ0A 3LWMA 4M9GA 1FKOA 1ZBLA 2HW3A 3AO1A 3TAPA 3AVMA 1BIUA 4CEQA 4QWDA 1U9LA 2PI5A 4NCGA 3DM2A 2ATLA 1XSNA 9ICAA 2RDIA 1WNSA 3RJKA 1S0VA 2FBYA 4F4WA 1SUQA 2X78A 3WNEA 3RJGA 3NTUA 4P2HA 1TKTA 5J2BA 2DFLA 2HNYA 3HL8A 3C2LA 4C8NA 1ZQXA 3JPNA 5IIKA 4TUSA 4FVMA 4CJFA 1Q9XA 3T1AA 4DSJA 4N56A 1TKZA 1NJZA 1S6QA 4KB0A 5HNKA 3C95A 3ZDBA 3E01A 2PFNA 4FLUA 1RCHA 3OY9A 1WLJA 1A77A 1QQCA 5DDYA 2R7YA 1TKXA 1KVBA 4HHTA 1RT5A 4YD1A 2JEIA 4UAYA 2DFHA 2A1JB 4ELVA 3CM6A 2IC3A 4O5CA 4PGYA 3ZSVA 1J5OA 9ICPA 3JPPA 4E7JA 2XRIA 4YFKA 8ICAA 4GW6A 3SCXA 4F4KA 4RQ4A 2XY7A 2BCQA 2ATQA 4I29A 4RNMA 4CEAA 3LK9A 4DU4A 2PZSA 5KTQA 5KFVA 3SI6A 3JSMA 5DQHA 1S0NA 3B6PA 4HTUA 3PMNA 4CECA 2OYQA 4R66A 1SV5A 4CJPA 3I0SA 4BDYA 1Z00A 4QZEA 3ZSXA 2GBZA 5L1JA 4JRQA 1RZTA 5I3UA 4KLHA 3MGIA 2P1JA 5K14A 4ED2A 3RB0A 3ZT1A 4MF2A 3RTVA 7ICGA 2B21A 3VN5A 4J2EA 4OKKA 3OYGA 5CP2A 4DL3A 1JL1A 3T5JA 3VQCA 2JZBB 1JL2A 2AJQA 3MDAA 4R5PA 4RT3A 4E19A 3V6JA 1WCNA 1D9DA 5DLGA 2BQRA 3F73A 4MEYA 1IXRA 1RDCA 3NF9A 4RQ0A 4QZGA 4NLNA 1XS9D 3MECA 3SNNA 1N6QA 4GVMA 4RUAA 4YP3A 3QEAZ 4F3TA 1ZBHA 1KVAA 3ZSQA 1KRPA 1C0MA 5CWRA 5TZVA 3SQ1A 8ICSA 5I42A 4ED1A 3EZ5A 3AVCA 3PY8A 4KTZA 5HMMA 5DQGA 2YKMA 1QHTA 1LWCA 3G10A 3V1RA 2VG7A 1U4BA 4CERA 2XHBA 3UXOA 3OYLA 4BE2A 3S3NA 5KT5A 2E6MA 2F1HA 1ZJNA 8ICJA 4DU1A 2HHWA 3NF6A 3SPZA 4KI4A 3KLIA 3QO9A 5KFNA 4UAWA 1ZQIA 4FW2A 3VQ9A 4R8UA 4Z4IA 3DRRA 3ISNC 5C24A 4I28A 3HSTB 4CHQA 4CGFA 4KV8A 1D8LA 2C22A 4RUCA 3K75D 2R8GA 3L2WA 3RB6A 1JN3A 3QEVA 1F21A 4IR1A 4C8LA 3H4DA 1IKYA 4YVZA 3NAEA 9ICJA 4C8KA 4ICLA 3PW4A 1A76A 1ZQTA 3ZCMA 4DFKA 1RT4A 3QEPA 1C1BA 4PHEA 2MUTA 3KIOA 2YNGA 4Y1CA 2XO7A 2P51A 4DFJA 1ZQJA 2P66A 5KFOA 1NK5A 4KHQA 5HHHA 4HUEA 3EW9A 4GC6A 1ASWA 2ZQBA 4E3SA 4IDKA 4PQUA 2RN2A 4DQQA 4DG1A 2YHAA 1C0UA 5J2EA 8ICIA 1GOAA 2OPRA 1FKPA 1S0MA 2WTFA 4ECXA 4YMMA 4DFMA 1TV6A 4EP4A 3RB3A 4GXKA 1TAQA 5IIIA 5J0RA 4KLEA 1NK9A 1HUOA 3PW7A 1RBUA 1RNHA 4UB5A 2LYHA 5HRNA 1LWFA 3QEXA 4O3NA 2IAJA 2FBXA 4PHDA 3QE9Y 4OLBA 3RAQA 5CJ7A 4MFBA 4FS2A 2FPMA 2YNIA 3TQ1A 3MEEA 1J53A 4RPXA 4OKEA 2QKBA 1V9PA 2VG5A 4NCAA 1TL3A 1JKHA 3NGIA 2X6SA 4YG2A 3OSNA 4FLVA 5CYQA 2YNHA 9ICSA 3CG7A 5J0QA 3PMLA 4G3IA 4O44A 4IQUA 3N97B 1ZQZA 1X1PA 2EHGA 2FPKA 3RJJA 3HVTA 2DY4A 1EETA 4AHUA 3OYJA 4MEXA 2BCVA 2P6UA 1VSKA 4Q0BA 1ZQWA 1CLQA 2OPQA 3KLEA 5HP1A 3RMAA 2IDOA 3LP2A 2B5JA 3KKRA 3LZIA 4M3UA 2ZJ8A 4DSEA 2HMIA 5DG7A 4ID1A 5IILA 3DOLA 2R8HA 2O4GA 5J2NA 4HCBA 2AGOA 3SQ4A 4J9QA 4FLWA 2HVHA 4RQ5A 4B9MA 1CEZA 3IRXA 3OYFA 3NCIA 4O3OA 9ICMA 1VSMA 4CF9A 4BE1A 3CM5A 7ICJA 5CZ1A 2BPGA 2ZJAA 3WNFA 1SL1A 3PW0A 1HYSA 4QZ9A 2B6AA 9ICBA 4Z6CA 4UBCA 3Q8SB 1IKVA 4CFCA 2AU0A 3GILA 3SV4A 4DO9A 2IS3A 3EPGA 7ICSA 2NUBA 4KREA 4AH9A 3PX4A 1ZQSA 5CA7A 4K4GA 1MQ3A 4QWCA 3C6UA 4Z4GA 3MXIA 3U3YA 2BDPA 2E6LA 1U48A 1UT5A 5KG6A 4I2CA 5SWMA 3AVJA 3JYTA 5F9LA 2IHMA 1ZBIA 4KFBA 5CYMA 4O3SA 3Q8QB 4DEZA 4KB1A 2F1JA 5J0PA 9ICQA 2ZUCA 4DTUA 3JPSA 3GIJA 1NKEA 1K1SA 3TR8A 3H40A 1TKDA 1NK8A 2G8FA 5J2DA 4KLDA 3P5JA 4YFUA 4QZBA 4CEEA 3OS2A 3KHHA 3HWTA 3PR4A 2Z1GA 4XA5A 1J9AA 3U6FA 4ECRA 4DOCA 5KFGA 4PH5A 1L3TA 1S0OA 3M8PA 3LDSA 4DL4A 1S77D 2OPSA 4KKOA 1ZQDA 1HPZA 1LAWA 3O3GA 1ZQEA 4O5EA 3AVBA 4FBTA 5JS2A 1KVCA 2NRVA 1BPBA 3PX6A 4R64A 2DFEA 4BACA 3AVGA 5IIMA 4DL5A 9ICTA 1S9EA 4RNOA 5BPCA 5J2CA 2IGIA 1T03A 3RWUA 3S9HA 4M41A 4ZTJA 3K59A 1ZQLA 2DPJA 1RILA 3M8QA 2OPPA 2Y1JA 5KFKA 3MXMA 1LAVA 4F5NA 7ICVA 4EBEA 1B92A 2V9WA 5HHIA 2RPIA 3BQ0A 3ITHA 3ZDDA 1UAXA 2BE2A 4FJGA 1ZQGA 3DLBA 4LZDA 4I2FA 2HNDA 2ZTCA 4QOZB 4IQWA 4I2PA 4YNQA 4TURA 3ORYA 8ICMA 2OZSA 4JUZA 5DBAA 1B22A 2ETJA 1C1AA 4CEDA 4CEZA 1Q8IA 3RH5A 3K5LA 3RJHA 4CF0A 4FZZA 1MSWD 5KT6A 3OVNA 1FXXA 1YT3A 3KJVA 3V9ZA 2F1IA 3C23A 1XSPA 2XY6A 2W9AA 4J9MA 3KHRA 3B0XA 4KPYA 4I2EA 4DQSA 3H8JA 1Z26A 4P4OA 4KLFA 3H8WA 3ISDA 4O3RA 1KEJA 4ECZA 4CGGA 1VK0A 3FFIA 2BQUA 3VA0A 3LZJA 4RNNA 3L2VA 3RBEA 4O5KA 5CR0A 5FROA 3U3GA 2VWJA 1REVA 4JRPA 5J2QA 1WN7A 4PGXA 1TVAA 3AO4A 2C2RA 2PI4A 3DOKA 4EYHB 5DLFA 3B0YA 3OJUA 4CJ5A 4KLOA 5DMRA 2HHUA 3ASMA 3IAYA 3M9MB 1WAJA 1DLOA 3GQCA 3QEBZ 3V9SA 4KITB 4E7LA 2MAXA 3LAKA 4YR2A 3V9XA 2BGGA 2ZD1A 1VSLA 3G6VA 2DFFA 4PWDA 7ICIA 5KFJA 3ISBA 4KAZA 3VQBA 4CIEA 3VQEA 3AU6A 2ASDA 3A2FA 3DLEA 4FCYA 3M8SA 9ICHA 3OS0A 3T19A 3GV8B 4KMUA 2XCAA 4CEFA 1COOA 1QE1A 5KG2A 3AVHA 3VQ5A 3GFKB 4CJLA 4XQ8A 4WE1A 1XO1A 3HP6A 2NRTA 1NKBA 4P4MA 4J9RA 7ICNA 1ZQMA 4DL7A 4M3TA 3IG1A 5J0UA 4K4HA 1ZQNA 4B9SA 2W42A 3OHAA 2O4IA 3OYHA 4K4IA 3V6HA 4I2HA 1JLCA 3VQ4A 3NGDA 3RAXA 3MR2A 2IOCA 1DTQA 1UT8A
