1WCLA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wclA00
2ISOA 1WCNA 1TAQA 1QSLA 5KFJA 5KFPA 3BQ1A 5KFZA 3G6XA 9ICBA 5J2GA 4Q43A 4ECTA 1X9SA 3RB0A 1XC9A 4UAZA 3M9NB 4K4IA 3PR5B 1T7PA 4B9VA 1ZQRA 7ICLA 2HHQA 3G6VA 2KZMA 1C7YA 4C8MA 9ICHA 4MFFA 5J29A 1BPEA 1XSNA 3RJKA 4JWNA 4RUAA 2PFNA 4KLOA 5KFWA 5F9LA 4P4PA 4XQ8A 4ED3A 4ED7A 2IBKA 4YMNA 3PY8A 4B9MA 4PHAA 2J6SA 2B21A 3MBYA 1U48A 5DLFA 3OSNA 1DOQA 4Z6DA 4RNMA 4DWIA 4M6WA 5BOLA 2MUTA 4PGQA 5CR0A 4GC6A 3RB3A 5CWRA 4K4HA 4IR9A 2A1JB 5EWFA 3SZ2A 1KFSA 4F4ZA 4KLUA 5EWEA 2AJQA 4TUSA 1BPBA 4MEYA 4J9KA 4EBEA 4I28A 5L1LA 1Y88A 4J9MA 5CB1A 5KFNA 2R8IA 1JXLA 4BWMA 1KSPA 4M9GA 4XRHA 7ICFA 5J2EA 1NOMA 3PV8A 1L3VA 4QZGA 4FS1A 5IIMA 4RQ2A 1JIHA 4RQ5A 4UAYA 3UQ0A 2BQRA 2IHNA 2HHUA 3HX0A 1ZQJA 3Q8LA 4F3OA 4DL7A 1L3UA 3Q8QB 1SL0A 3K75D 5HNKA 3PR4A 3H8SA 3V7KA 4ED0A 2C2DA 5KFLA 4YQWA 3GIMA 4GC7A 2GWSA 3PNCA 3TI0A 1X9WA 4ECRA 2Y1IA 3T5HA 1ZQGA 4KLIA 3AUOA 4QWAA 3RJHA 8ICVA 1KLNA 2BQUA 9ICMA 4G3IA 4ECVA 4F4YA 5IIJA 4DQSA 3OJSA 5J2DA 5KG7A 4Q45A 3V6HA 1ZQPA 4RZRA 4ELUA 3H4DA 1ZQUA 8ICQA 3PW5A 3LK9A 3RAXA 3LDAA 4IRDA 2H5XA 5KFXA 2ASDA 2DPJA 3GIKA 1TV9A 4YMMA 2W9CA 2ZTCA 4GLXA 1NK9A 5BPCA 4KTQA 4NM2A 3AU6A 4DFJA 3BDPA 4P4OA 4DLEA 3GDXA 5KT6A 2PI4A 4KLTA 9ICLA 5J2KA 3HP6A 8ICKA 1D9FA 7ICNA 4QW9A 4TUPA 1IXRA 1KRPA 3EZ5A 3B0XA 2WTFA 2BCUA 3PO5A 1SKSA 4NY8A 4RQ1A 3GV7B 1B43A 1B22A 5HMMA 5KFRA 3MDCA 5HHHA 1NJXA 3V6KA 8ICFA 5KG3A 1RYSA 2HVHA 2PXIA 8ICRA 1UT5A 4QWBA 5J0UA 4PHPA 4MF2A 1L5UA 3C2MA 4B9NA 4RPYA 4ELVA 2C22A 2XGQA 2XO7A 1TVAA 4DFKA 4F5OA 4ED8A 2JZBA 4JV1A 4IQUA 4RNOA 1ZQHA 2W9BB 1QLNA 3PW7A 3TANA 1JMSA 2MAXA 9ICAA 8ICXA 1K1SA 1RXVA 3MFHA 3UQ2A 4J9RA 3ZDCA 1TKDA 4M9JA 4KLQA 9ICWA 2V9WA 5IIIA 5F9NA 3Q8MA 5KT4A 1XSLA 1U45A 2FMPA 4I2EA 4Q8EA 1SZPA 1D9DA 1L3SA 2ZUCA 8ICHA 5KFYA 4M9LA 3PX0A 2ATLA 7ICRA 5KFMA 1Z00A 5IIOA 5DDMA 2RDJA 1NKCA 4CCHA 1TK8A 4QZ8A 4B9UA 2HHSA 9ICSA 4O0IA 5KG1A 3V72A 4R8UB 4B9LA 3ISDA 4XA5A 2AQ0A 4YN4A 4DFPA 5DLGA 1S0VA 3V7LA 2ZTEA 4O3QA 4DS4A 3ISCA 3HWTA 2KFNA 4IQWA 4F2RA 1NJZA 5KTQA 1ZQKA 2AGOA 2I1QA 4YFKA 1NK8A 5KFEA 2R8JA 4R8UA 4ECXA 2AGQA 3M9OB 1UA0A 2XCPA 1BPDA 4J9SA 1ZJMA 4PPXA 3JPSA 1BPXA 8ICLA 5CHGA 5IIKA 3THVA 4QZDA 1N56A 2IMWP 4C8OA 1JX4A 1S76D 4YD1A 4C8LA 5DGAA 1X2IA 1MQ2A 5C5JA 4QWCA 2ZJ8A 4BDPA 4JK1A 3TQ1A 1XWLA 4R63A 4ECQA 1UA1A 4RPZA 1JN3A 1D8LA 4C8NA 1KTQA 5J0RA 3MR3A 4Q8FA 1KFDA 2NRWA 3OHAA 8ICYA 4Z6FA 3C21A 4M6WB 3RRGA 2HVIA 2MUTB 3BQTA 2VANA 1UT8A 2BPCA 2ZJAA 3PMNA 4P4MA 4ECZA 5D49A 3V6JA 2IHMA 4PGYA 5KFFA 4TURA 4DL2A 4HYKA 2BDPA 5J0OA 4FBUA 9ICPA 1N48A 1ZQTA 4FS2A 1L3TA 2BPGA 4JV2A 4NLZA 3ETLA 3RJIA 4DSFA 2J6UA 3RR7A 8ICUA 9ICJA 3SV3A 5KFQA 4DOAA 3EPIA 4Q44A 7ICKA 7ICVA 4ECYA 1QSYA 3PVXA 4KLLA 5J0XA 4M9HA 1TAUA 4F5RA 2FPKA 2Y1JA 4YR3A 4KITB 5KT7A 4XUSA 4I2FA 9ICVA 4DS5A 4DOBA 4I2DA 3H7IA 4F91B 3T5JA 2VA2A 1EXNA 4LZDA 2KZZA 3ZDDA 3B0YA 5JUMA 4IR1A 1NK4A 1RPLA 2IA6A 4YR0A 1NK5A 4KLEA 3PMLA 3RBDA 1S77D 3QZ7A 2FPMA 1QTMA 2W9MA 8ICMA 4M2YA 2W9CB 4M0AA 5EOZA 1IM4A 8ICJA 4O3SA 4MEXA 5J0SA 2BHNA 3OGUA 3TAQA 7ICUA 3TARA 1ZQFA 2BKEA 3ZDEA 4J9QA 2AQ4A 4KLDA 9ICOA 5KT2A 5DQGA 5DB8A 2F1HA 9ICIA 3ZD8A 3RR8A 3LWLA 9ICRA 4YG2A 4KLHA 1X9MA 2V4RA 5DB9A 5L1IA 3JPQA 1ZQMA 4DQPA 3QEBZ 3TAPA 4RNNA 5KFCA 5J0PA 3QEAZ 4F5QA 1NK6A 3IM1A 4UB1A 4UQGA 5KFUA 3RJGA 4O5CA 1XU4A 4EYHB 5DQHA 4QZ9A 5EWGA 4DSJA 4RUCA 8ICCA 3C2KA 4M47A 2JEIA 2JZBB 4KLFA 1KFTA 7ICTA 4Z6CA 4EBCA 3PW0A 1ZQEA 4LVSA 8ICZA 4KN4A 4I2IA 9ICQA 4KN7A 3RRHA 3HPOA 3M8RA 4PH5A 3N4MB 3MDAA 4M9NA 3MR2A 3JPNA 3ZDAA 4IRCA 4UB4A 4KLMA 3NGDA 4R66A 1KDHA 8ICTA 4UBBA 4RT3A 9ICKA 1Z00B 3RBEA 2R8HA 5KFGA 9ICEA 2HHTA 2KTQA 5KFBA 4I27A 5CP2A 2NRZA 3KHHA 3H8JA 2BCSA 4I2CA 5HMLA 4E0DA 4ZH4A 1KEJA 2F1IA 3OHBA 4RQ4A 3MR6A 5DG9A 2W8LA 1ZQAA 1AROP 4IRKA 8ICNA 2PFOA 3FYHA 4KLGA 8ICSA 1A77A 5L9XA 8ICBA 5DG8A 2C28A 4TQRA 9ICFA 4Z6EA 4DSLA 1LB2B 1XSPA 4ED2A 3MR5A 2P6UA 1ZQOA 2R8KA 4LZGA 3ISBA 3V7JA 2FLLA 4UB2A 1U47A 2FLNA 5KG5A 3H8WA 4NLNA 1ZQYA 5J0TA 3RB6A 3K4GA 5KFHA 3PW2A 4YXJA 4QWEA 4F8RA 4RQ0A 2BQ3A 4X5VA 5KFAA 8ICGA 4EYIB 2FMQA 1ZQVA 3E2EA 3RB4A 4B9TA 4F2SA 3BQ2A 4O5KA 7ICPA 5KFIA 3KHLA 3GILA 1D8YA 4DQIA 9ICTA 5BOMA 1DGSA 5DGBA 4ECSA 3EYZA 4F4XA 2XY7A 1BVSA 4KMUA 4JV0A 2HHVA 2ASJA 2ZJ5A 8ICEA 5DBAA 4ECUA 1NK0A 3C2LA 3KHGA 5HP4A 4O3NA 5J2AA 4F4WA 1T4GA 3GFKB 3Q8KA 1ZJNA 7ICSA 3OJUA 4DL4A 2R8GA 3FDSA 2HHXA 1XO1A 4MFCA 1H38A 3SI8A 5CA7A 5DB7A 2UVRA 1ZQQA 3Q8SB 3RH5A 1SL2A 2BCVA 7ICOA 3MGIA 2FMSA 4YCXA 4QZHA 5DG7A 2FLPA 7ICHA 1S97A 4ECWA 3PW4A 7ICMA 3H40A 1NKBA 1CEZA 2PFQA 5IINA 4DL6A 1XS9D 1T3NA 4C8KA 3N97B 3GIIA 1T8EA 5J0YA 4J9LA 4QZIA 2BCQA 1ZQSA 4DO9A 8ICAA 8ICIA 3ORYA 1ZQZA 3C1YA 2HHWA 2PFPA 4O3OA 4GXJA 7ICIA 3Q8RB 4PHEA 4MFAA 2JEJA 4NLGA 2NRVA 4ED6A 4I2JA 3M8SA 2BR0A 2ZTDA 4RQ3A 4UBCA 5KFVA 3GQCA 4RU9A 5DQIA 1U49A 5KT5A 4NM1A 1HUOA 1ZQNA 3GV5B 4EZ9A 3UXOA 4O3PA 4QZCA 4TUQA 4F93B 1S0MA 3G6YA 5DKWA 1JXEA 5J2HA 4DOCA 4F5NA 2ISPA 2Q0ZX 1SKRA 4IQTA 4JUZA 4P2HA 4RQ6A 5J2FA 4KLSA 9ICGA 3UXPA 2A1JA 3NTUA 1MSWD 4RT2A 1HUZA 4I2HA 2V4QA 3GV8B 9ICNA 5KFSA 2AU0A 1Z3EB 5KFKA 1ZYQA 1MQ3A 5DB6A 3T5KA 3UXNA 2XGPA 5J2CA 1SL1A 1ZQCA 4UB5A 1NJWA 3RJJA 3RH6A 1TFRA 1TK5A 4DSEA 1ZQXA 2XY5A 7ICEA 3GIJA 4GXIA 4DF4A 2P66A 8ICOA 4BXOB 2ZUBA 5J0WA 2C2EA 1U9LA 4K4GA 7ICQA 1BPZA 2JEGA 5L1KA 4MF8A 3ZD9A 1U4BA 3HW8A 4O3RA 4DEZA 4IQVA 4DLGA 4J9OA 3KHRA 5KG6A 1ZETA 4O9MA 3JPPA 3BQ0A 5DDYA 1QSSA 3MFIA 4QZBA 3UPQA 2NRXA 4ED1A 4QZAA 4YMOA 4TQSA 1S9FA 2BPFA 1NKEA 3Q8PB 4BXOA 2HW3A 1S10A 4ELTA 9ICXA 1ZQBA 2RDIA 1TK0A 5J2IA 3ZDBA 2LYHA 3H4BA 5TZVA 4BWJA 4DL3A 4PGXA 4DSKA 3EPGA 3C23A 4GXKA 4J9PA 2UVUA 2UVVA 4DFMA 7ICGA 3M9MB 3RJFA 4RQ7A 8ICPA 2ZUDA 2XC9A 2J6TA 1WCLA 3JPRA 3RAQA 1ZQLA 1S0OA 5KG2A 4R64A 3C5FA 1SKWA 1BPYA 3RH4A 3EWAA 3SYZA 2KFZA 5DBCA 3SV4A 3RTVA 4M04A 5KT3A 3HT3A 3PX4A 3C1ZA 4BGDA 1RXWA 2C2RA 1S0NA 1LV5A 3MGHA 4PHDA 4QWDA 1BGXT 5KFOA 4JWMA 2DFLA 1V9PA 4F4KA 1MC8A 3RJEA 5D46A 2BGWA 1COOA 4UAWA 5KG0A 4QW8A 4J9NA 4FO6A 3TFRA 1RZTA 2XCAA 1NJYA 5KG4A 3JPOA 4DL5A 5HHIA 4RQ8A 3QE9Y 3PX6A 3LWMA 1CUKA 1ZQWA 5KFDA 2I9GA 2PI5A 2VA8A 2W9AA 2DPIA 3PO4A 4I2BA 4I2AA 3BJYA 4NLKA 4YVZA 1A76A 1ZQDA 3QZ8A 4EEYA 1K1QA 4EBDA 9ICCA 2W9BA 5DBBA 4EZ6A 4FBTA 4KLJA 5J0QA 1HJPA 9ICUA 7ICJA 4I29A 4F92B 1ZQIA 3AU2A 4F50A 3OSPA 2VA3A 4R65A 2OWOA 5D4BA 2BCRA 2AGPA 4RPXA 4QZEA 5J2BA 2NRTA 5L1JA 4F5PA 2ALZA 4YXMA 1PZNA 2F1JA 3KTQA 4I2GA 2M9NA 8ICWA 2KZ3A 3MABA 5KFTA 4NXZA 4YD2A 2JEFA 2XY6A 2UVWA 2ASLA 3T5LA 3TFSA 2FPLA 4QZFA 3T3FA 2P6RA 4DSIA 2KN7A 4DF8A 3C5GA 5J2JA 3IHQB 4UB3A 3JPTA 5IILA 1NK7A 4B9SA 4YP3A 4O5EA 4DQRA 5CJ7A 2W8KA 4DQQA 4YR2A 1RYRA 3EW9A
chains in the Genus database with same CATH superfamily
