1WCLA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
total genus 21
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wclA00
4PPXA 5J2BA 4EBDA 2BPGA 4J9RA 1NJZA 4RNMA 2DFLA 4BGDA 4UB4A 1ZQLA 4KLHA 5DGAA 4ED7A 2BQUA 5CWRA 3EZ5A 3TI0A 2BQ3A 2KTQA 3V6JA 4O9MA 5BPCA 5DQGA 2IBKA 1AROP 4B9UA 5J2CA 4PGXA 2I1QA 4F4YA 4ECWA 1ZQEA 4IR1A 8ICXA 2FMQA 4DF8A 4R8UB 5IILA 2NRZA 4DEZA 4O3OA 4R64A 2BCVA 2W8LA 2P6UA 1QTMA 9ICEA 3MR6A 1ZETA 5KT7A 3MR3A 5J2AA 1ZQYA 3N4MB 1S10A 4DQIA 4RPXA 2UVWA 2XC9A 4QW8A 1X2IA 3Q8KA 8ICBA 2JZBA 4YR0A 1QSLA 2FPLA 2WTFA 2F1HA 1ZQHA 9ICXA 9ICBA 1TAUA 1PZNA 9ICVA 2BCRA 4F2RA 2PFQA 5KFYA 3T5JA 3B0YA 4YXJA 4J9LA 4DF4A 2BDPA 1XU4A 1ZQCA 4DL3A 1SKRA 1XWLA 4JWNA 4RUCA 1SZPA 3SV4A 5KFBA 1ZQAA 4KLEA 4I2GA 3KHRA 1B43A 5KFMA 1U4BA 4GC7A 2BGWA 4UQGA 4DS4A 4QW9A 3UPQA 9ICTA 3V7JA 1HUZA 1ZQSA 4JK1A 5KG6A 4P4PA 4B9SA 4F4KA 4C8OA 8ICZA 4QWDA 7ICEA 2C2EA 3AUOA 3JPTA 5KFHA 4DFPA 2Y1IA 9ICAA 5J0OA 4FO6A 4KLUA 4CCHA 4I29A 1TAQA 3QZ7A 2AGQA 2KZZA 4M6WB 2XY5A 1ZQNA 5IIIA 3OSNA 2MAXA 3MFIA 3GV5B 2ALZA 1TKDA 3RRGA 2M9NA 4ED1A 4YD2A 1S0OA 2PFNA 4KLJA 3SI8A 4BWJA 5D4BA 4B9MA 2C22A 4DSKA 3T5LA 3H4DA 1D8YA 9ICPA 2W9MA 2ASJA 2FPMA 4J9QA 1NOMA 1NK5A 4DFMA 2FPKA 4PHDA 3MABA 2J6UA 9ICQA 1JXEA 4C8NA 1TVAA 2Y1JA 5KT4A 1T3NA 3RAXA 2BKEA 2DPJA 3IHQB 3JPQA 1MQ3A 8ICOA 5DG9A 3RBDA 4DSFA 5L1JA 5L1KA 4QZEA 5CHGA 1ZQFA 4O0IA 1X9MA 4UBBA 4ECZA 5DG8A 2XGPA 3T5KA 5DB8A 2FMPA 5KFUA 3TARA 8ICTA 3QEBZ 5J2FA 2BHNA 4GC6A 1ZYQA 2IMWP 5CP2A 1KFDA 4RQ1A 4IQVA 4F4ZA 2HHWA 9ICJA 4QZAA 4TURA 1HUOA 4B9VA 4KLMA 3RBEA 1SL2A 1Z00A 4NLZA 9ICGA 5J0UA 1SL1A 1ZQGA 8ICRA 2XY7A 8ICKA 1BPXA 7ICKA 8ICPA 4I2DA 5KFWA 2IHNA 5DBCA 4F93B 5DLGA 2KN7A 1ZQZA 7ICHA 1IM4A 2H5XA 1NK4A 3PO5A 1NK6A 1KEJA 5HHIA 3PMLA 4Q44A 3UXOA 4QWCA 4DLGA 4KLDA 3M8RA 7ICSA 2JEFA 1D9DA 4J9SA 9ICLA 2VA3A 2J6SA 4KN4A 5IIMA 3TAQA 3EYZA 8ICJA 3C1ZA 3RJFA 3AU2A 3Q8SB 4M9JA 3KHHA 4MF8A 3RH4A 1N56A 4M9LA 1LV5A 5KG0A 4J9OA 1ZQKA 8ICQA 3SZ2A 4ZH4A 2ASLA 4K4IA 7ICIA 4ELTA 1RXVA 7ICTA 4RNOA 4YFKA 5J0PA 1S0MA 4ELUA 4MFFA 4KLTA 9ICFA 3MGHA 3OSPA 1NK9A 4RQ2A 4R66A 5DGBA 2HVHA 4ED8A 4I2HA 4I2AA 3T5HA 