chains in the Genus database with same CATH superfamily
4KY3A 4RW7B 3RH4A 3RBDA 5CZVA 3CYMA 3MOJB 1L3SA 3AHPA 1S1XB 3R5GA 1TV6B 1YVUA 1FKAF 9ICLA 3M2UB 1RKIA 1IM4A 4Q45A 5HMZA 1BOTO 2KG5A 1EQ0A 4F5QA 2IDLA 5A2QO 1JLBB 2JWKA 4F0HA 2B3TB 4FWPA 3GU3A 2G8HA 1YGYA 2G1DA 4WQ4C 3KMQA 3EUNA 3GE9A 3ZEUA 2DCLA 3Q83A 4AYBC 1BPDA 2HHTA 4QZIA 1RCOB 1WJ9A 3MEEB 4KHRA 5ETRA 2XC9A 2E2PA 4UW2A 2UXDF 4J7CA 8ICOA 1NHUA 1N63A 2VV5A 5CHCB 1NAQA 1S6UA 5SZTA 4M3XA 4TYBA 1NBWA 4MO5A 8ICPA 2QIFA 4NCBA 3SCKE 3ZX0A 2VG7B 1DOQA 3H98A 3DXKB 3D2FB 4RW9B 3LWLA 4JV1A 4EELA 1WC0A 3K4GA 2WOMB 2R7UA 5KG1A 5T41A 4KSEB 4ED7A 2FHJA 2QA1A 4ECSA 3QFPA 2BCUA 1CJUB 2G0CA 2WBMA 1ZH5A 1KXPA 3V2UC 4R8UB 4RWTA 3C1YA 2CQ0A 4K4WA 2GMJA 4KPCA 1FWLA 3HVRA 4EYIB 2IMWP 5AQZA 2C2ZB 1SKSA 1WC1A 2FVCA 4JI2J 1RAEB 3GZ7A 2JR5A 1RTHB 1I39A 1LW2A 3IDWA 1GLJO 4PXDA 5A8WA 2BRLA 2AHOB 4Y2XA 1Q7LB 4TSXA 1HFEL 2VDHA 4CLKA 4IC9A 2VJUA 4GMJB 2AH5A 3MFIA 3C65A 4JI7J 4BC4A 3QU4A 2VPWB 1F9HA 4U7UK 2NXJA 4P71A 3H0RB 2X74A 1WOPA 2ITMA 3UD3P 3CEDA 4LSNA 4CJQA 3W65A 2HS0A 2P6SA 3AU2A 4AT1B 3TVKA 1FRHA 2D9PA 4LRDA 3H4BA 1BI4B 2VBXA 1YK9A 2JNJA 2NV3A 1AA1B 5EWFA 5C42A 2QYCA 2RQ5A 4USAA 3UE5A 5ADXH 1UEKA 3KUGA 2BKPA 1L7PA 1OQ6A 3U27A 3RVCA 4ANDA 5GAGU 2J6SA 1B43A 1HBUB 3QUBA 1S7HA 4BRHA 4DSFA 4E89A 3C66A 3J80O 4Y1DA 1IJEB 4P73A 2YKAA 1CQNA 2FTRA 3H7IA 4WIIA 3PX0A 2RDJA 1FFGB 3M6UA 1Q8BA 3LANA 3DRYA 4KH1B 1YI2S 3LALA 3OXGA 3FBCA 2QMXA 2F7VA 3SUPA 2NYVA 2J7WA 1VSFA 5AKGA 4M6WB 1KW4A 1CULA 1R6YA 3JS9A 1SI9A 1S22A 2XSFA 4WP8A 1T03B 5KFAA 3NVYA 3LDAA 8ICYA 3EE8A 3KG4A 4ZVOB 5KPRA 1JLGB 5J1EB 4LF9K 4US9A 5ALKA 4X4SA 2GUIA 8ICVA 1DXSA 4DR6F 1VSHA 5HO4A 1FNMA 4L3KA 4K42A 3PCOB 5BOMA 4M04A 3MMAB 3M32A 7ICKA 5AIBA 3N4MB 4LJMA 2VGMA 1WSJA 3W2VB 4JI0F 4CHYA 2ZJRQ 4J90A 3THXB 3SJJA 1QTNB 5MLCQ 2QFIA 5E41A 5C12A 3TX0A 3QRQA 5HROA 3GIIA 1H38A 2YV0X 3EUB2 5DB6A 3CCMS 4XH4A 1S6PA 4J9VA 4OI1A 1Y88A 5ALHA 1YJNN 2G5HB 1K73T 3W8PA 1F0MA 3RJIA 1J5EK 3MM7B 2R2UA 2VPYB 3ISZA 3VF2A 4DQIA 1DT9A 4BRPA 2WB1C 1VQNS 4RG8A 5D4BA 2BXJA 2E2QA 1S1WA 4X66F 1YHQS 4AM7A 5HLFB 2YX1A 3NDKA 1U2CA 2AGPA 1K0VA 1U47A 4OPAA 2VICA 4W4MA 1UFWA 3I9ZA 3T41A 1JMTA 2VFSA 3PNCA 4PUOA 3HI0A 4EEYA 4KGVB 4ELUA 1FXRA 2PAVA 4Q43A 2YPYA 2P9NB 4KB7A 1R3NA 4L8RB 4CF8A 2LXFA 3IXQA 1K5OA 4HDHA 4GRSA 3D3BJ 3AJ2A 1GMUA 2GTDA 3A0HU 5J1NA 3MPVA 2EAMA 2HHXA 3O6WA 1ULRA 5B08A 2UVWA 2NSCA 3VAHA 4KLTA 5J0YA 4E98A 4LZGA 5ALVA 5KFHA 3NNAA 3T5LA 2E5SA 4M45A 1Y0HA 3AARA 4ZKAA 4CO5A 4DL6A 1PAUB 2X6NA 3CIPA 1NGCA 3OV7A 1GOBA 5IT9U 1I5OB 4ZTFA 1RAGB 3QZ8A 5E3QA 2DCUB 3KD5E 1F0XA 3R5JB 4LFAF 3P6YC 1XC3A 4NYZA 3TEHB 3BS5B 2GV1A 2CZVC 3SQGA 5HMYA 4EBCA 3DXMA 1NM2A 2KT5A 4CYUB 2ADBA 3DFEA 5AQHA 3UCUP 1W2IA 3FFKB 4K0KJ 1TFRA 3AA4A 5AI6A 1YKWA 1ZYQA 3CMES 1YJWN 3M1VA 8ICQA 5JLHA 4M42A 3FR0A 9ICUA 1JLCB 3EPIA 1NK7A 2DTUA 5KFUA 1K1QA 3A5LC 2GELA 3B8AX 3ZC4A 3PFEA 2YNFA 4O5BA 3GV7B 3AQPA 4WQ5A 3HHLB 1SV0C 3V7LA 3OYBA 1M90T 1RT6A 1RTZA 7ICUA 4CWBA 5TKWA 4CGJA 5BOLA 4IOCL 5RUBA 5KL1B 1KHWA 3H8SA 3ZZPA 3OT9A 5HAOA 1KQSR 2I6XA 3VENA 3V1QA 1DAXA 1C2PA 3P8BB 4P52A 2W54A 2KP7A 4CJ4A 2K8GA 2UXBF 2BW7A 3TAMA 3W62A 1A5XA 2UUAK 5AQLA 1Q8KA 4JV5F 3CC7N 2B43A 3NFAA 3BSNA 4NL5A 2O5DA 3W5XA 5AM4A 1Q78A 1T9VA 4CHOA 2WBRA 3BKFA 4GC7A 4QWAA 1YDLA 2A40A 3SJHA 4Y00A 3DU5A 4OI6A 3CCUS 2YQ0A 1KQSM 1DURA 5DG9A 1YJRA 2PA3A 2ZEJA 4DCCA 3LGMA 1Z4NA 5LOQA 2NLWA 2DBYA 2ROPA 3H5XA 3VEVA 4YHHK 4GKKK 3LW5C 2PYJA 1N60A 2UYTA 3K5OA 4TQRA 