1WCNA 2O6KA 5KFJA 5KFPA 1ECWA 5HR6A 3R9KA 9ICBA 1XC9A 1T7PA 2HHQA 2HBMA 1C7YA 4C8MA 4P0PB 1XSNA 2GO7A 2IBKA 2E8OA 4ED3A 4CF3A 3PY8A 4C4TA 2ZXHA 2LYBA 2J6SA 2B21A 1DOQA 4M6WA 5BOLA 3KZIU 4K4HA 2A1JB 5EWFA 1KFSA 1J97A 4I28A 5CB1A 2R8IA 1SXDA 4XRHA 5J2EA 4B9SA 2IHNA 3UQ0A 4RQ5A 1L7OA 4BX9C 1ZQJA 1KBUA 2DL0A 2A3VA 3K75D 3LYSA 5EE3A 2CPRA 3H8SA 3PR4A 3BZKA 4YQWA 3GIMA 4GC7A 2PMZF 4KLIA 1N62A 2BQUA 4FZMA 4ECVA 3IG8A 4F4YA 3RAXA 4IRDA 5KFXA 4P4OA 3IDWA 7ICNA 4EX7A 5KL1B 4QW9A 2KP7A 3EZ5A 1P7DA 2WTFA 3PO5A 2KVSA 4U7CA 4RQ1A 1B22A 1B43A 4UARA 3TKAA 8ICRA 1L5UA 4B9NA 2HBKA 2C22A 2VKQA 4F5OA 2JZBA 4KX3A 2W3RA 5ALPA 1QLNA 4KX5A 1JMSA 2MAXA 1K1SA 3ZDCA 3ED5A 4BUGA 1XSLA 1X66A 4I2EA 4Q8EA 1SZPA 1Q8KA 4NLBA 2ZUCA 1L3SA 2DQNB 5KFMA 4R8UB 4B9LA 4DFPA 2NO4A 2ZTEA 2G0AA 4DS4A 3HWTA 4IQWA 4F2RA 1NJZA 5ALTA 2R8JA 4ECXA 2KNJA 5AIAA 5AKEA 5KAFU 1UA0A 2XCPA 4J9SA 1Z4NA 3D2NA 4RQNA 8ICLA 5CHGA 5IIKA 2KJ9A 3A0HU 4QZDA 1S5LU 2KMDA 5CEHA 1JX4A 4C8OA 4FZNA 4YD1A 5DGAA 1X2IA 4Y2VA 2H3VA 3GU3A 3CNHA 5J0RA 1KTQA 3MR3A 3C28A 4Q8FA 1LKYA 2HBLA 3ALRA 4Z6FA 2MUTB 1QQ5A 1RG6A 2WAQF 4P4MA 2LYAA 2IHMA 5J0OA 3NS1A 1N48A 1L3TA 3ETLA 3RJIA 3SV3A 5KFQA 7ICKA 2KE7A 1FO4A 3AQEA 4KLLA 4NWIA 1TAUA 4DOBA 4I2DA 1QH9A 4LZDA 4NL9C 4IR1A 1NK4A 4F72A 2IA6A 3QXGA 1NK5A 3RBDA 2E8NA 2FPMA 1F0MA 4M2YA 2W9CB 3HKZF 5AI5A 1PVRA 2F3NA 3RR8A 3BS5B 4DQPA 3F53A 3N7PD 4UQGA 1NK6A 3C2KA 4M47A 3K1ZA 4C7ZA 4Z6CA 4LVSA 4PH5A 5GTHU 3MDAA 4OJ5A 3ZDAA 3QNMA 4IRCA 2VJ4A 2ES6A 4C80A 1KDHA 8ICTA 4USAA 4AP9A 3AQFA 4RT3A 1Z00B 3RBEA 2R8HA 9ICEA 4I27A 3KHHA 3E0FA 2YB1A 1HIWA 2W8LA 1ZD4A 1CRXA 1ZQAA 1QCKA 2PFOA 4KLGA 8ICSA 3M1YA 1URJA 2KJ5A 3SAHA 3I1YA 4DSLA 3WK6A 3NRWA 3V7JA 1UCVA 2FLLA 1L8OA 4UB2A 2FLNA 4US8A 1RQNA 3RB6A 3K4GA 3PW2A 4RQMA 4RQ0A 3E2EA 3WKAA 1T94A 2KG5A 4PJ0U 1D8YA 5BOMA 2HHVA 1BVSA 2EAOA 1Z19A 1IIPA 3C2LA 3FC4A 2ODGA 2W04A 5G5HA 5J2AA 1S8OA 4P0QA 4DL4A 5AICA 3M6KA 2W54A 1ZXIA 1ZQQA 3Q8SB 3MGIA 4QZHA 2FLPA 1N5XA 4ECWA 7ICMA 2PFQA 5IINA 4DL6A 4J9LA 1F44A 1ZQSA 4DO9A 1SWVA 2RQ5A 1Q3VA 2PFPA 4CRXA 2EANA 4MFAA 2ZIVB 3WKCA 3M8SA 2ZTDA 4RQ3A 5KT5A 4NM1A 1HUOA 2MU2A 3UXOA 2FE9A 2H3IA 2GOLA 2AH5A 4DOCA 4F5NA 5J8YA 4IQTA 2KOBA 9ICGA 2EAPA 3UXPA 4RT2A 1HUZA 2EZXA 3H0RB 3KD3A 2KSOA 1M6YA 4UB5A 3RJJA 1TFRA 3D2SA 1ZQXA 2XY5A 3WKDA 1KL9A 3IG5A 5J0WA 2WFAA 3ZD9A 1HEKA 1DGJA 1VDVA 3MFIA 4AYBC 2NRXA 1O03A 5ALRA 5FP0A 9ICXA 1ZQBA 2RDIA 2LYHA 4DL3A 4DSKA 3J81j 3C23A 4DFMA 1F5SA 7ICGA 3CYMA 2ZUDA 2J6TA 3RTVA 1Z1VA 1RXWA 5AHXA 4QWDA 3M6ZA 2DF4B 1MC8A 3RJEA 2BGWA 1COOA 1NJYA 1FEZA 5EE0A 5DBBA 4EZ6A 4KLJA 9ICUA 1IG6A 4I29A 4F92B 2OWOA 3AU2A 1BNPA 2BCRA 5AM4A 4RPXA 2OH2A 2ALZA 1PZNA 4JMUA 2F1JA 3WK9A 3MABA 4NXZA 2FPLA 2ZXIA 2KN7A 1N60A 3IHQB 5AI4A 5CJ7A 2W8KA 4EENA 5AKIA 5JRTA 4Y2PA 4OD0A 1TAQA 2F77X 3G6XA 5J2GA 4Q43A 4ECTA 2WF8A 4UAZA 4B9VA 3KKAC 3G6VA 2HBJA 9ICHA 4MFFA 5ALOA 5KFWA 3NUQA 1X42A 1U48A 1ZRMA 3O0FA 4EELA 3NVZA 4EBEA 4MEYA 4J9KA 5L1LA 1Y88A 4J9MA 5KFNA 4QNLA 4FS1A 2R18A 4RQ2A 1JIHA 2BQRA 2HHUA 2W55A 4Y2SA 3V7KA 4ED0A 5KFLA 2K8AA 2GWSA 4IS7A 3PNCA 4CGZA 2QB1A 3TI0A 2EH9A 1ZQGA 3AUOA 3RJHA 3TADA 2ZIXB 1ZQPA 4RZRA 8ICQA 2DPJA 3GIKA 1KN5A 4YMMA 1FIQA 4C4RA 4NM2A 4DFJA 3GDXA 5KT6A 2PI4A 5J2KA 3HP6A 8ICKA 1XO0A 4QIWF 3PSTA 1SIJA 2LMRA 2K4PA 3MDCA 1NJXA 3V6KA 1MA7A 2HMXA 3QU4A 1UT5A 4PHPA 3QX7A 4MF2A 3C2MA 3AMZA 4ED8A 3PW7A 1JALA 9ICAA 2EAMA 1TKDA 9ICWA 5IIIA 4C0ZA 2HOIA 2B6GA 7ICRA 2RDJA 4CCHA 1TK8A 4O0IA 3H0LB 5DLGA 4FE3A 4O3QA 2KFNA 3IN5A 4YFKA 2AGQA 2H3ZA 2RLTA 4ACOA 3JPSA 4Y2XA 3THVA 1N56A 1S76D 5ALFA 3L5KA 2KVCA 4BDPA 4JK1A 1XWLA 1CI4A 1D8LA 2KJ8A 2NRWA 8ICYA 5ALSA 3C21A 2QB0B 3N7RC 2VANA 1UQVA 3NVVA 4PGYA 4DL2A 5KNIA 1KW4A 3RR7A 2J6UA 9ICJA 2QARB 2GLEA 1Z1BA 4ECYA 1QSYA 1COKA 4AYBF 1DK3A 4KITB 4YR3A 4C4SA 4XUSA 4I2FA 2P35A 3H7IA 4F91B 5ALEA 2KKPA 3B0YA 1NNLA 5ALMA 4KLEA 1S77D 2OM6A 2W9MA 8ICJA 1IM4A 2ZIWA 4MEXA 2BHNA 3TARA 4UATA 2BKEA 4J9QA 4KLDA 5KT2A 2F1HA 9ICRA 4YG2A 5DB9A 5EE9A 3JPQA 1L6NA 4G9BA 4UAVA 4O5CA 4EYHB 2W11A 4Y2UA 8ICCA 5ALZA 1KFTA 7ICTA 3PW0A 2KICA 4IC9A 4I2IA 3WKBA 9ICQA 3RRHA 3N4MB 2NO5A 2L5YA 4UB4A 3UM9A 9ICKA 1BNOA 5KFGA 5ALIA 4FFDA 1X6IA 2JH1A 3H8JA 3KBBA 2BCSA 4I2CA 5HMLA 4E0DA 4LJXA 4ZH4A 3IV6A 2CXYA 3OHBA 3SQIA 8ICNA 1A77A 8ICBA 9ICFA 3SAFA 3ONNA 2P6UA 1K5OA 5KG5A 4NLNA 1NI3A 2KV2A 5KFHA 4QWEA 1DK2A 4X5VA 5KFAA 3FAHA 1ZQVA 2LKYA 2WHEA 4O5KA 3KHLA 3S6JA 4DQIA 2H3QA 4JV0A 3MC1A 2ASJA 1WYGA 4ECUA 2F8KA 1DRGA 5G5GA 4O3NA 1ZJNA 2R8GA 2HHXA 4EX6A 1AQ6A 5DB7A 7ICOA 3PSIA 1S97A 1CEZA 3H40A 1XS9D 4UB6U 4C8KA 3N97B 3GIIA 3KFUF 5AI9A 3M7DA 8ICAA 8ICIA 1SV0A 1ZQZA 3C1YA 3WKEA 2HHWA 4NLGA 2NV3A 2NRVA 3QYPA 4ED6A 4I2JA 4P0PA 5KFVA 3GQCA 4RU9A 5DQIA 4DCCA 5JU5A 1ZQNA 3GV5B 4O3PA 1VJ5A 2Y9UA 3B9JA 4TUQA 1S0MA 3G6YA 2ISPA 5ALNA 2LHTA 2BZFA 2EZZA 2EDUA 5ALQA 4P2HA 4KLSA 2A1JA 1MSWD 3GV8B 3DV9A 5KFSA 5ALKA 4HAIA 2AHOB 5L1MA 1ZQCA 1L7MA 7ICEA 4GXIA 2G5IB 4NV0A 4OJ6A 2HSZA 4K4GA 7ICQA 4O3RA 4MF8A 1UHUA 2F76X 3HW8A 3CW2C 4IQVA 4J9OA 1ZETA 3JPPA 2KEYA 5AKJA 2DUYA 3UPQA 4U6PA 3RF9A 4TQSA 4BXOA 2HW3A 1GO3F 1N61A 5J2IA 4BWJA 2D8CA 4J9PA 1RM6C 2M0NA 3M9MB 4B6JA 2W7PA 3RAQA 1ZQLA 3GZFA 1S0OA 5KG2A 3C5FA 1SKWA 3RH4A 3EWAA 3SV4A 3KOOA 3C1ZA 4BGDA 1LV5A 3F2CA 4PHDA 5KFOA 4QJFB 2Y0SC 4UAWA 4QW8A 4J9NA 2XCAA 5KG4A 3JPOA 4DL5A 2A19A 3QE9Y 3PX6A 1CUKA 5KFDA 2I9GA 4I2BA 4J03A 4YVZA 2OCEA 1K1QA 1MN8A 4QIWC 1C20A 9ICCA 1HJPA 2LPEA 5D4BA 1OXJA 4QZEA 5L1JA 4F5PA 1YT3A 4I2GA 8ICWA 2YMMA 4YD2A 2XY6A 3QU7A 1FFVA 1ZQ1C 3T3FA 3C5GA 2EQYA 4UB3A 1NK7A 4O5EA 4YP3A 4DQRA 5AK6A 4DQQA 2DKXA 4YR2A 3AL0B 2HOQA 1J2NA 1QSLA 3BQ1A 5KFZA 1X9SA 3RB0A 5AM0A 1N2XA 3M9NB 1ZQRA 7ICLA 1ZD2P 2IOFA 3RJKA 4JWNA 4US9A 4P4PA 4ED7A 4YMNA 4PHAA 1SXEA 3MBYA 5DLFA 3OSNA 1SZHA 4Z6DA 4RNMA 3SENA 4DWIA 2MUTA 4PGQA 5CR0A 4GC6A 3RB3A 5CWRA 4IR9A 3SZ2A 4KLUA 2AJQA 1Q46A 1KSPA 4BWMA 3A0BU 5AKKA 7ICFA 1L3VA 4QZGA 2XICA 3HX0A 1L3UA 1X9WA 2Y1IA 3T5HA 8ICVA 1KLNA 4UW9A 3SAGA 5ALGA 3OJSA 5J2DA 5KG7A 3H4DA 1ZQUA 5AI6A 3LK9A 3PW5A 2H5XA 2ASDA 1TV9A 2W9CA 2ZTCA 4GLXA 1KKXA 5BPCA 3AU6A 2WF5A 3BDPA 4DLEA 4KLTA 9ICLA 5B5EU 1N5WA 4TUPA 1KRPA 3B0XA 5ALWA 3BS5A 4NY8A 3L3FX 4CF4A 5HMMA 2DBYA 8ICFA 2HVHA 4EEKA 4ELVA 1TVAA 3UMBA 3K1RB 1TE2A 5F3XB 4JV1A 4IQUA 4RNOA 2W9BB 3TANA 3D2QA 1V85A 1DXSA 1RXVA 3MFHA 3UQ2A 4J9RA 4M9JA 4KLQA 1A6SA 5ALDA 3Q8MA 5F9NA 3WK8A 5KT4A 1U45A 1NZBA 1D9DA 3ETRA 2YY6A 2DGZA 5KFYA 4M9LA 1Z00A 1NKCA 2HHSA 1PK1A 9ICSA 3V72A 4XA5A 2AQ0A 3V7LA 5K4LA 3ISCA 2WF6A 4OCZA 2I1QA 1BPDA 1ZJMA 1PVQA 4PPXA 1BPXA 2GH1A 4Y2RA 2IMWP 3HJEA 1MQ2A 5C5JA 3OPXA 1RDFA 4R63A 1UA1A 1JN3A 4C8NA 5H2FU 1O08A 2JGAA 4M6WB 3RRGA 2G09A 3BQTA 2BPCA 4ECZA 2WB1F 3QUCA 5KFFA 2E5SA 2BDPA 2D6FC 1Z4OA 4FS2A 4JV2A 8ICUA 4DOAA 3VC8A 4Q44A 3PVXA 2RP5A 5J0XA 2YQEA 4M9HA 4F5RA 2FPKA 5KT7A 2H3FA 4DS5A 2KZZA 3T5JA 2VA2A 1EXNA 2JMGA 2YN4A 1XNSA 1V97A 3PMLA 3QZ7A 5JTIA 1QTMA 8ICMA 2ZIVA 4O3SA 5J0SA 3F5EA 3OGUA 4PL2A 1VLBA 1ZQFA 2HCFA 2AQ4A 9ICOA 5DQGA 2Y0SF 9ICIA 2F8LA 3ZD8A 3LWLA 2YMQA 1X9MA 5L1IA 1ZQMA 4RNNA 5J0PA 4F5QA 5KFUA 5DQHA 5AK5A 5EWGA 4RUCA 2JEIA 2JZBB 1TAMA 4KLFA 1JRPA 4KN4A 2FDRA 3M8RA 3UMGA 3IRUA 2KK0A 3MR2A 3JPNA 4M9NA 1D8BA 3I76A 2JHDA 4R66A 2VJ5A 4UBBA 1Q3UA 2HHTA 2KTQA 5KFBA 5ALUA 3LVWA 1L7NA 5C0YA 5AI0A 2F1IA 4RQ4A 3MR6A 4IRKA 5L9XA 4CF5A 5DG8A 2AXTU 1LB2B 3QUQA 3TADC 4ED2A 2R8KA 4LZGA 5EE1A 2KD1A 1U47A 1ZQYA 2YB4A 2BDUA 5J0TA 4F8RA 3H0MB 2BQ3A 8ICGA 1LKYB 4EYIB 2FMQA 3F2BA 3RB4A 4F2SA 3BQ2A 1WUDA 3PZPA 9ICTA 4ECSA 2E8PA 5DGBA 2G07A 3EYZA 4F4XA 2XY7A 4KMUA 2ZJ5A 8ICEA 2IOHA 5DBAA 3QUBA 2RRDA 1NK0A 3C29A 1XO1A 4OO1J 1H38A 2HDOA 5CA7A 2BCVA 2JR5A 3F2DA 7ICHA 3PSFA 3I28A 5T14A 1SWWA 5J0YA 4QZIA 3ORYA 4O3OA 4GXJA 7ICIA 1JUDA 3Q8RB 4PHEA 2JEJA 4UB8U 3WK5A 5AKYA 2ZG6A 3SD7A 1PK3A 4F93B 4GFJA 1X6JA 1IV8A 3N7SC 4RQ6A 5J2FA 3NRZA 2MRLA 3N28A 3NTUA 3NASA 1YZ6A 2V4QA 2AU0A 3PSPA 5KFKA 1ZYQA 5AKLA 2XGPA 1SL1A 3RFAA 4DSEA 3ICXA 1ZRNA 2P66A 1B4FA 4BXOB 5AKZA 1BPZA 2OYYA 3E58A 3VCBA 3WK4A 1U4BA 4DEZA 4DLGA 5KG6A 4O9MA 1QSSA 5DDYA 1L7PA 4QZBA 4QZAA 2BPFA 1NKEA 3Q8PB 3HILA 2ZIXA 1TK0A 3H4BA 5TZVA 3F5AA 4PGXA 4GXKA 2UVVA 3RJFA 1WCLA 3U26A 1BPYA 5DBCA 4M04A 5KT3A 3HT3A 1WG8A 3PX4A 1OUQA 1BGXT 4JWMA 2DFLA 1V9PA 5KG0A 5KL8B 5HHIA 4RQ8A 3BQ7A 1ZQWA 2ZIUA 2VA8A 2W9AA 3PO4A 4NLKA 2FJ6A 2W43A 1QQ7A 3WK7A 4FBTA 3HRDD 7ICJA 2VA3A 1ZQIA 3OSPA 2Q4TA 2AGPA 2CRXA 1UPHA 5J2BA 2NRTA 4NL9A 4P0QB 3KTQA 2M9NA 4OJLA 1RQLA 5KFTA 2JEFA 2ASLA 2P6RA 4QZFA 1N63A 4DSIA 5J2JA 5IILA 3JPTA 5AM2A 3IP4B 3RH5A 1RYRA 3LVVA 2ISOA 1X40A 3L4PA 4K4IA 3PR5B 2KZMA 5J29A 1BPEA 1L8LA 4RUAA 2PFNA 4KLOA 5F9LA 5AM3A 4XQ8A 4B9MA 3ZI4A 2LM4A 2QB0A 2JH7A 3DDHA 3CRXA 4F4ZA 5EWEA 4TUSA 1BPBA 4Y2JA 1KQQA 1JXLA 2KSOB 2OXOA 