2XCPA 4UAZA 4ECTA 4F5NA 2IHMA 3LK9A 1U9LA 5CB1A 4DQPA 3PX6A 5J2IA 1KLNA 4KLFA 4KLLA 5KTQA 3H4BA 2KZ3A 5KFIA 5DB9A 5J2KA 4QWAA 5KFCA 4BXOA 4JWMA 4F3OA 3KHGA 2PI4A 1KTQA 2HHTA 8ICVA 4JUZA 4I27A 1S0VA 5KFXA 2OWOA 4RUAA 4B9NA 3PMNA 2BQRA 4MF2A 2MUTA 5L9XA 1X9SA 5DLFA 1SKSA 1T8EA 5KT6A 3BJYA 1CEZA 9ICSA 4KLIA 5J0YA 5KFFA 3JPPA 4ED3A 1T4GA 4NXZA 5KFLA 3OJSA 4EYHB 4P2HA 5DBBA 4QWBA 9ICMA 3MGIA 4DLEA 7ICLA 4I2CA 1BPDA 5J0TA 4Z6EA 3OJUA 3V6KA 4IQUA 4YXMA 4DL2A 3C23A 4M47A 8ICIA 4M0AA 1ZQOA 2ISPA 3EWAA 4RQ7A 2AQ4A 1ZQVA 1RYRA 1CUKA 2HHXA 3PV8A 3UQ2A 1JIHA 5DQIA 4TQSA 1KFSA 4RPZA 1KRPA 3PR4A 9ICRA 4GXKA 1JN3A 2AU0A 4J9MA 3RR7A 4PH5A 1K1SA 3JPSA 3V7KA 3UQ0A 3Q8PB 2F1IA 4JV1A 2KFNA 3JPRA 2IA6A 2UVRA 2ZJAA 4GXJA 7ICMA 4J9NA 4DFKA 3SV3A 1ZQIA 2KFZA 2XY6A 3EW9A 2A1JB 4YR2A 3HP6A 3M9OB 1ZQBA 4ED6A 3RB3A 5J2JA 4M9GA 1KFTA 4DSLA 1RZTA 3Q8RB 5J0SA 4FS2A 4ECUA 1QSSA 1X9WA 4R65A 5L1LA 4M6WA 4I2BA 1XC9A 4DWIA 1JMSA 1IXRA 4E0DA 1NKBA 4O3RA 1L3VA 3Q8LA 5KFKA 3PO4A 1XS9D 4RU9A 4ECSA 3ZDDA 3MR5A 2ZUCA 1TV9A 4GXIA 1JXLA 2RDJA 4YQWA 4F8RA 4ED0A 1JX4A 4MEXA 3NGDA 3PW0A 2W9CB 4K4GA 1DGSA 3Q8QB 5BOLA 3OGUA 3G6YA 4I2IA 2ATLA 5J0WA 3G6XA 4DSJA 9ICUA 8ICWA 2W8KA 5J0RA 4LZGA 5CA7A 3Q8MA 3RB4A 5DDYA 4DO9A 1S9FA 7ICRA 3IM1A 3PW7A 3GQCA 4I2JA 4KN7A 3ETLA 4PHPA 5IIKA 7ICGA 4KITB 5KG5A 1ZQRA 4DL6A 8ICGA 3TANA 2HHVA 5KFQA 3HPOA 3QE9Y 4IRDA 1ZQMA 4Q8EA 7ICFA 2JEGA 8ICNA 4RPYA 2AJQA 4F50A 1ZQTA 2XO7A 3ZDBA 5D49A 4ECYA 3RJGA 1T7PA 4XUSA 5DBAA 2HHUA 4YMOA 5BOMA 4ECVA 4UB1A 4YD1A 5KG3A 2W9CA 5EWEA 5DKWA 2PI5A 1ZQUA 3H8WA 5HMLA 4G3IA 3PW4A 1TK8A 2PFOA 1UT8A 1XO1A 3C2LA 2FLPA 2BPCA 4I2EA 4QZGA 4YG2A 4O5CA 4DOAA 1D9FA 5KFAA 1Z00B 4DSEA 3RJKA 4BXOB 5J29A 4O3SA 4R63A 2HVIA 5KFSA 4FBUA 4R8UA 2ASDA 4BWMA 3TFRA 1ZQPA 4M2YA 3KTQA 7ICUA 3RJIA 4HYKA 4RQ8A 4DSIA 1DOQA 7ICJA 4UB3A 5JUMA 5EWGA 4Z6DA 4DFJA 2LYHA 3H8SA 4YN4A 4M04A 4NM1A 1BPBA 1MSWD 4F5RA 3MDAA 4I2FA 3C5FA 2A1JA 3GIMA 2FMSA 4FBTA 9ICNA 4Z6CA 4TQRA 4EZ6A 3BQ0A 4EEYA 5KG2A 4EBCA 4B9LA 4MEYA 3PNCA 3MDCA 4O5EA 3C5GA 4EZ9A 3E2EA 5DG7A 4QZDA 4RT3A 1L3TA 1RXWA 3ISDA 4ECQA 9ICOA 5DB6A 3BQ1A 3N97B 3BQTA 5L1IA 1Z3EB 2NRXA 