4RUBA 2EI5A 4RQ2A 4LVNP 3K5MA 4ZP8A 2Q97A 1LKYB 5BRHA 1E3MA 2YTCA 4LRCA 1WBDA 4ZJQA 2QMUB 5F0WA 4X64J 4NL9C 1RTJB 1TAUA 3S6JA 4KLMA 4I6AA 1RBVA 3AQOA 4DV2J 1L7NA 4K4XA 2VIHA 5HVHA 3F9KA 4YR0A 1IKXA 5T7LA 1PO6A 2LDYA 3V7KA 4N7TA 5KFCA 4F50A 1SB3C 1GTHA 2OHDA 3FZBA 3GP9A 5KFBA 4NZ6A 1KFDA 5K8MA 1RTJA 3NGSA 1HQUB 3MM5A 2FJWA 2E5IA 1WTFA 2KIWA 1X40A 1TL1A 3J8AA 4ECWA 3GE1A 3P83D 1HRHA 1HW9A 4ZLJA 3CCTA 2V69A 3BZKA 3CJRA 3T79A 2YB4A 1RXWA 2HOQA 3H2LA 4LF4J 3G71N 4DR1F 2FMSA 4LFAK 2HIQA 2YHYA 2HQIA 3HD1A 4NLYA 1IJFB 3WU2U 1U1OA 4BE0A 1LW0A 1T95A 2JEGA 3FVYA 2CRXA 2V2ZA 4C3KA 4DPYA 3O3HA 2EDUA 3ENVA 2EEYA 1RWMB 1BPYA 4GFJA 3KOOA 1BCOA 4JKGB 1BU6O 5ALMA 4Y2CA 2HMIB 2VFVA 1IR0A 1LWFB 2K3IA 2HWHA 3AAPA 5AQGA 5AJ3F 1U04A 2HFUA 4OX8A 2KZZA 4UUXA 2WFBA 4EO6A 2GVZB 1T7PA 1X3MA 3MUMP 1HKCA 2EC2A 2O1PA 5AT1B 3ZDAA 3CETA 2ZE2B 3Q22A 4XAKA 3GFHA 3PVXA 4I2IA 2PT0A 4X4RA 1QLNA 2PMZC 3MDQA 1BLUA 5GAEI 2B6AB 2VANA 2E5JA 3HRDD 5F8GA 2PFQA 4PYDA 1S9FA 1FRIA 1KBRA 4N5SA 3G87A 4F36A 5HROB 3NG8A 5H9EK 4YOEA 5F8LA 5BR8J 2ZDPA 8ATCB 5L1LA 5A8WB 2ODGA 5HBMB 4UAVA 2YXLA 1TGOA 4BJQA 1GXLA 5CABA 3KTQA 3LDQA 1EIYB 4KRWA 4S0MA 4GVBA 3OSPA 4CH0S 4EHTA 5L39A 3OUYB 4UB3A 1QAYA 2KVQE 1CVJA 1SS6A 4PG5A 1IXKA 5TISU 2WTUA 1GMWA 2O8DB 1L3KA 5FPEA 4PGQA 1SQGA 2CPXA 4DTPA 2UXCF 4LF6K 2A2CA 1KKHA 4C80A 3HM8A 3SMSA 4B3SK 2DGOA 4UASA 5AQKA 3IG5A 3L3FX 1TZ0A 4ER8A 5GTHU 3TI0A 3DYAA 2F96A 2CQ3A 2ZWOA 3SAFA 4MJKA 4BC5A 2OPPB 4OYOA 3OYMA 4KH5A 4FLXA 1FVQA 3EDRB 2QM1A 4CK3A 4USMA 2UVVA 4B02A 5CYMB 4Y0FA 1D0EA 4TUPA 4WCEL 4I67A 2ZM6K 5ALJA 4CZJA 4HL9A 3NMAA 1AUSL 2ZWHA 1HWJA 3C2MA 5ETNA 1MMDA 3DXBA 4BREA 3F53A 3AVFA 1HJPA 3CCUN 1EKEA 3UXNA 5IIOA 4K0KF 2BX6A 2DF4B 4K5SA 4P10A 5HQMA 2KHQA 2XTJP 1N88A 2Z56B 3ZZYA 5EHHA 3G6ES 1VSJA 1NDPA 1LFPA 2VPZB 3FE1A 2UUBJ 3EGZA 2I0XA 1PBAA 2KYXA 4RQ7A 3VEOA 4U96A 2ZHAA 2NRZA 4JKEA 4ANCA 2HCFA 1U02A 3MMCA 4OYPA 2M88A 1SJQA 4X4PA 1BC6A 4ZCMA 1YSJA 1HNZK 4ED0A 2XULA 2VQFF 3RR7A 1NDKA 5GAHI 2KKVA 1Q82T 4UB4A 5H2FU 1TELA 3IBWA 5D3GA 2HVDA 2JWNA 5J2GA 2AQ4A 2JC0A 3DHXA 2O6KA 4DDFA 1OUQA 4A8MP 4JI7K 2E8OA 4DSKA 1JIHA 4WK3A 2WF7A 2RQCA 3LO3A 3OFGA 1G4CA 2F9DA 3KKFA 3A8IA 3BGRB 2VUGA 1M1HA 2UU9J 1S97A 1I1GA 1HNZF 2ZOGA 5HVFA 4QZAA 3ZZZA 1MU2A 2F8EX 1KDNA 2YB1A 4PY5A 2J9DE 3B4MA 2DO4A 1G2EA 2K4IA 3QBCA 3HOSA 2RH3A 4CE6A 2CJQA 3TX8A 3Q24A 1LWCB 1W7AA 4ZLPA 2K89A 3CCVS 4B9QA 1RPLA 4USJC 3D7EO 2WF9A 3JSRA 3GG4A 4C7ZA 2DITA 2ZH2A 3AD8C 2QB1A 1HWKA 1VQLS 2WC9A 1OO0B 5KGXA 4N47A 1RTDA 3VR1A 2XY8A 1UA1A 4LBHA 2JLEA 4MIAA 4HUFA 5KI6A 3TZXA 4LF4F 1NNLA 1IV0A 4G65A 4FLTA 2KZMA 3O4WA 3CWJA 1RACB 5E3AA 1RB0A 4Y2SA 2H65B 1RDDA 1SIZA 2OUGA 1RHMB 2ABYA 1BDGA 1DLOB 5L1KA 3WEEA 3SSRA 3AOBA 2BCSA 4CESA 4B3MJ 3A5OC 2ZD1B 3WNGA 2XBPA 3QINA 4ID5B 2N3OA 2FMQA 4J2AA 2H4WB 3PW2A 2A41A 1X7VA 1UJ6A 9ICCA 2EVZA 1JK9B 3M2UA 1VBYA 5D46A 2BJ1A 3PFOA 2ACMA 3QIOA 3RB4A 4BHQA 1P9YA 1MC8A 1UWBB 4HHJA 3CJ1A 4RPFA 3NXZA 2W24A 1HNWJ 3A8YA 3BYRA 3EKSA 3BN7A 4USVA 4DR4K 4CF3A 3FYHA 2FD2A 3P1GA 3G0ZA 2W9CA 3NVZA 2YY3A 4YMNA 3ZZTA 4CP5A 3VQQA 1N0UA 3H5YA 5D0EA 3EDQB 1F2GA 2CH6A 2A3ZA 3L6QA 3VQTA 2EW9A 9ICEA 1HNIA 2VBWA 4CH7A 2MJUA 4HT5A 2E7XA 2B7BB 1U0HA 3K9JA 2Q0UA 4BR4A 3AM9A 5DDQC 2HBLA 3PSFA 4AQYJ 1ASUA 2B0GA 5DM6L 4Y2AA 2Y9TA 1O0PA 2O8FB 1HUXA 1I94F 2CQ2A 5AJ3J 1TL4A 1SZ2A 3BZQA 5JS1A 2HQ3A 3W60A 5JMVA 4A2BA 2Q6BA 2MY8A 3KZBA 3CQ8A 4M5DB 3AOAA 3QICA 4OGCA 1T05A 5E7OB 2WUSA 2E5HA 4C4SA 4CK1A 2HGNA 5HP1B 5KFIA 2ZTEA 2F4VJ 1U6FA 4PEOA 4J8FA 2IRYA 2HHPA 2W40A 2C28A 3QB0A 1WCLA 1UCNA 2YX7A 3OYKA 1O8BA 1X2IA 4Z6FA 3JTPA 2VQEF 1NEEA 4X65K 2XO6A 9ICWA 3SXLA 4MT1A 1NJXA 5KFLA 3DMJB 1BPXA 3T1HJ 3B82A 1BI4A 2AP6A 5D4PA 4BG8A 3JTNA 4IL6U 5B0CA 3U1NA 1RT1B 3HHDA 4YXJA 1SVDA 1Y4ZB 3O6QA 3N01A 2ZM6F 3L8BA 3AL0B 1RLCL 4IG3B 2AYGA 1C4CA 2BJ9A 2Q36A 4C8OA 4ECYA 4TU9A 1RDRA 1X31C 1HIYA 3ZT4A 3OW2R 3ZETA 5G4DA 2V8HA 4KHUA 3CJ3A 3KZXA 4FLZA 5CCLA 2P5OA 3P3DA 4B3SF 5M1OA 1N56A 2JFKA 2MQLA 1SXLA 1ZBFA 2FZCB 2VA8A 4TQSA 