1WCLA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
b'EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 21
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wclA00
2ZUDA 4J9RA 1L3UA 4RQ2A 3OSPA 3MABA 3KTQA 4J9OA 8ICWA 1BVSA 2Q0ZX 3SI8A 4UB5A 1V9PA 2IMWP 3C21A 5J0QA 2AGPA 5KFCA 4IQUA 4RQ4A 3UXOA 4EZ9A 1B43A 2HHSA 2NRTA 1NK9A 2JZBB 2ZTEA 4P4OA 4R64A 2ASLA 4B9LA 8ICMA 4FS2A 1TAQA 3G6XA 1RYRA 4E0DA 3ETLA 4DSKA 1TFRA 1D9FA 1BPDA 5J2DA 3JPPA 4ZH4A 3LK9A 4DQQA 5IIKA 1KFDA 1ZQVA 5DDMA 4FO6A 4O9MA 1CUKA 7ICFA 2FMQA 2FLNA 5J2BA 2C2RA 9ICRA 4RUCA 1T4GA 4QZCA 5KFYA 3C2MA 4YMNA 3MDCA 1L3SA 4GXIA 1L5UA 8ICGA 3UQ0A 9ICSA 3OHBA 4KMUA 1X9WA 3RB0A 1JXEA 1KDHA 8ICHA 2ZTCA 5CJ7A 4DOAA 3B0XA 1ZQYA 4RQ7A 1TK5A 3HWTA 4C8KA 5EOZA 5DDYA 1C7YA 1NKEA 5CHGA 4RPZA 4UB3A 3V7JA 1ZQKA 3E2EA 1T3NA 4O3OA 1IXRA 5J0UA 3BJYA 2UVUA 4XRHA 5EWEA 4ECQA 7ICTA 3HP6A 1BPZA 2JEFA 4R66A 2W9AA 5J2HA 4DOCA 4Z6DA 3JPOA 1S0OA 9ICVA 3PR5B 3TANA 4JWMA 5HMLA 2PFNA 3PW7A 3C2LA 1MQ2A 9ICWA 4KLOA 4GLXA 1JXLA 5DKWA 3QZ8A 2HHQA 3M8RA 8ICXA 5KTQA 4UBBA 3Q8RB 2A1JA 3C5GA 5J29A 1XSPA 2XO7A 5DB9A 5CR0A 2R8HA 2XCAA 1NK4A 9ICAA 4NLNA 4DEZA 4F50A 4ED3A 5F9LA 4ELTA 1ZQOA 4B9MA 1RXWA 9ICXA 5KFIA 3OJUA 5L1JA 2IBKA 8ICSA 4ECWA 9ICQA 4QWCA 8ICLA 4EBEA 1NJZA 4RPYA 4YQWA 5J2GA 9ICKA 1NK5A 4I2DA 3RH6A 4BGDA 4F5RA 1KEJA 3QE9Y 2AU0A 2BDPA 1BGXT 4PGXA 1RPLA 2NRZA 2PFPA 3BDPA 4B9UA 4I2AA 4M9NA 5HHIA 5D46A 5BOLA 3HPOA 4QZHA 4ED1A 1SKRA 2BCQA 7ICQA 4I2JA 1T8EA 3ZDBA 7ICOA 4GXJA 4M6WB 7ICIA 3IHQB 4YR0A 3MBYA 3JPTA 4DSJA 4MF2A 3PX0A 3G6YA 4ED0A 1JMSA 3N97B 1JX4A 3M9OB 2J6SA 5DG9A 3MFIA 4JV0A 4MFAA 2W8LA 5KFZA 1HJPA 5KFDA 2C2DA 2BR0A 3AU2A 5DB6A 4QWAA 4Q8EA 2KFNA 3PMLA 1TAUA 3K75D 4C8MA 4MEXA 1ZQMA 4DQSA 4KLHA 3RR7A 3IM1A 4DFJA 2AGQA 4K4IA 5KT6A 8ICKA 4ECRA 2BQ3A 3MGHA 1EXNA 2MUTA 4O3PA 4KITB 5BOMA 1K1SA 5DQIA 1X9MA 4I2EA 5DG7A 4NLKA 9ICPA 1NK6A 3H7IA 4KLSA 4IR9A 4DS4A 8ICUA 4Q45A 2J6UA 4QWEA 4ECZA 5D4BA 1ZQLA 4I2CA 2F1HA 4XQ8A 2V4QA 4GC6A 4ECYA 4KLUA 1B22A 3GV7B 2AQ4A 3Q8SB 3ISCA 4TUQA 4F5PA 1ZJMA 1CEZA 4QW8A 2HHTA 4Q44A 5DLFA 1ZETA 3ORYA 3ISDA 1UA1A 1ZYQA 3GIMA 9ICTA 5IINA 4PGYA 4J9NA 3UXPA 3T5LA 3NGDA 3RBDA 3JPRA 8ICBA 4XUSA 9ICJA 1S97A 3H8JA 4F5OA 4M04A 7ICKA 4I2FA 1XSLA 4G3IA 2F1IA 2R8IA 2DFLA 3V6KA 2ALZA 3ISBA 5KT5A 2BCSA 3Q8LA 4F4WA 3MR6A 2Y1JA 3TAPA 7ICVA 4YN4A 2BCRA 4JV2A 9ICUA 1TV9A 4X5VA 4RT3A 3AUOA 1UT5A 5IIJA 4Z6CA 4PHEA 5J0WA 3T5KA 8ICEA 2KZMA 5KG0A 4IQTA 1S0VA 7ICMA 3TARA 8ICVA 5J2IA 4O3SA 4QZGA 4RNMA 1MC8A 3V72A 5KFWA 1ZQFA 4TUPA 1JN3A 4ED8A 3KHLA 3QEBZ 3TI0A 1NK7A 3KHRA 2RDJA 2KZZA 2PXIA 3RJEA 4B9VA 3PW2A 4O5CA 2BQUA 1ZQTA 4BXOA 8ICNA 1ZQCA 4LVSA 1SL0A 1SL1A 1BPYA 2IHMA 9ICIA 2XGQA 3PW5A 2BQRA 2JEIA 2M9NA 2FPLA 5KG4A 2XY5A 2ZJ8A 2PFOA 3ZDDA 4QZIA 3GFKB 4MF8A 2Y1IA 3RBEA 2R8JA 2PI4A 4M9LA 3C1YA 5J0PA 3OJSA 8ICPA 5IIIA 1LV5A 4I27A 4DWIA 4UAYA 3KHHA 4YP3A 2BCUA 8ICYA 2FPMA 5IIMA 4HYKA 2JZBA 2NRWA 1U4BA 3RAXA 5DLGA 3EW9A 4QWDA 3PW4A 9ICNA 1ZQNA 4C8OA 5JUMA 1S77D 2HHWA 4J9LA 4GXKA 4DL3A 1ZQAA 1ZQJA 4F4KA 4JUZA 4DL6A 4F2RA 3MR3A 1COOA 1DOQA 2FPKA 5J0SA 3TAQA 1SL2A 1ZQSA 4KLFA 4LZGA 4IQWA 1A76A 3SZ2A 2BHNA 4FBTA 3MGIA 3ZDEA 4F2SA 4PPXA 4KLGA 4QZBA 3Q8QB 8ICTA 4YMMA 5HNKA 1NKCA 4NM1A 1Y88A 1XO1A 4PH5A 5EWGA 5J0XA 4M47A 1U49A 4F4YA 3PVXA 4MFCA 1U48A 1N56A 3RJJA 3GV8B 3JPNA 2WTFA 1ZQUA 5KFKA 5KFTA 2ZUCA 2A1JB 3H8SA 5KFPA 1NJYA 4ECVA 1ZQZA 5KFRA 4M9JA 2VA8A 7ICRA 4BWJA 3N4MB 5L1IA 4FBUA 4UBCA 4P2HA 4YR3A 2C22A 2P6UA 4DLEA 3RJHA 2BPGA 4DFMA 2P6RA 3HW8A 4PGQA 4RU9A 4UB1A 1XSNA 1RZTA 1ZQEA 2XY6A 7ICSA 3C5FA 1Z00B 1IM4A 4PHAA 4RQ0A 5DGAA 1ZQPA 5J2JA 2W8KA 4GC7A 2UVRA 3C1ZA 5J2EA 3EZ5A 3V6JA 4KLJA 4DF4A 5KFAA 4KTQA 5J0YA 4J9MA 3SYZA 5KT3A 3EPGA 4NXZA 2I9GA 3JPQA 3UXNA 4O5KA 4DOBA 4RT2A 3PR4A 4DL5A 4M2YA 5J2KA 4MFFA 2ASJA 3M9MB 7ICJA 3B0YA 3PW0A 1ZQHA 4UAZA 4ECUA 2XGPA 2ZJ5A 2J6TA 5DQHA 3H8WA 2DPIA 1Z3EB 3MFHA 2PFQA 2BGWA 3FYHA 1TK8A 4DLGA 3HT3A 4DL7A 4YFKA 4ECSA 5J2CA 8ICIA 1T7PA 1U47A 4O3NA 3C2KA 3PX4A 5J2FA 4EYIB 3H40A 3PV8A 2KN7A 2MUTB 3GILA 4DO9A 4IR1A 2ZUBA 5KG1A 1RXVA 5F9NA 1S76D 2R8GA 1JIHA 4P4MA 3BQTA 5KFUA 3PX6A 4M6WA 5KFFA 3PNCA 4DF8A 2FLLA 4KN7A 4ECTA 9ICMA 5KFOA 2HVHA 4QW9A 2W9BB 3LWLA 4QZEA 5J0RA 1S0MA 9ICCA 1KFTA 5EWFA 3OGUA 3SV3A 1QSLA 2NRVA 4I2IA 1L3TA 7ICHA 1MQ3A 3RJFA 2ZJAA 7ICNA 4QZ8A 3FDSA 4F5QA 1HUOA 2UVWA 4KLEA 4EBCA 3Q8PB 3RB3A 2IA6A 4KN4A 1S9FA 4PHPA 3RRHA 2GWSA 1NK8A 4R8UB 5HMMA 1TVAA 1H38A 5KFLA 3H4DA 4DL2A 2HHXA 5DBBA 2ATLA 9ICGA 2VA3A 3GIKA 9ICLA 3BQ2A 4O3QA 5KFMA 3HX0A 1U45A 4I29A 4F5NA 1MSWD 1HUZA 4NLZA 2HW3A 3C23A 2HHUA 5DQGA 1SKWA 3V7LA 4YMOA 2ISOA 4RNNA 4RNOA 1SKSA 2VA2A 5KFVA 3Q8MA 1KFSA 2HVIA 2NRXA 4P4PA 1BPXA 3BQ0A 1L3VA 3ZD9A 4NLGA 5KFHA 7ICGA 3RH5A 1U9LA 2W9CA 3T5JA 5L9XA 4C8LA 4LZDA 5KFJA 4K4GA 1ZQQA 4TUSA 5DBAA 9ICBA 1ZQBA 3PY8A 4M9HA 2H5XA 4J9QA 4YXJA 4KLTA 2C28A 2KTQA 5KT7A 4ED6A 1XS9D 3M9NB 3V6HA 1N48A 5DB7A 4KLDA 4R65A 4I2GA 3RJIA 5DG8A 3H4BA 4QZ9A 3MR5A 8ICJA 1LB2B 4RQ8A 4I2HA 4ELVA 3RTVA 3RRGA 5HP4A 4I2BA 1D9DA 2JEJA 3RR8A 2JEGA 4B9NA 4J9KA 5DGBA 4O3RA 2RDIA 2OWOA 4DQIA 2FLPA 5HHHA 4DFKA 1TK0A 7ICPA 4YXMA 1QLNA 1D8YA 3GDXA 1KTQA 4TQSA 1QSYA 4M9GA 1K1QA 3EPIA 1QSSA 2FMSA 3OSNA 4UB4A 1ZQXA 2MAXA 5KFGA 8ICCA 5KFBA 2V4RA 4Q43A 4F91B 4YR2A 4F4ZA 4QZDA 5IILA 8ICOA 4IRCA 2KZ3A 3TQ1A 5D49A 5CB1A 1WCLA 3MR2A 5TZVA 3GQCA 9ICEA 4Q8FA 1X2IA 2BKEA 4FS1A 1QTMA 3EWAA 4J9PA 5CP2A 4DSFA 4QZFA 2W9MA 4ECXA 4DS5A 4EYHB 3T5HA 3RJKA 4F3OA 1KSPA 2P66A 4IRDA 1NJWA 1S0NA 4RUAA 8ICQA 5KFQA 3QEAZ 3ZDCA 3LDAA 5KG7A 4RZRA 7ICEA 4B9TA 2IHNA 3UQ2A 4TQRA 4RQ6A 1PZNA 5IIOA 5CWRA 5L1KA 4R63A 4DL4A 3M8SA 4UB2A 3UPQA 4ELUA 4KLMA 8ICAA 4RQ3A 1SZPA 1BPEA 5KG5A 3RAQA 5C5JA 3THVA 1UT8A 4DSEA 2UVVA 2B21A 4O0IA 2DPJA 4F8RA 1NKBA 3G6VA 4UAWA 2R8KA 4NM2A 5CA7A 1XU4A 3AU6A 1Z00A 4YD2A 5DB8A 3LWMA 4YD1A 4YCXA 4J9SA 1X9SA 3ZDAA 3RB4A 5J0OA 3JPSA 3MDAA 3Q8KA 2FMPA 1NOMA 3RJGA 4BDPA 4O5EA 2AQ0A 4JWNA 4KLIA 4F93B 2V9WA 4I28A 3SV4A 3NTUA 4B9SA 4IRKA 1A77A 3GIJA 3EYZA 3T3FA 3V7KA 2KFZA 4BWMA 5J0TA 1KLNA 1ZQIA 4DFPA 4Z6FA 5KFEA 4TURA 4F4XA 4IQVA 1NJXA 1BPBA 2BPFA 4DQPA 4ED2A 2AGOA 1NK0A 3PO4A 4RQ5A 4M0AA 1ZQDA 4JV1A 2ASDA 8ICZA 5KT4A 4JK1A 4EEYA 2ISPA 3TFRA 4RQ1A 4DQRA 4KLLA 5L1LA 5BPCA 5KFXA 5KFNA 4EZ6A 2LYHA 1XC9A 3OHAA 4QWBA 4CCHA 2ZTDA 5J2AA 3PMNA 7ICLA 2I1QA 1ZQWA 3GV5B 1ZQRA 4YG2A 2XY7A 4YVZA 5KFSA 1S10A 2PI5A 2XC9A 8ICRA 9ICFA 4PHDA 4K4HA 2VANA 3GIIA 4XA5A 9ICOA 2AJQA 3KHGA 3ZD8A 9ICHA 2C2EA 5KG3A 3K4GA 1UA0A 2W9BA 4MEYA 2BCVA 3PO5A 1ZJNA 8ICFA 4QZAA 1WCNA 4KLQA 7ICUA 4C8NA 4Z6EA 5KG2A 3RH4A 3TFSA 3QZ7A 2F1JA 4DSIA 4NY8A 4EBDA 4F92B 1XWLA 4RPXA 2XCPA 2W9CB 5DBCA 1KRPA 1D8LA 3BQ1A 5KT2A 1AROP 2BPCA 5KG6A 4BXOB 1ZQGA 1TKDA 1DGSA 4R8UA 4DSLA 4UQGA 1RYSA 3RB6A 4ED7A 2HHVA
chains in the Genus database with same CATH superfamily