3K4GA 4C8MA 4RQ4A 2AGPA 1NK7A 2R8GA 4KLQA 4QWEA 4J9KA 3GIIA 4ED2A 4MFCA 4TUQA 4KLSA 1SKWA 4IR9A 4DL7A 4KTQA 5KT5A 2C2DA 1ZQQA 3V6HA 1TFRA 2NRVA 5IIOA 5KT3A 2C28A 4DL5A 1MC8A 5KFJA 1MQ2A 1ZQXA 3ORYA 1S97A 1ZQWA 2R8IA 4EYIB 5J2HA 4DOCA 2V4RA 1BPZA 2XCAA 4EBEA 1D8LA 4QZ8A 2ZTCA 4O3NA 4IRCA 2Q0ZX 5HHHA 5F9LA 4DQQA 8ICLA 2XGQA 4M9HA 3OHBA 4QZ9A 2MUTB 3AU6A 1N48A 3QEAZ 3PY8A 1L3SA 5CJ7A 2JZBB 4PGQA 4Q8FA 2KZMA 7ICNA 3RJHA 4O3QA 3HT3A 3RAQA 5DDMA 9ICKA 3OHAA 1XSPA 1TK0A 1S0NA 4K4HA 1B22A 2HHQA 7ICVA 4RNNA 2FLLA 4C8LA 4F5OA 5CR0A 3RH5A 4IQWA 5HP4A 5KFVA 4PHEA 5KFDA 4NY8A 8ICAA 4Q43A 1NKCA 4P4MA 2ISOA 5KFEA 4YMMA 5J2DA 3T3FA 4DQRA 9ICWA 1NJXA 4UAYA 4UB2A 4RZRA 3PVXA 8ICFA 1H38A 1XSLA 4ECRA 3RR8A 2ZTEA 1ZQJA 4YVZA 5IIJA 5EOZA 3TQ1A 1ZJMA 4JV2A 4F4WA 1L3UA 8ICCA 2J6TA 2VANA 1NK8A 2P6RA 3FYHA 3PW5A 8ICMA 2ZTDA 2B21A 4QZIA 2NRWA 3M9NB 4UAWA 2ZJ5A 1UA1A 4O5KA 3V72A 4RQ0A 1TK5A 4LZDA 5J2GA 4QZFA 4F5QA 3PW2A 4UBCA 4LVSA 4ELVA 9ICCA 1A77A 1RYSA 1V9PA 5F9NA 2BCSA 5HNKA 3C21A 4P4OA 1EXNA 1RPLA 5KG1A 2UVVA 3RTVA 1COOA 1HJPA 4YR3A 4F91B 3G6VA 1BPEA 1NJWA 5KFPA 2W9BA 3KHLA 1XSNA 1S76D 4ECXA 2P66A 4RQ3A 4B9TA 3TAPA 3TFSA 3FDSA 3SYZA 3BDPA 1LB2B 2DPIA 3NTUA 5C5JA 4PGYA 5J0QA 3MBYA 3ZD9A 3K75D 2VA2A 4RQ6A 1NJYA 1BPYA 2W9BB 3PR5B 3RRHA 4KLGA 2JEIA 4QZHA 3LDAA 3GIKA 1ZJNA 4XQ8A 8ICHA 4C8KA 3PX0A 5KFZA 5IINA 2RDIA 3MFHA 5KFTA 2JEJA 8ICEA 5KG7A 3BQ2A 4F5PA 5KFGA 4DL4A 1WCNA 8ICYA 3ISBA 2ZUDA 3RB6A 3GV8B 3PX4A 3H8JA 3V7LA 3ISCA 1NK0A 3EPGA 3ZDEA 5TZVA 2BCUA 2NRTA 4IRKA 3GFKB 3MR2A 2R8JA 4Z6FA 4I28A 2BPFA 4RT2A 1QLNA 4IQTA 3HWTA 1U47A 4YCXA 3M9MB 4Q45A 3RJEA 8ICSA 4YMNA 3LWMA 3C2KA 3RH6A 3ZDAA 3M8SA 4F92B 3B0XA 9ICIA 4RQ5A 4M9NA 3EPIA 2UVUA 3ZDCA 5KG4A 1BGXT 2GWSA 2VA8A 2R8HA 1KSPA 5J2EA 1U45A 4TUSA 3UXPA 4UB5A 2PFPA 4QZBA 4NLGA 4F2SA 5KFRA 4X5VA 5DQHA 4NLKA 3GILA 4O3PA 4J9PA 2HW3A 7ICOA 4XRHA 3C1YA 4XA5A 4MFAA 1K1QA 3JPOA 2C2RA 2AGOA 7ICPA 4TUPA 2I9GA 4F4XA 4NLNA 5KT2A 1QSYA 4KLOA 4FS1A 2HHSA 2AQ0A 5KFOA 9ICHA 3UXNA 1S77D 2F1JA 5EWFA 3H40A 2ZUBA 5J0XA 7ICQA 3RJJA 4DOBA 4JV0A 3LWLA 3GV7B 1BVSA 3GDXA 4DS5A 3ZD8A 2W9AA 1UT5A 2PXIA 8ICUA 5DB7A 4GLXA 2BCQA 4YP3A 1A76A 4NM2A 2V4QA 3H7IA 2ZJ8A 3HW8A 3GIJA 5HMMA 1KDHA 1NKEA 2BR0A 1Y88A 1L5UA 1C7YA 2V9WA 1ZQDA 4BDPA 2R8KA 4QZCA 3JPNA 3C2MA 1U48A 3RB0A 4PHAA 3THVA 1WCLA 1UA0A 1SL0A 5KFNA 4DQSA 4KMUA 1U49A 5D46A 3QZ8A 3HX0A 2FLNA