4M9GA 1NOMA 2Z7JA 3PV8A 5IIMA 4UAYA 2MSNA 2QARA 3Q8LA 5AKHA 4DL7A 4F3OA 4UASA 5ALVA 2E1EA 3Q8QB 1SL0A 2WB1C 5HNKA 2C2DA 4MHVA 1SV4A 3SEIA 4ECRA 5ALJA 5TISU 4QWAA 5AKXA 3SMVA 9ICMA 4G3IA 3AN1A 5IIJA 4DQSA 2B0CA 4Q45A 3V6HA 4ELUA 3LDAA 4CDGA 5AM1A 1NK9A 4KTQA 4BJQA 2YX8A 1FFUA 1D9FA 2HI0A 1IXRA 2BCUA 1SKSA 3GV7B 1SV0C 2I6XA 2KKVA 3AM9A 5KFRA 2KIVA 5HHHA 5KG3A 1RYSA 2PXIA 4QWBA 5J0UA 4OJOA 4RPYA 2XGQA 4ICAA 2XO7A 5ALLA 2NYVA 4DFKA 1ZQHA 2XI9A 8ICXA 1PK1B 2V9WA 1YZ7A 3QU2A 5GTIU 2LBOA 2FMPA 2EZYA 2E3TA 2WF7A 8ICHA 3PX0A 2ATLA 5IIOA 5DDMA 1ZD3A 4QZ8A 4B9UA 2K4IA 5KG1A 3ISDA 4YN4A 2QLTA 1S0VA 5AI8A 1B0XA 5KTQA 1ZQKA 2AGOA 1NK8A 5KFEA 2K89A 4R8UA 3M9OB 2W3SA 2Y9TA 4C8LA 4QWCA 2ZJ8A 3BZCA 1V38A 3TQ1A 4ECQA 4RPZA 2F44A 1KFDA 3OHAA 1X9XA 3NVWA 2HVIA 1UT8A 3PMNA 2ZJAA 5AM5A 3V6JA 5D49A 2XVTA 4NJ8A 4TURA 4HYKA 4FBUA 9ICPA 1ZQTA 2BPGA 4NLZA 4DSFA 3QU5A 3BS7A 3EPIA 7ICVA 4F71A 2KHVA 2JV3A 3NVYA 2JRZA 2Y1JA 9ICVA 2XIDA 2WF9A 3ZDDA 5JUMA 1RPLA 4Y2TA 4YR0A 2YMPA 2K8BB 1ED1A 1PUZA 3OTQA 4M0AA 5EOZA 4ZOHC 3TAQA 7ICUA 3MGVA 3ZDEA 3FM9A 1J2MA 5DB8A 4KLHA 3WU2U 2V4RA 2LI6A 2CN1A 3QEBZ 5AIBA 3TAPA 5KFCA 3QEAZ 2LM1A 3IM1A 4UB1A 5ALXA 3RJGA 2OHFA 1XU4A 4CE6A 3SR6A 4QZ9A 4DSJA 4KMOB 4EBCA 3KZXA 1ZQEA 2ESEA 8ICZA 4KN7A 3HPOA 2KHQA 3TACB 4KLMA 1A0PA 3NGDA 2K8CB 2N1RA 5CRXA 5J8YC 5CP2A 1QQ6A 2NRZA 3KKAA 2PMZC 4PL1A 1KEJA 2I5HA 5DG9A 3QUTA 1AROP 3FYHA 2C28A 4TQRA 5ALYA 3UMCA 5AK4A 4Z6EA 1XSPA 3MR5A 1ZQOA 1RYUA 3ISBA 1SB3C 5A0LA 3D6JA 3H8WA 4YXJA 3QU9A 2F2AB 4B9TA 7ICPA 5KFIA 2W7OA 3GILA 1DGSA 3KHGA 5HP4A 2E1FA 4F4WA 1ZOLA 1T4GA 3GFKB 3Q8KA 1PVPA 7ICSA 2E8MA 3OJUA 3FDSA 4MFCA 3DEEA 3SI8A 2UVRA 1SL2A 2IOFK 2FMSA 4YCXA 5DG7A 4PZNA 1JROA 1T3QA 2KIWA 3PW4A 4JB3A 1NKBA 1NZPA 1T3NA 1T8EA 2BCQA 2G08A 2K4HA 3EUB2 2DKZA 2ZIWB 5ALHA 2BR0A 4UBCA 1U49A 4EZ9A 2K4EA 4QZCA 5DKWA 1JXEA 2G06A 5J2HA 2Q0ZX 1SKRA 5HR7A 4JUZA 4I2HA 9ICNA 4Y2QA 2WAQC 1Z3EB 2W03A 1MQ3A 1LVHA 5DB6A 2FI1A 3UXNA 3T5KA 5J2CA 1JI7A 1NJWA 3RH6A 1TK5A 3GIJA 4DF4A 8ICOA 4FZLA 5E79U 2ZUBA 2YTUA 2C2EA 1U9LA 2K60A 2JEGA 5L1KA 2YMLA 3KHRA 3BQ0A 1S9FA 4ED1A 4YMOA 2OEHA 1S10A 4Y2YA 4PZOA 4ELTA 3ZDBA 1ZD5A 3EPGA 2UVUA 4DFDA 2HOFA 4RQ7A 8ICPA 2XC9A 3JPRA 2RHFA 1WWUA 4R64A 3SYZA 5AKGA 3HKZC 1SGGA 2KFZA 4C7YA 2D3DA 2C2RA 1S0NA 4IL6U 3MGHA 2ZIUB 4OJPA 4WJ3B 1OW5A 2A1AA 2QKQA 4CNQA 5KAIU 4F4KA 5D46A 2VIXA 4FO6A 3TFRA 1RZTA 4NLCA 5B66U 3LWMA 2PI5A 2JXJA 2DPIA 4I2AA 3BJYA 1A76A 1ZQDA 3QZ8A 4UAUA 4EEYA 4EBDA 2W9BA 3T79A 1WWVA 5J0QA 3AEVA 3CP8A 4F50A 4O3MA 4R65A 4GIBA 4YXMA 2G5HB 2MA1A 3H8MA 2KZ3A 2UVWA 2DWQA 3T5LA 3TFSA 4DF8A 2PKEA 4A8EA 5AK3A 3EW9A
chains in the Genus database with same CATH topology
2ISOA 1WCNA 1TAQA 1QSLA 5KFJA 5KFPA 3BQ1A 5KFZA 3G6XA 9ICBA 5J2GA 4Q43A 4ECTA 1X9SA 3RB0A 1XC9A 4UAZA 3M9NB 4K4IA 3PR5B 1T7PA 4B9VA 1ZQRA 7ICLA 2HHQA 3G6VA 2KZMA 1C7YA 4C8MA 9ICHA 4MFFA 5J29A 1BPEA 1XSNA 3RJKA 4JWNA 4RUAA 2PFNA 4KLOA 5KFWA 5F9LA 4P4PA 4XQ8A 4ED3A 4ED7A 2IBKA 4YMNA 3PY8A 4B9MA 4PHAA 2J6SA 2B21A 3MBYA 1U48A 5DLFA 3OSNA 1DOQA 4Z6DA 4RNMA 4DWIA 4M6WA 5BOLA 2MUTA 4PGQA 5CR0A 4GC6A 3RB3A 5CWRA 4K4HA 4IR9A 2A1JB 5EWFA 3SZ2A 1KFSA 4F4ZA 4KLUA 5EWEA 2AJQA 4TUSA 1BPBA 4MEYA 4J9KA 4EBEA 4I28A 5L1LA 1Y88A 4J9MA 5CB1A 5KFNA 2R8IA 1JXLA 4BWMA 1KSPA 4M9GA 4XRHA 7ICFA 5J2EA 1NOMA 3PV8A 1L3VA 4QZGA 4FS1A 5IIMA 4RQ2A 1JIHA 4RQ5A 4UAYA 3UQ0A 2BQRA 2IHNA 2HHUA 3HX0A 1ZQJA 3Q8LA 4F3OA 4DL7A 1L3UA 3Q8QB 1SL0A 3K75D 5HNKA 3PR4A 3H8SA 3V7KA 4ED0A 2C2DA 5KFLA 4YQWA 3GIMA 4GC7A 2GWSA 3PNCA 3TI0A 1X9WA 4ECRA 2Y1IA 3T5HA 1ZQGA 4KLIA 3AUOA 4QWAA 3RJHA 8ICVA 1KLNA 2BQUA 9ICMA 4G3IA 4ECVA 4F4YA 5IIJA 4DQSA 3OJSA 5J2DA 5KG7A 4Q45A 3V6HA 1ZQPA 4RZRA 4ELUA 3H4DA 1ZQUA 8ICQA 3PW5A 3LK9A 3RAXA 3LDAA 4IRDA 2H5XA 5KFXA 2ASDA 2DPJA 3GIKA 1TV9A 4YMMA 2W9CA 2ZTCA 4GLXA 1NK9A 5BPCA 4KTQA 4NM2A 3AU6A 4DFJA 3BDPA 4P4OA 4DLEA 3GDXA 5KT6A 2PI4A 4KLTA 9ICLA 5J2KA 3HP6A 8ICKA 1D9FA 7ICNA 4QW9A 4TUPA 1IXRA 1KRPA 3EZ5A 3B0XA 2WTFA 2BCUA 3PO5A 1SKSA 4NY8A 4RQ1A 3GV7B 1B43A 1B22A 5HMMA 5KFRA 3MDCA 5HHHA 1NJXA 3V6KA 8ICFA 5KG3A 1RYSA 2HVHA 2PXIA 8ICRA 1UT5A 4QWBA 5J0UA 4PHPA 4MF2A 1L5UA 3C2MA 4B9NA 4RPYA 4ELVA 2C22A 2XGQA 2XO7A 1TVAA 4DFKA 4F5OA 4ED8A 2JZBA 4JV1A 4IQUA 4RNOA 1ZQHA 2W9BB 1QLNA 3PW7A 3TANA 1JMSA 2MAXA 9ICAA 8ICXA 1K1SA 1RXVA 3MFHA 3UQ2A 4J9RA 3ZDCA 1TKDA 4M9JA 4KLQA 9ICWA 2V9WA 5IIIA 5F9NA 3Q8MA 5KT4A 1XSLA 1U45A 2FMPA 4I2EA 4Q8EA 1SZPA 1D9DA 1L3SA 2ZUCA 8ICHA 5KFYA 4M9LA 3PX0A 2ATLA 7ICRA 5KFMA 1Z00A 5IIOA 5DDMA 2RDJA 1NKCA 4CCHA 1TK8A 4QZ8A 4B9UA 2HHSA 9ICSA 4O0IA 5KG1A 3V72A 4R8UB 4B9LA 3ISDA 4XA5A 2AQ0A 4YN4A 4DFPA 5DLGA 1S0VA 3V7LA 2ZTEA 4O3QA 4DS4A 3ISCA 3HWTA 2KFNA 4IQWA 4F2RA 1NJZA 5KTQA 1ZQKA 2AGOA 2I1QA 4YFKA 1NK8A 5KFEA 2R8JA 4R8UA 4ECXA 2AGQA 3M9OB 1UA0A 2XCPA 1BPDA 4J9SA 1ZJMA 4PPXA 3JPSA 1BPXA 8ICLA 5CHGA 5IIKA 3THVA 4QZDA 1N56A 2IMWP 4C8OA 1JX4A 1S76D 4YD1A 4C8LA 5DGAA 1X2IA 1MQ2A 5C5JA 4QWCA 2ZJ8A 4BDPA 4JK1A 3TQ1A 1XWLA 4R63A 4ECQA 1UA1A 4RPZA 1JN3A 1D8LA 4C8NA 1KTQA 5J0RA 3MR3A 4Q8FA 1KFDA 2NRWA 3OHAA 8ICYA 4Z6FA 3C21A 4M6WB 3RRGA 2HVIA 2MUTB 3BQTA 2VANA 1UT8A 2BPCA 2ZJAA 3PMNA 4P4MA 4ECZA 5D49A 3V6JA 2IHMA 4PGYA 5KFFA 4TURA 4DL2A 4HYKA 2BDPA 5J0OA 4FBUA 9ICPA 1N48A 1ZQTA 4FS2A 1L3TA 2BPGA 4JV2A 4NLZA 3ETLA 3RJIA 4DSFA 2J6UA 3RR7A 8ICUA 9ICJA 3SV3A 5KFQA 4DOAA 3EPIA 4Q44A 7ICKA 7ICVA 4ECYA 1QSYA 3PVXA 4KLLA 5J0XA 4M9HA 1TAUA 4F5RA 2FPKA 2Y1JA 4YR3A 4KITB 5KT7A 4XUSA 4I2FA 9ICVA 4DS5A 4DOBA 4I2DA 3H7IA 4F91B 3T5JA 2VA2A 1EXNA 4LZDA 2KZZA 3ZDDA 3B0YA 5JUMA 4IR1A 1NK4A 1RPLA 2IA6A 4YR0A 1NK5A 4KLEA 3PMLA 3RBDA 1S77D 3QZ7A 2FPMA 1QTMA 2W9MA 8ICMA 4M2YA 2W9CB 4M0AA 5EOZA 1IM4A 8ICJA 4O3SA 4MEXA 5J0SA 2BHNA 3OGUA 3TAQA 7ICUA 3TARA 1ZQFA 2BKEA 3ZDEA 4J9QA 2AQ4A 4KLDA 9ICOA 5KT2A 5DQGA 5DB8A 2F1HA 9ICIA 3ZD8A 3RR8A 3LWLA 9ICRA 4YG2A 4KLHA 1X9MA 2V4RA 5DB9A 5L1IA 3JPQA 1ZQMA 4DQPA 3QEBZ 3TAPA 4RNNA 5KFCA 5J0PA 3QEAZ 4F5QA 1NK6A 3IM1A 4UB1A 4UQGA 5KFUA 3RJGA 4O5CA 1XU4A 4EYHB 5DQHA 4QZ9A 5EWGA 4DSJA 4RUCA 8ICCA 3C2KA 4M47A 2JEIA 2JZBB 4KLFA 1KFTA 7ICTA 4Z6CA 4EBCA 3PW0A 1ZQEA 4LVSA 8ICZA 4KN4A 4I2IA 9ICQA 4KN7A 3RRHA 3HPOA 3M8RA 4PH5A 3N4MB 3MDAA 4M9NA 3MR2A 3JPNA 3ZDAA 4IRCA 4UB4A 4KLMA 3NGDA 4R66A 1KDHA 8ICTA 4UBBA 4RT3A 9ICKA 1Z00B 3RBEA 2R8HA 5KFGA 9ICEA 2HHTA 2KTQA 5KFBA 4I27A 5CP2A 2NRZA 3KHHA 3H8JA 2BCSA 4I2CA 5HMLA 4E0DA 4ZH4A 1KEJA 2F1IA 3OHBA 4RQ4A 3MR6A 5DG9A 2W8LA 1ZQAA 1AROP 4IRKA 8ICNA 2PFOA 3FYHA 4KLGA 8ICSA 1A77A 5L9XA 8ICBA 5DG8A 2C28A 4TQRA 9ICFA 4Z6EA 4DSLA 1LB2B 1XSPA 4ED2A 3MR5A 2P6UA 1ZQOA 2R8KA 4LZGA 3ISBA 3V7JA 2FLLA 4UB2A 1U47A 2FLNA 5KG5A 3H8WA 4NLNA 1ZQYA 5J0TA 3RB6A 3K4GA 5KFHA 3PW2A 4YXJA 4QWEA 4F8RA 4RQ0A 2BQ3A 4X5VA 5KFAA 8ICGA 4EYIB 2FMQA 1ZQVA 3E2EA 3RB4A 4B9TA 4F2SA 3BQ2A 4O5KA 7ICPA 5KFIA 3KHLA 3GILA 1D8YA 4DQIA 9ICTA 5BOMA 1DGSA 5DGBA 4ECSA 3EYZA 4F4XA 2XY7A 1BVSA 4KMUA 4JV0A 2HHVA 2ASJA 2ZJ5A 8ICEA 5DBAA 4ECUA 1NK0A 3C2LA 3KHGA 5HP4A 4O3NA 5J2AA 4F4WA 1T4GA 3GFKB 3Q8KA 1ZJNA 7ICSA 3OJUA 4DL4A 2R8GA 3FDSA 2HHXA 1XO1A 4MFCA 1H38A 3SI8A 5CA7A 5DB7A 2UVRA 1ZQQA 3Q8SB 3RH5A 1SL2A 2BCVA 7ICOA 3MGIA 2FMSA 4YCXA 4QZHA 5DG7A 2FLPA 7ICHA 1S97A 4ECWA 3PW4A 7ICMA 3H40A 1NKBA 1CEZA 2PFQA 5IINA 4DL6A 1XS9D 1T3NA 4C8KA 3N97B 3GIIA 1T8EA 5J0YA 4J9LA 4QZIA 2BCQA 1ZQSA 4DO9A 8ICAA 8ICIA 3ORYA 1ZQZA 3C1YA 2HHWA 2PFPA 4O3OA 4GXJA 7ICIA 3Q8RB 4PHEA 4MFAA 2JEJA 4NLGA 2NRVA 4ED6A 4I2JA 3M8SA 2BR0A 2ZTDA 4RQ3A 4UBCA 5KFVA 3GQCA 4RU9A 5DQIA 1U49A 5KT5A 4NM1A 1HUOA 1ZQNA 3GV5B 4EZ9A 3UXOA 4O3PA 4QZCA 4TUQA 4F93B 1S0MA 3G6YA 5DKWA 1JXEA 5J2HA 4DOCA 4F5NA 2ISPA 2Q0ZX 1SKRA 4IQTA 4JUZA 4P2HA 4RQ6A 5J2FA 4KLSA 9ICGA 3UXPA 2A1JA 3NTUA 1MSWD 4RT2A 1HUZA 4I2HA 2V4QA 3GV8B 9ICNA 5KFSA 