3WKAA 5CRXA 2H3IA 2EANA 2AGPA 4Y2YA 2NRTA 1NK9A 2JZBB 8ICMA 2FDRA 1DRGA 4FS2A 1RYRA 4E0DA 1FFVA 2K4HA 1BPDA 4AYBC 5J2DA 2KKPA 3N7SC 1KFDA 4O9MA 1URJA 2ZIUB 2ZXHA 5KFYA 2YX8A 8ICGA 9ICSA 3UQ0A 3OHBA 2YTUA 1X9WA 1ZQYA 1PVRA 1YT3A 4LJXA 1IG6A 2O6KA 1NZPA 2UVUA 5EWEA 3KZIU 2HBJA 1PK1B 5J2HA 4Z6DA 3JPOA 1S0OA 3PR5B 3PW7A 1N2XA 9ICWA 5AI0A 5DKWA 5KTQA 3QX7A 3Q8RB 5ALZA 2A1JA 3C5GA 2XO7A 3AM9A 5ALWA 1NK4A 3IP4B 9ICXA 2IBKA 3NVZA 1NJZA 3H8MA 4I2DA 3RH6A 3D2QA 3BDPA 1BGXT 3EUB2 2NRZA 5D46A 4QZHA 3TADA 7ICOA 4M6WB 1QCKA 3FAHA 3G6YA 4ED0A 1JX4A 3WK9A 2H3FA 5DG9A 4MFAA 5KFZA 4QWAA 4Q8EA 4MEXA 4DQSA 2KVSA 2BQ3A 2K4IA 4O3PA 3PSIA 5BOMA 2G08A 9ICPA 2KMDA 3NVVA 3SR6A 3H7IA 4C4RA 4I2CA 4KLUA 2V4QA 2AQ4A 2KKVA 3NASA 1FEZA 4TUQA 3GIMA 2EAPA 4PGYA 2KJ8A 4XUSA 2EAMA 2E1FA 2DFLA 3V6KA 2ALZA 2KOBA 2E8MA 3TAPA 3AEVA 2IOHA 4YN4A 5AM2A 3AUOA 4Z6CA 4UARA 4EELA 5J0WA 2LYBA 5KG0A 4IQTA 5J2IA 4OJOA 4ED8A 3TI0A 2RDJA 2PXIA 4B9VA 4OCZA 1ZQTA 4CDGA 1PUZA 5KG4A 2ZJ8A 2MU2A 3OJSA 5IIIA 4EEKA 4DWIA 4QJFB 2FPMA 5IIMA 1D8BA 2NRWA 1Q8KA 1U4BA 3RAXA 5DLGA 2DF4B 2VJ4A 1S77D 1JUDA 4G9BA 4F4KA 1COOA 1DOQA 2FPKA 5J0SA 1NI3A 1SL2A 4IQWA 3K1RB 4KLGA 1X66A 3Q8QB 5HNKA 1Y88A 1XO1A 5EWGA 5J0XA 1U49A 4MFCA 1SWVA 3AMZA 3H8SA 1NJYA 5KFRA 2VA8A 4KX3A 4FZNA 5L1IA 5ALLA 3F2CA 5AKLA 3HW8A 4PGQA 4RU9A 4Y2PA 4PHAA 2W11A 5J2JA 3LVVA 1VJ5A 4J9MA 3EPGA 2I9GA 3UXNA 4O5KA 1IIPA 4M2YA 3B0YA 1ZQHA 4P0PB 4Y2XA 1TE2A 2XGPA 2K4EA 2PFQA 3MFHA 1TK8A 3HT3A 1OUQA 2HDOA 5AIBA 4O3NA 5JTIA 3C2KA 2MRLA 3C29A 2I5HA 2KN7A 2G09A 2Y9TA 1KBUA 5KFFA 1M6YA 2FLLA 4QW9A 3NS1A 2KSOA 3SV3A 2K60A 5AKEA 3NRWA 2ZJAA 4QZ8A 3HILA 3FDSA 5T14A 4EBCA 4KN4A 1S9FA 4PHPA 3RRHA 2GWSA 4R8UB 2EZYA 5AIAA 3H4DA 2LM4A 2HHXA 2DQNB 1Q46A 4O3QA 1U45A 2IOFA 3QU9A 1Z1BA 4QNLA 3H0RB 1SKWA 2XICA 4YMOA 1SKSA 1KFSA 2HVIA 4P4PA 4NLGA 3RH5A 2PMZF 4C8LA 4NV0A 5KFJA 1ZQQA 4TUSA 4WJ3B 1L8OA 3PSFA 4QIWF 1N48A 2F76X 4I2GA 3QUQA 3H4BA 3MR5A 2KP7A 1LB2B 3A0BU 2A1AA 1X6JA 2G06A 2N1RA 2ZG6A 4UB8U 4UAVA 2RDIA 2WB1C 5HHHA 2KICA 3QNMA 4TQSA 1WWUA 2ZIUA 3HKZC 4UB4A 1ZRNA 2MAXA 5KFBA 2EZZA 4F91B 4Q43A 1ZD2P 4QZDA 8ICOA 3B9JA 5CB1A 3MR2A 4FZMA 2BKEA 2K4PA 1XNSA 2WF7A 4DS5A 2YN4A 1KSPA 5FP0A 5KFQA 3QEAZ 3LDAA 4CRXA 4CE6A 3ALRA 7ICEA 2VKQA 2WF5A 3NVWA 4R63A 4UB2A 2CN1A 2DKXA 5KG5A 3RAQA 1UT8A 4U6PA 4OJPA 2UVVA 2DL0A 4NM2A 3BS5B 3AU6A 4YD1A 3MDAA 2GO7A 3RF9A 2OEHA 4O5EA 4JB3A 3NTUA 2WF6A 4IRKA 2KJ5A 3V7KA 4BWMA 1L7OA 5AKXA 4F4XA 5AM4A 4ICAA 3PO4A 1ZQDA 4FFDA 2ASDA 2KK0A 1VLBA 3TFRA 3D2SA 4RQ1A 3OHAA 1RDFA 3PMNA 5ALNA 1ZQRA 1DK2A 2XY7A 9ICFA 4K4HA 2DUYA 2VANA 3GIIA 5ALTA 2HBMA 4XA5A 2AJQA 3PO5A 2KG5A 3RH4A 1Q3UA 3QZ7A 2F1JA 3D6JA 4NY8A 1KRPA 2W9CB 5DBCA 4KX5A 2W55A 1S8OA 2BDUA 5KT2A 3AL0B 5ALEA 1RYSA 1COKA 3RFAA 4RQ2A 2IMWP 3C21A 5KFCA 4IQUA 2HHSA 3GU3A 4R64A 2ASLA 4B9LA 2FJ6A 4DSKA 1TFRA 1D9FA 1ECWA 3LK9A 3IV6A 2DGZA 2DKZA 3CNHA 1ZQVA 2DBYA 7ICFA 2C2RA 4RUCA 1L3SA 4GXIA 2AH5A 4KMUA 2L5YA 2H3VA 2ZTCA 3B0XA 3T79A 4RQ7A 3VCBA 1Z4OA 4C8KA 1C7YA 1NKEA 2Q4TA 4UB3A 3V7JA 5G5HA 1ZQKA 1IXRA 7ICTA 2KHQA 3F5AA 3HP6A 1X42A 1BPZA 3PZPA 2JEFA 2W9AA 4DOCA 3TANA 2PFNA 1MQ2A 3SAGA 4CF4A 3M8RA 5J29A 2R8HA 1CI4A 4MHVA 1UPHA 4F50A 5F9LA 4ELTA 1ZQOA 5L1JA 8ICLA 4GFJA 4RPYA 2KE7A 2F8KA 4NL9A 2WAQF 2AU0A 1KEJA 2PFPA 4IL6U 4M9NA 3I1YA 4ED1A 1SKRA 3E0FA 3LVWA 4I2JA 1T8EA 1BNOA 3ZDBA 4GXJA 4C80A 3IHQB 4YR0A 3MBYA 4Y2VA 5AI9A 4CGZA 2KSOB 1JI7A 9ICVA 4JV0A 5KAFU 3SQIA 2KFNA 3K75D 2YMPA 4C8MA 4KLHA 4DFJA 2AGQA 3MGHA 3FC4A 4KITB 4C0ZA 5DG7A 1NK6A 4DS4A 2J6UA 4QWEA 2F1HA 4ECYA 1PVQA 3ISCA 1UCVA 1CEZA 1ZETA 9ICTA 1UA1A 5IINA 4J9NA 3T5LA 3BZCA 3RBDA 3A0HU 5ALVA 1S97A 1SGGA 4F5OA 4I2FA 1XSLA 2F1IA 2R8IA 2QKQA 2Y1JA 3F2BA 4JV2A 2IOFK 4X5VA 4RT3A 1UT5A 5IIJA 3U26A 2KIVA 1S0VA 7ICMA 3TARA 8ICVA 3ETRA 3RJEA 5A0LA 1PK3A 5ALPA 4LVSA 9ICIA 2XGQA 3PW5A 2BQRA 1S5LU 2JEIA 2JH1A 2OHFA 3GFKB 2KVCA 5ALDA 3WKBA 5J0PA 1DGJA 3M1YA 8ICPA 1LV5A 2YB1A 4I27A 2D8CA 2HCFA 4UAYA 2BCUA 1ZRMA 3EW9A 3PW4A 1V38A 5JUMA 5AI4A 4JUZA 1T3QA 1ZQSA 1A76A 3SZ2A 4F2SA 8ICTA 4PH5A 4OJLA 1U48A 3L3FX 3RJJA 1ZQUA 3F53A 2QB0B 1ZQZA 4FBUA 2G0AA 5E79U 4YR3A 3SAHA 2P6UA 2E8OA 4DFMA 1C20A 2P6RA 2W04A 1XSNA 1RZTA 2XY6A 3ZI4A 5AK3A 2NO4A 2B6GA 2G5HB 4KLJA 3V6JA 3F2DA 4DF4A 2Y0SF 3JPQA 4DOBA 2KIWA 5TISU 1OXJA 4DL5A 5J2KA 4MFFA 3PW0A 2JV3A 2ZJ5A 5DQHA 1Z3EB 3KOOA 4DLGA 5KAIU 3BS5A 2LKYA 5GTIU 1T7PA 3PX4A 3PV8A 4DO9A 2JHDA 2R8GA 1JIHA 3BQTA 4OJ5A 4DF8A 2BZFA 5J0RA 2JGAA 1S0MA 5ALMA 9ICCA 1KFTA 3OGUA 1QQ7A 1KN5A 4A8EA 1N60A 1MQ3A 2UVWA 4KLEA 1N62A 3ED5A 1N5XA 2PKEA 5HMMA 5KFLA 9ICLA 5KFMA 4I29A 4ACOA 2WFAA 2RHFA 1YZ7A 5DQGA 2E8NA 4Y2QA 5KFVA 1RQNA 2NRXA 1BPXA 3BQ0A 5AK4A 1L3VA 5KFHA 7ICGA 1U9LA 2W9CA 5KL1B 5L9XA 3T5JA 4RQMA 5AK5A 5AM1A 9ICBA 1XO0A 2H5XA 5KT7A 2F3NA 3NUQA 5DB7A 1O08A 3RJIA 4C7YA 5DG8A 4QZ9A 8ICJA 4I2HA 2JMGA 2M0NA 3RTVA 3KKAC 2W03A 5ALUA 3MGVA 3QU5A 2JEGA 4B6JA 2YQEA 4O3RA 5DGBA 2FLPA 1D8YA 1K1QA 1QSSA 2OM6A 3I76A 8ICCA 2V4RA 4F4ZA 4IRCA 1SXDA 9ICEA 2RQ5A 1QTMA 3E58A 3EWAA 5CP2A 4ECXA 4AYBF 3RJKA 2JH7A 3DEEA 4RQNA 3FM9A 3CW2C 2EAOA 5HR6A 2ZIXB 1L6NA 2EH9A 1X6IA 5IIOA 2FE9A 1SB3C 1QH9A 4RQ3A 5C5JA 2B21A 4PJ0U 4C7ZA 4O0IA 2DPJA 4F8RA 1NKBA 5CA7A 2ZIWB 1XU4A 1Z00A 4YD2A 2AXTU 5DB8A 3QU4A 2FMPA 1NOMA 3RJGA 4JWNA 4KLIA 4F93B 4B9SA 3EYZA 3LYSA 5AHXA 5J0TA 1ZQIA 4DFPA 1NJXA 3QU2A 5AICA 3I28A 2Y9UA 1NK0A 8ICZA 5KT4A 2KD1A 5L1LA 2KEYA 5KFXA 4EZ6A 5ALQA 4QWBA 2W7OA 5J2AA 1ZQWA 4YG2A 4YVZA 5KFSA 2PI5A 2F8LA 2XC9A 8ICRA 2LYAA 1J2NA 3J81j 4GIBA 1ZXIA 5KG3A 3K4GA 4NWIA 2W9BA 4MEYA 7ICUA 5ALRA 3TFSA 2XCPA 5K4LA 5AKKA 1NZBA 5KG6A 1DGSA 1B4FA 5ALHA 4J9OA 2GLEA 2W3SA 2H3ZA 4Y2TA 4RQ4A 3UXOA 4EZ9A 1B43A 2ZTEA 1N5WA 2F2AB 4ZH4A 2LBOA 5IIKA 4US9A 3WK5A 1CUKA 5J2BA 2XVTA 2YY6A 1T4GA 4NLBA 3D2NA 3MDCA 1L5UA 1JXEA 1KDHA 1SV0C 5CJ7A 5AKYA 3HWTA 3NVYA 2K89A 5CHGA 4RPZA 1L7NA 3WK8A 3E2EA 5J0UA 3BJYA 1UQVA 2OCEA 4ECQA 2MA1A 1JROA 1NNLA 2WAQC 4KLOA 1JXLA 5J8YC 1DK3A 2QB0A 5JU5A 1FFUA 4NLNA 3UMCA 2EZXA 4B9MA 1RXWA 3OJUA 9ICQA 8ICSA 4ECWA 4YQWA 9ICKA 1NK5A 2KJ9A 2NO5A 1TAMA 4F5RA 2K8BB 5B66U 5HHIA 3HPOA 5AK6A 1J2MA 4MF2A 2NYVA 1JMSA 4UB6U 5EE1A 3M9OB 3MFIA 1TAUA 1ZQMA 3RR7A 3TACB 3IM1A 2AHOB 5KT6A 4ECRA 1EXNA 2WF9A 1K1SA 5DQIA 1QQ5A 4NLKA 2W54A 4KLSA 2WHEA 2G5IB 8ICUA 4ECZA 4GC6A 3GV7B 3Q8SB 2RP5A 4CF5A 1L8LA 3CP8A 4F5PA 1Z4NA 2HHTA 2E5SA 5DLFA 3ORYA 3ISDA 1ZYQA 8ICBA 3JPRA 4M04A 3H8JA 7ICKA 3ISBA 2EQYA 4EX6A 3MR6A 2BCRA 1TV9A 2W43A 8ICEA 4PHEA 3WU2U 2HI0A 4RNMA 3OTQA 3V72A 2F44A 1JN3A 3TADC 1NK7A 3KHRA 2HSZA 1Z19A 4O5CA 8ICNA 4BXOA 1ZQCA 1SL0A 1SL1A 2PFOA 3ZDDA 4QZIA 4MF8A 3RBEA 1UHUA 3C1YA 1N63A 3K1ZA 8ICYA 2G07A 4HYKA 3WKEA 9ICNA 1GO3F 1ZQNA 4C8OA 2VJ5A 3BZKA 2HHWA 1ZQJA 4F2RA 3TAQA 4US8A 1ZD5A 4LZGA 3AQEA 4FBTA 3MGIA 2B0CA 2Z7JA 3QXGA 4F4YA 2WTFA 2ZUCA 4ECVA 7ICRA 3IRUA 3AN1A 2C22A 4BJQA 4DLEA 3RJHA 2BPGA 4BX9C 2WB1F 1ZQEA 1WWVA 1IM4A 1Z00B 4RQ0A 5DGAA 3HKZF 1ZQPA 3PSTA 4GC7A 2ZIXA 5KFAA 5J0YA 4NXZA 1YZ6A 2XIDA 3PR4A 7ICJA 3NRZA 3M9MB 3WKDA 4EENA 1T94A 3WKCA 1MA7A 4DL7A 4YFKA 2ZIWA 5J2CA 8ICIA 5J2FA 5GTHU 3H40A 2MUTB 5KG1A 5AI6A 5F9NA 2D6FC 1S76D 5ALYA 5KFUA 4ECTA 2HVHA 2FI1A 2W9BB 4FZLA 2LMRA 4NLCA 2NRVA 1L3TA 1QSLA 5HR7A 4F5QA 3KD3A 4F71A 1JALA 3RB3A 1NK8A 1H38A 5DBBA 9ICGA 3BQ2A 3HX0A 4P0QB 2HBKA 2QARB 1MSWD 1HUZA 4NLZA 5AKIA 2HW3A 3C23A 2HHUA 3HRDD 4RNNA 4RNOA 3Q8MA 5ALKA 3IDWA 3ZD9A 3OPXA 4IS7A 3CRXA 5ALXA 1ZQBA 4M9HA 4J9QA 4YXJA 4KLTA 2KTQA 4ED6A 1XS9D 3M9NB 3V6HA 4EX7A 1RM6C 5EE3A 4RQ8A 4Y2UA 4PZNA 1V85A 4I2BA 1P7DA 1D9DA 1KL9A 4KMOB 4B9NA 4DCCA 3N28A 2OWOA 4UATA 4CF3A 2K8CB 2KHVA 1TK0A 4YXMA 1QLNA 3GDXA 1KTQA 4PL1A 4M9GA 3OSNA 1ZQXA 3MC1A 3TQ1A 1WCLA 3GQCA 5TZVA 4Q8FA 1O03A 3UMGA 4FS1A 3KBBA 4J9PA 4EYHB 1WUDA 4F3OA 2P66A 4IRDA 1S0NA 2LPEA 3ZDCA 4RZRA 4B9TA 2IHNA 3UQ2A 2JXJA 4HAIA 4TQRA 1PZNA 5CWRA 5ALIA 1WYGA 2OH2A 4DL4A 5H2FU 3CYMA 4ELUA 4KLMA 8ICAA 1BPEA 4CNQA 3THVA 4DSEA 3G6VA 3N7RC 4UAUA 4O3MA 3WK4A 1X9SA 3ZDAA 3RB4A 5J0OA 3JPSA 3Q8KA 2E3TA 2V9WA 3SV4A 2QB1A 2A19A 1A77A 3GIJA 2KFZA 3SENA 1KLNA 5AI5A 4Z6FA 4IQVA 2BPFA 4ED2A 2AGOA 4RQ5A 4M0AA 4JV1A 4EEYA 5BPCA 1KKXA 1LKYB 5KFNA 2LYHA 2PMZC 2ZTDA 2I1QA 2E1EA 4PHDA 1MN8A 1J97A 4QIWC 2W7PA 9ICHA 3KHGA 2C2EA 4BUGA 1UA0A 2BCVA 1SWWA 1ZJNA 8ICFA 2EDUA 2GH1A 3KFUF 5KG2A 4F92B 3ICXA 1AROP 2I6XA 4BXOB 1ZQGA 4DSLA 3RB6A 5C0YA 2HHVA 2ZUDA 4J9RA 1L3UA 1K5OA 3OSPA 3MABA 3KTQA 8ICWA 1DXSA 1BVSA 2Q0ZX 3SI8A 4UB5A 1V9PA 5J0QA 5ALGA 3DV9A 4P4OA 1TAQA 3G6XA 5AM3A 3ETLA 1HEKA 3SD7A 3WK7A 3N7PD 3JPPA 4DQQA 3SMVA 2WF8A 3H0MB 5DDMA 4FO6A 2FMQA 2FLNA 9ICRA 4QZCA 3C2MA 4YMNA 1BNPA 3RB0A 4AP9A 8ICHA 2YB4A 4DOAA 1TK5A 