2VQFJ 4BS2A 4B3TF 1ZRNA 3O3LA 4BXOB 3G6YA 1Q53A 3CCWA 1VIXA 4JNEA 2XNQA 5DKWA 3LPYA 1FRKA 1BISA 1YJNS 1O51A 2E88A 1XWLA 5HR6A 3KDOA 4YB6A 5LSLA 3ZT0A 3LPUA 3BM7A 3VVTA 5KGWA 4QWEA 4FJMA 3ULDA 3LAMA 3OHBA 4UOGA 1FD2A 5LSRA 4JV5K 4JS5A 2W25A 3C6HA 4WYWA 3NVMA 4FPAA 1UOCA 8ICLA 4CZMA 4F9OA 4BXOA 4O0NA 1IO2A 7FDRA 1LK7A 3QERA 3MM8B 5AXMA 5EXWA 2C2OB 4B17A 3C7NA 2YWFA 1YITN 4IOAL 3VAJA 4K25A 2D41A 1SCJB 1K9MT 1CUKA 3J7AP 3CF5L 4ZP7A 3KYLA 2OANA 2GWSA 4O8KA 3ZNJ1 3R7SB 3TAQA 1CRXA 1N36J 1FXDA 2GAGC 1NNEA 4M2YA 4I2PB 2EZYA 4O3PA 2HQCA 1K8KA 4P0PB 3LVWA 1YVFA 5B0DA 5KT3A 4DCHA 2W2QP 2UXBK 4DPTA 1JLGA 3MR5A 1NKCA 3M3ZA 3FZ2A 1A5WA 3CFPA 2YN4A 1PBUA 2MQNA 2ZZMA 3AO1A 1Q79A 1T11A 2H3FA 2NPIA 3M6ZA 4QWDA 2ZGZA 3BKTA 2LCWA 4GKJF 1XSNA 3UVJA 3EE9A 3RJKA 3N4WA 3IDHA 3CD7A 1PAEX 2F9WA 1BY9A 1CS4B 4NLWA 1VAZA 3EGNA 4LRAA 4DV4F 3NTUA 2G06A 4DR7F 5KQ8A 3C2LA 1KKXA 4C8NA 3TYTA 3VERA 1ZQXA 1RCXB 2KJ9A 2VFRA 4LFCK 4BUGA 5E84A 5IIKA 1MROB 4FO0A 4FVMA 2YH1A 2IMOA 3UVJB 2N82B 1H73A 2KRBA 4N56A 2E1YA 1R8PA 4JI6J 4KB0A 2AF6A 3C46A 1ZAWA 2PFNA 5EGYA 3I31A 5HJXA 3KK1B 3OY9A 2DNGA 1WLJA 1GO3F 3AMZA 1XNSA 5AZJB 4Y2KA 3H3OB 1RUSA 2F44A 4LFAJ 5H1SV 5AK5A 3TADC 3HBTA 3O9UA 3LF0A 4UAYA 2Y0BB 2A1JB 2DFHA 5LJVA 1HLWA 5JXSA 1IVZA 3THTA 2JLGA 3I55N 3G71S 9ICPA 3CD6N 3WIUA 1ELOA 3HKZD 4GW6A 4RQ4A 4CEAA 4I29A 3MWBA 2QFJA 2QSFA 4DU4A 5KFVA 1FO4A 4EEKA 1HD0A 4UOCA 3JSMA 3SI6A 3PMNA 1WACA 3EX7B 2GJIA 4JHDB 2QLJB 3I0SA 5CD4H 4CRJA 3JSYA 3ZSXA 2RE2A 4YDUA 2UUBK 2QWLA 4WQ4A 3ZT1A 4C8YA 2B4UA 4OKKA 4LBPA 1GX5A 3VQCA 3MM9B 4CYUA 5C25B 5I4MA 2VL1A 3QGIA 2F1FA 3MDAA 2LMRA 5HQ8A 4OJLA 3G25A 3SCJE 4CW7B 3DOMA 2ZC4A 4JD2B 1S4FA 4QZGA 2YNFB 1XS9D 3DAWA 3MECA 2KV2A 4ATNA 3DI6B 4GVMA 2P9LB 4RUAA 2XVTA 2N4CA 3AGRA 1WYGA 1SH0A 4LF2A 1VQ6S 1C0MA 3BEXA 4L72B 1N34F 3SQ1A 3FFIB 4B3RK 3S01A 4M5GA 3AVCA 2Y9HA 3QJJA 4DV0J 2AJ4A 2E1ZA 4KTZA 5DQGA 3V1RA 1HL6A 1WELA 4ICAA 3BSOA 2G08A 2XS5A 3D2FA 4WF9Q 4M5DA 2A3JA 3T9ZA 1V3SA 4DU1A 5ETSA 4KI4A 1UWAA 3EZUA 3NWRA 2OH2A 5KFNA 4XDCA 3E9PA 4Z4IA 3DRRA 4MK9A 3LGHA 2HBQB 5ETLA 3FSYA 1IKXB 2DT9A 3VF0B 2WZ1A 3L2WA 2DJWA 4NLQA 3QEVA 1WHVA 3H4DA 4YVZA 2PIIA 1UETA 3BF3A 5D4NA 3BSCA 4I0WA 1HQ2A 3A5NC 2P9SB 1RT4A 2GGPB 3N7PD 4PZVA 1C1BA 4PHEA 3CCES 3KIOA 2NRHA 3FZKA 4V19X 4DN9A 3MTJA 4CO0A 1Y10A 5AQVA 2QWOA 1JNZB 4ZVGA 5C2FA 2ZIVA 3BSAA 4JB8B 5HHHA 3OPKA 2G4BA 2XLJA 1NRKA 4H0TB 4OZLA 2GCFA 4XH5A 4MHVA 3TW0A 2YHAA 4OCZA 4X62F 1HHTP 4ILMA 2OPRA 1S0MA 2WTFA 1V6HA 2K8BB 3L95X 4ED5A 4YMMA 2HNZB 4H0YB 1TV6A 1TAQA 2PMWA 2OM6A 5CYQB 5J0RA 4KLEA 1WC6A 3R3TA 1NK9A 4WYLA 1U1PA 4JKGA 1VQ6N 1RBUA 2Q0RA 4UB5A 2DISA 2E8PA 3Q2SC 1WHWA 4MKVA 4JK9A 1Y3KA 3QE9Y 1V4SA 4Y2TA 4IOXA 3KK3B 2YNIA 3MEEA 4OKEA 2FSKA 1WHYA 2VG5A 2F3NA 3NGIA 4FLVA 4QIWC 4Q0BB 3MOZA 3PMLA 2NS1B 3HKZF 4C0ZA 1OPZA 3IGNA 3QATA 3RJJA 5E3CA 1VJQA 3L0QA 3W2WB 2D3O1 1YX2A 4LFBF 5JVGL 1XMQJ 4IS7A 3DEEA 2AZ3A 2YH0A 5EX0A 4ES1A 2BCVA 3R9PA 1J2NA 1ZQWA 1CLQA 4DPWA 1CJUA 2CQ4A 1UAWA 1F9FA 2B5JA 2OELA 3LZIA 4O44B 2ZJ8A 4DSEA 3D0IE 5DG7A 2O4GA 5B5EU 3TRGA 3FEYB 4AYBD 2W03A 3E51A 2V4JB 1XMOF 1TR0A 1AB8A 1SQFA 1JCGA 3ADAC 2HZVA 5IV3A 1QJHA 3NCIA 1KAYA 4CF9A 2HK3A 2AKWB 1OSCA 3W3DA 2B5JB 2DHXA 2BPGA 3OL9A 2ZJAA 1NSAA 3OD2A 2O8DA 4B3RF 1WOQA 3IR7B 1K8AO 1SL1A 3ZXWA 4UQTA 3WK8A 4WWSA 4CFCA 2E7WA 4U7BA 3GILA 4LF5K 2DTJA 3F44A 3TADA 4LSNB 4C9DA 2NUBA 3O1WA 1SAZA 3FZMA 3PX4A 5CA7A 3JXOA 1JJ4A 1QZ6A 3ISND 1AW0A 3MPYA 4Z4GA 2YQ1A 1UTAA 3MEGB 1Z05A 3U3YA 1NB2A 3QPIA 1U48A 2CFXA 5DETA 5KG6A 4PPZA 3GMGA 3AVJA 3CJ7A 2ZHBA 3M1FA 3GYNA 5CYMA 1Z6RA 4DEZA 4OYWA 2F1JA 1EO1A 1ILYA 5J0PA 2ZUCA 4DTUA 3JPSA 2Z57B 4BR0A 3DDKA 2QV6A 1K1SA 2M4MA 4L73A 2E9TA 3M5RA 1TKDA 2E1RA 5HL7L 5J2DA 1R0AB 1K73O 4QZBA 3SBGA 3FK4A 4OZJA 4F0KA 4FZMA 3OS2A 4JI0J 1J9AA 3U6FA 5M1QA 4KHPF 5DDOC 5F0UA 5EOYA 4NYOA 3M8PA 5L1MA 2DR6A 1HI0P 4RW8B 2OPSA 4U67L 4KKOA 2DNOA 2W2OP 3EGWB 1VQ7S 2HKEA 5JS2A 3C14B 2KB2A 4ZOSA 1CULB 4FWLA 2DFEA 4NMLA 4BACA 1VBZA 3AVGA 1HKAA 3LDOA 3BEGB 