2AU0A 1Z3EB 5KFKA 1ZYQA 1MQ3A 5DB6A 3T5KA 3UXNA 2XGPA 5J2CA 1SL1A 1ZQCA 4UB5A 1NJWA 3RJJA 3RH6A 1TFRA 1TK5A 4DSEA 1ZQXA 2XY5A 7ICEA 3GIJA 4GXIA 4DF4A 2P66A 8ICOA 4BXOB 2ZUBA 5J0WA 2C2EA 1U9LA 4K4GA 7ICQA 1BPZA 2JEGA 5L1KA 4MF8A 3ZD9A 1U4BA 3HW8A 4O3RA 4DEZA 4IQVA 4DLGA 4J9OA 3KHRA 5KG6A 1ZETA 4O9MA 3JPPA 3BQ0A 5DDYA 1QSSA 3MFIA 4QZBA 3UPQA 2NRXA 4ED1A 4QZAA 4YMOA 4TQSA 1S9FA 2BPFA 1NKEA 3Q8PB 4BXOA 2HW3A 1S10A 4ELTA 9ICXA 1ZQBA 2RDIA 1TK0A 5J2IA 3ZDBA 2LYHA 3H4BA 5TZVA 4BWJA 4DL3A 4PGXA 4DSKA 3EPGA 3C23A 4GXKA 4J9PA 2UVUA 2UVVA 4DFMA 7ICGA 3M9MB 3RJFA 4RQ7A 8ICPA 2ZUDA 2XC9A 2J6TA 1WCLA 3JPRA 3RAQA 1ZQLA 1S0OA 5KG2A 4R64A 3C5FA 1SKWA 1BPYA 3RH4A 3EWAA 3SYZA 2KFZA 5DBCA 3SV4A 3RTVA 4M04A 5KT3A 3HT3A 3PX4A 3C1ZA 4BGDA 1RXWA 2C2RA 1S0NA 1LV5A 3MGHA 4PHDA 4QWDA 1BGXT 5KFOA 4JWMA 2DFLA 1V9PA 4F4KA 1MC8A 3RJEA 5D46A 2BGWA 1COOA 4UAWA 5KG0A 4QW8A 4J9NA 4FO6A 3TFRA 1RZTA 2XCAA 1NJYA 5KG4A 3JPOA 4DL5A 5HHIA 4RQ8A 3QE9Y 3PX6A 3LWMA 1CUKA 1ZQWA 5KFDA 2I9GA 2PI5A 2VA8A 2W9AA 2DPIA 3PO4A 4I2BA 4I2AA 3BJYA 4NLKA 4YVZA 1A76A 1ZQDA 3QZ8A 4EEYA 1K1QA 4EBDA 9ICCA 2W9BA 5DBBA 4EZ6A 4FBTA 4KLJA 5J0QA 1HJPA 9ICUA 7ICJA 4I29A 4F92B 1ZQIA 3AU2A 4F50A 3OSPA 2VA3A 4R65A 2OWOA 5D4BA 2BCRA 2AGPA 4RPXA 4QZEA 5J2BA 2NRTA 5L1JA 4F5PA 2ALZA 4YXMA 1PZNA 2F1JA 3KTQA 4I2GA 2M9NA 8ICWA 2KZ3A 3MABA 5KFTA 4NXZA 4YD2A 2JEFA 2XY6A 2UVWA 2ASLA 3T5LA 3TFSA 2FPLA 4QZFA 3T3FA 2P6RA 4DSIA 2KN7A 4DF8A 3C5GA 5J2JA 3IHQB 4UB3A 3JPTA 5IILA 1NK7A 4B9SA 4YP3A 4O5EA 4DQRA 5CJ7A 2W8KA 4DQQA 4YR2A 1RYRA 3EW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ISO A;  1WCN A;  1TAQ A;  1QSL A;  5KFJ A;  5KFP A;  3BQ1 A;  5KFZ A;  3G6X A;  9ICB A;  5J2G A;  4Q43 A;  4ECT A;  1X9S A;  3RB0 A;  1XC9 A;  4UAZ A;  3M9N B;  4K4I A;  3PR5 B;  1T7P A;  4B9V A;  1ZQR A;  7ICL A;  2HHQ A;  3G6V A;  2KZM A;  1C7Y A;  4C8M A;  9ICH A;  4MFF A;  5J29 A;  1BPE A;  1XSN A;  3RJK A;  4JWN A;  4RUA A;  2PFN A;  4KLO A;  5KFW A;  5F9L A;  4P4P A;  4XQ8 A;  4ED3 A;  4ED7 A;  2IBK A;  4YMN A;  3PY8 A;  4B9M A;  4PHA A;  2J6S A;  2B21 A;  3MBY A;  1U48 A;  5DLF A;  3OSN A;  1DOQ A;  4Z6D A;  4RNM A;  4DWI A;  4M6W A;  5BOL A;  2MUT A;  4PGQ A;  5CR0 A;  4GC6 A;  3RB3 A;  5CWR A;  4K4H A;  4IR9 A;  2A1J B;  5EWF A;  3SZ2 A;  1KFS A;  4F4Z A;  4KLU A;  5EWE A;  2AJQ A;  4TUS A;  1BPB A;  4MEY A;  4J9K A;  4EBE A;  4I28 A;  5L1L A;  1Y88 A;  4J9M A;  5CB1 A;  5KFN A;  2R8I A;  1JXL A;  4BWM A;  1KSP A;  4M9G A;  4XRH A;  7ICF A;  5J2E A;  1NOM A;  3PV8 A;  1L3V A;  4QZG A;  4FS1 A;  5IIM A;  4RQ2 A;  1JIH A;  4RQ5 A;  4UAY A;  3UQ0 A;  2BQR A;  2IHN A;  2HHU A;  3HX0 A;  1ZQJ A;  3Q8L A;  4F3O A;  4DL7 A;  1L3U A;  3Q8Q B;  1SL0 A;  3K75 D;  5HNK A;  3PR4 A;  3H8S A;  3V7K A;  4ED0 A;  2C2D A;  5KFL A;  4YQW A;  3GIM A;  4GC7 A;  2GWS A;  3PNC A;  3TI0 A;  1X9W A;  4ECR A;  2Y1I A;  3T5H A;  1ZQG A;  4KLI A;  3AUO A;  4QWA A;  3RJH A;  8ICV A;  1KLN A;  2BQU A;  9ICM A;  4G3I A;  4ECV A;  4F4Y A;  5IIJ A;  4DQS A;  3OJS A;  5J2D A;  5KG7 A;  4Q45 A;  3V6H A;  1ZQP A;  4RZR A;  4ELU A;  3H4D A;  1ZQU A;  8ICQ A;  3PW5 A;  3LK9 A;  3RAX A;  3LDA A;  4IRD A;  2H5X A;  5KFX A;  2ASD A;  2DPJ A;  3GIK A;  1TV9 A;  4YMM A;  2W9C A;  2ZTC A;  4GLX A;  1NK9 A;  5BPC A;  4KTQ A;  4NM2 A;  3AU6 A;  4DFJ A;  3BDP A;  4P4O A;  4DLE A;  3GDX A;  5KT6 A;  2PI4 A;  4KLT A;  9ICL A;  5J2K A;  3HP6 A;  8ICK A;  1D9F A;  7ICN A;  4QW9 A;  4TUP A;  1IXR A;  1KRP A;  3EZ5 A;  3B0X A;  2WTF A;  2BCU A;  3PO5 A;  1SKS A;  4NY8 A;  4RQ1 A;  3GV7 B;  1B43 A;  1B22 A;  5HMM A;  5KFR A;  3MDC A;  5HHH A;  1NJX A;  3V6K A;  8ICF A;  5KG3 A;  1RYS A;  2HVH A;  2PXI A;  8ICR A;  1UT5 A;  4QWB A;  5J0U A;  4PHP A;  4MF2 A;  1L5U A;  3C2M A;  4B9N A;  4RPY A;  4ELV A;  2C22 A;  2XGQ A;  2XO7 A;  1TVA A;  4DFK A;  4F5O A;  4ED8 A;  2JZB A;  4JV1 A;  4IQU A;  4RNO A;  1ZQH A;  2W9B B;  1QLN A;  3PW7 A;  3TAN A;  1JMS A;  2MAX A;  9ICA A;  8ICX A;  1K1S A;  1RXV A;  3MFH A;  3UQ2 A;  4J9R A;  3ZDC A;  1TKD A;  4M9J A;  4KLQ A;  9ICW A;  2V9W A;  5III A;  5F9N A;  3Q8M A;  5KT4 A;  1XSL A;  1U45 A;  2FMP A;  4I2E A;  4Q8E A;  1SZP A;  1D9D A;  1L3S A;  2ZUC A;  8ICH A;  5KFY A;  4M9L A;  3PX0 A;  2ATL A;  7ICR A;  5KFM A;  1Z00 A;  5IIO A;  5DDM A;  2RDJ A;  1NKC A;  4CCH A;  1TK8 A;  4QZ8 A;  4B9U A;  2HHS A;  9ICS A;  4O0I A;  5KG1 A;  3V72 A;  4R8U B;  4B9L A;  3ISD A;  4XA5 A;  2AQ0 A;  4YN4 A;  4DFP A;  5DLG A;  1S0V A;  3V7L A;  2ZTE A;  4O3Q A;  4DS4 A;  3ISC A;  3HWT A;  2KFN A;  4IQW A;  4F2R A;  1NJZ A;  5KTQ A;  1ZQK A;  2AGO A;  2I1Q A;  4YFK A;  1NK8 A;  5KFE A;  2R8J A;  4R8U A;  4ECX A;  2AGQ A;  3M9O B;  1UA0 A;  2XCP A;  1BPD A;  4J9S A;  1ZJM A;  4PPX A;  3JPS A;  1BPX A;  8ICL A;  5CHG A;  5IIK A;  3THV A;  4QZD A;  1N56 A;  2IMW P;  4C8O A;  1JX4 A;  1S76 D;  4YD1 A;  4C8L A;  5DGA A;  1X2I A;  1MQ2 A;  5C5J A;  4QWC A;  2ZJ8 A;  4BDP A;  4JK1 A;  3TQ1 A;  1XWL A;  4R63 A;  4ECQ A;  1UA1 A;  4RPZ A;  1JN3 A;  1D8L A;  4C8N A;  1KTQ A;  5J0R A;  3MR3 A;  4Q8F A;  1KFD A;  2NRW A;  3OHA A;  8ICY A;  4Z6F A;  3C21 A;  4M6W B;  3RRG A;  2HVI A;  2MUT B;  3BQT A;  2VAN A;  1UT8 A;  2BPC A;  2ZJA A;  3PMN A;  4P4M A;  4ECZ A;  5D49 A;  3V6J A;  2IHM A;  4PGY A;  5KFF A;  4TUR A;  4DL2 A;  4HYK A;  2BDP A;  5J0O A;  4FBU A;  9ICP A;  1N48 A;  1ZQT A;  4FS2 A;  1L3T A;  2BPG A;  4JV2 A;  4NLZ A;  3ETL A;  3RJI A;  4DSF A;  2J6U A;  3RR7 A;  8ICU A;  9ICJ A;  3SV3 A;  5KFQ A;  4DOA A;  3EPI A;  4Q44 A;  7ICK A;  7ICV A;  4ECY A;  1QSY A;  3PVX A;  4KLL A;  5J0X A;  4M9H A;  1TAU A;  4F5R A;  2FPK A;  2Y1J A;  4YR3 A;  4KIT B;  5KT7 A;  4XUS A;  4I2F A;  9ICV A;  4DS5 A;  4DOB A;  4I2D A;  3H7I A;  4F91 B;  3T5J A;  2VA2 A;  1EXN A;  4LZD A;  2KZZ A;  3ZDD A;  3B0Y A;  5JUM A;  4IR1 A;  1NK4 A;  1RPL A;  2IA6 A;  4YR0 A;  1NK5 A;  4KLE A;  3PML A;  3RBD A;  1S77 D;  3QZ7 A;  2FPM A;  1QTM A;  2W9M A;  8ICM A;  4M2Y A;  2W9C B;  4M0A A;  5EOZ A;  1IM4 A;  8ICJ A;  4O3S A;  4MEX A;  5J0S A;  2BHN A;  3OGU A;  3TAQ A;  7ICU A;  3TAR A;  1ZQF A;  2BKE A;  3ZDE A;  4J9Q A;  2AQ4 A;  4KLD A;  9ICO A;  5KT2 A;  5DQG A;  5DB8 A;  2F1H A;  9ICI A;  3ZD8 A;  3RR8 A;  3LWL A;  9ICR A;  4YG2 A;  4KLH A;  1X9M A;  2V4R A;  5DB9 A;  5L1I A;  3JPQ A;  1ZQM A;  4DQP A;  3QEB Z;  3TAP A;  4RNN A;  5KFC A;  5J0P A;  3QEA Z;  4F5Q A;  1NK6 A;  3IM1 A;  4UB1 A;  4UQG A;  5KFU A;  3RJG A;  4O5C A;  1XU4 A;  4EYH B;  5DQH A;  4QZ9 A;  5EWG A;  4DSJ A;  4RUC A;  8ICC A;  3C2K A;  4M47 A;  2JEI A;  2JZB B;  4KLF A;  1KFT A;  7ICT A;  4Z6C A;  4EBC A;  3PW0 A;  1ZQE A;  4LVS A;  8ICZ A;  4KN4 A;  4I2I A;  9ICQ A;  4KN7 A;  3RRH A;  3HPO A;  3M8R A;  4PH5 A;  3N4M B;  3MDA A;  4M9N A;  3MR2 A;  3JPN A;  3ZDA A;  4IRC A;  4UB4 A;  4KLM A;  3NGD A;  4R66 A;  1KDH A;  8ICT A;  4UBB A;  4RT3 A;  9ICK A;  1Z00 B;  3RBE A;  2R8H A;  5KFG A;  9ICE A;  2HHT A;  2KTQ A;  5KFB A;  4I27 A;  5CP2 A;  2NRZ A;  3KHH A;  3H8J A;  2BCS A;  4I2C A;  5HML A;  4E0D A;  4ZH4 A;  1KEJ A;  2F1I A;  3OHB A;  4RQ4 A;  3MR6 A;  5DG9 A;  2W8L A;  1ZQA A;  1ARO P;  4IRK A;  8ICN A;  2PFO A;  3FYH A;  4KLG A;  8ICS A;  1A77 A;  5L9X A;  8ICB A;  5DG8 A;  2C28 A;  4TQR A;  9ICF A;  4Z6E A;  4DSL A;  1LB2 B;  1XSP A;  4ED2 A;  3MR5 A;  2P6U A;  1ZQO A;  2R8K A;  4LZG A;  3ISB A;  3V7J A;  2FLL A;  4UB2 A;  1U47 A;  2FLN A;  5KG5 A;  3H8W A;  4NLN A;  1ZQY A;  5J0T A;  3RB6 A;  3K4G A;  5KFH A;  3PW2 A;  4YXJ A;  4QWE A;  4F8R A;  4RQ0 A;  2BQ3 A;  4X5V A;  5KFA A;  8ICG A;  4EYI B;  2FMQ A;  1ZQV A;  3E2E A;  3RB4 A;  4B9T A;  4F2S