chains in the Genus database with same CATH superfamily
4RNMA 2DFLA 4BGDA 1DK3A 2BQ3A 4O9MA 5DQGA 1AROP 1ZD2P 5ALPA 4DF8A 1YZ6A 2G5IB 2N1RA 2QKQA 3DV9A 2UVWA 2XC9A 3IG5A 5AKHA 2WTFA 2F1HA 9ICXA 1RYUA 3ALRA 9ICVA 4F2RA 4YXJA 2GLEA 1XU4A 4JWNA 4IC9A 4RUCA 5KFBA 1ZQAA 4AP9A 3GU3A 3KKAA 3WKDA 4AYBC 9ICTA 4JK1A 4B9SA 4C8OA 2C2EA 3JPTA 1V97A 3H0RB 1KKXA 3SR6A 2WF8A 4Y2YA 3MGVA 4CCHA 4Y2SA 1ZQNA 2ALZA 3MFIA 3GV5B 3RRGA 1S0OA 1Z19A 5H2FU 4OJPA 3SI8A 5D4BA 1JUDA 2W9MA 1JALA 5EE1A 2FPMA 2K8CB 4J9QA 4DFMA 1HIWA 1SV0C 3A0BU 4OJ6A 9ICQA 1TVAA 5KT4A 3RAXA 2BKEA 8ICOA 3JPQA 1MQ3A 2GO7A 4KMOB 1C20A 5DG9A 2F76X 5CHGA 3F53A 1ZQFA 8ICTA 3NUQA 3I28A 1AQ6A 2BHNA 3M6KA 2IMWP 9ICJA 4C4SA 1UHUA 9ICGA 5J0UA 8ICKA 8ICPA 4I2DA 5KFWA 2K89A 3WU2U 2VJ5A 7ICSA 4DLGA 2QB0A 2K8AA 2ZXHA 5AKIA 5ALYA 2JEFA 1D9DA 4J9SA 1TE2A 1X40A 3AU2A 4J03A 8ICQA 3WKBA 2ASLA 4K4IA 2HMXA 3PSIA 1V38A 5T14A 1Z1BA 2ZIVA 4MFFA 9ICFA 3AMZA 3T5HA 2XCPA 4F5NA 2IHMA 3PX6A 4KLFA 4OJLA 4BXOA 4JWMA 4F3OA 4JUZA 4I27A 5KFXA 2EH9A 2OWOA 3B9JA 4RUAA 2BQRA 4NXZA 1ZRMA 1F0MA 4QWBA 2LKYA 5KL8B 2F8KA 3F2DA 4YXMA 2AH5A 4M47A 4M0AA 4RQ7A 5G5GA 1KL9A 3PV8A 3UQ2A 4TQSA 1JN3A 4IS7A 3N7PD 4PH5A 1LKYB 3V7KA 3UQ0A 2F1IA 4JV1A 3JPRA 2UVRA 3SV3A 2WAQF 2XY6A 3O0FA 5J2JA 1XO0A 1QSSA 3PSFA 1M6YA 4OO1J 1XC9A 1N2XA 2ODGA 1L3VA 3ZDDA 4ECSA 3QUBA 1JXLA 4YQWA 4UASA 5BOLA 4I2IA 4DSJA 9ICUA 1XNSA 1S8OA 4LZGA 5CA7A 5DDYA 4DO9A 3TACB 7ICGA 4KITB 4DL6A 3IV6A 2W3RA 2YMQA 1ZQMA 2F8LA 4BUGA 2CN1A 8ICNA 2AJQA 3EUB2 1QQ7A 4YD1A 5HMLA 3PW4A 1TK8A 2PFOA 1BNPA 1UT8A 1Z00B 2XICA 4DSEA 4O3SA 5J29A 3WKCA 4FBUA 4M2YA 3VC8A 4HYKA 2AXTU 5AM5A 1DOQA 5JUMA 4Z6DA 3C5FA 2A1JA 1WG8A 3SEIA 4B9LA 5AI9A 4O5EA 5ALXA 3E2EA 2ESEA 4QZDA 4RT3A 4ECQA 4C7YA 3BQ1A 2NRXA 3K4GA 4C8MA 2R8GA 4KLQA 7ICIA 3WK6A 2MRLA 4IR9A 4DL7A 4KTQA 5KT5A 3SAFA 1TFRA 2NRVA 3AM9A 3SQIA 1L8OA 1A6SA 1S97A 2HBMA 3FC4A 2ZTCA 4IRCA 5HHHA 