4DL5A 4RNOA 5J2CA 1RDUA 3RWUA 5LXRA 2DPJA 2ZH4A 2ZKUA 2XZWA 3N0VA 3E66A 3D1OA 3MXMA 4Y2QA 3I5BA 3CIZA 4F5NA 2YWHA 2NZTA 4CT9A 7ICVA 3TO8A 3LDPA 3M8YA 1HPZB 4B6JA 3D7SB 3BQ0A 3ITHA 3CC2S 2J7UA 1Z1VA 3BBFA 1IBKJ 3WKCA 4H0VB 1VQ9N 2LQBA 1ATRA 3ORYA 8ICMA 5ALTA 2OZSA 1VQ4S 4JUZA 1ZQ1C 1Q82O 2ZJQQ 4UW9A 2HGMA 1C1AA 5GADP 1HI8A 3RH5A 1FDAA 1IR1A 1F9EB 1MSWD 2NYHA 1FKOB 4PL8A 1F5SA 3THWA 2MQPA 3FSIA 3UDCA 2WSEC 3C23A 2DKXA 1KR4A 4USIA 2P8IA 3M05A 2CVEA 4DQSA 2ZIWB 2DH8A 1MLAA 5ALPA 4NMXA 1FDNA 4ECZA 2C2NA 2EZZA 2OEHA 4LIWA 2R9LA 2JRZA 3VA0A 2OYYA 4RNNA 3L2VA 3RBEA 4Y2VA 2QARB 5CR0A 5FROA 1R43A 3AA8A 4LQ9A 3FEZA 4NPOA 2KEYA 4KMOB 4EYHB 4XDDA 3B0YA 3S8SA 1CJKB 4H4KC 4KLOA 3M6KA 5DMRA 2HDOA 2XS2A 4AD6A 3CHWA 1LVHA 1YTYA 2HLTA 5AZIA 1HLUA 5LT5A 4KITB 3PG9A 2VONA 2RUSA 1Z19A 2V8VA 2MAXA 2WB1D 2YBVA 3CF5Q 2CJXB 3OR1A 2DFFA 7ICIA 3HHKA 3CUNA 1QQ7A 3ISBA 3PSIA 4XH1A 4WBFA 2M7SA 2A19A 1VQ8N 5AM3A 2KH9A 5D0GA 3A2FA 3IG1B 4MYUA 5E26A 1NDCA 5BYQA 3JAMY 9ICHA 2A5XA 1B7FA 2R2TA 4FWRA 2E8AA 1QE1A 5KG2A 3DDNA 3D6MB 2R2RA 2E1PA 3GFKB 2P9SA 3ZYYX 4XQ8A 2ZC3A 1S4EA 2R7TA 1XO1A 4YB5A 3PKYA 4H4MB 2LEAA 4IO9L 2JJ4D 4EK2A 4M3TA 4DR6J 4K4HA 3WHIA 1N8RT 3QBXA 4B9SA 1VBKA 3OHAA 4NXNK 2K06A 2O4IA 4A8OA 4IH7A 4KT0C 1JLCA 5AI4A 3VQ4A 4DG1B 4CTAA 1F2HA 3THYB 5IT4A 4RO0A 3D3CJ 1W0HA 7ICQA 4W5RA 4IKAA 1NOYA 1R27B 5LM7E 2QJ3A 2R42A 5F9NA 2GZOA 4FZLA 2ZBCA 4C23A 2ZH6A 1TFWA 1UMJA 4QPXA 3FBFA 3VGUA 4FJNA 3AAQA 1VCTA 4O4GB 5KQDA 4NX9A 1NSQA 4RW7A 2RRDA 5D8HB 4B1XB 3NOCA 5CA5A 4BC3A 2D9OA 2MMYA 1FDBA 1Y97A 1UJ5A 3BO3A 4E7KA 3HPOA 2CVIA 2VU5A 1FEZA 4US8A 1VGYA 3CPEA 1SJ3P 3I56S 1KVIA 4OZ1A 1WB9A 4W5TA 2SXLA 1UJ4A 2LA4A 4CZCA 2W6LA 3NRZA 1RT3A 5KFXA 2XICA 3PW5A 5AQFA 1M5OC 2GVZA 3L09A 2FLLA 4LC9B 2H3QA 4FVUA 3QRPA 2BMBA 2OEKA 3VQ6A 5KFEA 1DTTB 1RDAA 2D4WA 1C7YA 4F4ZA 4FJLA 2J0WA 3ZDEA 2ILYA 3I8BA 1XHZA 4BRDA 4JAXA 3IFRA 2C3OA 2VBYA 4EHUA 4LF5F 5AQIA 2ZUBA 4BDZA 4JI4J 4M3RA 1WOSA 1LQ9A 2O3DA 3UCGA 1NHVA 4FW1A 3WDOA 1D8ZA 4X2BA 1CJVA 3WX8A 4AUKA 3FAHA 2VB6A 2PFFB 1GXTA 4DR2J 3ID6A 5ALOA 2HHVA 4OZ5A 3B4DA 4IO9Q 4E1NA 4Q8FA 2FZGB 2BPFA 4OPJA 3TAFA 4NWBA 4JWNA 2CYYA 3CD6S 2E20A 1ZETA 3SSSA 2QO3A 1S10A 4JI1F 1RFQA 9ICNA 3K2YA 2P5GA 3OTOF 3VTIA 3CC7S 5HN0A 1GLEG 2KQ2A 5IM0B 4FPBA 3QEWA 2RMLA 3J7ZT 3PIPQ 4F04B 4FK0A 4NWIA 2UVRA 5I3PA 3U9DA 1PSDA 2AW0A 2FJVA 3G8QA 1TVRA 4O3MA 3ILOA 1Q86O 3SV3A 4FYVB 4OJ1A 3BQ7A 3O0FA 1UA0A 3K5NA 3ZX3A 1S1TB 1JWWA 4GO5X 1ITPA 4DPXA 3P96A 2FMPA 1PC5A 3AOCA 2F8LA 5B7WA 1ZTWA 2Y9UA 8ICRA 4DCPB 2QI2A 3AO3A 5J1EA 3EKUA 3KHLA 3ZT3A 2CPFA 2JMGA 2WONB 4GXIA 1NDLA 5AM2A 2GX8A 3VA3A 1MWZA 3AO5A 4ECUA 5AQTA 4F2RA 4CO2A 1XMQK 2WAQF 3GB0A 5AQUA 3W2WA 1KN5A 5JVHL 4LVOP 1QUPA 2GNKA 4CQ1A 4ZVTB 5DM6Q 2K7JA 3MR6A 3KUHA 1VJWA 1XN9A 2GMLA 3MCOA 2G0IA 3Q8LA 2EH9A 4DV3K 4DV0F 2D3UA 2V9KA 5AK4A 4QR0A 3NBPB 1PJ6A 1URRA 4CF5A 2L9NA 2Y1IA 3ONNA 3DOLB 3HYFA 4MH8A 1U1KA 2QX0A 4ETXA 4OJOA 4C97A 2W9BA 4FPIA 4K4SA 4BQZA 2ZUDA 2RRBA 3DLKB 3HK2A 4K43A 2HZCA 4UAZA 3QUQA 3J7YP 5HBMA 4NLBA 3MBYA 2M3DA 2F8KA 4UZCA 1RT7B 1U2VB 4KO0B 3EZWA 4X4TA 3WNHA 2YMPA 2AWZA 2FHMA 1VC6A 2F2AB 1H7XA 4YCXA 2QL7B 4CZHA 5ALLA 3V9UA 1IG9A 1I3AA 2VH7A 5EDWA 3IAM9 3D0GE 4L6V3 4TU8A 3M9OB 3RMBA 3OFFA 2WW4A 3BDEA 5U47A 2HVIA 3CCEN 2PA8D 2JFDA 2F9TA 3Q8YA 4PL2A 3L4IA 4DLEA 5J2HA 4RU2A 3LDLA 4DV1K 4FF3A 1RABB 4OLOA 4GNIA 1MWYA 1RA6A 5ETMA 4M63C 1HUZA 1TV9A 3BN4A 3CJ8A 2AQ0A 2PC6A 4FPRA 5AZIB 2HHQA 3ED5A 2R4FA 3ENQA 4I2AA 1JALA 3JSMB 4KHYA 1B3TA 5J0OA 9ICGA 2AGQA 2BPCA 5DQIA 2KJ5A 4CF1A 2HHSA 4K7QA 1ZQHA 1SV0A 3O2IA 2VZ9A 2UP1A 4YD2A 3FM9A 5AK6A 1N2XA 2JH3A 1U26A 4DFDA 3RSEB 4WXWA 2CZ9A 3HHLA 4QAGA 2QKQA 4JI6F 1FFSB 3FQLA 4DTMA 3MDCA 4EO8A 3B9JA 3ULHA 4B9NA 4DV4J 2QXLA 2CQGA 3F0NA 1NOZA 4O3QA 4UUWA 4KIAA 2AJ1A 3J81O 2H5EA 1V5IB 4ACOA 2WAQC 2CNKB 3PEHA 4OYIA 1RAAB 2HFNA 5BXIA 2W41A 3V6DA 2EAOA 2HHHF 4J5OA 1SC4B 1YJVA 4NLOA 2LP4A 1FTRA 2LXUA 2W8KA 4CLTA 4CJWA 3UNYA 4YDXA 2ISOA 1Z00B 1CSJA 1NGHA 4IJNA 3CMAN 3AVLA 4F8RA 1QVFR 