A;  3BQ2 A;  4O5K A;  7ICP A;  5KFI A;  3KHL A;  3GIL A;  1D8Y A;  4DQI A;  9ICT A;  5BOM A;  1DGS A;  5DGB A;  4ECS A;  3EYZ A;  4F4X A;  2XY7 A;  1BVS A;  4KMU A;  4JV0 A;  2HHV A;  2ASJ A;  2ZJ5 A;  8ICE A;  5DBA A;  4ECU A;  1NK0 A;  3C2L A;  3KHG A;  5HP4 A;  4O3N A;  5J2A A;  4F4W A;  1T4G A;  3GFK B;  3Q8K A;  1ZJN A;  7ICS A;  3OJU A;  4DL4 A;  2R8G A;  3FDS A;  2HHX A;  1XO1 A;  4MFC A;  1H38 A;  3SI8 A;  5CA7 A;  5DB7 A;  2UVR A;  1ZQQ A;  3Q8S B;  3RH5 A;  1SL2 A;  2BCV A;  7ICO A;  3MGI A;  2FMS A;  4YCX A;  4QZH A;  5DG7 A;  2FLP A;  7ICH A;  1S97 A;  4ECW A;  3PW4 A;  7ICM A;  3H40 A;  1NKB A;  1CEZ A;  2PFQ A;  5IIN A;  4DL6 A;  1XS9 D;  1T3N A;  4C8K A;  3N97 B;  3GII A;  1T8E A;  5J0Y A;  4J9L A;  4QZI A;  2BCQ A;  1ZQS A;  4DO9 A;  8ICA A;  8ICI A;  3ORY A;  1ZQZ A;  3C1Y A;  2HHW A;  2PFP A;  4O3O A;  4GXJ A;  7ICI A;  3Q8R B;  4PHE A;  4MFA A;  2JEJ A;  4NLG A;  2NRV A;  4ED6 A;  4I2J A;  3M8S A;  2BR0 A;  2ZTD A;  4RQ3 A;  4UBC A;  5KFV A;  3GQC A;  4RU9 A;  5DQI A;  1U49 A;  5KT5 A;  4NM1 A;  1HUO A;  1ZQN A;  3GV5 B;  4EZ9 A;  3UXO A;  4O3P A;  4QZC A;  4TUQ A;  4F93 B;  1S0M A;  3G6Y A;  5DKW A;  1JXE A;  5J2H A;  4DOC A;  4F5N A;  2ISP A;  2Q0Z X;  1SKR A;  4IQT A;  4JUZ A;  4P2H A;  4RQ6 A;  5J2F A;  4KLS A;  9ICG A;  3UXP A;  2A1J A;  3NTU A;  1MSW D;  4RT2 A;  1HUZ A;  4I2H A;  2V4Q A;  3GV8 B;  9ICN A;  5KFS A;  2AU0 A;  1Z3E B;  5KFK A;  1ZYQ A;  1MQ3 A;  5DB6 A;  3T5K A;  3UXN A;  2XGP A;  5J2C A;  1SL1 A;  1ZQC A;  4UB5 A;  1NJW A;  3RJJ A;  3RH6 A;  1TFR A;  1TK5 A;  4DSE A;  1ZQX A;  2XY5 A;  7ICE A;  3GIJ A;  4GXI A;  4DF4 A;  2P66 A;  8ICO A;  4BXO B;  2ZUB A;  5J0W A;  2C2E A;  1U9L A;  4K4G A;  7ICQ A;  1BPZ A;  2JEG A;  5L1K A;  4MF8 A;  3ZD9 A;  1U4B A;  3HW8 A;  4O3R A;  4DEZ A;  4IQV A;  4DLG A;  4J9O A;  3KHR A;  5KG6 A;  1ZET A;  4O9M A;  3JPP A;  3BQ0 A;  5DDY A;  1QSS A;  3MFI A;  4QZB A;  3UPQ A;  2NRX A;  4ED1 A;  4QZA A;  4YMO A;  4TQS A;  1S9F A;  2BPF A;  1NKE A;  3Q8P B;  4BXO A;  2HW3 A;  1S10 A;  4ELT A;  9ICX A;  1ZQB A;  2RDI A;  1TK0 A;  5J2I A;  3ZDB A;  2LYH A;  3H4B A;  5TZV A;  4BWJ A;  4DL3 A;  4PGX A;  4DSK A;  3EPG A;  3C23 A;  4GXK A;  4J9P A;  2UVU A;  2UVV A;  4DFM A;  7ICG A;  3M9M B;  3RJF A;  4RQ7 A;  8ICP A;  2ZUD A;  2XC9 A;  2J6T A;  1WCL A;  3JPR A;  3RAQ A;  1ZQL A;  1S0O A;  5KG2 A;  4R64 A;  3C5F A;  1SKW A;  1BPY A;  3RH4 A;  3EWA A;  3SYZ A;  2KFZ A;  5DBC A;  3SV4 A;  3RTV A;  4M04 A;  5KT3 A;  3HT3 A;  3PX4 A;  3C1Z A;  4BGD A;  1RXW A;  2C2R A;  1S0N A;  1LV5 A;  3MGH A;  4PHD A;  4QWD A;  1BGX T;  5KFO A;  4JWM A;  2DFL A;  1V9P A;  4F4K A;  1MC8 A;  3RJE A;  5D46 A;  2BGW A;  1COO A;  4UAW A;  5KG0 A;  4QW8 A;  4J9N A;  4FO6 A;  3TFR A;  1RZT A;  2XCA A;  1NJY A;  5KG4 A;  3JPO A;  4DL5 A;  5HHI A;  4RQ8 A;  3QE9 Y;  3PX6 A;  3LWM A;  1CUK A;  1ZQW A;  5KFD A;  2I9G A;  2PI5 A;  2VA8 A;  2W9A A;  2DPI A;  3PO4 A;  4I2B A;  4I2A A;  3BJY A;  4NLK A;  4YVZ A;  1A76 A;  1ZQD A;  3QZ8 A;  4EEY A;  1K1Q A;  4EBD A;  9ICC A;  2W9B A;  5DBB A;  4EZ6 A;  4FBT A;  4KLJ A;  5J0Q A;  1HJP A;  9ICU A;  7ICJ A;  4I29 A;  4F92 B;  1ZQI A;  3AU2 A;  4F50 A;  3OSP A;  2VA3 A;  4R65 A;  2OWO A;  5D4B A;  2BCR A;  2AGP A;  4RPX A;  4QZE A;  5J2B A;  2NRT A;  5L1J A;  4F5P A;  2ALZ A;  4YXM A;  1PZN A;  2F1J A;  3KTQ A;  4I2G A;  2M9N A;  8ICW A;  2KZ3 A;  3MAB A;  5KFT A;  4NXZ A;  4YD2 A;  2JEF A;  2XY6 A;  2UVW A;  2ASL A;  3T5L A;  3TFS A;  2FPL A;  4QZF A;  3T3F A;  2P6R A;  4DSI A;  2KN7 A;  4DF8 A;  3C5G A;  5J2J A;  3IHQ B;  4UB3 A;  3JPT A;  5IIL A;  1NK7 A;  4B9S A;  4YP3 A;  4O5E A;  4DQR A;  5CJ7 A;  2W8K A;  4DQQ A;  4YR2 A;  1RYR A;  3EW9 A; 
#chains in the Genus database with same CATH topology
 1WCN A;  2O6K A;  5KFJ A;  5KFP A;  1ECW A;  5HR6 A;  3R9K A;  9ICB A;  1XC9 A;  1T7P A;  2HHQ A;  2HBM A;  1C7Y A;  4C8M A;  4P0P B;  1XSN A;  2GO7 A;  2IBK A;  2E8O A;  4ED3 A;  4CF3 A;  3PY8 A;  4C4T A;  2ZXH A;  2LYB A;  2J6S A;  2B21 A;  1DOQ A;  4M6W A;  5BOL A;  3KZI U;  4K4H A;  2A1J B;  5EWF A;  1KFS A;  1J97 A;  4I28 A;  5CB1 A;  2R8I A;  1SXD A;  4XRH A;  5J2E A;  4B9S A;  2IHN A;  3UQ0 A;  4RQ5 A;  1L7O A;  4BX9 C;  1ZQJ A;  1KBU A;  2DL0 A;  2A3V A;  3K75 D;  3LYS A;  5EE3 A;  2CPR A;  3H8S A;  3PR4 A;  3BZK A;  4YQW A;  3GIM A;  4GC7 A;  2PMZ F;  4KLI A;  1N62 A;  2BQU A;  4FZM A;  4ECV A;  3IG8 A;  4F4Y A;  3RAX A;  4IRD A;  5KFX A;  4P4O A;  3IDW A;  7ICN A;  4EX7 A;  5KL1 B;  4QW9 A;  2KP7 A;  3EZ5 A;  1P7D A;  2WTF A;  3PO5 A;  2KVS A;  4U7C A;  4RQ1 A;  1B22 A;  1B43 A;  4UAR A;  3TKA A;  8ICR A;  1L5U A;  4B9N A;  2HBK A;  2C22 A;  2VKQ A;  4F5O A;  2JZB A;  4KX3 A;  2W3R A;  5ALP A;  1QLN A;  4KX5 A;  1JMS A;  2MAX A;  1K1S A;  3ZDC A;  3ED5 A;  4BUG A;  1XSL A;  1X66 A;  4I2E A;  4Q8E A;  1SZP A;  1Q8K A;  4NLB A;  2ZUC A;  1L3S A;  2DQN B;  5KFM A;  4R8U B;  4B9L A;  4DFP A;  2NO4 A;  2ZTE A;  2G0A A;  4DS4 A;  3HWT A;  4IQW A;  4F2R A;  1NJZ A;  5ALT A;  2R8J A;  4ECX A;  2KNJ A;  5AIA A;  5AKE A;  5KAF U;  1UA0 A;  2XCP A;  4J9S A;  1Z4N A;  3D2N A;  4RQN A;  8ICL A;  5CHG A;  5IIK A;  2KJ9 A;  3A0H U;  4QZD A;  1S5L U;  2KMD A;  5CEH A;  1JX4 A;  4C8O A;  4FZN A;  4YD1 A;  5DGA A;  1X2I A;  4Y2V A;  2H3V A;  3GU3 A;  3CNH A;  5J0R A;  1KTQ A;  3MR3 A;  3C28 A;  4Q8F A;  1LKY A;  2HBL A;  3ALR A;  4Z6F A;  2MUT B;  1QQ5 A;  1RG6 A;  2WAQ F;  4P4M A;  2LYA A;  2IHM A;  5J0O A;  3NS1 A;  1N48 A;  1L3T A;  3ETL A;  3RJI A;  3SV3 A;  5KFQ A;  7ICK A;  2KE7 A;  1FO4 A;  3AQE A;  4KLL A;  4NWI A;  1TAU A;  4DOB A;  4I2D A;  1QH9 A;  4LZD A;  4NL9 C;  4IR1 A;  1NK4 A;  4F72 A;  2IA6 A;  3QXG A;  1NK5 A;  3RBD A;  2E8N A;  2FPM A;  1F0M A;  4M2Y A;  2W9C B;  3HKZ F;  5AI5 A;  1PVR A;  2F3N A;  3RR8 A;  3BS5 B;  4DQP A;  3F53 A;  3N7P D;  4UQG A;  1NK6 A;  3C2K A;  4M47 A;  3K1Z A;  4C7Z A;  4Z6C A;  4LVS A;  4PH5 A;  5GTH U;  3MDA A;  4OJ5 A;  3ZDA A;  3QNM A;  4IRC A;  2VJ4 A;  2ES6 A;  4C80 A;  1KDH A;  8ICT A;  4USA A;  4AP9 A;  3AQF A;  4RT3 A;  1Z00 B;  3RBE A;  2R8H A;  9ICE A;  4I27 A;  3KHH A;  3E0F A;  2YB1 A;  1HIW A;  2W8L A;  1ZD4 A;  1CRX A;  1ZQA A;  1QCK A;  2PFO A;  4KLG A;  8ICS A;  3M1Y A;  1URJ A;  2KJ5 A;  3SAH A;  3I1Y A;  4DSL A;  3WK6 A;  3NRW A;  3V7J A;  1UCV A;  2FLL A;  1L8O A;  4UB2 A;  2FLN A;  4US8 A;  1RQN A;  3RB6 A;  3K4G A;  3PW2 A;  4RQM A;  4RQ0 A;  3E2E A;  3WKA A;  1T94 A;  2KG5 A;  4PJ0 U;  1D8Y A;  5BOM A;  2HHV A;  1BVS A;  2EAO A;  1Z19 A;  1IIP A;  3C2L A;  3FC4 A;  2ODG A;  2W04 A;  5G5H A;  5J2A A;  1S8O A;  4P0Q A;  4DL4 A;  5AIC A;  3M6K A;  2W54 A;  1ZXI A;  1ZQQ A;  3Q8S B;  3MGI A;  4QZH A;  2FLP A;  1N5X A;  4ECW A;  7ICM A;  2PFQ A;  5IIN A;  4DL6 A;  4J9L A;  1F44 A;  1ZQS A;  4DO9 A;  1SWV A;  2RQ5 A;  1Q3V A;  2PFP A;  4CRX A;  2EAN A;  4MFA A;  2ZIV B;  3WKC A;  3M8S A;  2ZTD A;  4RQ3 A;  5KT5 A;  4NM1 A;  1HUO A;  2MU2 A;  3UXO A;  2FE9 A;  2H3I A;  2GOL A;  2AH5 A;  4DOC A;  4F5N A;  5J8Y A;  4IQT A;  2KOB A;  9ICG A;  2EAP A;  3UXP A;  4RT2 A;  1HUZ A;  2EZX A;  3H0R B;  3KD3 A;  2KSO A;  1M6Y A;  4UB5 A;  3RJJ A;  1TFR A;  3D2S A;  1ZQX A;  2XY5 A;  3WKD A;  1KL9 A;  3IG5 A;  5J0W A;  2WFA A;  3ZD9 A;  1HEK A;  1DGJ A;  1VDV A;  3MFI A;  4AYB C;  2NRX A;  1O03 A;  5ALR A;  5FP0 A;  9ICX A;  1ZQB A;  2RDI A;  2LYH A;  4DL3 A;  4DSK A;  3J81 j;  3C23 A;  4DFM A;  1F5S A;  7ICG A;  3CYM A;  2ZUD A;  2J6T A;  3RTV A;  1Z1V A;  1RXW A;  5AHX A;  4QWD A;  3M6Z A;  2DF4 B;  1MC8 A;  3RJE A;  2BGW A;  1COO A;  1NJY A;  1FEZ A;  5EE0 A;  5DBB