2GOLA 4MHVA 4M9HA 3OHBA 3QEAZ 1L3SA 5CJ7A 2JZBB 3SD7A 4F72A 3RAQA 3QXGA 1XSPA 1TK0A 4KX5A 4RNNA 4F5OA 4IQWA 5HP4A 2E8PA 5KFDA 3HKZC 8ICAA 3T3FA 4UAYA 4UB2A 4RZRA 1ZOLA 5EOZA 3TQ1A 3D2SA 8ICCA 3QX7A 1WWVA 2VANA 2WF5A 3FYHA 4QZIA 2NRWA 2ZJ5A 1UA1A 4QZFA 1A77A 2OH2A 2FJ6A 2GH1A 4P4OA 4OJ5A 3D2NA 2W9BA 1Z4OA 2KMDA 4B9TA 4U7CA 4EEKA 3SYZA 1LB2B 4PGYA 3MBYA 1BPYA 3WKAA 3PR5B 2KIWA 3RRHA 4KLGA 2JEIA 4QZHA 8ICHA 4XQ8A 2D3DA 2LMRA 5AKYA 4DL4A 3ISBA 2ZUDA 3V7LA 2WB1F 1NK0A 2A3VA 3EPGA 3GFKB 2ZIWB 4Z6FA 4RT2A 4YCXA 4FFDA 2IOFK 3RH6A 3NVVA 2KHQA 2DBYA 3EPIA 4Y2JA 5KG4A 1BGXT 1DK2A 1U45A 2HBKA 3UXPA 4QZBA 2W43A 2Y0SF 4UAVA 4ZOHC 4XA5A 7ICPA 2C2RA 1L6NA 3D6JA 4F4XA 5KT2A 1QSYA 4EELA 3CW2C 2ZUBA 4UAUA 4DOBA 5AKZA 3WKEA 1UT5A 8ICUA 5DB7A 3KOOA 1QQ6A 3GIJA 2BR0A 1Y88A 1C7YA 2V9WA 2KSOB 1K5OA 4QZCA 3RB0A 1WCLA 3HX0A 2G0AA 1SV4A 4PPXA 4KLHA 4UB4A 2W55A 2YX8A 5CWRA 3EZ5A 3TI0A 2ES6A 3V6JA 2I1QA 2OYYA 1NZPA 5IILA 4O3OA 4R64A 2W8LA 3LVWA 1QTMA 5AKXA 5ALTA 1ZQYA 4JMUA 4RPXA 4QW8A 4OD0A 3Q8KA 2AHOB 3HRDD 1PZNA 5KFYA 4DL3A 3H0MB 1SKRA 1XWLA 8ICLA 3SV4A 1SZPA 5KFMA 1NZBA 1Q3UA 4Y2QA 3UPQA 1PVQA 8ICZA 4QWDA 3AUOA 4DFPA 2ZXIA 1KBUA 3CRXA 3IDWA 3SENA 9ICAA 4FO6A 4KLUA 2W04A 3TADA 4I29A 1TAQA 2JH7A 3J81j 2G09A 2KZZA 2XY5A 1B4FA 1JRPA 5AKEA 2XVTA 3T5LA 2E5SA 1N61A 2EZZA 1CRXA 4JB3A 2QB1A 3DDHA 4PHDA 3MABA 2YTUA 2VJ4A 4G9BA 4Y2UA 3SAHA 1N5WA 3QYPA 3IHQB 2KD1A 3RBDA 4ECZA 3T5KA 2FMPA 2IOHA 5J2FA 1Z4NA 4Y2VA 4RQ1A 4IQVA 4Y2TA 4TURA 1HUOA 2XY7A 5DBCA 2KJ9A 1DXSA 2BDUA 1IM4A 3F2BA 1KEJA 5HHIA 4KLDA 9ICLA 2J6SA 3TAQA 1SXDA 5AKKA 3RJFA 4MF8A 3RH4A 4M9LA 3ZI4A 1LV5A 4ELTA 5KNIA 5AK5A 1RXVA 7ICTA 4YFKA 5J0PA 4ELUA 2HVHA 5ALOA 4I2AA 4UAZA 4ECTA 3PSTA 3QU2A 4DQPA 5KFIA 3KHGA 2PI4A 1KTQA 2HHTA 1PK1B 4B9NA 4KLIA 5J0YA 1VJ5A 1T4GA 2OM6A 4ED3A 2ZIVB 3A0HU 1PVRA 7ICLA 4I2CA 2K4PA 2E8OA 3S6JA 4Z6EA 3OJUA 4IQUA 2QB0B 1ZD5A 2K8BB 1CUKA 3WK8A 2HHXA 5ALKA 2KE7A 5JTIA 5DQIA 1KFSA 4RPZA 1KRPA 3PR4A 4GXKA 1RM6C 2K60A 3AL0B 1D8BA 4CRXA 2ZJAA 3NVYA 2EAPA 3EW9A 4M9GA 4ED6A 3Q8RB 4R65A 5KAIU 4I2BA 1IXRA 4E0DA 1OW5A 5KFKA 1VDVA 3PO4A 2FI1A 2WF7A 5KL1B 1LKYA 2WHEA 4MEXA 