5EOZA 5DDYA 4C4TA 2ESEA 2HOFA 1T3NA 4O3OA 5KNIA 4XRHA 4R66A 4JWMA 5HMLA 3C2LA 4Y2JA 4GLXA 3QZ8A 2HHQA 8ICXA 3H0LB 4UBBA 1XSPA 5DB9A 2RLTA 5CR0A 9ICAA 2XCAA 4DEZA 4ED3A 5KFIA 2HBLA 4Y2RA 4QWCA 4EBEA 1L7MA 5J2GA 4BGDA 3QE9Y 4B9UA 2BDPA 4PGXA 4I2AA 1RPLA 7ICQA 5BOLA 2BCQA 7ICIA 2ZIVA 3JPTA 4DSJA 3PX0A 3N97B 2J6SA 2W8LA 5KFDA 1HJPA 2C2DA 2BR0A 3AU2A 5DB6A 4OO1J 3PMLA 1SV4A 3BQ7A 4USAA 3UM9A 3S6JA 4K4IA 8ICKA 2MUTA 4PZOA 1X9MA 4I2EA 4IR9A 4Q45A 5D4BA 1ZQLA 4XQ8A 1B22A 1ZD3A 1AQ6A 2YMLA 3QUCA 3PSPA 1ZJMA 4QW8A 4Q44A 2OXOA 2LHTA 2KV2A 3UXPA 3NGDA 9ICJA 1F0MA 4G3IA 3BS7A 5KT5A 2BCSA 5F3XB 3Q8LA 4F4WA 7ICVA 9ICUA 4P0QA 2QARA 4J03A 4ZOHC 4NL9C 3T5KA 2KZMA 4JMUA 4O3SA 4QZGA 2KNJA 1MC8A 5KFWA 1ZQFA 4TUPA 3KHLA 3QEBZ 1RQLA 2KZZA 4DFDA 3PW2A 2BQUA 1ED1A 1BPYA 1CRXA 2IHMA 2M9NA 2FPLA 2XY5A 1A6SA 3UMBA 3QYPA 2Y1IA 2PI4A 2R8JA 4M9LA 1WG8A 5ALJA 1FO4A 5JRTA 1LVHA 3KHHA 4YP3A 1VDVA 2JZBA 3QU7A 3L4PA 4QWDA 3DDHA 4Y2SA 4U7CA 1KQQA 4J9LA 2RRDA 4GXKA 4DL3A 1ZQAA 4DL6A 3MR3A 4KLFA 2BHNA 4PPXA 1L7PA 3ZDEA 5AI8A 4UASA 2VIXA 2HOQA 4QZBA 4YMMA 1NKCA 2F77X 4NM1A 4M47A 5EE0A 3PVXA 1N56A 3GV8B 3JPNA 5KFKA 1FIQA 5KFTA 2A1JB 5KFPA 4M9JA 1V97A 4BWJA 3N4MB 4UBCA 4P2HA 1X9XA 2YMQA 1IV8A 5G5GA 4UB1A 3O0FA 4OD0A 7ICSA 3C5FA 1PK1A 3L5KA 2LI6A 2P35A 1QQ6A 2W8KA 2UVRA 3C1ZA 5J2EA 3EZ5A 5ALOA 2NV3A 4KTQA 1B0XA 3SYZA 5KT3A 3F5EA 4RT2A 1OW5A 2ASJA 5AKHA 2E8PA 4UAZA 4ECUA 2J6TA 2DPIA 3H8WA 5AM5A 2R18A 2BGWA 3FYHA 2D3DA 3IG8A 4ECSA 1U47A 4EYIB 5AM0A 2YMMA 3GILA 4IR1A 2ZUBA 1RXVA 1KW4A 3KKAA 4P4MA 3GZFA 1SXEA 3PX6A 4M6WA 3PNCA 4KN7A 3SAFA 9ICMA 5KFOA 4F72A 3LWLA 4QZEA 1SZHA 5EWFA 2MSNA 5AKZA 4I2IA 7ICHA 3RJFA 3IG5A 7ICNA 1HUOA 3Q8PB 2IA6A 1LKYA 1TVAA 4DL2A 2ATLA 2VA3A 3GIKA 3AQFA 4F5NA 1Q3VA 3V7LA 2ISOA 2VA2A 1N61A 1F5SA 1Z1VA 3WK6A 2W3RA 4LZDA 4K4GA 1ZQ1C 5DBAA 3PY8A 2C28A 4KLDA 5B5EU 4R65A 4IC9A 5CEHA 3R9KA 3RRGA 2ES6A 5L1MA 5HP4A 3VC8A 2JEJA 3RR8A 3M6KA 5ALSA 4J9KA 3IN5A 4DQIA 4DFKA 7ICPA 1F44A 1QSYA 1PVPA 3EPIA 2FMSA 2GOLA 2CXYA 2XI9A 4FE3A 5KFGA 2H3QA 4YR2A 5IILA 2KZ3A 2Y0SC 5D49A 5KL8B 1X2IA 1ZD4A 5AKGA 5EE9A 4QZFA 4DSFA 2W9MA 2HOIA 3T5HA 3HJEA 3SEIA 1NJWA 3C28A 4RUAA 8ICQA 5KG7A 3TKAA 5AKJA 4RQ6A 4C4SA 2CRXA 5L1KA 2ZIVB 3M8SA 3UPQA 1SZPA 4OJ6A 4UAWA 2R8KA 2DWQA 1HIWA 3KZXA 3LWMA 4J9SA 3QUBA 4YCXA 4ELVA 1ZOLA 4BDPA 1A0PA 2AQ0A 4I28A 3T3FA 4PL2A 1RYUA 3ONNA 5KFEA 4TURA 4DQPA 1BPBA 4P0PA 5ALFA 1JRPA 4JK1A 2ISPA 4DQRA 4UW9A 4KLLA 2JR5A 1XC9A 2JRZA 4CCHA 7ICLA 3GV5B 2CPRA 2ODGA 1S10A 1RG6A 1SV0A 3QUTA 9ICOA 3ZD8A 2QLTA 4QZAA 3M6ZA 1WCNA 4KLQA 4C8NA 4Z6EA 2ZXIA 2K8AA 4DSIA 2HMXA 2LM1A 4EBDA 1XWLA 4RPXA 3M7DA 4NJ8A 1D8LA 3BQ1A 1X40A 1SIJA 2BPCA 1TKDA 4R8UA 2OYYA 2A3VA 5J8YA 4UQGA 4ED7A
chains in the Genus database with same CATH topology
2ZUDA 4J9RA 1L3UA 4RQ2A 3OSPA 3MABA 3KTQA 4J9OA 8ICWA 1BVSA 2Q0ZX 3SI8A 4UB5A 1V9PA 2IMWP 3C21A 5J0QA 2AGPA 5KFCA 4IQUA 4RQ4A 3UXOA 4EZ9A 1B43A 2HHSA 2NRTA 1NK9A 2JZBB 2ZTEA 4P4OA 4R64A 2ASLA 4B9LA 8ICMA 4FS2A 1TAQA 3G6XA 1RYRA 4E0DA 3ETLA 4DSKA 1TFRA 1D9FA 1BPDA 5J2DA 3JPPA 4ZH4A 3LK9A 4DQQA 5IIKA 1KFDA 1ZQVA 5DDMA 4FO6A 4O9MA 1CUKA 7ICFA 2FMQA 2FLNA 5J2BA 2C2RA 9ICRA 4RUCA 1T4GA 4QZCA 5KFYA 3C2MA 4YMNA 3MDCA 1L3SA 4GXIA 1L5UA 8ICGA 3UQ0A 9ICSA 3OHBA 4KMUA 1X9WA 3RB0A 1JXEA 1KDHA 8ICHA 2ZTCA 5CJ7A 4DOAA 3B0XA 1ZQYA 4RQ7A 1TK5A 3HWTA 4C8KA 5EOZA 5DDYA 1C7YA 1NKEA 5CHGA 4RPZA 4UB3A 3V7JA 1ZQKA 3E2EA 1T3NA 4O3OA 1IXRA 5J0UA 3BJYA 2UVUA 4XRHA 5EWEA 4ECQA 7ICTA 3HP6A 1BPZA 2JEFA 4R66A 2W9AA 5J2HA 4DOCA 4Z6DA 3JPOA 1S0OA 9ICVA 3PR5B 3TANA 4JWMA 5HMLA 2PFNA 3PW7A 3C2LA 1MQ2A 9ICWA 4KLOA 4GLXA 1JXLA 5DKWA 3QZ8A 2HHQA 3M8RA 8ICXA 5KTQA 4UBBA 3Q8RB 2A1JA 3C5GA 5J29A 1XSPA 2XO7A 5DB9A 5CR0A 2R8HA 2XCAA 1NK4A 9ICAA 4NLNA 4DEZA 4F50A 4ED3A 5F9LA 4ELTA 1ZQOA 4B9MA 1RXWA 9ICXA 5KFIA 3OJUA 5L1JA 2IBKA 8ICSA 4ECWA 9ICQA 4QWCA 8ICLA 4EBEA 1NJZA 4RPYA 4YQWA 5J2GA 9ICKA 1NK5A 4I2DA 3RH6A 4BGDA 4F5RA 1KEJA 3QE9Y 2AU0A 2BDPA 1BGXT 4PGXA 1RPLA 2NRZA 2PFPA 3BDPA 4B9UA 4I2AA 4M9NA 5HHIA 5D46A 5BOLA 3HPOA 4QZHA 4ED1A 1SKRA 2BCQA 7ICQA 4I2JA 1T8EA 3ZDBA 7ICOA 4GXJA 4M6WB 7ICIA 3IHQB 4YR0A 3MBYA 3JPTA 4DSJA 4MF2A 3PX0A 3G6YA 4ED0A 1JMSA 3N97B 1JX4A 3M9OB 2J6SA 5DG9A 3MFIA 4JV0A 4MFAA 2W8LA 5KFZA 1HJPA 5KFDA 2C2DA 2BR0A 3AU2A 5DB6A 4QWAA 4Q8EA 2KFNA 3PMLA 1TAUA 3K75D 4C8MA 4MEXA 1ZQMA 4DQSA 4KLHA 3RR7A 3IM1A 4DFJA 2AGQA 4K4IA 5KT6A 8ICKA 4ECRA 2BQ3A 3MGHA 1EXNA 2MUTA 4O3PA 4KITB 5BOMA 1K1SA 5DQIA 1X9MA 4I2EA 5DG7A 4NLKA 9ICPA 1NK6A 3H7IA 4KLSA 4IR9A 4DS4A 8ICUA 4Q45A 2J6UA 4QWEA 4ECZA 5D4BA 1ZQLA 4I2CA 2F1HA 4XQ8A 2V4QA 4GC6A 4ECYA 4KLUA 1B22A 3GV7B 2AQ4A 3Q8SB 3ISCA 4TUQA 4F5PA 1ZJMA 1CEZA 4QW8A 2HHTA 4Q44A 5DLFA 1ZETA 3ORYA 3ISDA 1UA1A 1ZYQA 3GIMA 9ICTA 5IINA 4PGYA 4J9NA 3UXPA 3T5LA 3NGDA 3RBDA 3JPRA 8ICBA 4XUSA 9ICJA 1S97A 3H8JA 4F5OA 4M04A 7ICKA 4I2FA 1XSLA 4G3IA 2F1IA 2R8IA 2DFLA 3V6KA 2ALZA 3ISBA 5KT5A 2BCSA 3Q8LA 4F4WA 3MR6A 2Y1JA 3TAPA 7ICVA 4YN4A 2BCRA 4JV2A 9ICUA 1TV9A 4X5VA 4RT3A 3AUOA 1UT5A 5IIJA 4Z6CA 4PHEA 5J0WA 3T5KA 8ICEA 2KZMA 5KG0A 4IQTA 1S0VA 7ICMA 3TARA 8ICVA 5J2IA 4O3SA 4QZGA 4RNMA 1MC8A 3V72A 5KFWA 1ZQFA 4TUPA 1JN3A 4ED8A 3KHLA 3QEBZ 3TI0A 1NK7A 3KHRA 2RDJA 2KZZA 2PXIA 3RJEA 4B9VA 3PW2A 4O5CA 2BQUA 1ZQTA 4BXOA 8ICNA 1ZQCA 4LVSA 1SL0A 1SL1A 1BPYA 2IHMA 9ICIA 2XGQA 3PW5A 2BQRA 2JEIA 2M9NA 2FPLA 5KG4A 2XY5A 2ZJ8A 2PFOA 3ZDDA 4QZIA 3GFKB 4MF8A 2Y1IA 3RBEA 2R8JA 2PI4A 4M9LA 3C1YA 5J0PA 3OJSA 8ICPA 5IIIA 1LV5A 4I27A 4DWIA 4UAYA 3KHHA 4YP3A 2BCUA 8ICYA 2FPMA 5IIMA 4HYKA 2JZBA 2NRWA 1U4BA 3RAXA 5DLGA 3EW9A 4QWDA 3PW4A 9ICNA 1ZQNA 4C8OA 5JUMA 1S77D 2HHWA 4J9LA 4GXKA 4DL3A 1ZQAA 1ZQJA 4F4KA 4JUZA 4DL6A 4F2RA 3MR3A 1COOA 1DOQA 2FPKA 5J0SA 3TAQA 1SL2A 1ZQSA 4KLFA 4LZGA 4IQWA 1A76A 3SZ2A 2BHNA 4FBTA 3MGIA 3ZDEA 4F2SA 4PPXA 4KLGA 4QZBA 3Q8QB 8ICTA 4YMMA 5HNKA 1NKCA 4NM1A 1Y88A 1XO1A 4PH5A 5EWGA 5J0XA 4M47A 1U49A 4F4YA 3PVXA 4MFCA 1U48A 1N56A 3RJJA 3GV8B 3JPNA 2WTFA 1ZQUA 5KFKA 5KFTA 2ZUCA 2A1JB 3H8SA 5KFPA 1NJYA 4ECVA 1ZQZA 5KFRA 4M9JA 2VA8A 7ICRA 4BWJA 3N4MB 5L1IA 4FBUA 4UBCA 4P2HA 4YR3A 2C22A 2P6UA 4DLEA 3RJHA 2BPGA 4DFMA 2P6RA 3HW8A 4PGQA 4RU9A 4UB1A 1XSNA 1RZTA 1ZQEA 2XY6A 7ICSA 3C5FA 1Z00B 1IM4A 4PHAA 4RQ0A 5DGAA 1ZQPA 5J2JA 2W8KA 4GC7A 2UVRA 3C1ZA 5J2EA 3EZ5A 3V6JA 4KLJA 4DF4A 5KFAA 4KTQA 5J0YA 4J9MA 3SYZA 5KT3A 3EPGA 4NXZA 2I9GA 3JPQA 3UXNA 4O5KA 4DOBA 4RT2A 3PR4A 4DL5A 4M2YA 5J2KA 4MFFA 2ASJA 3M9MB 7ICJA 3B0YA 3PW0A 1ZQHA 4UAZA 4ECUA 2XGPA 2ZJ5A 2J6TA 5DQHA 3H8WA 2DPIA 1Z3EB 3MFHA 2PFQA 2BGWA 3FYHA 1TK8A 4DLGA 3HT3A 4DL7A 4YFKA 4ECSA 5J2CA 8ICIA 1T7PA 1U47A 4O3NA 3C2KA 3PX4A 5J2FA 4EYIB 3H40A 3PV8A 2KN7A 2MUTB 3GILA 4DO9A 4IR1A 2ZUBA 5KG1A 1RXVA 5F9NA 1S76D 2R8GA 1JIHA 4P4MA 3BQTA 5KFUA 3PX6A 4M6WA 5KFFA 3PNCA 4DF8A 2FLLA 4KN7A 4ECTA 9ICMA 5KFOA 2HVHA 4QW9A 2W9BB 3LWLA 4QZEA 5J0RA 1S0MA 9ICCA 1KFTA 5EWFA 3OGUA 3SV3A 1QSLA 2NRVA 4I2IA 1L3TA 7ICHA 1MQ3A 3RJFA 2ZJAA 7ICNA 4QZ8A 3FDSA 4F5QA 1HUOA 2UVWA 4KLEA 4EBCA 3Q8PB 3RB3A 2IA6A 4KN4A 1S9FA 4PHPA 3RRHA 2GWSA 1NK8A 4R8UB 5HMMA 1TVAA 1H38A 5KFLA 3H4DA 4DL2A 2HHXA 5DBBA 2ATLA 9ICGA 2VA3A 3GIKA 9ICLA 3BQ2A 4O3QA 5KFMA 3HX0A 1U45A 4I29A 4F5NA 1MSWD 1HUZA 4NLZA 2HW3A 3C23A 2HHUA 5DQGA 1SKWA 3V7LA 4YMOA 2ISOA 4RNNA 4RNOA 1SKSA 2VA2A 5KFVA 3Q8MA 1KFSA 2HVIA 2NRXA 4P4PA 1BPXA 3BQ0A 1L3VA 3ZD9A 4NLGA 5KFHA 7ICGA 3RH5A 1U9LA 2W9CA 3T5JA 5L9XA 4C8LA 4LZDA 5KFJA 4K4GA 1ZQQA 4TUSA 5DBAA 9ICBA 1ZQBA 3PY8A 4M9HA 2H5XA 4J9QA 4YXJA 4KLTA 2C28A 2KTQA 5KT7A 4ED6A 1XS9D 3M9NB 3V6HA 1N48A 5DB7A 4KLDA 4R65A 4I2GA 3RJIA 5DG8A 3H4BA 4QZ9A 3MR5A 8ICJA 1LB2B 4RQ8A 4I2HA 4ELVA 3RTVA 3RRGA 5HP4A 4I2BA 1D9DA 2JEJA 3RR8A 2JEGA 4B9NA 4J9KA 5DGBA 4O3RA 2RDIA 2OWOA 4DQIA 2FLPA 5HHHA 4DFKA 1TK0A 7ICPA 