A;  4EZ6 A;  4KLJ A;  9ICU A;  1IG6 A;  4I29 A;  4F92 B;  2OWO A;  3AU2 A;  1BNP A;  2BCR A;  5AM4 A;  4RPX A;  2OH2 A;  2ALZ A;  1PZN A;  4JMU A;  2F1J A;  3WK9 A;  3MAB A;  4NXZ A;  2FPL A;  2ZXI A;  2KN7 A;  1N60 A;  3IHQ B;  5AI4 A;  5CJ7 A;  2W8K A;  4EEN A;  5AKI A;  5JRT A;  4Y2P A;  4OD0 A;  1TAQ A;  2F77 X;  3G6X A;  5J2G A;  4Q43 A;  4ECT A;  2WF8 A;  4UAZ A;  4B9V A;  3KKA C;  3G6V A;  2HBJ A;  9ICH A;  4MFF A;  5ALO A;  5KFW A;  3NUQ A;  1X42 A;  1U48 A;  1ZRM A;  3O0F A;  4EEL A;  3NVZ A;  4EBE A;  4MEY A;  4J9K A;  5L1L A;  1Y88 A;  4J9M A;  5KFN A;  4QNL A;  4FS1 A;  2R18 A;  4RQ2 A;  1JIH A;  2BQR A;  2HHU A;  2W55 A;  4Y2S A;  3V7K A;  4ED0 A;  5KFL A;  2K8A A;  2GWS A;  4IS7 A;  3PNC A;  4CGZ A;  2QB1 A;  3TI0 A;  2EH9 A;  1ZQG A;  3AUO A;  3RJH A;  3TAD A;  2ZIX B;  1ZQP A;  4RZR A;  8ICQ A;  2DPJ A;  3GIK A;  1KN5 A;  4YMM A;  1FIQ A;  4C4R A;  4NM2 A;  4DFJ A;  3GDX A;  5KT6 A;  2PI4 A;  5J2K A;  3HP6 A;  8ICK A;  1XO0 A;  4QIW F;  3PST A;  1SIJ A;  2LMR A;  2K4P A;  3MDC A;  1NJX A;  3V6K A;  1MA7 A;  2HMX A;  3QU4 A;  1UT5 A;  4PHP A;  3QX7 A;  4MF2 A;  3C2M A;  3AMZ A;  4ED8 A;  3PW7 A;  1JAL A;  9ICA A;  2EAM A;  1TKD A;  9ICW A;  5III A;  4C0Z A;  2HOI A;  2B6G A;  7ICR A;  2RDJ A;  4CCH A;  1TK8 A;  4O0I A;  3H0L B;  5DLG A;  4FE3 A;  4O3Q A;  2KFN A;  3IN5 A;  4YFK A;  2AGQ A;  2H3Z A;  2RLT A;  4ACO A;  3JPS A;  4Y2X A;  3THV A;  1N56 A;  1S76 D;  5ALF A;  3L5K A;  2KVC A;  4BDP A;  4JK1 A;  1XWL A;  1CI4 A;  1D8L A;  2KJ8 A;  2NRW A;  8ICY A;  5ALS A;  3C21 A;  2QB0 B;  3N7R C;  2VAN A;  1UQV A;  3NVV A;  4PGY A;  4DL2 A;  5KNI A;  1KW4 A;  3RR7 A;  2J6U A;  9ICJ A;  2QAR B;  2GLE A;  1Z1B A;  4ECY A;  1QSY A;  1COK A;  4AYB F;  1DK3 A;  4KIT B;  4YR3 A;  4C4S A;  4XUS A;  4I2F A;  2P35 A;  3H7I A;  4F91 B;  5ALE A;  2KKP A;  3B0Y A;  1NNL A;  5ALM A;  4KLE A;  1S77 D;  2OM6 A;  2W9M A;  8ICJ A;  1IM4 A;  2ZIW A;  4MEX A;  2BHN A;  3TAR A;  4UAT A;  2BKE A;  4J9Q A;  4KLD A;  5KT2 A;  2F1H A;  9ICR A;  4YG2 A;  5DB9 A;  5EE9 A;  3JPQ A;  1L6N A;  4G9B A;  4UAV A;  4O5C A;  4EYH B;  2W11 A;  4Y2U A;  8ICC A;  5ALZ A;  1KFT A;  7ICT A;  3PW0 A;  2KIC A;  4IC9 A;  4I2I A;  3WKB A;  9ICQ A;  3RRH A;  3N4M B;  2NO5 A;  2L5Y A;  4UB4 A;  3UM9 A;  9ICK A;  1BNO A;  5KFG A;  5ALI A;  4FFD A;  1X6I A;  2JH1 A;  3H8J A;  3KBB A;  2BCS A;  4I2C A;  5HML A;  4E0D A;  4LJX A;  4ZH4 A;  3IV6 A;  2CXY A;  3OHB A;  3SQI A;  8ICN A;  1A77 A;  8ICB A;  9ICF A;  3SAF A;  3ONN A;  2P6U A;  1K5O A;  5KG5 A;  4NLN A;  1NI3 A;  2KV2 A;  5KFH A;  4QWE A;  1DK2 A;  4X5V A;  5KFA A;  3FAH A;  1ZQV A;  2LKY A;  2WHE A;  4O5K A;  3KHL A;  3S6J A;  4DQI A;  2H3Q A;  4JV0 A;  3MC1 A;  2ASJ A;  1WYG A;  4ECU A;  2F8K A;  1DRG A;  5G5G A;  4O3N A;  1ZJN A;  2R8G A;  2HHX A;  4EX6 A;  1AQ6 A;  5DB7 A;  7ICO A;  3PSI A;  1S97 A;  1CEZ A;  3H40 A;  1XS9 D;  4UB6 U;  4C8K A;  3N97 B;  3GII A;  3KFU F;  5AI9 A;  3M7D A;  8ICA A;  8ICI A;  1SV0 A;  1ZQZ A;  3C1Y A;  3WKE A;  2HHW A;  4NLG A;  2NV3 A;  2NRV A;  3QYP A;  4ED6 A;  4I2J A;  4P0P A;  5KFV A;  3GQC A;  4RU9 A;  5DQI A;  4DCC A;  5JU5 A;  1ZQN A;  3GV5 B;  4O3P A;  1VJ5 A;  2Y9U A;  3B9J A;  4TUQ A;  1S0M A;  3G6Y A;  2ISP A;  5ALN A;  2LHT A;  2BZF A;  2EZZ A;  2EDU A;  5ALQ A;  4P2H A;  4KLS A;  2A1J A;  1MSW D;  3GV8 B;  3DV9 A;  5KFS A;  5ALK A;  4HAI A;  2AHO B;  5L1M A;  1ZQC A;  1L7M A;  7ICE A;  4GXI A;  2G5I B;  4NV0 A;  4OJ6 A;  2HSZ A;  4K4G A;  7ICQ A;  4O3R A;  4MF8 A;  1UHU A;  2F76 X;  3HW8 A;  3CW2 C;  4IQV A;  4J9O A;  1ZET A;  3JPP A;  2KEY A;  5AKJ A;  2DUY A;  3UPQ A;  4U6P A;  3RF9 A;  4TQS A;  4BXO A;  2HW3 A;  1GO3 F;  1N61 A;  5J2I A;  4BWJ A;  2D8C A;  4J9P A;  1RM6 C;  2M0N A;  3M9M B;  4B6J A;  2W7P A;  3RAQ A;  1ZQL A;  3GZF A;  1S0O A;  5KG2 A;  3C5F A;  1SKW A;  3RH4 A;  3EWA A;  3SV4 A;  3KOO A;  3C1Z A;  4BGD A;  1LV5 A;  3F2C A;  4PHD A;  5KFO A;  4QJF B;  2Y0S C;  4UAW A;  4QW8 A;  4J9N A;  2XCA A;  5KG4 A;  3JPO A;  4DL5 A;  2A19 A;  3QE9 Y;  3PX6 A;  1CUK A;  5KFD A;  2I9G A;  4I2B A;  4J03 A;  4YVZ A;  2OCE A;  1K1Q A;  1MN8 A;  4QIW C;  1C20 A;  9ICC A;  1HJP A;  2LPE A;  5D4B A;  1OXJ A;  4QZE A;  5L1J A;  4F5P A;  1YT3 A;  4I2G A;  8ICW A;  2YMM A;  4YD2 A;  2XY6 A;  3QU7 A;  1FFV A;  1ZQ1 C;  3T3F A;  3C5G A;  2EQY A;  4UB3 A;  1NK7 A;  4O5E A;  4YP3 A;  4DQR A;  5AK6 A;  4DQQ A;  2DKX A;  4YR2 A;  3AL0 B;  2HOQ A;  1J2N A;  1QSL A;  3BQ1 A;  5KFZ A;  1X9S A;  3RB0 A;  5AM0 A;  1N2X A;  3M9N B;  1ZQR A;  7ICL A;  1ZD2 P;  2IOF A;  3RJK A;  4JWN A;  4US9 A;  4P4P A;  4ED7 A;  4YMN A;  4PHA A;  1SXE A;  3MBY A;  5DLF A;  3OSN A;  1SZH A;  4Z6D A;  4RNM A;  3SEN A;  4DWI A;  2MUT A;  4PGQ A;  5CR0 A;  4GC6 A;  3RB3 A;  5CWR A;  4IR9 A;  3SZ2 A;  4KLU A;  2AJQ A;  1Q46 A;  1KSP A;  4BWM A;  3A0B U;  5AKK A;  7ICF A;  1L3V A;  4QZG A;  2XIC A;  3HX0 A;  1L3U A;  1X9W A;  2Y1I A;  3T5H A;  8ICV A;  1KLN A;  4UW9 A;  3SAG A;  5ALG A;  3OJS A;  5J2D A;  5KG7 A;  3H4D A;  1ZQU A;  5AI6 A;  3LK9 A;  3PW5 A;  2H5X A;  2ASD A;  1TV9 A;  2W9C A;  2ZTC A;  4GLX A;  1KKX A;  5BPC A;  3AU6 A;  2WF5 A;  3BDP A;  4DLE A;  4KLT A;  9ICL A;  5B5E U;  1N5W A;  4TUP A;  1KRP A;  3B0X A;  5ALW A;  3BS5 A;  4NY8 A;  3L3F X;  4CF4 A;  5HMM A;  2DBY A;  8ICF A;  2HVH A;  4EEK A;  4ELV A;  1TVA A;  3UMB A;  3K1R B;  1TE2 A;  5F3X B;  4JV1 A;  4IQU A;  4RNO A;  2W9B B;  3TAN A;  3D2Q A;  1V85 A;  1DXS A;  1RXV A;  3MFH A;  3UQ2 A;  4J9R A;  4M9J A;  4KLQ A;  1A6S A;  5ALD A;  3Q8M A;  5F9N A;  3WK8 A;  5KT4 A;  1U45 A;  1NZB A;  1D9D A;  3ETR A;  2YY6 A;  2DGZ A;  5KFY A;  4M9L A;  1Z00 A;  1NKC A;  2HHS A;  1PK1 A;  9ICS A;  3V72 A;  4XA5 A;  2AQ0 A;  3V7L A;  5K4L A;  3ISC A;  2WF6 A;  4OCZ A;  2I1Q A;  1BPD A;  1ZJM A;  1PVQ A;  4PPX A;  1BPX A;  2GH1 A;  4Y2R A;  2IMW P;  3HJE A;  1MQ2 A;  5C5J A;  3OPX A;  1RDF A;  4R63 A;  1UA1 A;  1JN3 A;  4C8N A;  5H2F U;  1O08 A;  2JGA A;  4M6W B;  3RRG A;  2G09 A;  3BQT A;  2BPC A;  4ECZ A;  2WB1 F;  3QUC A;  5KFF A;  2E5S A;  2BDP A;  2D6F C;  1Z4O A;  4FS2 A;  4JV2 A;  8ICU A;  4DOA A;  3VC8 A;  4Q44 A;  3PVX A;  2RP5 A;  5J0X A;  2YQE A;  4M9H A;  4F5R A;  2FPK A;  5KT7 A;  2H3F A;  4DS5 A;  2KZZ A;  3T5J A;  2VA2 A;  1EXN A;  2JMG A;  2YN4 A;  1XNS A;  1V97 A;  3PML A;  3QZ7 A;  5JTI A;  1QTM A;  8ICM A;  2ZIV A;  4O3S A;  5J0S A;  3F5E A;  3OGU A;  4PL2 A;  1VLB A;  1ZQF A;  2HCF A;  2AQ4 A;  9ICO A;  5DQG A;  2Y0S F;  9ICI A;  2F8L A;  3ZD8 A;  3LWL A;  2YMQ A;  1X9M A;  5L1I A;  1ZQM A;  4RNN A;  5J0P A;  4F5Q A;  5KFU A;  5DQH A;  5AK5 A;  5EWG A;  4RUC A;  2JEI A;  2JZB B;  1TAM A;  4KLF A;  1JRP A;  4KN4 A;  2FDR A;  3M8R A;  3UMG A;  3IRU A;  2KK0 A;  3MR2 A;  3JPN A;  4M9N A;  1D8B A;  3I76 A;  2JHD A;  4R66 A;  2VJ5 A;  4UBB A;  1Q3U A;  2HHT A;  2KTQ A;  5KFB A;  5ALU A;  3LVW A;  1L7N A;  5C0Y A;  5AI0 A;  2F1I A;  4RQ4 A;  3MR6 A;  4IRK A;  5L9X A;  4CF5 A;  5DG8 A;  2AXT U;  1LB2 B;  3QUQ A;  3TAD C;  4ED2 A;  2R8K A;  4LZG A;  5EE1 A;  2KD1 A;  1U47 A;  1ZQY A;  2YB4 A;  2BDU A;  5J0T A;  4F8R A;  3H0M B;  2BQ3 A;  8ICG A;  1LKY B;  4EYI B;  2FMQ A;  3F2B A;  3RB4 A;  4F2S A;  3BQ2 A;  1WUD A;  3PZP A;  9ICT A;  4ECS A;  2E8P A;  5DGB A;  2G07 A;  3EYZ A;  4F4X A;  2XY7 A;  4KMU A;  2ZJ5 A;  8ICE A;  2IOH A;  5DBA A;  3QUB A;  2RRD A;  1NK0 A;  3C29 A;  1XO1 A;  4OO1 J;  1H38 A;  2HDO A;  5CA7 A;  2BCV A;  2JR5 A;  3F2D A;  7ICH A;  3PSF A;  3I28 A;  5T14 A;  1SWW A;  5J0Y A;  4QZI A;  3ORY A;  4O3O A;  4GXJ A;  7ICI A;  1JUD A;  3Q8R B;  4PHE A;  2JEJ A;  4UB8 U;  3WK5 A;  5AKY A;  2ZG6 A;  3SD7 A;  1PK3 A;  4F93 B;  4GFJ A;  1X6J A;  1IV8 A;  3N7S C;  4RQ6 A;  5J2F A;  3NRZ A;  2MRL A;  3N28 A;  3NTU A;  3NAS A;  1YZ6 A;  2V4Q A;  2AU0 A;  3PSP A;  5KFK A;  1ZYQ A;  5AKL A;  2XGP A;  1SL1 A;  3RFA A;  4DSE A;  3ICX A;  1ZRN A;  2P66 A;  1B4F A;  4BXO B;  5AKZ A;  1BPZ A;  2OYY A;  3E58 A;  3VCB A;  3WK4 A;  1U4B A;  4DEZ A;  4DLG A;  5KG6 A;  4O9M A;  1QSS A;  5DDY A;  1L7P A;  4QZB A;  4QZA A;  2BPF A;  1NKE A;  3Q8P B;  3HIL A;  2ZIX A;  1TK0 A;  3H4B A;  5TZV A;  3F5A A;  4PGX A;  4GXK A;  2UVV A;  3RJF A;  1WCL A;  3U26 A;  1BPY A;  5DBC A;  4M04 A;  5KT3 A;  3HT3 A;  1WG8 A;  3PX4 A;  1OUQ A;  1BGX T;  4JWM A;  2DFL A;  1V9P A;  5KG0 A;  5KL8 B;  5HHI A;  4RQ8 A;  3BQ7 A;  1ZQW A;  2ZIU A;  2VA8 A;  2W9A A;  3PO4 A;  4NLK A;  2FJ6 A;  2W43 A;  1QQ7 A;  3WK7 A;  4FBT A;  3HRD D;  7ICJ A;  2VA3 A;  1ZQI A;  3OSP A;  2Q4T A;  2AGP A;  2CRX A;  1UPH A;  5J2B A;  2NRT A;  4NL9 A;  4P0Q B;  3KTQ A;  2M9N A;  4OJL A;  1RQL A;  5KFT A;  2JEF A;  2ASL A;  2P6R A;  4QZF A;  1N63 A;  4DSI A;  5J2J A;  5IIL A;  3JPT A;  5AM2 A;  3IP4 B;  3RH5 A;  1RYR A;  3LVV A;  2ISO A;  1X40 A;  3L4P A;  4K4I A;  3PR5 B;  2KZM A;  5J29 A;  1BPE A;  1L8L A;  4RUA A;  2PFN A;  4KLO A;  5F9L A;  5AM3 A;  4XQ8 A;  4B9M A;  3ZI4 A;  2LM4 A;  2QB0 A;  2JH7 A;  3DDH A;  3CRX A;  4F4Z A;  5EWE A;  4TUS A;  1BPB A;  4Y2J A;  1KQQ A;  1JXL A;  2KSO B;  2OXO A;  4M9G A;  1NOM A;  2Z7J A;  3PV8 A;  5IIM A;  4UAY A;  2MSN A;  2QAR A;  3Q8L A;  5AKH A;  4DL7 A;  4F3O A;  4UAS A;  5ALV A;  2E1E A;  3Q8Q B;  1SL0 A;  2WB1 C;  5HNK A;  2C2D A;  4MHV A;  1SV4 A;  3SEI A;  4ECR A;  5ALJ A;  5TIS U;  4QWA A;  5AKX A;  3SMV A;  9ICM A;  4G3I A;  3AN1 A;  5IIJ A;  4DQS A;  2B0C A;  4Q45 A;  3V6H A;  4ELU A;  3LDA A;  4CDG A;  5AM1 A;  1NK9 A;  4KTQ A;  4BJQ A;  2YX8 A;  1FFU A;  1D9F A;  2HI0 A;  1IXR A;  2BCU A;  1SKS A;  3GV7 B;  1SV0 C;  2I6X A;  2KKV A;  3AM9 A;  5KFR A;  2KIV A;  5HHH A;  5KG3 A;  1RYS A;  2PXI A;  4QWB A;  5J0U A;  4OJO A;  4RPY A;  2XGQ A;  4ICA A;  2XO7 A;  5ALL A;  2NYV A;  4DFK A;  1ZQH A;  2XI9 A;  8ICX A;  1PK1 B;  2V9W A;  1YZ7 A;  3QU2 A;  5GTI U;  2LBO A;  2FMP A;  2EZY A;  2E3T A;  2WF7 A;  8ICH A;  3PX0 A;  2ATL A;  5IIO A;  5DDM A;  1ZD3 A;  4QZ8 A;  4B9U A;  2K4I A;  5KG1 A;  3ISD A;  4YN4 A;  2QLT A;  1S0V A;  5AI8 A;  1B0X A;  5KTQ A;  1ZQK A;  2AGO A;  1NK8 A;  5KFE A;  2K89 A;  4R8U A;  3M9O B;  2W3S A;  2Y9T A;  4C8L A;  4QWC A;  2ZJ8 A;  3BZC A;  1V38 A;  3TQ1 A;  4ECQ A;  4RPZ A;  2F44 A;  1KFD A;  3OHA A;  1X9X A;  3NVW A;  2HVI A;  1UT8 A;  3PMN A;  2ZJA A;  5AM5 A;  3V6J A;  5D49 A;  2XVT A;  4NJ8 A;  4TUR A;  4HYK A;  4FBU A;  9ICP A;  1ZQT A;  2BPG A;  4NLZ A;  4DSF A;  3QU5 A;  3BS7 A;  3EPI A;  7ICV A;  4F71 A;  2KHV A;  2JV3 A;  3NVY A;  2JRZ A;  2Y1J A;  9ICV A;  2XID A;  2WF9 A;  3ZDD A;  5JUM A;  1RPL A;  4Y2T A;  4YR0 A;  2YMP A;  2K8B B;  1ED1 A;  1PUZ A;  3OTQ A;  4M0A A;  5EOZ A;  4ZOH C;  3TAQ A;  7ICU A;  3MGV A;  3ZDE A;  3FM9 A;  1J2M A;  5DB8 A;  4KLH A;  3WU2 U;  2V4R A;  2LI6 A;  2CN1 A;  3QEB Z;  5AIB A;  3TAP A;  5KFC A;  3QEA Z;  2LM1 A;  3IM1 A;  4UB1 A;  5ALX A;  3RJG A;  2OHF A;  1XU4 A;  4CE6 A;  3SR6 A;  4QZ9 A;  4DSJ A;  4KMO B;  4EBC A;  3KZX A;  1ZQE A;  2ESE A;  8ICZ A;  4KN7 A;  3HPO A;  2KHQ A;  3TAC B;  4KLM A;  1A0P A;  3NGD A;  2K8C B;  2N1R A;  5CRX A;  5J8Y C;  5CP2 A;  1QQ6 A;  2NRZ A;  3KKA A;  2PMZ C;  4PL1 A;  1KEJ A;  2I5H A;  5DG9 A;  3QUT A;  1ARO P;  3FYH A;  2C28 A;  4TQR A;  5ALY A;  3UMC A;  5AK4 A;  4Z6E A;  1XSP A;  3MR5 A;  1ZQO A;  1RYU A;  3ISB A;  1SB3 C;  5A0L A;  3D6J A;  3H8W A;  4YXJ A;  3QU9 A;  2F2A B;  4B9T A;  7ICP A;  5KFI A;  2W7O A;  3GIL A;  1DGS A;  3KHG A;  5HP4 A;  2E1F A;  4F4W A;  1ZOL A;  1T4G A;  3GFK B;  3Q8K A;  1PVP A;  7ICS A;  2E8M A;  3OJU A;  3FDS A;  4MFC A;  3DEE A;  3SI8 A;  2UVR A;  1SL2 A;  2IOF K;  2FMS A;  4YCX A;  5DG7 A;  4PZN A;  1JRO A;  1T3Q A;  2KIW A;  3PW4 A;  4JB3 A;  1NKB A;  1NZP A;  1T3N A;  1T8E A;  2BCQ A;  2G08 A;  2K4H A;  3EUB 2;  2DKZ A;  2ZIW B;  5ALH A;  2BR0 A;  4UBC A;  1U49 A;  4EZ9 A;  2K4E A;  4QZC A;  5DKW A;  1JXE A;  2G06 A;  5J2H A;  2Q0Z X;  1SKR A;  5HR7 A;  4JUZ A;  4I2H A;  9ICN A;  4Y2Q A;  2WAQ C;  1Z3E B;  2W03 A;  1MQ3 A;  1LVH A;  5DB6 A;  2FI1 A;  3UXN A;  3T5K A;  5J2C A;  1JI7 A;  1NJW A;  3RH6 A;  1TK5 A;  3GIJ A;  4DF4 A;  8ICO A;  4FZL A;  5E79 U;  2ZUB A;  2YTU A;  2C2E A;  1U9L A;  2K60 A;  2JEG A;  5L1K A;  2YML A;  3KHR A;  3BQ0 A;  1S9F A;  4ED1 A;  4YMO A;  2OEH A;  1S10 A;  4Y2Y A;  4PZO A;  4ELT A;  3ZDB A;  1ZD5 A;  3EPG A;  2UVU A;  4DFD A;  2HOF A;  4RQ7 A;  8ICP A;  2XC9 A;  3JPR A;  2RHF A;  1WWU A;  4R64 A;  3SYZ A;  5AKG A;  3HKZ C;  1SGG A;  2KFZ A;  4C7Y A;  2D3D A;  2C2R A;  1S0N A;  4IL6 U;  3MGH A;  2ZIU B;  4OJP A;  4WJ3 B;  1OW5 A;  2A1A A;  2QKQ A;  4CNQ A;  5KAI U;  4F4K A;  5D46 A;  2VIX A;  4FO6 A;  3TFR A;  1RZT A;  4NLC A;  5B66 U;  3LWM A;  2PI5 A;  2JXJ A;  2DPI A;  4I2A A;  3BJY A;  1A76 A;  1ZQD A;  3QZ8 A;  4UAU A;  4EEY A;  4EBD A;  2W9B A;  3T79 A;  1WWV A;  5J0Q A;  3AEV A;  3CP8 A;  4F50 A;  4O3M A;  4R65 A;  4GIB A;  4YXM A;  2G5H B;  2MA1 A;  3H8M A;  2KZ3 A;  2UVW A;  2DWQ A;  3T5L A;  3TFS A;  4DF8 A;  2PKE A;  4A8E A;  5AK3 A;  3EW9 A; 
#chains in the Genus database with same CATH homology
 2ISO A;  1WCN A;  1TAQ A;  1QSL A;  5KFJ A;  5KFP A;  3BQ1 A;  5KFZ A;  3G6X A;  9ICB A;  5J2G A;  4Q43 A;  4ECT A;  1X9S A;  3RB0 A;  1XC9 A;  4UAZ A;  3M9N B;  4K4I A;  3PR5 B;  1T7P A;  4B9V A;  1ZQR A;  7ICL A;  2HHQ A;  3G6V A;  2KZM A;  1C7Y A;  4C8M A;  9ICH A;  4MFF A;  5J29 A;  1BPE A;  1XSN A;  3RJK A;  4JWN A;  4RUA A;  2PFN A;  4KLO A;  5KFW A;  5F9L A;  4P4P A;  4XQ8 A;  4ED3 A;  4ED7 A;  2IBK A;  4YMN A;  3PY8 A;  4B9M A;  4PHA A;  2J6S A;  2B21 A;  3MBY A;  1U48 A;  5DLF A;  3OSN A;  1DOQ A;  4Z6D A;  4RNM A;  4DWI A;  4M6W A;  5BOL A;  2MUT A;  4PGQ A;  5CR0 A;  4GC6 A;  3RB3 A;  5CWR A;  4K4H A;  4IR9 A;  2A1J B;  5EWF A;  3SZ2 A;  1KFS A;  4F4Z A;  4KLU A;  5EWE A;  2AJQ A;  4TUS A;  1BPB A;  4MEY A;  4J9K A;  4EBE A;  4I28 A;  5L1L A;  1Y88 A;  4J9M A;  5CB1 A;  5KFN A;  2R8I A;  1JXL A;  4BWM A;  1KSP A;  4M9G A;  4XRH A;  7ICF A;  5J2E A;  1NOM A;  3PV8 A;  1L3V A;  4QZG A;  4FS1 A;  5IIM A;  4RQ2 A;  1JIH A;  4RQ5 A;  4UAY A;  3UQ0 A;  2BQR A;  2IHN A;  2HHU A;  3HX0 A;  1ZQJ A;  3Q8L A;  4F3O A;  4DL7 A;  1L3U A;  3Q8Q B;  1SL0 A;  3K75 D;  5HNK A;  3PR4 A;  3H8S A;  3V7K A;  4ED0 A;  2C2D A;  5KFL A;  4YQW A;  3GIM A;  4GC7 A;  2GWS A;  3PNC A;  3TI0 A;  1X9W A;  4ECR A;  2Y1I A;  3T5H A;  1ZQG A;  4KLI A;  3AUO A;  4QWA A;  3RJH A;  8ICV A;  1KLN A;  2BQU A;  9ICM A;  4G3I A;  4ECV A;  4F4Y A;  5IIJ A;  4DQS A;  3OJS A;  5J2D A;  5KG7 A;  4Q45 A;  3V6H A;  1ZQP A;  4RZR A;  4ELU A;  3H4D A;  1ZQU A;  8ICQ A;  3PW5 A;  3LK9 A;  3RAX A;  3LDA A;  4IRD A;  2H5X A;  5KFX A;  2ASD A;  2DPJ A;  3GIK A;  1TV9 A;  4YMM A;  2W9C A;  2ZTC A;  4GLX A;  1NK9 A;  5BPC A;  4KTQ A;  4NM2 A;  3AU6 A;  4DFJ A;  3BDP A;  4P4O A;  4DLE A;  3GDX A;  5KT6 A;  2PI4 A;  4KLT A;  9ICL A;  5J2K A;  3HP6 A;  8ICK A;  1D9F A;  7ICN A;  4QW9 A;  4TUP A;  1IXR A;  1KRP A;  3EZ5 A;  3B0X A;  2WTF A;  2BCU A;  3PO5 A;  1SKS A;  4NY8 A;  4RQ1 A;  3GV7 B;  1B43 A;  1B22 A;  5HMM A;  5KFR A;  3MDC A;  5HHH A;  1NJX A;  3V6K A;  8ICF A;  5KG3 A;  1RYS A;  2HVH A;  2PXI A;  8ICR A;  1UT5 A;  4QWB A;  5J0U A;  4PHP A;  4MF2 A;  1L5U A;  3C2M A;  4B9N A;  4RPY A;  4ELV A;  2C22 