1PK1A 2G5HB 3OGUA 2ATLA 2EDUA 3WK7A 1X9XA 3Q8MA 5TISU 7ICRA 3GQCA 1F44A 5KG5A 4EX6A 1ZQRA 3HPOA 3QE9Y 4IRDA 3F5AA 2W03A 5D49A 4ECYA 4XUSA 5DBAA 2LYAA 4YMOA 5BOMA 1P7DA 5DKWA 1ZQUA 4G3IA 2RP5A 1XO1A 3C2LA 2FLPA 4I2EA 2HDOA 4NL9A 4O5CA 2HCFA 3FAHA 1D9FA 3LVVA 4R63A 5KFSA 2W11A 2ASDA 4BWMA 3TFRA 2LHTA 4PZNA 3KTQA 3RJIA 1B0XA 4DSIA 5EWGA 4DFJA 4YN4A 4M04A 2ZIUB 4CF3A 4GIBA 3BQ0A 3MDCA 3PNCA 4EZ9A 3M7DA 1L3TA 3ISDA 1YZ7A 5DB6A 1Z3EB 4RQ4A 2AGPA 5AIBA 1DGJA 4P0QA 4ED2A 3GIIA 4MFCA 1SV0A 4KLSA 4DCCA 1SKWA 3QUQA 2R18A 1L7PA 1V85A 1ZQ1C 5KT3A 4DL5A 3ORYA 1A0PA 4QZ8A 4O3NA 3OPXA 4Y2RA 5F9LA 2D6FC 3PSPA 3AU6A 5ALZA 4PGQA 1L7OA 5DDMA 9ICKA 1S0NA 3C29A 4NY8A 2KICA 1SB3C 8ICFA 4ECRA 1WUDA 2HSZA 1SGGA 1ZJMA 2P6RA 3PW5A 2NO5A 4UAWA 5ALEA 1TK5A 2B6GA 2ZIUA 4LVSA 9ICCA 1RYSA 1V9PA 5F9NA 3C21A 1RPLA 5KG1A 1GO3F 3RTVA 1COOA 3G6VA 1BPEA 1TAMA 4ECXA 4RQ3A 3BDPA 3NTUA 2NYVA 5B66U 3ZD9A 4RQ6A 4P0QB 1OXJA 1RQLA 3LDAA 1ZJNA 3KKAC 5KFZA 3PX0A 3KBBA 3MFHA 5KFTA 8ICEA 4C7ZA 4F5PA 5GTHU 2KKPA 5ALSA 1LVHA 3RB6A 3VCBA 3ZDEA 2BCUA 4IRKA 3MR2A 2R8JA 1QLNA 5ALIA 4UATA 2LM4A 3CNHA 4EX7A 3L3FX 1Q3VA 3M8SA 3N28A 2KOBA 3B0XA 9ICIA 2JHDA 5ALNA 3AEVA 4WJ3B 2R8HA 1T3QA 4UB6U 3BZCA 4U6PA 5EE0A 2KJ8A 5DQHA 4NLKA 3GILA 5AI0A 4J9PA 2VIXA 2YQEA 3C1YA 4MFAA 4TUPA 4FS1A 4PJ0U 2F1JA 3I76A 1BVSA 3GDXA 4DS5A 2O6KA 1O08A 4GLXA 2BCQA 2JMGA 4NM2A 5AKLA 2ZJ8A 1KDHA 5HMMA 1RDFA 3RF9A 4CGZA 1UA0A 2ZIWA 1SXEA 5KFNA 3CP8A 3QZ8A 2K4IA 5J2BA 4EBDA 2HBJA 2K4EA 3L4PA 2OXOA 1NJZA 5AK3A 2E1EA 2BQUA 2KTQA 2EANA 2IOFA 4B9UA 4F4YA 1ZQEA 4IR1A 2FMQA 4R8UB 2JH1A 4DEZA 2BCVA 1ZETA 5J2AA 1X6IA 8ICBA 4YR0A 3D2QA 1ZXIA 1SWVA 3T5JA 3B0YA 4DF4A 2BDPA 1ZQCA 4KLEA 3KHRA 2M0NA 1U4BA 2RLTA 4GC7A 2CRXA 1FO4A 1IV8A 1PVPA 1FFVA 4QW9A 4NJ8A 3NVZA 1ZQSA 4F4KA 7ICEA 4RQNA 5KFHA 3UMBA 1UPHA 1IIPA 5J0OA 3FM9A 3NVWA 1MA7A 3QZ7A 4UARA 4A8EA 1MN8A 5IIIA 1TKDA 2P35A 1UCVA 4C0ZA 4YD2A 2FDRA 2PFNA 4BWJA 4B9MA 2C22A 4DSKA 3BQ7A 9ICPA 2YB1A 1KQQA 5ALDA 2FE9A 2H3IA 3QNMA 2F3NA 1JXEA 2H3ZA 4ICAA 3I1YA 4QNLA 4O0IA 5ALRA 2MSNA 5JRTA 1X9MA 4UBBA 3IRUA 2XGPA 5DB8A 5KFUA 3TARA 5B5EU 2F77X 5CP2A 1KFDA 2HHWA 2LBOA 4US9A 