2DRDA 2RU3A 1MWMA 4LR8A 4WK1A 1NK4A 2DB1A 1KLMB 4MIBA 4YOVA 5IFMA 1YVNA 4QZHA 2Q79A 1RAIB 1LOTB 4BRFA 1GQEA 3QNWB 1VSIA 3ZEUB 3AA5X 5KG0A 2EX3A 1EQMA 3BGRA 2PFUA 5BR9A 1JCEA 2BHNA 2BABA 1VQLN 5AQOA 2QWPA 1X5OA 1KQQA 5HR7A 4M5IA 3F5AA 3A13A 3ZFVA 4RW6B 3MMVA 4BX9C 1GLLO 2J4RA 2C2DA 4N76A 1YQHA 3C29A 2KRRA 1VQYA 4JI1J 4KLGA 1XJWB 2EFNA 1QVFM 2LQJA 4NLUA 3QT5A 3PACA 4FXDA 4FXVA 2PMZD 4P2XA 4I9QA 1L8LA 5KG4A 3G8TA 4DFPA 1FWKA 3G4SS 5K9FA 4FM0A 2A10A 2V63A 5F2RA 4WZMA 2YVSA 1RT2B 1SH3A 3VAKA 2WF8A 1E4FT 3WXKA 5DBBA 5K8NA 2DNRA 5KFSA 4WTOB 2MUTB 4RNHA 3MAAA 4YR3A 4MLEA 3L2UA 5C0YA 2VKRA 5H1SQ 4K5RA 1NZBA 1HMVA 2IM0A 3HHNB 3BF4A 3I9V9 2WRMA 4ID8A 4L76A 1F1BB 3FDSA 1X9MA 2OWOA 3QO9B 2GFFA 5H9FK 3TEGA 5FLXU 1LWXA 5J0XA 4C98A 1IBLK 1CXUA 1G7CB 1J5EF 2M8HA 3GJTB 4KHPK 2CQIA 2WVEA 5GAHP 4J9KA 3R1LA 2IHNA 1PYTA 9ATCB 2V51B 4OJRA 1A6LA 1YRXA 2DVIA 2XLKA 5MAOA 1NGJA 2C3UA 3FZFA 4XEIA 3N28A 2PFDA 4OHZA 3MK6A 4C11A 5AQNA 4M3ZA 1JLEA 2YNIB 3CTRA 5JJBA 3TAEA 2QA2A 3I55S 2BKEA 2W9CB 2J6UA 2CJ9A 3DDHA 4TLQA 1YBUA 2E5LK 1DQ8A 2QEXN 2VQEJ 3CERA 1VS3A 1R89A 1HBNB 2IVYA 3HD2A 5B0FA 3T1HF 4LVSA 2P9IB 4PWWA 2ASPA 1S1TA 1HJOA 5CB1A 3JPOA 1HQUA 4LF9J 3NOGA 4PQAA 2HRUA 1VDHA 5L46A 2MGZB 3VQDA 2MKKA 1RDWX 1IWAA 2IY5B 1TK8A 2COLA 4JMUA 2KLAA 1UVJA 2B9EA 4I2BA 3PV8A 1FJ7A 4CJVA 4Z0UA 2QN6B 2LU2A 3MN9A 3Q8KA 1HNZJ 2FJXA 4AP9A 4I9LA 1RM6C 3EWGA 1M5VC 4CBWA 1C0TA 3M2RB 4F91B 5E5NA 4RW9A 4ZVQB 3CJSA 2RQKA 1WI8A 3CDWA 3R2DJ 4OYXA 3K7RA 1T05B 3T5KA 2OSQA 1OH8A 5IT9O 4PHPA 3ZTPA 3C21A 1MMLA 1XR5A 4GKKF 2B4JA 1DBDA 5KL8B 3GG0A 3IR5B 4OHVA 3RRKA 4PPDA 4DR5F 4QW8A 1X9SA 2LYBA 1B9FA 4RX6A 4OI2A 4PKGA 3T69A 4KLLA 2Z2ZA 3V4IB 1Y5IB 1Q1KA 4JP8A 3DLKA 1D3WA 2G2ZA 4WKRA 4RT2A 3KHYA 4TNOA 3ZTSA 1HNWF 3JQJA 9ICXA 3L4BC 5AM5A 2OSRA 3AY0A 2K8AA 2HHHJ 1KAZA 1H7WA 4J9SA 3W5ZA 2EFQA 4DV5K 4NEZA 5EE3A 5B0BA 4QZFA 2IIHA 3C2KA 4NLSA 4IRCA 2YJFA 2KT3A 2IJRA 3QU7A 1IWGA 3WC0A 3CIMA 5CY4A 2R7OA 2EBEA 2FGOA 2VF3A 4LY7A 4CJTA 1FWPA 5LMNK 5IWAF 2R3VA 4ZCIA 1YHQN 3ZETB 2A1SA 4PKIA 1FX2A 2MHEA 1YRUA 4FO6A 7ICTA 3D2EB 2ROGA 4FJ8A 2DNLA 2HB5A 3AGKA 3O44A 3GFZA 3U8XA 2IBOA 5J2FA 3EL2A 1RBRA 2LM4A 5FPMA 1T3NA 2H48B 3NE6A 3ETLA 3AUOA 3NVKA 2KICA 1H2TZ 4DOBA 3EY1A 4Z37A 1RT5B 2CXYA 2EK6A 2QWNA 2F8HA 3FBBA 3TARA 3QU2A 1QVGM 3MWTA 3NS5A 2GW8A 3N5BA 1I51B 2IVNA 3KWGA 5F8HA 5HP4A 5AKHA 1J54A 3AFGA 4JKCA 4CH1A 3ZTQA 5F1XA 4KLQA 4W5OA 4I69A 2ZH7A 4CZEA 4DR3J 4OYBA 2P6RA 8ICEA 5HI7A 3CO0P 3CCLS 1RYRA 1HARA 5BYSA 2OI2A 1S12A 2OTJN 1A9NB 1S1UA 3IFEA 4AHSA 2Q3PA 1FFUA 2F8MA 4M94A 3E9LA 1XNQF 2R18A 2FQQB 4OPKA 4W92B 1C6VA 3QESA 3MM9A 3KKSA 2L9DA 2L3MA 4K8XA 4UOFA 4I2QA 4BGDA 1MQ2A 1KBUA 4FL9A 2CJBA 2BANA 2V7ZA 3T6BA 4NLDA 1GX6A 3QT6A 3VQ7A 4LF7K 3V7JA 3CCRS 4GVEA 5I9EB 4QNLA 5B09A 4CLSA 3MMCB 3MPUB 5FRNA 2QWMA 3FJ2A 2F76X 4ZH4A 1S3XA 2RF2A 1ZOLA 5LJ5Y 4ILLA 3S1TA 1P9QC 1N32K 2KM8B 4XK8C 3ZO7A 2Q0ZX 3QWUA 4LF4K 1B4SA 2YKPA 1VQPS 3BQ1A 2QTDA 3QNOA 2ALYB 1OW5A 4I2DA 4OX9K 1YIJS 2QEXS 1D9AA 3M6XA 2QWQA 2C2EA 8ICUA 1RWKB 4AHVA 3V72A 1U7LA 3KK1A 4A5BA 1B0XA 1VQ9S 2DXDA 3CI5A 3CXCM 1RTIA 3TUJC 4OJ3A 1HNXJ 1KNZA 4J9NA 1WSVA 2PSZA 4GV9A 5J29A 2K4EA 3QUTA 4YY3F 1L8OA 2A1JA 1KSPA 4PWUA 3W8GA 5L9NA 1BA1A 3KKAA 3ICXA 3MUTP 1ZBUA 4RKUC 1LB2B 2ZJ5A 4IKFA 5ITHA 2XGPA 2RU9A 3BUZB 1YJ7A 4H4OA 1HNVA 1N5QA 2W6KA 2J8AA 1I94J 5KFDA 1N8RO 2OZMA 4EFAC 4QZVB 3NNHA 3HJEA 5DGBA 4EENA 4KGMA 1VHXA 1ZQAA 2DNMA 4ISFA 1BPZA 4CI0B 5M1NA 4YHHJ 1X8DA 5I3UB 1WC5A 3ZX2A 1MN7A 5JMNA 1ZM4A 4CIFA 3P45B 4A8FA 5GIOA 4DV7J 2W3SA 1ZQFA 2BA9A 4RU9A 4IQMA 1B64A 3A3OB 3CDBA 2RJZA 5D4OA 4IEIA 3HMJG 3C16A 2A1RA 3I4HX 2XCPA 4NRUA 5E3PA 2F3JA 2ZXIA 1EX8A 4E0DA 3F2CA 2LKYA 3UPFA 4LJXA 2VA3A 4EZ9A 4P0QA 1PCAA 4FS1A 4DJBA 4WJ3B 2P9IA 3C1ZA 4OV6A 1WWVA 4M95A 3DLLQ 3HFZB 2DBBA 4CDIA 2ERRA 3HDSA 2VG6A 2MQOA 4C2MA 4DUZJ 1VI7A 3C3LA 5CHGA 4LF6J 3ENHA 2KVIA 7ICRA 1RBOB 1S9GA 4JI2K 4F4AA 4B3SJ 1X5TA 1WF0A 4PCQA 5A8KB 3E3XA 3S3MA 2YKMB 3EVWA 4NXMK 4IRKA 2D0PA 5DM7L 4IYQA 2Z1JA 