4YXMA 1QLNA 1D8YA 3GDXA 1KTQA 4TQSA 1QSYA 4M9GA 1K1QA 3EPIA 1QSSA 2FMSA 3OSNA 4UB4A 1ZQXA 2MAXA 5KFGA 8ICCA 5KFBA 2V4RA 4Q43A 4F91B 4YR2A 4F4ZA 4QZDA 5IILA 8ICOA 4IRCA 2KZ3A 3TQ1A 5D49A 5CB1A 1WCLA 3MR2A 5TZVA 3GQCA 9ICEA 4Q8FA 1X2IA 2BKEA 4FS1A 1QTMA 3EWAA 4J9PA 5CP2A 4DSFA 4QZFA 2W9MA 4ECXA 4DS5A 4EYHB 3T5HA 3RJKA 4F3OA 1KSPA 2P66A 4IRDA 1NJWA 1S0NA 4RUAA 8ICQA 5KFQA 3QEAZ 3ZDCA 3LDAA 5KG7A 4RZRA 7ICEA 4B9TA 2IHNA 3UQ2A 4TQRA 4RQ6A 1PZNA 5IIOA 5CWRA 5L1KA 4R63A 4DL4A 3M8SA 4UB2A 3UPQA 4ELUA 4KLMA 8ICAA 4RQ3A 1SZPA 1BPEA 5KG5A 3RAQA 5C5JA 3THVA 1UT8A 4DSEA 2UVVA 2B21A 4O0IA 2DPJA 4F8RA 1NKBA 3G6VA 4UAWA 2R8KA 4NM2A 5CA7A 1XU4A 3AU6A 1Z00A 4YD2A 5DB8A 3LWMA 4YD1A 4YCXA 4J9SA 1X9SA 3ZDAA 3RB4A 5J0OA 3JPSA 3MDAA 3Q8KA 2FMPA 1NOMA 3RJGA 4BDPA 4O5EA 2AQ0A 4JWNA 4KLIA 4F93B 2V9WA 4I28A 3SV4A 3NTUA 4B9SA 4IRKA 1A77A 3GIJA 3EYZA 3T3FA 3V7KA 2KFZA 4BWMA 5J0TA 1KLNA 1ZQIA 4DFPA 4Z6FA 5KFEA 4TURA 4F4XA 4IQVA 1NJXA 1BPBA 2BPFA 4DQPA 4ED2A 2AGOA 1NK0A 3PO4A 4RQ5A 4M0AA 1ZQDA 4JV1A 2ASDA 8ICZA 5KT4A 4JK1A 4EEYA 2ISPA 3TFRA 4RQ1A 4DQRA 4KLLA 5L1LA 5BPCA 5KFXA 5KFNA 4EZ6A 2LYHA 1XC9A 3OHAA 4QWBA 4CCHA 2ZTDA 5J2AA 3PMNA 7ICLA 2I1QA 1ZQWA 3GV5B 1ZQRA 4YG2A 2XY7A 4YVZA 5KFSA 1S10A 2PI5A 2XC9A 8ICRA 9ICFA 4PHDA 4K4HA 2VANA 3GIIA 4XA5A 9ICOA 2AJQA 3KHGA 3ZD8A 9ICHA 2C2EA 5KG3A 3K4GA 1UA0A 2W9BA 4MEYA 2BCVA 3PO5A 1ZJNA 8ICFA 4QZAA 1WCNA 4KLQA 7ICUA 4C8NA 4Z6EA 5KG2A 3RH4A 3TFSA 3QZ7A 2F1JA 4DSIA 4NY8A 4EBDA 4F92B 1XWLA 4RPXA 2XCPA 2W9CB 5DBCA 1KRPA 1D8LA 3BQ1A 5KT2A 1AROP 2BPCA 5KG6A 4BXOB 1ZQGA 1TKDA 1DGSA 4R8UA 4DSLA 4UQGA 1RYSA 3RB6A 4ED7A 2HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUD A;  4J9R A;  1L3U A;  4RQ2 A;  3OSP A;  3MAB A;  3KTQ A;  4J9O A;  8ICW A;  1BVS A;  2Q0Z X;  3SI8 A;  4UB5 A;  1V9P A;  2IMW P;  3C21 A;  5J0Q A;  2AGP A;  5KFC A;  4IQU A;  4RQ4 A;  3UXO A;  4EZ9 A;  1B43 A;  2HHS A;  2NRT A;  1NK9 A;  2JZB B;  2ZTE A;  4P4O A;  4R64 A;  2ASL A;  4B9L A;  8ICM A;  4FS2 A;  1TAQ A;  3G6X A;  1RYR A;  4E0D A;  3ETL A;  4DSK A;  1TFR A;  1D9F A;  1BPD A;  5J2D A;  3JPP A;  4ZH4 A;  3LK9 A;  4DQQ A;  5IIK A;  1KFD A;  1ZQV A;  5DDM A;  4FO6 A;  4O9M A;  1CUK A;  7ICF A;  2FMQ A;  2FLN A;  5J2B A;  2C2R A;  9ICR A;  4RUC A;  1T4G A;  4QZC A;  5KFY A;  3C2M A;  4YMN A;  3MDC A;  1L3S A;  4GXI A;  1L5U A;  8ICG A;  3UQ0 A;  9ICS A;  3OHB A;  4KMU A;  1X9W A;  3RB0 A;  1JXE A;  1KDH A;  8ICH A;  2ZTC A;  5CJ7 A;  4DOA A;  3B0X A;  1ZQY A;  4RQ7 A;  1TK5 A;  3HWT A;  4C8K A;  5EOZ A;  5DDY A;  1C7Y A;  1NKE A;  5CHG A;  4RPZ A;  4UB3 A;  3V7J A;  1ZQK A;  3E2E A;  1T3N A;  4O3O A;  1IXR A;  5J0U A;  3BJY A;  2UVU A;  4XRH A;  5EWE A;  4ECQ A;  7ICT A;  3HP6 A;  1BPZ A;  2JEF A;  4R66 A;  2W9A A;  5J2H A;  4DOC A;  4Z6D A;  3JPO A;  1S0O A;  9ICV A;  3PR5 B;  3TAN A;  4JWM A;  5HML A;  2PFN A;  3PW7 A;  3C2L A;  1MQ2 A;  9ICW A;  4KLO A;  4GLX A;  1JXL A;  5DKW A;  3QZ8 A;  2HHQ A;  3M8R A;  8ICX A;  5KTQ A;  4UBB A;  3Q8R B;  2A1J A;  3C5G A;  5J29 A;  1XSP A;  2XO7 A;  5DB9 A;  5CR0 A;  2R8H A;  2XCA A;  1NK4 A;  9ICA A;  4NLN A;  4DEZ A;  4F50 A;  4ED3 A;  5F9L A;  4ELT A;  1ZQO A;  4B9M A;  1RXW A;  9ICX A;  5KFI A;  3OJU A;  5L1J A;  2IBK A;  8ICS A;  4ECW A;  9ICQ A;  4QWC A;  8ICL A;  4EBE A;  1NJZ A;  4RPY A;  4YQW A;  5J2G A;  9ICK A;  1NK5 A;  4I2D A;  3RH6 A;  4BGD A;  4F5R A;  1KEJ A;  3QE9 Y;  2AU0 A;  2BDP A;  1BGX T;  4PGX A;  1RPL A;  2NRZ A;  2PFP A;  3BDP A;  4B9U A;  4I2A A;  4M9N A;  5HHI A;  5D46 A;  5BOL A;  3HPO A;  4QZH A;  4ED1 A;  1SKR A;  2BCQ A;  7ICQ A;  4I2J A;  1T8E A;  3ZDB A;  7ICO A;  4GXJ A;  4M6W B;  7ICI A;  3IHQ B;  4YR0 A;  3MBY A;  3JPT A;  4DSJ A;  4MF2 A;  3PX0 A;  3G6Y A;  4ED0 A;  1JMS A;  3N97 B;  1JX4 A;  3M9O B;  2J6S A;  5DG9 A;  3MFI A;  4JV0 A;  4MFA A;  2W8L A;  5KFZ A;  1HJP A;  5KFD A;  2C2D A;  2BR0 A;  3AU2 A;  5DB6 A;  4QWA A;  4Q8E A;  2KFN A;  3PML A;  1TAU A;  3K75 D;  4C8M A;  4MEX A;  1ZQM A;  4DQS A;  4KLH A;  3RR7 A;  3IM1 A;  4DFJ A;  2AGQ A;  4K4I A;  5KT6 A;  8ICK A;  4ECR A;  2BQ3 A;  3MGH A;  1EXN A;  2MUT A;  4O3P A;  4KIT B;  5BOM A;  1K1S A;  5DQI A;  1X9M A;  4I2E A;  5DG7 A;  4NLK A;  9ICP A;  1NK6 A;  3H7I A;  4KLS A;  4IR9 A;  4DS4 A;  8ICU A;  4Q45 A;  2J6U A;  4QWE A;  4ECZ A;  5D4B A;  1ZQL A;  4I2C A;  2F1H A;  4XQ8 A;  2V4Q A;  4GC6 A;  4ECY A;  4KLU A;  1B22 A;  3GV7 B;  2AQ4 A;  3Q8S B;  3ISC A;  4TUQ A;  4F5P A;  1ZJM A;  1CEZ A;  4QW8 A;  2HHT A;  4Q44 A;  5DLF A;  1ZET A;  3ORY A;  3ISD A;  1UA1 A;  1ZYQ A;  3GIM A;  9ICT A;  5IIN A;  4PGY A;  4J9N A;  3UXP A;  3T5L A;  3NGD A;  3RBD A;  3JPR A;  8ICB A;  4XUS A;  9ICJ A;  1S97 A;  3H8J A;  4F5O A;  4M04 A;  7ICK A;  4I2F A;  1XSL A;  4G3I A;  2F1I A;  2R8I A;  2DFL A;  3V6K A;  2ALZ A;  3ISB A;  5KT5 A;  2BCS A;  3Q8L A;  4F4W A;  3MR6 A;  2Y1J A;  3TAP A;  7ICV A;  4YN4 A;  2BCR A;  4JV2 A;  9ICU A;  1TV9 A;  4X5V A;  4RT3 A;  3AUO A;  1UT5 A;  5IIJ A;  4Z6C A;  4PHE A;  5J0W A;  3T5K A;  8ICE A;  2KZM A;  5KG0 A;  4IQT A;  1S0V A;  7ICM A;  3TAR A;  8ICV A;  5J2I A;  4O3S A;  4QZG A;  4RNM A;  1MC8 A;  3V72 A;  5KFW A;  1ZQF A;  4TUP A;  1JN3 A;  4ED8 A;  3KHL A;  3QEB Z;  3TI0 A;  1NK7 A;  3KHR A;  2RDJ A;  2KZZ A;  2PXI A;  3RJE A;  4B9V A;  3PW2 A;  4O5C A;  2BQU A;  1ZQT A;  4BXO A;  8ICN A;  1ZQC A;  4LVS A;  1SL0 A;  1SL1 A;  1BPY A;  2IHM A;  9ICI A;  2XGQ A;  3PW5 A;  2BQR A;  2JEI A;  2M9N A;  2FPL A;  5KG4 A;  2XY5 A;  2ZJ8 A;  2PFO A;  3ZDD A;  4QZI A;  3GFK B;  4MF8 A;  2Y1I A;  3RBE A;  2R8J A;  2PI4 A;  4M9L A;  3C1Y A;  5J0P A;  3OJS A;  8ICP A;  5III A;  1LV5 A;  4I27 A;  4DWI A;  4UAY A;  3KHH A;  4YP3 A;  2BCU A;  8ICY A;  2FPM A;  5IIM A;  4HYK A;  2JZB A;  2NRW A;  1U4B A;  3RAX A;  5DLG A;  3EW9 A;  4QWD A;  3PW4 A;  9ICN A;  1ZQN A;  4C8O A;  5JUM A;  1S77 D;  2HHW A;  4J9L A;  4GXK A;  4DL3 A;  1ZQA A;  1ZQJ A;  4F4K A;  4JUZ A;  4DL6 A;  4F2R A;  3MR3 A;  1COO A;  1DOQ A;  2FPK A;  5J0S A;  3TAQ A;  1SL2 A;  1ZQS A;  4KLF A;  4LZG A;  4IQW A;  1A76 A;  3SZ2 A;  2BHN A;  4FBT A;  3MGI A;  3ZDE A;  4F2S A;  4PPX A;  4KLG A;  4QZB A;  3Q8Q B;  8ICT A;  4YMM A;  5HNK A;  1NKC A;  4NM1 A;  1Y88 A;  1XO1 A;  4PH5 A;  5EWG A;  5J0X A;  4M47 A;  1U49 A;  4F4Y A;  3PVX A;  4MFC A;  1U48 A;  1N56 A;  3RJJ A;  3GV8 B;  3JPN A;  2WTF A;  1ZQU A;  5KFK A;  5KFT A;  2ZUC A;  2A1J B;  3H8S A;  5KFP A;  1NJY A;  4ECV A;  1ZQZ A;  5KFR A;  4M9J A;  2VA8 A;  7ICR A;  4BWJ A;  3N4M B;  5L1I A;  4FBU A;  4UBC A;  4P2H A;  4YR3 A;  2C22 A;  2P6U A;  4DLE A;  3RJH A;  2BPG A;  4DFM A;  2P6R A;  3HW8 A;  4PGQ A;  4RU9 A;  4UB1 A;  1XSN A;  1RZT A;  1ZQE A;  2XY6 A;  7ICS A;  3C5F A;  1Z00 B;  1IM4 A;  4PHA A;  4RQ0 A;  5DGA A;  1ZQP A;  5J2J A;  2W8K A;  4GC7 A;  2UVR A;  3C1Z A;  5J2E A;  3EZ5 A;  3V6J A;  4KLJ A;  4DF4 A;  5KFA A;  4KTQ A;  5J0Y A;  4J9M A;  3SYZ A;  5KT3 A;  3EPG A;  4NXZ A;  2I9G A;  3JPQ A;  3UXN A;  4O5K A;  4DOB A;  4RT2 A;  3PR4 A;  4DL5 A;  4M2Y A;  5J2K A;  4MFF A;  2ASJ A;  3M9M B;  7ICJ A;  3B0Y A;  3PW0 A;  1ZQH A;  4UAZ A;  4ECU A;  2XGP A;  2ZJ5 A;  2J6T A;  5DQH A;  3H8W A;  2DPI A;  1Z3E B;  3MFH A;  2PFQ A;  2BGW A;  3FYH A;  1TK8 A;  4DLG A;  3HT3 A;  4DL7 A;  4YFK A;  4ECS A;  5J2C A;  8ICI A;  1T7P A;  1U47 A;  4O3N A;  3C2K A;  3PX4 A;  5J2F A;  4EYI B;  3H40 A;  3PV8 A;  2KN7 A;  2MUT B;  3GIL A;  4DO9 A;  4IR1 A;  2ZUB A;  5KG1 A;  1RXV A;  5F9N A;  1S76 D;  2R8G A;  1JIH A;  4P4M A;  3BQT A;  5KFU A;  3PX6 A;  4M6W A;  5KFF A;  3PNC A;  4DF8 A;  2FLL A;  4KN7 A;  4ECT A;  9ICM A;  5KFO A;  2HVH A;  4QW9 A;  2W9B B;  3LWL A;  4QZE A;  5J0R A;  1S0M A;  9ICC A;  1KFT A;  5EWF A;  3OGU A;  3SV3 A;  1QSL A;  2NRV A;  4I2I A;  1L3T A;  7ICH A;  1MQ3 A;  3RJF A;  2ZJA A;  7ICN A;  4QZ8 A;  3FDS A;  4F5Q A;  1HUO A;  2UVW A;  4KLE A;  4EBC A;  3Q8P B;  3RB3 A;  2IA6 A;  4KN4 A;  1S9F A;  4PHP A;  3RRH A;  2GWS A;  1NK8 A;  4R8U B;  5HMM A;  1TVA A;  1H38 A;  5KFL A;  3H4D A;  4DL2 A;  2HHX A;  5DBB A;  2ATL A;  9ICG A;  2VA3 A;  3GIK A;  9ICL A;  3BQ2 A;  4O3Q A;  5KFM A;  3HX0 A;  1U45 A;  4I29 A;  4F5N A;  1MSW D;  1HUZ A;  4NLZ A;  2HW3 A;  3C23 A;  2HHU A;  5DQG A;  1SKW A;  3V7L A;  4YMO A;  2ISO A;  4RNN A;  4RNO A;  1SKS A;  2VA2 A;  5KFV A;  3Q8M A;  1KFS A;  2HVI A;  2NRX A;  4P4P A;  1BPX A;  3BQ0 A;  1L3V A;  3ZD9 A;  4NLG A;  5KFH A;  7ICG A;  3RH5 A;  1U9L A;  2W9C A;  3T5J A;  5L9X A;  4C8L A;  4LZD A;  5KFJ A;  4K4G A;  1ZQQ A;  4TUS A;  5DBA A;  9ICB A;  1ZQB A;  3PY8 A;  4M9H A;  2H5X A;  4J9Q A;  4YXJ A;  4KLT A;  2C28 A;  2KTQ A;  5KT7 A;  4ED6 A;  1XS9 D;  3M9N B;  3V6H A;  1N48 A;  5DB7 A;  4KLD A;  4R65 A;  4I2G A;  3RJI A;  5DG8 A;  3H4B A;  4QZ9 A;  3MR5 A;  8ICJ A;  1LB2 B;  4RQ8 A;  4I2H A;  4ELV A;  3RTV A;  3RRG A;  5HP4 A;  4I2B A;  1D9D A;  2JEJ A;  3RR8 A;  2JEG A;  4B9N A;  4J9K A;  5DGB A;  4O3R A;  2RDI A;  2OWO A;  4DQI A;  2FLP A;  5HHH A;  4DFK A;  1TK0 A;  7ICP A;  4YXM A;  1QLN A;  1D8Y A;  3GDX A;  1KTQ A;  4TQS A;  1QSY A;  4M9G A;  1K1Q A;  3EPI A;  1QSS A;  2FMS A;  3OSN A;  4UB4 A;  1ZQX A;  2MAX A;  5KFG A;  8ICC A;  5KFB A;  2V4R A;  4Q43 A;  4F91 B;  4YR2 A;  4F4Z A;  4QZD A;  5IIL A;  8ICO A;  4IRC A;  2KZ3 A;  3TQ1 A;  5D49 A;  5CB1 A;  1WCL A;  3MR2 A;  5TZV A;  3GQC A;  9ICE A;  4Q8F A;  1X2I A;  2BKE A;  4FS1 A;  1QTM A;  3EWA A;  4J9P A;  5CP2 A;  4DSF A;  4QZF A;  2W9M A;  4ECX A;  4DS5 A;  4EYH B;  3T5H A;  3RJK A;  4F3O A;  1KSP A;  2P66 A;  4IRD A;  1NJW A;  1S0N A;  4RUA A;  8ICQ A;  5KFQ A;  3QEA Z;  3ZDC A;  3LDA A;  5KG7 A;  4RZR A;  7ICE A;  4B9T A;  2IHN A;  3UQ2 A;  4TQR A;  4RQ6 A;  1PZN A;  5IIO A;  5CWR A;  5L1K A;  4R63 A;  4DL4 A;  3M8S A;  4UB2 A;  3UPQ A;  4ELU A;  4KLM A;  8ICA A;  4RQ3 A;  1SZP A;  1BPE A;  5KG5 A;  3RAQ A;  5C5J A;  3THV A;  1UT8 A;  4DSE A;  2UVV A;  2B21 A;  4O0I A;  2DPJ A;  4F8R A;  1NKB A;  3G6V A;  4UAW A;  2R8K A;  4NM2 A;  5CA7 A;  1XU4 A;  3AU6 A;  1Z00 A;  4YD2 A;  5DB8 A;  3LWM A;  4YD1 A;  4YCX A;  4J9S A;  1X9S A;  3ZDA A;  3RB4 A;  5J0O A;  3JPS A;  3MDA A;  3Q8K A;  2FMP A;  1NOM A;  3RJG A;  4BDP A;  4O5E A;  2AQ0 A;  4JWN A;  4KLI A;  4F93 B;  2V9W A;  4I28 A;  3SV4 A;  3NTU A;  4B9S A;  4IRK A;  1A77 A;  3GIJ A;  3EYZ A;  3T3F A;  3V7K A;  2KFZ A;  4BWM A;  5J0T A;  1KLN A;  1ZQI A;  4DFP A;  4Z6F A;  5KFE A;  4TUR A;  4F4X A;  4IQV A;  1NJX A;  1BPB A;  2BPF A;  4DQP A;  4ED2 A;  2AGO A;  1NK0 A;  3PO4 A;  4RQ5 A;  4M0A A;  1ZQD A;  4JV1 A;  2ASD A;  8ICZ A;  5KT4 A;  4JK1 A;  4EEY A;  2ISP A;  3TFR A;  4RQ1 A;  4DQR A;  4KLL A;  5L1L A;  5BPC A;  5KFX A;  5KFN A;  4EZ6 A;  2LYH A;  1XC9 A;  3OHA A;  4QWB A;  4CCH A;  2ZTD A;  5J2A A;  3PMN A;  7ICL A;  2I1Q A;  1ZQW A;  3GV5 B;  1ZQR A;  4YG2 A;  2XY7 A;  4YVZ A;  5KFS A;  1S10 A;  2PI5 A;  2XC9 A;  8ICR A;  9ICF A;  4PHD A;  4K4H A;  2VAN A;  3GII A;  4XA5 A;  9ICO A;  2AJQ A;  3KHG A;  3ZD8 A;  9ICH A;  2C2E A;  5KG3 A;  3K4G A;  1UA0 A;  2W9B A;  4MEY A;  2BCV A;  3PO5 A;  1ZJN A;  8ICF A;  4QZA A;  1WCN A;  4KLQ A;  7ICU A;  4C8N A;  4Z6E A;  5KG2 A;  3RH4 A;  3TFS A;  3QZ7 A;  2F1J A;  4DSI A;  4NY8 A;  4EBD A;  4F92 B;  1XWL A;  4RPX A;  2XCP A;  2W9C B;  5DBC A;  1KRP A;  1D8L A;  3BQ1 A;  5KT2 A;  1ARO P;  2BPC A;  5KG6 A;  4BXO B;  1ZQG A;  1TKD A;  1DGS A;  4R8U A;  4DSL A;  4UQG A;  1RYS A;  3RB6 A;  4ED7 A;  2HHV A; 
#chains in the Genus database with same CATH topology
 3WKA A;  5CRX A;  2H3I A;  2EAN A;  2AGP A;  4Y2Y A;  2NRT A;  1NK9 A;  2JZB B;  8ICM A;  2FDR A;  1DRG A;  4FS2 A;  1RYR A;  4E0D A;  1FFV A;  2K4H A;  1BPD A;  4AYB C;  5J2D A;  2KKP A;  3N7S C;  1KFD A;  4O9M A;  1URJ A;  2ZIU B;  2ZXH A;  5KFY A;  2YX8 A;  8ICG A;  9ICS A;  3UQ0 A;  3OHB A;  2YTU A;  1X9W A;  1ZQY A;  1PVR A;  1YT3 A;  4LJX A;  1IG6 A;  2O6K A;  1NZP A;  2UVU A;  5EWE A;  3KZI U;  2HBJ A;  1PK1 B;  5J2H A;  4Z6D A;  3JPO A;  1S0O A;  3PR5 B;  3PW7 A;  1N2X A;  9ICW A;  5AI0 A;  5DKW A;  5KTQ A;  3QX7 A;  3Q8R B;  5ALZ A;  2A1J A;  3C5G A;  2XO7 A;  3AM9 A;  5ALW A;  1NK4 A;  3IP4 B;  9ICX A;  2IBK A;  3NVZ A;  1NJZ A;  3H8M A;  4I2D A;  3RH6 A;  3D2Q A;  3BDP A;  1BGX T;  3EUB 2;  2NRZ A;  5D46 A;  4QZH A;  3TAD A;  7ICO A;  4M6W B;  1QCK A;  3FAH A;  3G6Y A;  4ED0 A;  1JX4 A;  3WK9 A;  2H3F A;  5DG9 A;  4MFA A;  5KFZ A;  4QWA A;  4Q8E A;  4MEX A;  4DQS A;  2KVS A;  2BQ3 A;  2K4I A;  4O3P A;  3PSI A;  5BOM A;  2G08 A;  9ICP A;  2KMD A;  3NVV A;  3SR6 A;  3H7I A;  4C4R A;  4I2C A;  4KLU A;  2V4Q A;  2AQ4 A;  2KKV A;  3NAS A;  1FEZ A;  4TUQ A;  3GIM A;  2EAP A;  4PGY A;  2KJ8 A;  4XUS A;  2EAM A;  2E1F A;  2DFL A;  3V6K A;  2ALZ A;  2KOB A;  2E8M A;  3TAP A;  3AEV A;  2IOH A;  4YN4 A;  5AM2 A;  3AUO A;  4Z6C A;  4UAR A;  4EEL A;  5J0W A;  2LYB A;  5KG0 A;  4IQT A;  5J2I A;  4OJO A;  4ED8 A;  3TI0 A;  2RDJ A;  2PXI A;  4B9V A;  4OCZ A;  1ZQT A;  4CDG A;  1PUZ A;  5KG4 A;  2ZJ8 A;  2MU2 A;  3OJS A;  5III A;  4EEK A;  4DWI A;  4QJF B;  2FPM A;  5IIM A;  1D8B A;  2NRW A;  1Q8K A;  1U4B A;  3RAX A;  5DLG A;  2DF4 B;  2VJ4 A;  1S77 D;  1JUD A;  4G9B A;  4F4K A;  1COO A;  1DOQ A;  2FPK A;  5J0S A;  1NI3 A;  1SL2 A;  4IQW A;  3K1R B;  4KLG A;  1X66 A;  3Q8Q B;  5HNK A;  1Y88 A;  1XO1 A;  5EWG A;  5J0X A;  1U49 A;  4MFC A;  1SWV A;  3AMZ A;  3H8S A;  1NJY A;  5KFR A;  2VA8 A;  4KX3 A;  4FZN A;  5L1I A;  5ALL A;  3F2C A;  5AKL A;  3HW8 A;  4PGQ A;  4RU9 A;  4Y2P A;  4PHA A;  2W11 A;  5J2J A;  3LVV A;  1VJ5 A;  4J9M A;  3EPG A;  2I9G A;  3UXN A;  4O5K A;  1IIP A;  4M2Y A;  3B0Y A;  1ZQH A;  4P0P B;  4Y2X A;  1TE2 A;  2XGP A;  2K4E A;  2PFQ A;  3MFH A;  1TK8 A;  3HT3 A;  1OUQ A;  2HDO A;  5AIB A;  4O3N A;  5JTI A;  3C2K A;  2MRL A;  3C29 A;  2I5H A;  2KN7 A;  2G09 A;  2Y9T A;  1KBU A;  5KFF A;  1M6Y A;  2FLL A;  4QW9 A;  3NS1 A;  2KSO A;  3SV3 A;  2K60 A;  5AKE A;  3NRW A;  2ZJA A;  4QZ8 A;  3HIL A;  3FDS A;  5T14 A;  4EBC A;  4KN4 A;  1S9F A;  4PHP A;  3RRH A;  2GWS A;  4R8U B;  2EZY A;  5AIA A;  3H4D A;  2LM4 A;  2HHX A;  2DQN B;  1Q46 A;  4O3Q A;  1U45 A;  2IOF A;  3QU9 A;  1Z1B A;  4QNL A;  3H0R B;  1SKW A;  2XIC A;  4YMO A;  1SKS A;  1KFS A;  2HVI A;  4P4P A;  4NLG A;  3RH5 A;  2PMZ F;  4C8L A;  4NV0 A;  5KFJ A;  1ZQQ A;  4TUS A;  4WJ3 B;  1L8O A;  3PSF A;  4QIW F;  1N48 A;  2F76 X;  4I2G A;  3QUQ A;  3H4B A;  3MR5 A;  2KP7 A;  1LB2 B;  3A0B U;  2A1A A;  1X6J A;  2G06 A;  2N1R A;  2ZG6 A;  4UB8 U;  4UAV A;  2RDI A;  2WB1 C;  5HHH A;  2KIC A;  3QNM A;  4TQS A;  1WWU A;  2ZIU A;  3HKZ C;  4UB4 A;  1ZRN A;  2MAX A;  5KFB A;  2EZZ A;  4F91 B;  4Q43 A;  1ZD2 P;  4QZD A;  8ICO A;  3B9J A;  5CB1 A;  3MR2 A;  4FZM A;  2BKE A;  2K4P A;  1XNS A;  2WF7 A;  4DS5 A;  2YN4 A;  1KSP A;  5FP0 A;  5KFQ A;  3QEA Z;  3LDA A;  4CRX A;  4CE6 A;  3ALR A;  7ICE A;  2VKQ A;  2WF5 A;  3NVW A;  4R63 A;  4UB2 A;  2CN1 A;  2DKX A;  5KG5 A;  3RAQ A;  1UT8 A;  4U6P A;  4OJP A;  2UVV A;  2DL0 A;  4NM2 A;  3BS5 B;  3AU6 A;  4YD1 A;  3MDA A;  2GO7 A;  3RF9 A;  2OEH A;  4O5E A;  4JB3 A;  3NTU A;  2WF6 A;  4IRK A;  2KJ5 A;  3V7K A;  4BWM A;  1L7O A;  5AKX A;  4F4X A;  5AM4 A;  4ICA A;  3PO4 A;  1ZQD A;  4FFD A;  2ASD A;  2KK0 A;  1VLB A;  3TFR A;  3D2S A;  4RQ1 A;  3OHA A;  1RDF A;  3PMN A;  