A;  2XGQ A;  2XO7 A;  1TVA A;  4DFK A;  4F5O A;  4ED8 A;  2JZB A;  4JV1 A;  4IQU A;  4RNO A;  1ZQH A;  2W9B B;  1QLN A;  3PW7 A;  3TAN A;  1JMS A;  2MAX A;  9ICA A;  8ICX A;  1K1S A;  1RXV A;  3MFH A;  3UQ2 A;  4J9R A;  3ZDC A;  1TKD A;  4M9J A;  4KLQ A;  9ICW A;  2V9W A;  5III A;  5F9N A;  3Q8M A;  5KT4 A;  1XSL A;  1U45 A;  2FMP A;  4I2E A;  4Q8E A;  1SZP A;  1D9D A;  1L3S A;  2ZUC A;  8ICH A;  5KFY A;  4M9L A;  3PX0 A;  2ATL A;  7ICR A;  5KFM A;  1Z00 A;  5IIO A;  5DDM A;  2RDJ A;  1NKC A;  4CCH A;  1TK8 A;  4QZ8 A;  4B9U A;  2HHS A;  9ICS A;  4O0I A;  5KG1 A;  3V72 A;  4R8U B;  4B9L A;  3ISD A;  4XA5 A;  2AQ0 A;  4YN4 A;  4DFP A;  5DLG A;  1S0V A;  3V7L A;  2ZTE A;  4O3Q A;  4DS4 A;  3ISC A;  3HWT A;  2KFN A;  4IQW A;  4F2R A;  1NJZ A;  5KTQ A;  1ZQK A;  2AGO A;  2I1Q A;  4YFK A;  1NK8 A;  5KFE A;  2R8J A;  4R8U A;  4ECX A;  2AGQ A;  3M9O B;  1UA0 A;  2XCP A;  1BPD A;  4J9S A;  1ZJM A;  4PPX A;  3JPS A;  1BPX A;  8ICL A;  5CHG A;  5IIK A;  3THV A;  4QZD A;  1N56 A;  2IMW P;  4C8O A;  1JX4 A;  1S76 D;  4YD1 A;  4C8L A;  5DGA A;  1X2I A;  1MQ2 A;  5C5J A;  4QWC A;  2ZJ8 A;  4BDP A;  4JK1 A;  3TQ1 A;  1XWL A;  4R63 A;  4ECQ A;  1UA1 A;  4RPZ A;  1JN3 A;  1D8L A;  4C8N A;  1KTQ A;  5J0R A;  3MR3 A;  4Q8F A;  1KFD A;  2NRW A;  3OHA A;  8ICY A;  4Z6F A;  3C21 A;  4M6W B;  3RRG A;  2HVI A;  2MUT B;  3BQT A;  2VAN A;  1UT8 A;  2BPC A;  2ZJA A;  3PMN A;  4P4M A;  4ECZ A;  5D49 A;  3V6J A;  2IHM A;  4PGY A;  5KFF A;  4TUR A;  4DL2 A;  4HYK A;  2BDP A;  5J0O A;  4FBU A;  9ICP A;  1N48 A;  1ZQT A;  4FS2 A;  1L3T A;  2BPG A;  4JV2 A;  4NLZ A;  3ETL A;  3RJI A;  4DSF A;  2J6U A;  3RR7 A;  8ICU A;  9ICJ A;  3SV3 A;  5KFQ A;  4DOA A;  3EPI A;  4Q44 A;  7ICK A;  7ICV A;  4ECY A;  1QSY A;  3PVX A;  4KLL A;  5J0X A;  4M9H A;  1TAU A;  4F5R A;  2FPK A;  2Y1J A;  4YR3 A;  4KIT B;  5KT7 A;  4XUS A;  4I2F A;  9ICV A;  4DS5 A;  4DOB A;  4I2D A;  3H7I A;  4F91 B;  3T5J A;  2VA2 A;  1EXN A;  4LZD A;  2KZZ A;  3ZDD A;  3B0Y A;  5JUM A;  4IR1 A;  1NK4 A;  1RPL A;  2IA6 A;  4YR0 A;  1NK5 A;  4KLE A;  3PML A;  3RBD A;  1S77 D;  3QZ7 A;  2FPM A;  1QTM A;  2W9M A;  8ICM A;  4M2Y A;  2W9C B;  4M0A A;  5EOZ A;  1IM4 A;  8ICJ A;  4O3S A;  4MEX A;  5J0S A;  2BHN A;  3OGU A;  3TAQ A;  7ICU A;  3TAR A;  1ZQF A;  2BKE A;  3ZDE A;  4J9Q A;  2AQ4 A;  4KLD A;  9ICO A;  5KT2 A;  5DQG A;  5DB8 A;  2F1H A;  9ICI A;  3ZD8 A;  3RR8 A;  3LWL A;  9ICR A;  4YG2 A;  4KLH A;  1X9M A;  2V4R A;  5DB9 A;  5L1I A;  3JPQ A;  1ZQM A;  4DQP A;  3QEB Z;  3TAP A;  4RNN A;  5KFC A;  5J0P A;  3QEA Z;  4F5Q A;  1NK6 A;  3IM1 A;  4UB1 A;  4UQG A;  5KFU A;  3RJG A;  4O5C A;  1XU4 A;  4EYH B;  5DQH A;  4QZ9 A;  5EWG A;  4DSJ A;  4RUC A;  8ICC A;  3C2K A;  4M47 A;  2JEI A;  2JZB B;  4KLF A;  1KFT A;  7ICT A;  4Z6C A;  4EBC A;  3PW0 A;  1ZQE A;  4LVS A;  8ICZ A;  4KN4 A;  4I2I A;  9ICQ A;  4KN7 A;  3RRH A;  3HPO A;  3M8R A;  4PH5 A;  3N4M B;  3MDA A;  4M9N A;  3MR2 A;  3JPN A;  3ZDA A;  4IRC A;  4UB4 A;  4KLM A;  3NGD A;  4R66 A;  1KDH A;  8ICT A;  4UBB A;  4RT3 A;  9ICK A;  1Z00 B;  3RBE A;  2R8H A;  5KFG A;  9ICE A;  2HHT A;  2KTQ A;  5KFB A;  4I27 A;  5CP2 A;  2NRZ A;  3KHH A;  3H8J A;  2BCS A;  4I2C A;  5HML A;  4E0D A;  4ZH4 A;  1KEJ A;  2F1I A;  3OHB A;  4RQ4 A;  3MR6 A;  5DG9 A;  2W8L A;  1ZQA A;  1ARO P;  4IRK A;  8ICN A;  2PFO A;  3FYH A;  4KLG A;  8ICS A;  1A77 A;  5L9X A;  8ICB A;  5DG8 A;  2C28 A;  4TQR A;  9ICF A;  4Z6E A;  4DSL A;  1LB2 B;  1XSP A;  4ED2 A;  3MR5 A;  2P6U A;  1ZQO A;  2R8K A;  4LZG A;  3ISB A;  3V7J A;  2FLL A;  4UB2 A;  1U47 A;  2FLN A;  5KG5 A;  3H8W A;  4NLN A;  1ZQY A;  5J0T A;  3RB6 A;  3K4G A;  5KFH A;  3PW2 A;  4YXJ A;  4QWE A;  4F8R A;  4RQ0 A;  2BQ3 A;  4X5V A;  5KFA A;  8ICG A;  4EYI B;  2FMQ A;  1ZQV A;  3E2E A;  3RB4 A;  4B9T A;  4F2S A;  3BQ2 A;  4O5K A;  7ICP A;  5KFI A;  3KHL A;  3GIL A;  1D8Y A;  4DQI A;  9ICT A;  5BOM A;  1DGS A;  5DGB A;  4ECS A;  3EYZ A;  4F4X A;  2XY7 A;  1BVS A;  4KMU A;  4JV0 A;  2HHV A;  2ASJ A;  2ZJ5 A;  8ICE A;  5DBA A;  4ECU A;  1NK0 A;  3C2L A;  3KHG A;  5HP4 A;  4O3N A;  5J2A A;  4F4W A;  1T4G A;  3GFK B;  3Q8K A;  1ZJN A;  7ICS A;  3OJU A;  4DL4 A;  2R8G A;  3FDS A;  2HHX A;  1XO1 A;  4MFC A;  1H38 A;  3SI8 A;  5CA7 A;  5DB7 A;  2UVR A;  1ZQQ A;  3Q8S B;  3RH5 A;  1SL2 A;  2BCV A;  7ICO A;  3MGI A;  2FMS A;  4YCX A;  4QZH A;  5DG7 A;  2FLP A;  7ICH A;  1S97 A;  4ECW A;  3PW4 A;  7ICM A;  3H40 A;  1NKB A;  1CEZ A;  2PFQ A;  5IIN A;  4DL6 A;  1XS9 D;  1T3N A;  4C8K A;  3N97 B;  3GII A;  1T8E A;  5J0Y A;  4J9L A;  4QZI A;  2BCQ A;  1ZQS A;  4DO9 A;  8ICA A;  8ICI A;  3ORY A;  1ZQZ A;  3C1Y A;  2HHW A;  2PFP A;  4O3O A;  4GXJ A;  7ICI A;  3Q8R B;  4PHE A;  4MFA A;  2JEJ A;  4NLG A;  2NRV A;  4ED6 A;  4I2J A;  3M8S A;  2BR0 A;  2ZTD A;  4RQ3 A;  4UBC A;  5KFV A;  3GQC A;  4RU9 A;  5DQI A;  1U49 A;  5KT5 A;  4NM1 A;  1HUO A;  1ZQN A;  3GV5 B;  4EZ9 A;  3UXO A;  4O3P A;  4QZC A;  4TUQ A;  4F93 B;  1S0M A;  3G6Y A;  5DKW A;  1JXE A;  5J2H A;  4DOC A;  4F5N A;  2ISP A;  2Q0Z X;  1SKR A;  4IQT A;  4JUZ A;  4P2H A;  4RQ6 A;  5J2F A;  4KLS A;  9ICG A;  3UXP A;  2A1J A;  3NTU A;  1MSW D;  4RT2 A;  1HUZ A;  4I2H A;  2V4Q A;  3GV8 B;  9ICN A;  5KFS A;  2AU0 A;  1Z3E B;  5KFK A;  1ZYQ A;  1MQ3 A;  5DB6 A;  3T5K A;  3UXN A;  2XGP A;  5J2C A;  1SL1 A;  1ZQC A;  4UB5 A;  1NJW A;  3RJJ A;  3RH6 A;  1TFR A;  1TK5 A;  4DSE A;  1ZQX A;  2XY5 A;  7ICE A;  3GIJ A;  4GXI A;  4DF4 A;  2P66 A;  8ICO A;  4BXO B;  2ZUB A;  5J0W A;  2C2E A;  1U9L A;  4K4G A;  7ICQ A;  1BPZ A;  2JEG A;  5L1K A;  4MF8 A;  3ZD9 A;  1U4B A;  3HW8 A;  4O3R A;  4DEZ A;  4IQV A;  4DLG A;  4J9O A;  3KHR A;  5KG6 A;  1ZET A;  4O9M A;  3JPP A;  3BQ0 A;  5DDY A;  1QSS A;  3MFI A;  4QZB A;  3UPQ A;  2NRX A;  4ED1 A;  4QZA A;  4YMO A;  4TQS A;  1S9F A;  2BPF A;  1NKE A;  3Q8P B;  4BXO A;  2HW3 A;  1S10 A;  4ELT A;  9ICX A;  1ZQB A;  2RDI A;  1TK0 A;  5J2I A;  3ZDB A;  2LYH A;  3H4B A;  5TZV A;  4BWJ A;  4DL3 A;  4PGX A;  4DSK A;  3EPG A;  3C23 A;  4GXK A;  4J9P A;  2UVU A;  2UVV A;  4DFM A;  7ICG A;  3M9M B;  3RJF A;  4RQ7 A;  8ICP A;  2ZUD A;  2XC9 A;  2J6T A;  1WCL A;  3JPR A;  3RAQ A;  1ZQL A;  1S0O A;  5KG2 A;  4R64 A;  3C5F A;  1SKW A;  1BPY A;  3RH4 A;  3EWA A;  3SYZ A;  2KFZ A;  5DBC A;  3SV4 A;  3RTV A;  4M04 A;  5KT3 A;  3HT3 A;  3PX4 A;  3C1Z A;  4BGD A;  1RXW A;  2C2R A;  1S0N A;  1LV5 A;  3MGH A;  4PHD A;  4QWD A;  1BGX T;  5KFO A;  4JWM A;  2DFL A;  1V9P A;  4F4K A;  1MC8 A;  3RJE A;  5D46 A;  2BGW A;  1COO A;  4UAW A;  5KG0 A;  4QW8 A;  4J9N A;  4FO6 A;  3TFR A;  1RZT A;  2XCA A;  1NJY A;  5KG4 A;  3JPO A;  4DL5 A;  5HHI A;  4RQ8 A;  3QE9 Y;  3PX6 A;  3LWM A;  1CUK A;  1ZQW A;  5KFD A;  2I9G A;  2PI5 A;  2VA8 A;  2W9A A;  2DPI A;  3PO4 A;  4I2B A;  4I2A A;  3BJY A;  4NLK A;  4YVZ A;  1A76 A;  1ZQD A;  3QZ8 A;  4EEY A;  1K1Q A;  4EBD A;  9ICC A;  2W9B A;  5DBB A;  4EZ6 A;  4FBT A;  4KLJ A;  5J0Q A;  1HJP A;  9ICU A;  7ICJ A;  4I29 A;  4F92 B;  1ZQI A;  3AU2 A;  4F50 A;  3OSP A;  2VA3 A;  4R65 A;  2OWO A;  5D4B A;  2BCR A;  2AGP A;  4RPX A;  4QZE A;  5J2B A;  2NRT A;  5L1J A;  4F5P A;  2ALZ A;  4YXM A;  1PZN A;  2F1J A;  3KTQ A;  4I2G A;  2M9N A;  8ICW A;  2KZ3 A;  3MAB A;  5KFT A;  4NXZ A;  4YD2 A;  2JEF A;  2XY6 A;  2UVW A;  2ASL A;  3T5L A;  3TFS A;  2FPL A;  4QZF A;  3T3F A;  2P6R A;  4DSI A;  2KN7 A;  4DF8 A;  3C5G A;  5J2J A;  3IHQ B;  4UB3 A;  3JPT A;  5IIL A;  1NK7 A;  4B9S A;  4YP3 A;  4O5E A;  4DQR A;  5CJ7 A;  2W8K A;  4DQQ A;  4YR2 A;  1RYR A;  3EW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...