4QOTA 5JVHQ 1FJEB 1VRTB 3NGZA 4B9TA 1W7WA 3V9WA 2PMZF 2J9DA 3V6KA 2QG9B 4ZITA 3UKUB 3ISCA 2ASLA 3QT7A 3RMCA 1NSKL 2Y3YA 1DEJA 5A8KA 1HWIA 1O03A 4WFYA 4CK2A 2KKPA 3BDPA 2YKQA 1R0BG 2HFVA 4JLHA 2A2DA 1JXVA 5G0RB 1ZQOA 4FJJA 2KJWA 1RK8A 5EWGA 3HZEA 1YI2N 3KKAC 5HMWA 2ASMA 3HPHA 2LU1A 3LPTA 4DV2K 5A8RB 3ALYA 5AHXA 2ZNZA 1FNXH 2X3DA 3UDVA 1UFLA 3K2PA 4TYAA 4X66K 3ENOA 2MXYA 3FZLA 4E1MA 2W7OA 3OTEA 3OUYA 4G1QB 5J0SA 3DGVA 3MFHA 1B9DA 4UT4A 3UR0A 2UUCJ 5IWAK 1ZQUA 1N48A 2R8KA 4KLUA 2RHKA 5HJYA 1OJ4A 4CJRA 4UATA 3I1YA 5LMUK 5AKIA 2Q1NA 1WAFA 3GTYX 4R25A 4QBUA 3SENA 2N1RA 4NL9A 1SXDA 4KFBB 2W2NP 4GXJA 2KFZA 4EIAA 2I9GA 2F77X 1EXQA 3CDAA 2UU9K 3DRSB 2KN4A 4IH5A 1HEKA 4IDHA 3MUVP 3VQPA 3RFAA 3T7ZA 4MFFA 1PUZA 2HSZA 2GQQA 3D6JA 1W9HA 5ALUA 1YJUA 2D8CA 1NJYA 3OXFA 1Q5VA 3RAMA 1OYEA 4FKYA 4CM2A 3D1HA 2E8MA 4AXJA 5JU5A 4G9BA 3PSTA 3WK6A 4QIEA 2AYEA 1C0FA 5F41A 3V4MA 1Z2LA 4KN4A 5AIAA 3A5MC 3JQKA 1N62A 3L2QA 4I27A 2P9KB 3GDQA 4JV0A 4FJ5A 1WSHA 3TANA 2PFOA 3UKRB 4ILRA 1RISA 3CGIA 5SUHA 5KFMA 1R31A 1T44A 2NZ4A 1PVRA 2V67A 4DR5K 3RR8A 1JRPA 1RAHB 1RWXB 3P4UB 4DR1J 2VODA 4K4TA 4DX7A 1Y5NB 3CJKA 4P74A 2HAIA 3D0PA 1D8YA 2DGVA 1CS4A 3KNGA 4CBXA 2V4RA 4HT7A 2W04A 3RH6A 3IRXB 1GT8A 4DV0K 3UQ0A 1ZBLA 2HW3A 2UXCJ 4IWVA 1BIUA 3NMUA 3J7AN 4QU6A 1Z4UA 1SB6A 1U9LA 2PI5A 2Z8QA 3DM2A 2ATLA 4QS9A 2RDIA 1WNSA 3OBYA 2FBYA 2EWHA 1XMQF 4ANEA 3WNEA 2IOFK 3QAUA 1TKTA 5J2BA 3T1YK 1T3VA 3LP0B 3JPNA 1Z4OA 5J2QB 1FERA 4J91A 4DR7J 3ELHA 1EB0A 2QLTA 1JROA 2NO4A 2E5LF 4JI4K 5HNKA 3C95A 3RJMB 2XMKA 2GVDA 1O13A 2DY9A 5GMEA 1SC6A 4PG8A 5J8YC 1CI4A 3US5A 5DDYA 3QQCD 1TKXA 3VCDA 5ALWA 1RT5A 4YDUC 2JXJA 2JEIA 3ALRA 4OFZA 4ELVA 4JHDA 2IC3A 3P39A 4HDGA 5IQ6A 5ADZA 4PGYA 4DU8A 3ZSVA 2KVCA 3M6VA 5ELZA 1E6VA 4KH6A 4WJBA 2LEBA 3N7RC 1RAOA 2WSCC 4OJGA 2XY7A 1Q7YO 2MSNA 4EWTA 5KTQA 2P2CB 2M9KA 5DQHA 1S0NA 1EP4B 3THPA 4CECA 2OYQA 2FJAB 3CB4A 4R66A 2DNYA 4A8WA 4BDYA 1PIEA 2VD3A 4B3TK 3IP4B 4QZEA 5L1JA 4JRQA 2VJVA 5I3UA 2F65A 5C2CA 1J2VA 2IA0A 2XMTA 1RU2A 3RTVA 1M5KC 4YOTA 3VN5A 2B21A 4J2EA 4ZVEA 5TKYA 2LPEA 3VAMA 5CP2A 2E29A 5D0RA 4H0OA 3NASA 1JL2A 4Z7YA 4MKYA 4E19A 5B0EA 3TAMB 3D1QA 5AXKA 1WCNA 2JZ5A 4TY8A 1D9DA 3F73A 2HURA 4MEYA 3ZTOA 4GKJK 1RDCA 4NI2A 4RQ0A 1N0VC 5F8MA 1P1LA 2HMXA 1KVAA 4A2AA 1KRPA 5TZVA 2HWTA 4UY85 3CJTA 4K4ZA 1OY9A 4MLHA 2P9GA 5IC4B 4CD1A 2I5JB 4P2MA 3IRWP 4F3MA 3GR1A 4FSVA 5HMMA 1QHTA 4ZPVR 4YS2A 1B4FA 3QLHB 1TFYA 2E1EA 3KOAA 3PXGa 3J7ZO 3UXOA 3KNAA 2P9PA 4RCHA 3Q23A 3S3NA 1NMDA 4CBUA 2CJYB 2F1HA 3TP2A 4ERDA 8ICJA 1ECWA 4FYXB 4Y6IA 4BGAA 3K1RB 3QUCA 5LSOA 3ZTRA 4UB6U 2BJ8A 5F3ZA 1FRLA 2P9UA 1FRMA 4FF1A 3KLIA 3K1ZA 1ZQIA 4ZP6A 2C2KB 4R8UA 4E1JA 1E6YA 4ZJLA 4CHQA 1U8WA 2JGAA 3M7VA 4DL0C 1NPPA 2C22A 3K75D 3RGIA 3K0SA 2MZTA 3FQKA 1LW2B 3CNQP 3JS6A 1XIQA 1F21A 2AEJA 2K3KA 1MNEA 4C8LA 5AKLA 2BYCA 1IBLF 9ICJA 1QE1B 2P9UB 3E58A 1AYEA 1DGJA 4QYZK 4YB7A 1Q3VA 3BO2A 3BO4A 3Q8UA 3JB9k 1X0FA 3H0LB 4KV8B 1SPBP 2YNGA 1N36K 2P51A 1T6DA 4X84A 4K41A 2XM3A 1S59A 1NK5A 4QJVA 2OAUA 2CADA 2GIQA 2KSOA 4BQLA 2P5VA 2DEJA 4IDKA 4PQUA 2RN2A 1RHRB 1H1VA 5K5MA 2EANA 3IM8A 4JK7A 4XO0A 3A0BU 5J2EA 8ICIA 3NLCA 1GNKA 3TVZA 2YNGB 2D7SA 3HFVA 1WWUA 1FKPA 1KVJA 3ZZRA 3F5EA 5AQJA 4WYBA 1TL3B 1SJRA 2CNLB 6AT1B 1FT8A 5IIIA 3CCLN 5IT0A 1RNHA 5E2QA 4O3NA 2IAJA 4KYZA 3SEIA 2ZIXB 1OVQA 4OLBA 1ZXIA 3RAQA 4C11B 1QAJA 4RLEA 1VJ5A 2OFGX 4NCAA 1TL3A 2KKZA 1JKHA 2X6SA 4JN4A 2CG4A 5CYQA 2KD1A 9ICSA 2BE9B 3CG7A 1HBNA 3MURP 4G3IA 2LVWA 3FKBA 4IQUA 1KVKA 1ZQZA 3AN1A 2FPHX 1X1PA 4LF1A 2FPKA 3UR3C 3UMBA 3QIPB 5AQWA 4OJ6A 3DXKA 3G2XA 1EETA 3DC2A 3K89A 2MKSA 3EJMA 1NNDA 2RSQA 3GYXB 2HSTA 4QS8A 2MKJA 5HP1A 4JI3K 1Q18A 3KKRA 4M3UA 2X1AA 2HMIA 5A0YB 5ETVA 4D3HA 1GAOA 2BEFA 4I64A 2G9OA 1P1TA 4I7FB 5ALXA 5J2PB 6FD1A 5F0XA 4BRAA 2E44A 4RQ5A 4B9MA 1CEZA 3IRXA 3N6MA 9ICMA 1VSMA 2DR8A 4BE1A 2C1EB 3CM5A 7ICJA 5LJWA 3ZLJA 1FRJA 3DM2B 4DV5F 3PW0A 3VAIA 3VGKA 4Z6CA 3JYTB 4KGXB 3SV4A 4WIQA 2XG8A 4AH9A 1ZQSA 2XZDB 2ZBPA 2ZIUA 3PJWA 2XI3A 1UT5A 