5ALN A;  1ZQR A;  1DK2 A;  2XY7 A;  9ICF A;  4K4H A;  2DUY A;  2VAN A;  3GII A;  5ALT A;  2HBM A;  4XA5 A;  2AJQ A;  3PO5 A;  2KG5 A;  3RH4 A;  1Q3U A;  3QZ7 A;  2F1J A;  3D6J A;  4NY8 A;  1KRP A;  2W9C B;  5DBC A;  4KX5 A;  2W55 A;  1S8O A;  2BDU A;  5KT2 A;  3AL0 B;  5ALE A;  1RYS A;  1COK A;  3RFA A;  4RQ2 A;  2IMW P;  3C21 A;  5KFC A;  4IQU A;  2HHS A;  3GU3 A;  4R64 A;  2ASL A;  4B9L A;  2FJ6 A;  4DSK A;  1TFR A;  1D9F A;  1ECW A;  3LK9 A;  3IV6 A;  2DGZ A;  2DKZ A;  3CNH A;  1ZQV A;  2DBY A;  7ICF A;  2C2R A;  4RUC A;  1L3S A;  4GXI A;  2AH5 A;  4KMU A;  2L5Y A;  2H3V A;  2ZTC A;  3B0X A;  3T79 A;  4RQ7 A;  3VCB A;  1Z4O A;  4C8K A;  1C7Y A;  1NKE A;  2Q4T A;  4UB3 A;  3V7J A;  5G5H A;  1ZQK A;  1IXR A;  7ICT A;  2KHQ A;  3F5A A;  3HP6 A;  1X42 A;  1BPZ A;  3PZP A;  2JEF A;  2W9A A;  4DOC A;  3TAN A;  2PFN A;  1MQ2 A;  3SAG A;  4CF4 A;  3M8R A;  5J29 A;  2R8H A;  1CI4 A;  4MHV A;  1UPH A;  4F50 A;  5F9L A;  4ELT A;  1ZQO A;  5L1J A;  8ICL A;  4GFJ A;  4RPY A;  2KE7 A;  2F8K A;  4NL9 A;  2WAQ F;  2AU0 A;  1KEJ A;  2PFP A;  4IL6 U;  4M9N A;  3I1Y A;  4ED1 A;  1SKR A;  3E0F A;  3LVW A;  4I2J A;  1T8E A;  1BNO A;  3ZDB A;  4GXJ A;  4C80 A;  3IHQ B;  4YR0 A;  3MBY A;  4Y2V A;  5AI9 A;  4CGZ A;  2KSO B;  1JI7 A;  9ICV A;  4JV0 A;  5KAF U;  3SQI A;  2KFN A;  3K75 D;  2YMP A;  4C8M A;  4KLH A;  4DFJ A;  2AGQ A;  3MGH A;  3FC4 A;  4KIT B;  4C0Z A;  5DG7 A;  1NK6 A;  4DS4 A;  2J6U A;  4QWE A;  2F1H A;  4ECY A;  1PVQ A;  3ISC A;  1UCV A;  1CEZ A;  1ZET A;  9ICT A;  1UA1 A;  5IIN A;  4J9N A;  3T5L A;  3BZC A;  3RBD A;  3A0H U;  5ALV A;  1S97 A;  1SGG A;  4F5O A;  4I2F A;  1XSL A;  2F1I A;  2R8I A;  2QKQ A;  2Y1J A;  3F2B A;  4JV2 A;  2IOF K;  4X5V A;  4RT3 A;  1UT5 A;  5IIJ A;  3U26 A;  2KIV A;  1S0V A;  7ICM A;  3TAR A;  8ICV A;  3ETR A;  3RJE A;  5A0L A;  1PK3 A;  5ALP A;  4LVS A;  9ICI A;  2XGQ A;  3PW5 A;  2BQR A;  1S5L U;  2JEI A;  2JH1 A;  2OHF A;  3GFK B;  2KVC A;  5ALD A;  3WKB A;  5J0P A;  1DGJ A;  3M1Y A;  8ICP A;  1LV5 A;  2YB1 A;  4I27 A;  2D8C A;  2HCF A;  4UAY A;  2BCU A;  1ZRM A;  3EW9 A;  3PW4 A;  1V38 A;  5JUM A;  5AI4 A;  4JUZ A;  1T3Q A;  1ZQS A;  1A76 A;  3SZ2 A;  4F2S A;  8ICT A;  4PH5 A;  4OJL A;  1U48 A;  3L3F X;  3RJJ A;  1ZQU A;  3F53 A;  2QB0 B;  1ZQZ A;  4FBU A;  2G0A A;  5E79 U;  4YR3 A;  3SAH A;  2P6U A;  2E8O A;  4DFM A;  1C20 A;  2P6R A;  2W04 A;  1XSN A;  1RZT A;  2XY6 A;  3ZI4 A;  5AK3 A;  2NO4 A;  2B6G A;  2G5H B;  4KLJ A;  3V6J A;  3F2D A;  4DF4 A;  2Y0S F;  3JPQ A;  4DOB A;  2KIW A;  5TIS U;  1OXJ A;  4DL5 A;  5J2K A;  4MFF A;  3PW0 A;  2JV3 A;  2ZJ5 A;  5DQH A;  1Z3E B;  3KOO A;  4DLG A;  5KAI U;  3BS5 A;  2LKY A;  5GTI U;  1T7P A;  3PX4 A;  3PV8 A;  4DO9 A;  2JHD A;  2R8G A;  1JIH A;  3BQT A;  4OJ5 A;  4DF8 A;  2BZF A;  5J0R A;  2JGA A;  1S0M A;  5ALM A;  9ICC A;  1KFT A;  3OGU A;  1QQ7 A;  1KN5 A;  4A8E A;  1N60 A;  1MQ3 A;  2UVW A;  4KLE A;  1N62 A;  3ED5 A;  1N5X A;  2PKE A;  5HMM A;  5KFL A;  9ICL A;  5KFM A;  4I29 A;  4ACO A;  2WFA A;  2RHF A;  1YZ7 A;  5DQG A;  2E8N A;  4Y2Q A;  5KFV A;  1RQN A;  2NRX A;  1BPX A;  3BQ0 A;  5AK4 A;  1L3V A;  5KFH A;  7ICG A;  1U9L A;  2W9C A;  5KL1 B;  5L9X A;  3T5J A;  4RQM A;  5AK5 A;  5AM1 A;  9ICB A;  1XO0 A;  2H5X A;  5KT7 A;  2F3N A;  3NUQ A;  5DB7 A;  1O08 A;  3RJI A;  4C7Y A;  5DG8 A;  4QZ9 A;  8ICJ A;  4I2H A;  2JMG A;  2M0N A;  3RTV A;  3KKA C;  2W03 A;  5ALU A;  3MGV A;  3QU5 A;  2JEG A;  4B6J A;  2YQE A;  4O3R A;  5DGB A;  2FLP A;  1D8Y A;  1K1Q A;  1QSS A;  2OM6 A;  3I76 A;  8ICC A;  2V4R A;  4F4Z A;  4IRC A;  1SXD A;  9ICE A;  2RQ5 A;  1QTM A;  3E58 A;  3EWA A;  5CP2 A;  4ECX A;  4AYB F;  3RJK A;  2JH7 A;  3DEE A;  4RQN A;  3FM9 A;  3CW2 C;  2EAO A;  5HR6 A;  2ZIX B;  1L6N A;  2EH9 A;  1X6I A;  5IIO A;  2FE9 A;  1SB3 C;  1QH9 A;  4RQ3 A;  5C5J A;  2B21 A;  4PJ0 U;  4C7Z A;  4O0I A;  2DPJ A;  4F8R A;  1NKB A;  5CA7 A;  2ZIW B;  1XU4 A;  1Z00 A;  4YD2 A;  2AXT U;  5DB8 A;  3QU4 A;  2FMP A;  1NOM A;  3RJG A;  4JWN A;  4KLI A;  4F93 B;  4B9S A;  3EYZ A;  3LYS A;  5AHX A;  5J0T A;  1ZQI A;  4DFP A;  1NJX A;  3QU2 A;  5AIC A;  3I28 A;  2Y9U A;  1NK0 A;  8ICZ A;  5KT4 A;  2KD1 A;  5L1L A;  2KEY A;  5KFX A;  4EZ6 A;  5ALQ A;  4QWB A;  2W7O A;  5J2A A;  1ZQW A;  4YG2 A;  4YVZ A;  5KFS A;  2PI5 A;  2F8L A;  2XC9 A;  8ICR A;  2LYA A;  1J2N A;  3J81 j;  4GIB A;  1ZXI A;  5KG3 A;  3K4G A;  4NWI A;  2W9B A;  4MEY A;  7ICU A;  5ALR A;  3TFS A;  2XCP A;  5K4L A;  5AKK A;  1NZB A;  5KG6 A;  1DGS A;  1B4F A;  5ALH A;  4J9O A;  2GLE A;  2W3S A;  2H3Z A;  4Y2T A;  4RQ4 A;  3UXO A;  4EZ9 A;  1B43 A;  2ZTE A;  1N5W A;  2F2A B;  4ZH4 A;  2LBO A;  5IIK A;  4US9 A;  3WK5 A;  1CUK A;  5J2B A;  2XVT A;  2YY6 A;  1T4G A;  4NLB A;  3D2N A;  3MDC A;  1L5U A;  1JXE A;  1KDH A;  1SV0 C;  5CJ7 A;  5AKY A;  3HWT A;  3NVY A;  2K89 A;  5CHG A;  4RPZ A;  1L7N A;  3WK8 A;  3E2E A;  5J0U A;  3BJY A;  1UQV A;  2OCE A;  4ECQ A;  2MA1 A;  1JRO A;  1NNL A;  2WAQ C;  4KLO A;  1JXL A;  5J8Y C;  1DK3 A;  2QB0 A;  5JU5 A;  1FFU A;  4NLN A;  3UMC A;  2EZX A;  4B9M A;  1RXW A;  3OJU A;  9ICQ A;  8ICS A;  4ECW A;  4YQW A;  9ICK A;  1NK5 A;  2KJ9 A;  2NO5 A;  1TAM A;  4F5R A;  2K8B B;  5B66 U;  5HHI A;  3HPO A;  5AK6 A;  1J2M A;  4MF2 A;  2NYV A;  1JMS A;  4UB6 U;  5EE1 A;  3M9O B;  3MFI A;  1TAU A;  1ZQM A;  3RR7 A;  3TAC B;  3IM1 A;  2AHO B;  5KT6 A;  4ECR A;  1EXN A;  2WF9 A;  1K1S A;  5DQI A;  1QQ5 A;  4NLK A;  2W54 A;  4KLS A;  2WHE A;  2G5I B;  8ICU A;  4ECZ A;  4GC6 A;  3GV7 B;  3Q8S B;  2RP5 A;  4CF5 A;  1L8L A;  3CP8 A;  4F5P A;  1Z4N A;  2HHT A;  2E5S A;  5DLF A;  3ORY A;  3ISD A;  1ZYQ A;  8ICB A;  3JPR A;  4M04 A;  3H8J A;  7ICK A;  3ISB A;  2EQY A;  4EX6 A;  3MR6 A;  2BCR A;  1TV9 A;  2W43 A;  8ICE A;  4PHE A;  3WU2 U;  2HI0 A;  4RNM A;  3OTQ A;  3V72 A;  2F44 A;  1JN3 A;  3TAD C;  1NK7 A;  3KHR A;  2HSZ A;  1Z19 A;  4O5C A;  8ICN A;  4BXO A;  1ZQC A;  1SL0 A;  1SL1 A;  2PFO A;  3ZDD A;  4QZI A;  4MF8 A;  3RBE A;  1UHU A;  3C1Y A;  1N63 A;  3K1Z A;  8ICY A;  2G07 A;  4HYK A;  3WKE A;  9ICN A;  1GO3 F;  1ZQN A;  4C8O A;  2VJ5 A;  3BZK A;  2HHW A;  1ZQJ A;  4F2R A;  3TAQ A;  4US8 A;  1ZD5 A;  4LZG A;  3AQE A;  4FBT A;  3MGI A;  2B0C A;  2Z7J A;  3QXG A;  4F4Y A;  2WTF A;  2ZUC A;  4ECV A;  7ICR A;  3IRU A;  3AN1 A;  2C22 A;  4BJQ A;  4DLE A;  3RJH A;  2BPG A;  4BX9 C;  2WB1 F;  1ZQE A;  1WWV A;  1IM4 A;  1Z00 B;  4RQ0 A;  5DGA A;  3HKZ F;  1ZQP A;  3PST A;  4GC7 A;  2ZIX A;  5KFA A;  5J0Y A;  4NXZ A;  1YZ6 A;  2XID A;  3PR4 A;  7ICJ A;  3NRZ A;  3M9M B;  3WKD A;  4EEN A;  1T94 A;  3WKC A;  1MA7 A;  4DL7 A;  4YFK A;  2ZIW A;  5J2C A;  8ICI A;  5J2F A;  5GTH U;  3H40 A;  2MUT B;  5KG1 A;  5AI6 A;  5F9N A;  2D6F C;  1S76 D;  5ALY A;  5KFU A;  4ECT A;  2HVH A;  2FI1 A;  2W9B B;  4FZL A;  2LMR A;  4NLC A;  2NRV A;  1L3T A;  1QSL A;  5HR7 A;  4F5Q A;  3KD3 A;  4F71 A;  1JAL A;  3RB3 A;  1NK8 A;  1H38 A;  5DBB A;  9ICG A;  3BQ2 A;  3HX0 A;  4P0Q B;  2HBK A;  2QAR B;  1MSW D;  1HUZ A;  4NLZ A;  5AKI A;  2HW3 A;  3C23 A;  2HHU A;  3HRD D;  4RNN A;  4RNO A;  3Q8M A;  5ALK A;  3IDW A;  3ZD9 A;  3OPX A;  4IS7 A;  3CRX A;  5ALX A;  1ZQB A;  4M9H A;  4J9Q A;  4YXJ A;  4KLT A;  2KTQ A;  4ED6 A;  1XS9 D;  3M9N B;  3V6H A;  4EX7 A;  1RM6 C;  5EE3 A;  4RQ8 A;  4Y2U A;  4PZN A;  1V85 A;  4I2B A;  1P7D A;  1D9D A;  1KL9 A;  4KMO B;  4B9N A;  4DCC A;  3N28 A;  2OWO A;  4UAT A;  4CF3 A;  2K8C B;  2KHV A;  1TK0 A;  4YXM A;  1QLN A;  3GDX A;  1KTQ A;  4PL1 A;  4M9G A;  3OSN A;  1ZQX A;  3MC1 A;  3TQ1 A;  1WCL A;  3GQC A;  5TZV A;  4Q8F A;  1O03 A;  3UMG A;  4FS1 A;  3KBB