1SL2A 1Z00A 1QH9A 3SMVA 2Z7JA 1SL1A 1ZQGA 8ICRA 1BPXA 5AICA 7ICKA 4F93B 3TADC 5DLGA 2KN7A 1ZQZA 3ONNA 1NK4A 3PMLA 4Q44A 3UXOA 5C0YA 3M8RA 3QU4A 4KN4A 5IIMA 3EYZA 3C1ZA 3Q8SB 3KHHA 1N56A 4J9OA 5AKGA 3SZ2A 2DWQA 2ZIXB 1S0MA 4KLTA 4R66A 1WWUA 5E79U 5CB1A 4PL1A 1KLNA 4KLLA 5DB9A 5J2KA 8ICVA 2W54A 5ALFA 4USAA 1S0VA 4UB8U 2KNJA 1L8LA 3PMNA 4MF2A 2MUTA 5L9XA 1SKSA 5KT6A 3BJYA 9ICSA 5KFFA 2XIDA 3OJSA 3E0FA 3MGIA 2E8NA 2HBLA 4FE3A 2E3TA 1BPDA 1QCKA 2WB1C 5J0TA 2KVSA 3C23A 8ICIA 1KW4A 1ZQOA 1ZQVA 2I5HA 1RYRA 5AI6A 5EE3A 9ICRA 4J9MA 3JPSA 1FEZA 3Q8PB 2RQ5A 5ALVA 2NO4A 7ICMA 2A1AA 4J9NA 2Y9TA 4DFKA 1Z1VA 1ZQIA 2KFZA 2Y0SC 4IL6U 1ZQBA 2A1JB 3M9OB 2DKXA 2QARB 4NLBA 5AK6A 5GTIU 3QUTA 2JRZA 3HP6A 1KFTA 4DSLA 5J0SA 4FS2A 4ECUA 1JMSA 1X66A 1NKBA 3Q8LA 3WK4A 5JU5A 1S5LU 2KHVA 2W9CB 4K4GA 1DGSA 3BS5B 5J0WA 1L7NA 5J0RA 4CE6A 5AM2A 4QJFB 4US8A 3PW7A 4I2JA 5IIKA 8ICGA 2PMZC 2HHVA 2KEYA 4FZNA 4Q8EA 7ICFA 2JEGA 2L5YA 1ZQTA 1J2MA 3RJGA 1T7PA 2HOIA 3BZKA 2JXJA 5EWEA 2PI5A 3H8WA 3NASA 1YT3A 4CDGA 3RJKA 2HVIA 5AM4A 4R8UA 7ICUA 7ICJA 4UB3A 4NM1A 4Y2PA 3MDAA 4I2FA 3GIMA 9ICNA 4EZ6A 5KG2A 4EBCA 4MEYA 5ALQA 2D8CA 3C5GA 5A0LA 2KSOA 5DG7A 3BS7A 4GFJA 9ICOA 3N97B 1IG6A 3BQTA 2LM1A 2HOFA 4QWEA 4J9KA 4TUQA 1F5SA 2C2DA 1ZQQA 3V6HA 3MC1A 2C28A 2KP7A 1MQ2A 1JROA 2MA1A 1ZQWA 4NLCA 2R8IA 4DOCA 2H3FA 2XCAA 1D8LA 2Q0ZX 2XGQA 2MUTB 1ECWA 4Q8FA 7ICNA 3RJHA 4O3QA 4CNQA 3HT3A 2BZFA 7ICVA 2FLLA 4C8LA 3CYMA 5CR0A 5KFVA 4PHEA 2OCEA 3NRZA 4P4MA 5KFEA 4YMMA 5J2DA 1H38A 3RR8A 4JV2A 1PK3A 1L3UA 3C28A 3K1ZA 2B21A 4O5KA 5CEHA 3V72A 4RQ0A 4LZDA 3PW2A 4F5QA 4UBCA 4ELVA 2BCSA 5EE9A 5HNKA 2ZIXA 1EXNA 2UVVA 4F91B 1NJWA 5FP0A 1S76D 1T94A 3TAPA 3TFSA 3FDSA 5C5JA 5J0QA 3K75D 1L7MA 2W9BB 3GIKA 1HEKA 1SIJA 4C8KA 3BQ2A 8ICYA 5KFGA 2A19A 3PX4A 3ISCA 3OTQA 4BJQA 2NRTA 3BS5A 2BPFA 4IQTA 3HWTA 2HOQA 4YMNA 3LWMA 4F92B 4M9NA 1J97A 3ZDCA 5HR7A 2GWSA 2VA8A 5AI5A 1KSPA 2PFPA 2F2AB 4TUSA 4UB5A 4OCZA 5KFRA 5ALWA 1NNLA 5G5HA 4O3PA 7ICOA 4P0PB 2AGOA 3JPOA 1N60A 5ALGA 2HHSA 2AQ0A 5KFOA 9ICHA 4RQMA 5AIAA 3UXNA 1S77D 2YMMA 5EWFA 3H40A 2G08A 4QIWF 3RJJA 3GV7B 2W3SA 1WYGA 5KAFU 2PXIA 2WF6A 1A76A 3H7IA 