3LL3A 3SMVA 4I2CA 5IM0A 5SWMA 2LXIA 4WXOA 5F9LA 1UPHA 1ZBIA 2V0NA 3IWXA 4ZPTR 4RNFA 4NB4A 1TVRB 3PIPL 1X4HA 4A5AA 4CLFA 1VQMS 1LXJA 5A6PA 2RB7A 3WX4A 2A18A 1REGX 3PR4A 2HK2A 3W64A 1SH2A 4XA5A 4ECRA 1VK3A 3O9RA 3QSYB 2LMIA 3LDSA 3AJ1A 1UVIA 2AP1A 4Y2IA 1LAWA 1ZQEA 1UZDA 2CPRA 4FBTA 2IVPA 2FVRA 2NRVA 1BPBA 1DK2A 5BRDA 3MN5A 3MN6A 2MSTA 3DYAB 1VYAA 1WG1A 4CDGA 3VGMA 3S9HA 4M41A 4WTYA 4N8OA 1ZQLA 3HHEA 1HHQA 1RILA 3EE3A 1J5EJ 4CNZA 2QB0B 2ZOMA 2LI6A 3UKRA 3VOVA 4KHMA 4K4VA 2H1YA 1B92A 4EX6A 5HHIA 4G1PA 2RPIA 3SMPA 3F41A 2BE2A 1UAXA 4QJFB 1S5LU 4I2FA 2DRBA 4IQWA 1NZAA 4I2PA 1XMOK 4P0PA 3OBWA 4X4UA 1X5PA 5GAHU 5ALGA 2M0GB 2ETJA 1CC7A 2JVRA 1K44A 1Q8IA 2BBEA 1JLAB 4P2SA 3I76A 3K5LA 4BBYA 1OPIA 4Z94A 5ALSA 3V9ZA 2W9AA 4BVOA 4Y2YA 3B0XA 4KPYA 4I2EA 4OHXA 4P4OA 4KLFA 1SUQB 3ISDA 1WUAA 4FNHA 3Q86A 2E3TA 1RTDB 1N54B 1YWXA 3H46O 1F3VA 2OD4A 3HF5A 1VK0A 3FFIA 2HYIB 3LZJA 3THWB 3TA1A 2E8NA 4O5KA 2VWJA 4OHYA 4JI7F 2X3GA 1WN7A 2H3VA 3AO4A 2C2RA 2PI4A 1GMVA 3UFCX 4LT6A 5DLFA 1RKJA 4M5MA 3OJUA 1IG6A 3KLGB 2QLWA 4CJ5A 2VFTA 3Q2TC 1ZTTA 3EICA 3ASMA 3H25A 3CRXA 3W66A 3IAYA 3M9MB 2MJNA 2VOPA 3QGGA 1DLOA 4KR0B 2IJNA 2YWGA 2E1CA 1TKXB 2EG2A 5LY3A 3KLIB 3GZFA 2BVZA 4YR2A 2DR7A 2EFGA 5AR0A 4CZLA 1WDTA 1MN9A 3KFWX 2CN1A 4KAZA 1PILA 2H3IA 4JB3A 3CQYA 3VQBA 3MD3A 3VMFB 2PGCA 3VQEA 2V50A 4FCYA 3M8SA 1Q5YA 3OR2A 2XCAA 4CNYA 2XMVA 5IQQA 4IOBA 3MM6B 2IHR1 2NRTA 1ZD3A 2HRTA 4P4MA 2BM0A 2E7VA 1ATSA 4J9RA 4M5HA 1B0TA 4DL7A 3NKYA 4XPCA 3CSKA 2ZIVB 5AI8A 2QTWA 5J0UA 2I1RA 2UXDJ 3NVWA 4U8YA 4K4IA 2U2FA 4NV0A 3NGDA 3VV2B 2VKQA 1DTQA 2FJBB 2J0QD 1QS4A 3KHGA 4ZPAA 4NEYA 2LECA 1Q81O 4ISGA 3BV8A 3TUPA 2RQ4A 4LRFA 3AQFA 1TYQB 4DXLA 1ZPWX 4LF7J 5HRPA 4YY3J 1C4AA 3MWPA 1NH7A 3O80A 3N4PA 3D5MA 3L7PA 2MLXA 3PHTA 4BC2A 2RQMA 5EN1A 4B3OA 3GJSB 4DU7A 1LW0B 2B0CA 4IUFA 1FNOA 4C6AA 3M8RA 1UHUA 4QR2A 3WT0A 1B99A 1DGSA 1AQ6A 3SCLE 3L7OA 1FE0A 1TK0A 1DRGA 5J2AA 1SKWA 2I5JA 2R8IA 2RRAA 4YOWA 3OYAA 2G8WA 1CQMA 2EKYA 1UZHA 2FSJA 4PZOA 3QT8A 3C15B 4LFCJ 4DV6K 4CJSA 1IG8A 2XYHB 3QRRA 5AQPA 1A7GE 2FLOA 4JOUA 3TUZC 4FZXC 5HMLA 3R9KA 3ZD8A 3QAEA 3GDXA 2X1FA 2RD5C 2ZE2A 1X5SA 7ICHA 2V8GA 1VC5A 3NCRA 4M9JA 4O4RA 3UMGA 3SUQA 1FXLA 2QW9A 2DGQA 1F3FA 3CCRN 1VQOS 2LYVA 1VRTA 2V7YA 4JEPA 3TJAA 2C3YA 2MZRA 3D54A 3H42A 3W9IA 3KVGA 2GWJA 3UCZP 3IMXA 3OLAA 3HVAA 2L08A 4USHA 3HXMA 3D6HB 3PYFA 4OYZA 3L2RA 1KC8O 1H74A 4M5LA 2F4FA 3TNVA 1W2BR 1K6YA 2N4DA 2QRRA 2FBTA 4QZDA 2B4OA 2YJEA 3M9NB 2HFOA 3TUIC 4M9HA 1RWPB 2OD6A 1DK3A 1XNRK 5JICA 1SWWA 3QU5A 2WW8A 2NO5A 5HVGA 2QK9A 3MM5B 1C0UB 1KFTA 1CXQA 1Z1BA 4UB1A 2DKOB 5EE1A 1X9JA 3EXCX 4FOIA 3LQVA 4BWJA 1RDBA 2H51B 3RJEA 1KDHA 1PJ5A 2Z2LA 2BE7D 4U8VA 4DX6A 3IWLA 2XLIA 1OVYA 3D66A 1RZMA 2IAJB 4M5KA 3N9UC 2UUAJ 1H2UX 2G8IA 4UOHA 2YKNB 2M9NA 2IYGA 3TZWA 2MGZA 4CLPA 4HCCA 3C0BA 3TJ9A 2LLZA 3AODA 1BWVA 1T02A 4HHUA 4N41A 4LF7F 3X3UA 3RW7A 3GONA 2V5HG 3MR3A 3AA3A 2WVBA 4F5RA 2YCHA 1GTEA 4WU2A 5DDPC 4JWMA 4I6MA 2Z2YB 2YPZA 8ICCA 3WZ0A 1AUDA 2CZ4A 1Z1ZA 3J7YI 4ILJA 4X5VA 1XU4A 2YKNA 2WAQD 3IMQJ 4EX7A 2QB0A 3V81A 1P27B 4HH1A 8ICZA 4LFBK 3IA0A 1WKKA 2NREA 3I28A 1JJHA 3M30A 1ZZNA 1T8EA 5HRRA 3QSIA 1RWVB 3WK9A 3CFOA 1ITGA 3MEKA 2AIRB 2ZITA 5D0HA 1OWXA 3EN9A 5BREA 4DOZA 2KM8C 1N34K 5DZ6A 4FM1A 4GIBA 3V4IA 4C3LA 8AT1B 4MTPA 2V4QA 2F40A 3NEKA 3EWAA 1LFWA 2G8KA 2Y0SF 1KEKA 2R7SA 2GIFA 1V3RA 5AJ3K 3BH7B 3NH0A 2FLNA 3DLGA 1UVKA 3OHRA 1HYSB 4I2GA 3BJYA 3VPZA 2O66A 3O1BA 2ASJA 2UV8A 3CMAS 1AROP 2O01C 2Q6CA 2RUGA 1PK3A 3MEDA 2ZUGA 4FWKA 1ZOTA 3R8YA 1ZM9A 3DWLA 3PM9A 1AT1B 1NZ8A 2H5JB 3HKWA 5CZ2A 4Q44A 3NS6A 5EU7A 1Q86T 1RT7A 3DKDA 1REVB 4A48A 3NS1A 5LMUF 1QUVA 3BB5A 3TZYA 4WFBQ 3FMWA 5HLFA 3UPQA 2KOBA 5ALQA 1DGKN 1TE2A 4NLRA 3LP3A 2RKIA 4FK4A 2XSJA 4H8KA 1U6BA 3ATVA 2XMJA 1FEEA 5K8OA 3DXMB 3KD3A 1KL9A 4BRQA 2CXEA 2R7RA 1O1WA 3K8VA 1SXEA 2FC9A 2V68A 3MI7X 4PR6A 2MLYA 3BBBA 3IBCB 4MIWA 1NU0A 5BN9A 5J2JA 3SIPB 4DMZA 3DLEB 5EOZA 2UUCK 1RWUA 4ZLLA 3OR2B 5CH7B 4RPYA 5AICA 2D5RA 1ZQVA 2XSJB 1S9EB