A;  4J9P A;  4EYH B;  1WUD A;  4F3O A;  2P66 A;  4IRD A;  1S0N A;  2LPE A;  3ZDC A;  4RZR A;  4B9T A;  2IHN A;  3UQ2 A;  2JXJ A;  4HAI A;  4TQR A;  1PZN A;  5CWR A;  5ALI A;  1WYG A;  2OH2 A;  4DL4 A;  5H2F U;  3CYM A;  4ELU A;  4KLM A;  8ICA A;  1BPE A;  4CNQ A;  3THV A;  4DSE A;  3G6V A;  3N7R C;  4UAU A;  4O3M A;  3WK4 A;  1X9S A;  3ZDA A;  3RB4 A;  5J0O A;  3JPS A;  3Q8K A;  2E3T A;  2V9W A;  3SV4 A;  2QB1 A;  2A19 A;  1A77 A;  3GIJ A;  2KFZ A;  3SEN A;  1KLN A;  5AI5 A;  4Z6F A;  4IQV A;  2BPF A;  4ED2 A;  2AGO A;  4RQ5 A;  4M0A A;  4JV1 A;  4EEY A;  5BPC A;  1KKX A;  1LKY B;  5KFN A;  2LYH A;  2PMZ C;  2ZTD A;  2I1Q A;  2E1E A;  4PHD A;  1MN8 A;  1J97 A;  4QIW C;  2W7P A;  9ICH A;  3KHG A;  2C2E A;  4BUG A;  1UA0 A;  2BCV A;  1SWW A;  1ZJN A;  8ICF A;  2EDU A;  2GH1 A;  3KFU F;  5KG2 A;  4F92 B;  3ICX A;  1ARO P;  2I6X A;  4BXO B;  1ZQG A;  4DSL A;  3RB6 A;  5C0Y A;  2HHV A;  2ZUD A;  4J9R A;  1L3U A;  1K5O A;  3OSP A;  3MAB A;  3KTQ A;  8ICW A;  1DXS A;  1BVS A;  2Q0Z X;  3SI8 A;  4UB5 A;  1V9P A;  5J0Q A;  5ALG A;  3DV9 A;  4P4O A;  1TAQ A;  3G6X A;  5AM3 A;  3ETL A;  1HEK A;  3SD7 A;  3WK7 A;  3N7P D;  3JPP A;  4DQQ A;  3SMV A;  2WF8 A;  3H0M B;  5DDM A;  4FO6 A;  2FMQ A;  2FLN A;  9ICR A;  4QZC A;  3C2M A;  4YMN A;  1BNP A;  3RB0 A;  4AP9 A;  8ICH A;  2YB4 A;  4DOA A;  1TK5 A;  5EOZ A;  5DDY A;  4C4T A;  2ESE A;  2HOF A;  1T3N A;  4O3O A;  5KNI A;  4XRH A;  4R66 A;  4JWM A;  5HML A;  3C2L A;  4Y2J A;  4GLX A;  3QZ8 A;  2HHQ A;  8ICX A;  3H0L B;  4UBB A;  1XSP A;  5DB9 A;  2RLT A;  5CR0 A;  9ICA A;  2XCA A;  4DEZ A;  4ED3 A;  5KFI A;  2HBL A;  4Y2R A;  4QWC A;  4EBE A;  1L7M A;  5J2G A;  4BGD A;  3QE9 Y;  4B9U A;  2BDP A;  4PGX A;  4I2A A;  1RPL A;  7ICQ A;  5BOL A;  2BCQ A;  7ICI A;  2ZIV A;  3JPT A;  4DSJ A;  3PX0 A;  3N97 B;  2J6S A;  2W8L A;  5KFD A;  1HJP A;  2C2D A;  2BR0 A;  3AU2 A;  5DB6 A;  4OO1 J;  3PML A;  1SV4 A;  3BQ7 A;  4USA A;  3UM9 A;  3S6J A;  4K4I A;  8ICK A;  2MUT A;  4PZO A;  1X9M A;  4I2E A;  4IR9 A;  4Q45 A;  5D4B A;  1ZQL A;  4XQ8 A;  1B22 A;  1ZD3 A;  1AQ6 A;  2YML A;  3QUC A;  3PSP A;  1ZJM A;  4QW8 A;  4Q44 A;  2OXO A;  2LHT A;  2KV2 A;  3UXP A;  3NGD A;  9ICJ A;  1F0M A;  4G3I A;  3BS7 A;  5KT5 A;  2BCS A;  5F3X B;  3Q8L A;  4F4W A;  7ICV A;  9ICU A;  4P0Q A;  2QAR A;  4J03 A;  4ZOH C;  4NL9 C;  3T5K A;  2KZM A;  4JMU A;  4O3S A;  4QZG A;  2KNJ A;  1MC8 A;  5KFW A;  1ZQF A;  4TUP A;  3KHL A;  3QEB Z;  1RQL A;  2KZZ A;  4DFD A;  3PW2 A;  2BQU A;  1ED1 A;  1BPY A;  1CRX A;  2IHM A;  2M9N A;  2FPL A;  2XY5 A;  1A6S A;  3UMB A;  3QYP A;  2Y1I A;  2PI4 A;  2R8J A;  4M9L A;  1WG8 A;  5ALJ A;  1FO4 A;  5JRT A;  1LVH A;  3KHH A;  4YP3 A;  1VDV A;  2JZB A;  3QU7 A;  3L4P A;  4QWD A;  3DDH A;  4Y2S A;  4U7C A;  1KQQ A;  4J9L A;  2RRD A;  4GXK A;  4DL3 A;  1ZQA A;  4DL6 A;  3MR3 A;  4KLF A;  2BHN A;  4PPX A;  1L7P A;  3ZDE A;  5AI8 A;  4UAS A;  2VIX A;  2HOQ A;  4QZB A;  4YMM A;  1NKC A;  2F77 X;  4NM1 A;  4M47 A;  5EE0 A;  3PVX A;  1N56 A;  3GV8 B;  3JPN A;  5KFK A;  1FIQ A;  5KFT A;  2A1J B;  5KFP A;  4M9J A;  1V97 A;  4BWJ A;  3N4M B;  4UBC A;  4P2H A;  1X9X A;  2YMQ A;  1IV8 A;  5G5G A;  4UB1 A;  3O0F A;  4OD0 A;  7ICS A;  3C5F A;  1PK1 A;  3L5K A;  2LI6 A;  2P35 A;  1QQ6 A;  2W8K A;  2UVR A;  3C1Z A;  5J2E A;  3EZ5 A;  5ALO A;  2NV3 A;  4KTQ A;  1B0X A;  3SYZ A;  5KT3 A;  3F5E A;  4RT2 A;  1OW5 A;  2ASJ A;  5AKH A;  2E8P A;  4UAZ A;  4ECU A;  2J6T A;  2DPI A;  3H8W A;  5AM5 A;  2R18 A;  2BGW A;  3FYH A;  2D3D A;  3IG8 A;  4ECS A;  1U47 A;  4EYI B;  5AM0 A;  2YMM A;  3GIL A;  4IR1 A;  2ZUB A;  1RXV A;  1KW4 A;  3KKA A;  4P4M A;  3GZF A;  1SXE A;  3PX6 A;  4M6W A;  3PNC A;  4KN7 A;  3SAF A;  9ICM A;  5KFO A;  4F72 A;  3LWL A;  4QZE A;  1SZH A;  5EWF A;  2MSN A;  5AKZ A;  4I2I A;  7ICH A;  3RJF A;  3IG5 A;  7ICN A;  1HUO A;  3Q8P B;  2IA6 A;  1LKY A;  1TVA A;  4DL2 A;  2ATL A;  2VA3 A;  3GIK A;  3AQF A;  4F5N A;  1Q3V A;  3V7L A;  2ISO A;  2VA2 A;  1N61 A;  1F5S A;  1Z1V A;  3WK6 A;  2W3R A;  4LZD A;  4K4G A;  1ZQ1 C;  5DBA A;  3PY8 A;  2C28 A;  4KLD A;  5B5E U;  4R65 A;  4IC9 A;  5CEH A;  3R9K A;  3RRG A;  2ES6 A;  5L1M A;  5HP4 A;  3VC8 A;  2JEJ A;  3RR8 A;  3M6K A;  5ALS A;  4J9K A;  3IN5 A;  4DQI A;  4DFK A;  7ICP A;  1F44 A;  1QSY A;  1PVP A;  3EPI A;  2FMS A;  2GOL A;  2CXY A;  2XI9 A;  4FE3 A;  5KFG A;  2H3Q A;  4YR2 A;  5IIL A;  2KZ3 A;  2Y0S C;  5D49 A;  5KL8 B;  1X2I A;  1ZD4 A;  5AKG A;  5EE9 A;  4QZF A;  4DSF A;  2W9M A;  2HOI A;  3T5H A;  3HJE A;  3SEI A;  1NJW A;  3C28 A;  4RUA A;  8ICQ A;  5KG7 A;  3TKA A;  5AKJ A;  4RQ6 A;  4C4S A;  2CRX A;  5L1K A;  2ZIV B;  3M8S A;  3UPQ A;  1SZP A;  4OJ6 A;  4UAW A;  2R8K A;  2DWQ A;  1HIW A;  3KZX A;  3LWM A;  4J9S A;  3QUB A;  4YCX A;  4ELV A;  1ZOL A;  4BDP A;  1A0P A;  2AQ0 A;  4I28 A;  3T3F A;  4PL2 A;  1RYU A;  3ONN A;  5KFE A;  4TUR A;  4DQP A;  1BPB A;  4P0P A;  5ALF A;  1JRP A;  4JK1 A;  2ISP A;  4DQR A;  4UW9 A;  4KLL A;  2JR5 A;  1XC9 A;  2JRZ A;  4CCH A;  7ICL A;  3GV5 B;  2CPR A;  2ODG A;  1S10 A;  1RG6 A;  1SV0 A;  3QUT A;  9ICO A;  3ZD8 A;  2QLT A;  4QZA A;  3M6Z A;  1WCN A;  4KLQ A;  4C8N A;  4Z6E A;  2ZXI A;  2K8A A;  4DSI A;  2HMX A;  2LM1 A;  4EBD A;  1XWL A;  4RPX A;  3M7D A;  4NJ8 A;  1D8L A;  3BQ1 A;  1X40 A;  1SIJ A;  2BPC A;  1TKD A;  4R8U A;  2OYY A;  2A3V A;  5J8Y A;  4UQG A;  4ED7 A; 
#chains in the Genus database with same CATH homology
 2ZUD A;  4J9R A;  1L3U A;  4RQ2 A;  3OSP A;  3MAB A;  3KTQ A;  4J9O A;  8ICW A;  1BVS A;  2Q0Z X;  3SI8 A;  4UB5 A;  1V9P A;  2IMW P;  3C21 A;  5J0Q A;  2AGP A;  5KFC A;  4IQU A;  4RQ4 A;  3UXO A;  4EZ9 A;  1B43 A;  2HHS A;  2NRT A;  1NK9 A;  2JZB B;  2ZTE A;  4P4O A;  4R64 A;  2ASL A;  4B9L A;  8ICM A;  4FS2 A;  1TAQ A;  3G6X A;  1RYR A;  4E0D A;  3ETL A;  4DSK A;  1TFR A;  1D9F A;  1BPD A;  5J2D A;  3JPP A;  4ZH4 A;  3LK9 A;  4DQQ A;  5IIK A;  1KFD A;  1ZQV A;  5DDM A;  4FO6 A;  4O9M A;  1CUK A;  7ICF A;  2FMQ A;  2FLN A;  5J2B A;  2C2R A;  9ICR A;  4RUC A;  1T4G A;  4QZC A;  5KFY A;  3C2M A;  4YMN A;  3MDC A;  1L3S A;  4GXI A;  1L5U A;  8ICG A;  3UQ0 A;  9ICS A;  3OHB A;  4KMU A;  1X9W A;  3RB0 A;  1JXE A;  1KDH A;  8ICH A;  2ZTC A;  5CJ7 A;  4DOA A;  3B0X A;  1ZQY A;  4RQ7 A;  1TK5 A;  3HWT A;  4C8K A;  5EOZ A;  5DDY A;  1C7Y A;  1NKE A;  5CHG A;  4RPZ A;  4UB3 A;  3V7J A;  1ZQK A;  3E2E A;  1T3N A;  4O3O A;  1IXR A;  5J0U A;  3BJY A;  2UVU A;  4XRH A;  5EWE A;  4ECQ A;  7ICT A;  3HP6 A;  1BPZ A;  2JEF A;  4R66 A;  2W9A A;  5J2H A;  4DOC A;  4Z6D A;  3JPO A;  1S0O A;  9ICV A;  3PR5 B;  3TAN A;  4JWM A;  5HML A;  2PFN A;  3PW7 A;  3C2L A;  1MQ2 A;  9ICW A;  4KLO A;  4GLX A;  1JXL A;  5DKW A;  3QZ8 A;  2HHQ A;  3M8R A;  8ICX A;  5KTQ A;  4UBB A;  3Q8R B;  2A1J A;  3C5G A;  5J29 A;  1XSP A;  2XO7 A;  5DB9 A;  5CR0 A;  2R8H A;  2XCA A;  1NK4 A;  9ICA A;  4NLN A;  4DEZ A;  4F50 A;  4ED3 A;  5F9L A;  4ELT A;  1ZQO A;  4B9M A;  1RXW A;  9ICX A;  5KFI A;  3OJU A;  5L1J A;  2IBK A;  8ICS A;  4ECW A;  9ICQ A;  4QWC A;  8ICL A;  4EBE A;  1NJZ A;  4RPY A;  4YQW A;  5J2G A;  9ICK A;  1NK5 A;  4I2D A;  3RH6 A;  4BGD A;  4F5R A;  1KEJ A;  3QE9 Y;  2AU0 A;  2BDP A;  1BGX T;  4PGX A;  1RPL A;  2NRZ A;  2PFP A;  3BDP A;  4B9U A;  4I2A A;  4M9N A;  5HHI A;  5D46 A;  5BOL A;  3HPO A;  4QZH A;  4ED1 A;  1SKR A;  2BCQ A;  7ICQ A;  4I2J A;  1T8E A;  3ZDB A;  7ICO A;  4GXJ A;  4M6W B;  7ICI A;  3IHQ B;  4YR0 A;  3MBY A;  3JPT A;  4DSJ A;  4MF2 A;  3PX0 A;  3G6Y A;  4ED0 A;  1JMS A;  3N97 B;  1JX4 A;  3M9O B;  2J6S A;  5DG9 A;  3MFI A;  4JV0 A;  4MFA A;  2W8L A;  5KFZ A;  1HJP A;  5KFD A;  2C2D A;  2BR0 A;  3AU2 A;  5DB6 A;  4QWA A;  4Q8E A;  2KFN A;  3PML A;  1TAU A;  3K75 D;  4C8M A;  4MEX A;  1ZQM A;  4DQS A;  4KLH A;  3RR7 A;  3IM1 A;  4DFJ A;  2AGQ A;  4K4I A;  5KT6 A;  8ICK A;  4ECR A;  2BQ3 A;  3MGH A;  1EXN A;  2MUT A;  4O3P A;  4KIT B;  5BOM A;  1K1S A;  5DQI A;  1X9M A;  4I2E A;  5DG7 A;  4NLK A;  9ICP A;  1NK6 A;  3H7I A;  4KLS A;  4IR9 A;  4DS4 A;  8ICU A;  4Q45 A;  2J6U A;  4QWE A;  4ECZ A;  5D4B A;  1ZQL A;  4I2C A;  2F1H A;  4XQ8 A;  2V4Q A;  4GC6 A;  4ECY A;  4KLU A;  1B22 A;  3GV7 B;  2AQ4 A;  3Q8S B;  3ISC A;  4TUQ A;  4F5P A;  1ZJM A;  1CEZ A;  4QW8 A;  2HHT A;  4Q44 A;  5DLF A;  1ZET A;  3ORY A;  3ISD A;  1UA1 A;  1ZYQ A;  3GIM A;  9ICT A;  5IIN A;  4PGY A;  4J9N A;  3UXP A;  3T5L A;  3NGD A;  3RBD A;  3JPR A;  8ICB A;  4XUS A;  9ICJ A;  1S97 A;  3H8J A;  4F5O A;  4M04 A;  7ICK A;  4I2F A;  1XSL A;  4G3I A;  2F1I A;  2R8I A;  2DFL A;  3V6K A;  2ALZ A;  3ISB A;  5KT5 A;  2BCS A;  3Q8L A;  4F4W A;  3MR6 A;  2Y1J A;  3TAP A;  7ICV A;  4YN4 A;  2BCR A;  4JV2 A;  9ICU A;  1TV9 A;  4X5V A;  4RT3 A;  3AUO A;  1UT5 A;  5IIJ A;  4Z6C A;  4PHE A;  5J0W A;  3T5K A;  8ICE A;  2KZM A;  5KG0 A;  4IQT A;  1S0V A;  7ICM A;  3TAR A;  8ICV A;  5J2I A;  4O3S A;  4QZG A;  4RNM A;  1MC8 A;  3V72 A;  5KFW A;  1ZQF A;  4TUP A;  1JN3 A;  4ED8 A;  3KHL A;  3QEB Z;  3TI0 A;  1NK7 A;  3KHR A;  2RDJ A;  2KZZ A;  2PXI A;  3RJE A;  4B9V A;  3PW2 A;  4O5C A;  2BQU A;  1ZQT A;  4BXO A;  8ICN A;  1ZQC A;  4LVS A;  1SL0 A;  1SL1 A;  1BPY A;  2IHM A;  9ICI A;  2XGQ A;  3PW5 A;  2BQR A;  2JEI A;  2M9N A;  2FPL A;  5KG4 A;  2XY5 A;  2ZJ8 A;  2PFO A;  3ZDD A;  4QZI A;  3GFK B;  4MF8 A;  2Y1I A;  3RBE A;  2R8J A;  2PI4 A;  4M9L A;  3C1Y A;  5J0P A;  3OJS A;  8ICP A;  5III A;  1LV5 A;  4I27 A;  4DWI A;  4UAY A;  3KHH A;  4YP3 A;  2BCU A;  8ICY A;  2FPM A;  5IIM A;  4HYK A;  2JZB A;  2NRW A;  1U4B A;  3RAX A;  5DLG A;  3EW9 A;  4QWD A;  3PW4 A;  9ICN A;  1ZQN A;  4C8O A;  5JUM A;  1S77 D;  2HHW A;  4J9L A;  4GXK A;  4DL3 A;  1ZQA A;  1ZQJ A;  4F4K A;  4JUZ A;  4DL6 A;  4F2R A;  3MR3 A;  1COO A;  1DOQ A;  2FPK A;  5J0S A;  3TAQ A;  1SL2 A;  1ZQS A;  4KLF A;  4LZG A;  4IQW A;  1A76 A;  3SZ2 A;  2BHN A;  4FBT A;  3MGI A;  3ZDE A;  4F2S A;  4PPX A;  4KLG A;  4QZB A;  3Q8Q B;  8ICT A;  4YMM A;  5HNK A;  1NKC A;  4NM1 A;  1Y88 A;  1XO1 A;  4PH5 A;  5EWG A;  5J0X A;  4M47 A;  1U49 A;  4F4Y A;  3PVX A;  4MFC A;  1U48 A;  1N56 A;  3RJJ A;  3GV8 B;  3JPN A;  2WTF A;  1ZQU A;  5KFK A;  5KFT A;  2ZUC A;  2A1J B;  3H8S A;  5KFP A;  1NJY A;  4ECV A;  1ZQZ A;  5KFR A;  4M9J A;  2VA8 A;  7ICR A;  4BWJ A;  3N4M B;  5L1I A;  4FBU A;  4UBC A;  4P2H A;  4YR3 A;  2C22 A;  2P6U A;  4DLE A;  3RJH A;  2BPG A;  4DFM A;  2P6R A;  3HW8 A;  4PGQ A;  4RU9 A;  4UB1 A;  1XSN A;  1RZT A;  1ZQE A;  2XY6 A;  7ICS A;  3C5F A;  1Z00 B;  1IM4 A;  4PHA A;  4RQ0 A;  5DGA A;  1ZQP A;  5J2J A;  2W8K A;  4GC7 A;  2UVR A;  3C1Z A;  5J2E A;  3EZ5 A;  3V6J A;  4KLJ A;  4DF4 A;  5KFA A;  4KTQ A;  5J0Y A;  4J9M A;  3SYZ A;  5KT3 A;  3EPG A;  4NXZ A;  2I9G A;  3JPQ A;  3UXN A;  4O5K A;  4DOB A;  4RT2 A;  3PR4 A;  4DL5 A;  4M2Y A;  5J2K A;  4MFF A;  2ASJ A;  3M9M B;  7ICJ A;  3B0Y A;  3PW0 A;  1ZQH A;  4UAZ A;  4ECU A;  2XGP A;  2ZJ5 A;  2J6T A;  5DQH A;  3H8W A;  2DPI A;  1Z3E B;  3MFH A;  2PFQ A;  2BGW A;  3FYH A;  1TK8 A;  4DLG A;  3HT3 A;  4DL7 A;  4YFK A;  4ECS A;  5J2C A;  8ICI A;  1T7P A;  1U47 A;  4O3N A;  3C2K A;  3PX4 A;  5J2F A;  4EYI B;  3H40 A;  3PV8 A;  2KN7 A;  2MUT B;  3GIL A;  4DO9 A;  4IR1 A;  2ZUB A;  5KG1 A;  1RXV A;  5F9N A;  1S76 D;  2R8G A;  1JIH A;  4P4M A;  3BQT A;  5KFU A;  3PX6 A;  4M6W A;  5KFF A;  3PNC A;  4DF8 A;  2FLL A;  4KN7 A;  4ECT A;  9ICM A;  5KFO A;  2HVH A;  4QW9 A;  2W9B B;  3LWL A;  4QZE A;  5J0R A;  1S0M A;  9ICC A;  1KFT A;  5EWF A;  3OGU A;  3SV3 A;  1QSL A;  2NRV A;  4I2I A;  1L3T A;  7ICH A;  1MQ3 A;  3RJF A;  2ZJA A;  7ICN A;  4QZ8 A;  3FDS A;  4F5Q A;  1HUO A;  2UVW A;  4KLE A;  4EBC A;  3Q8P B;  3RB3 A;  2IA6 A;  4KN4 A;  1S9F A;  4PHP A;  3RRH A;  2GWS A;  1NK8 A;  4R8U B;  5HMM A;  1TVA A;  1H38 A;  5KFL A;  3H4D A;  4DL2 A;  2HHX A;  5DBB A;  2ATL A;  9ICG A;  2VA3 A;  3GIK A;  9ICL A;  3BQ2 A;  4O3Q A;  5KFM A;  3HX0 A;  1U45 A;  4I29 A;  4F5N A;  1MSW D;  1HUZ A;  4NLZ A;  2HW3 A;  3C23 A;  2HHU A;  5DQG A;  1SKW A;  3V7L A;  4YMO A;  2ISO A;  4RNN A;  4RNO A;  1SKS A;  2VA2 A;  5KFV A;  3Q8M A;  1KFS A;  2HVI A;  2NRX A;  4P4P A;  1BPX A;  3BQ0 A;  1L3V A;  3ZD9 A;  4NLG A;  5KFH A;  7ICG A;  3RH5 A;  1U9L A;  2W9C A;  3T5J A;  5L9X A;  4C8L A;  4LZD A;  5KFJ A;  4K4G A;  1ZQQ A;  4TUS A;  5DBA A;  9ICB A;  1ZQB A;  3PY8 A;  4M9H A;  2H5X A;  4J9Q A;  4YXJ A;  4KLT A;  2C28 A;  2KTQ A;  5KT7 A;  4ED6 A;  1XS9 D;  3M9N B;  3V6H A;  1N48 A;  5DB7 A;  4KLD A;  4R65 A;  4I2G A;  3RJI A;  5DG8 A;  3H4B A;  4QZ9 A;  3MR5 A;  8ICJ A;  1LB2 B;  4RQ8 A;  4I2H A;  4ELV A;  3RTV A;  3RRG A;  5HP4 A;  4I2B A;  1D9D A;  2JEJ A;  3RR8 A;  2JEG A;  4B9N A;  4J9K A;  5DGB A;  4O3R A;  2RDI A;  2OWO A;  4DQI A;  2FLP A;  5HHH A;  4DFK A;  1TK0 A;  7ICP A;  4YXM A;  1QLN A;  1D8Y A;  3GDX A;  1KTQ A;  4TQS A;  1QSY A;  4M9G A;  1K1Q A;  3EPI A;  1QSS A;  2FMS A;  3OSN A;  4UB4 A;  1ZQX A;  2MAX A;  5KFG A;  8ICC A;  5KFB A;  2V4R A;  4Q43 A;  4F91 B;  4YR2 A;  4F4Z A;  4QZD A;  5IIL A;  8ICO A;  4IRC A;  2KZ3 A;  3TQ1 A;  5D49 A;  5CB1 A;  1WCL A;  3MR2 A;  5TZV A;  3GQC A;  9ICE A;  4Q8F A;  1X2I A;  2BKE A;  4FS1 A;  1QTM A;  3EWA A;  4J9P A;  5CP2 A;  4DSF A;  4QZF A;  2W9M A;  4ECX A;  4DS5 A;  4EYH B;  3T5H A;  3RJK A;  4F3O A;  1KSP A;  2P66 A;  4IRD A;  1NJW A;  1S0N A;  4RUA A;  8ICQ A;  5KFQ A;  3QEA Z;  3ZDC A;  3LDA A;  5KG7 A;  4RZR A;  7ICE A;  4B9T A;  2IHN A;  3UQ2 A;  4TQR A;  4RQ6 A;  1PZN A;  5IIO A;  5CWR A;  5L1K A;  4R63 A;  4DL4 A;  3M8S A;  4UB2 A;  3UPQ A;  4ELU A;  4KLM A;  8ICA A;  4RQ3 A;  1SZP A;  1BPE A;  5KG5 A;  3RAQ A;  5C5J A;  3THV A;  1UT8 A;  4DSE A;  2UVV A;  2B21 A;  4O0I A;  2DPJ A;  4F8R A;  1NKB A;  3G6V A;  4UAW A;  2R8K A;  4NM2 A;  5CA7 A;  1XU4 A;  3AU6 A;  1Z00 A;  4YD2 A;  5DB8 A;  3LWM A;  4YD1 A;  4YCX A;  4J9S A;  1X9S A;  3ZDA A;  3RB4 A;  5J0O A;  3JPS A;  3MDA A;  3Q8K A;  2FMP A;  1NOM A;  3RJG A;  4BDP A;  4O5E A;  2AQ0 A;  4JWN A;  4KLI A;  4F93 B;  2V9W A;  4I28 A;  3SV4 A;  3NTU A;  4B9S A;  4IRK A;  1A77 A;  3GIJ A;  3EYZ A;  3T3F A;  3V7K A;  2KFZ A;  4BWM A;  5J0T A;  1KLN A;  1ZQI A;  4DFP A;  4Z6F A;  5KFE A;  4TUR A;  4F4X A;  4IQV A;  1NJX A;  1BPB A;  2BPF A;  4DQP A;  4ED2 A;  2AGO A;  1NK0 A;  3PO4 A;  4RQ5 A;  4M0A A;  1ZQD A;  4JV1 A;  2ASD A;  8ICZ A;  5KT4 A;  4JK1 A;  4EEY A;  2ISP A;  3TFR A;  4RQ1 A;  4DQR A;  4KLL A;  5L1L A;  5BPC A;  5KFX A;  5KFN A;  4EZ6 A;  2LYH A;  1XC9 A;  3OHA A;  4QWB A;  4CCH A;  2ZTD A;  5J2A A;  3PMN A;  7ICL A;  2I1Q A;  1ZQW A;  3GV5 B;  1ZQR A;  4YG2 A;  2XY7 A;  4YVZ A;  5KFS A;  1S10 A;  2PI5 A;  2XC9 A;  8ICR A;  9ICF A;  4PHD A;  4K4H A;  2VAN A;  3GII A;  4XA5 A;  9ICO A;  2AJQ A;  3KHG A;  3ZD8 A;  9ICH A;  2C2E A;  5KG3 A;  3K4G A;  1UA0 A;  2W9B A;  4MEY A;  2BCV A;  3PO5 A;  1ZJN A;  8ICF A;  4QZA A;  1WCN A;  4KLQ A;  7ICU A;  4C8N A;  4Z6E A;  5KG2 A;  3RH4 A;  3TFS A;  3QZ7 A;  2F1J A;  4DSI A;  4NY8 A;  4EBD A;  4F92 B;  1XWL A;  4RPX A;  2XCP A;  2W9C B;  5DBC A;  1KRP A;  1D8L A;  3BQ1 A;  5KT2 A;  1ARO P;  2BPC A;  5KG6 A;  4BXO B;  1ZQG A;  1TKD A;  1DGS A;  4R8U A;  4DSL A;  4UQG A;  1RYS A;  3RB6 A;  4ED7 A;  2HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...