1NKEA 1L5UA 3E58A 2W7PA 1ZQDA 4BDPA 4PHAA 3THVA 3IG8A 2KKVA 5D46A 3HILA 2FLNA 4LJXA 4O3MA 2BPGA 4J9RA 5AHXA 1ZQLA 5DGAA 2LYBA 4ED7A 2DUYA 3NRWA 5BPCA 2IBKA 5AM1A 5J2CA 5J8YA 4PGXA 4ECWA 8ICXA 2I6XA 3AQEA 2NRZA 2EQYA 2P6UA 9ICEA 4EENA 3MR6A 5KT7A 3L5KA 3MR3A 2KVCA 1FFUA 3N4MB 1S10A 4DQIA 1X2IA 2JZBA 1QSLA 2FPLA 1ZQHA 9ICBA 1TAUA 2KK0A 2BCRA 2PFQA 4J9LA 2W7OA 4I2GA 1B43A 2LPEA 2BGWA 4UQGA 4DS4A 3V7JA 3T79A 1HUZA 4P4PA 5KG6A 2LI6A 1VLBA 1N5XA 3GZFA 3KD3A 2Y1IA 1PUZA 3KZXA 3TKAA 1X6JA 2AGQA 4M6WB 3OSNA 2MAXA 2M9NA 4ED1A 3M6ZA 4KLJA 4HAIA 3H4DA 1D8YA 2ASJA 1NOMA 2RRDA 1SZHA 1NK5A 2RHFA 1QQ5A 2FPKA 2J6UA 4C8NA 2Y1JA 3M1YA 1T3NA 2DPJA 3QU5A 2WAQC 4Y2XA 4DSFA 5L1JA 5L1KA 4QZEA 3HKZF 2B0CA 5DG8A 1ZD3A 3QEBZ 2QARA 4NV0A 4GC6A 1ZYQA 2H3QA 5AM3A 2QLTA 4F4ZA 4QZAA 4KLMA 4B9VA 3AN1A 3RBEA 2HI0A 4NLZA 2DF4B 3F2CA 2CXYA 2YMPA 4CF5A 5AKJA 2IHNA 2CPRA 7ICHA 3RFAA 3ICXA 2H5XA 1X42A 3PO5A 2KV2A 2WF9A 1NK6A 2K4HA 4QWCA 1J2NA 5J8YC 2VA3A 2OEHA 3IN5A 5AI8A 3N7SC 2JGAA 8ICJA 2DGZA 2MU2A 4M9JA 5KG0A 1ZQKA 1KN5A 4ZH4A 4RNOA 3MGHA 3OSPA 1NK9A 4RQ2A 1NI3A 5DGBA 1SWWA 4ED8A 4I2HA 3H8MA 1BNOA 3ED5A 3LK9A 1U9LA 3QU9A 5J2IA 5KTQA 3H4BA 2KZ3A 4QWAA 5KFCA 2Y9UA 1Q8KA 3WK5A 1X9SA 5DLFA 1T8EA 1CEZA 3JPPA 4C4RA 5KFLA 4P2HA 4EYHB 5DBBA 9ICMA 4DLEA 1RG6A 2VKQA 1O03A 3V6KA 4DL2A 2ISPA 3EWAA 2AQ4A 4C80A 3UMCA 1JIHA 2EAOA 2JR5A 3HJEA 2YMLA 2AU0A 3RR7A 1K1SA 2WFAA 2KFNA 2IA6A 4CF4A 5L1MA 4GXJA 4AYBF 4YR2A 3QU7A 3RB3A 2OHFA 1RZTA 3WK9A 1X9WA 5L1LA 4M6WA 3UM9A 3R9KA 4DWIA 4O3RA 3UMGA 1XS9D 4RU9A 5K4LA 3MR5A 2ZUCA 1TV9A 2KJ5A 4GXIA 2RDJA 4F8RA 4ED0A 1JX4A 3NGDA 2G06A 3PW0A 1Q46A 3K1RB 2F44A 3Q8QB 3G6YA 1UQVA 3G6XA 8ICWA 2W8KA 3RB4A 1S9FA 3IM1A 5ALJA 4KN7A 3ETLA 4PHPA 2DQNB 4ACOA 3TANA 5KFQA 4P0PA 2YB4A 4RPYA 4F50A 5ALMA 2XO7A 3ZDBA 2HHUA 2Q4TA 3H0LB 4ECVA 4UB1A 5KG3A 2W9CA 1N62A 2BPCA 4QZGA 4YG2A 4DOAA 4NWIA 5KFAA 4BXOB 4UW9A 2DKZA 4QIWC 4F71A 1ZQPA 1N63A 1COKA 4RQ8A 3KZIU 1MSWD 2LYHA 3H8SA 1ZRNA 1BPBA 4F5RA 4NL9C 2FMSA 4FBTA 1JI7A 4Z6CA 4TQRA 3N7RC 5AM0A 4EEYA 1RXWA 1FIQA 2EAMA 5L1IA 4B6JA 1NK7A 1ZD4A 3KFUF 2KG5A 4BX9C 5IIOA 5ALUA 1MC8A 4DFDA 5KFJA 2E1FA 1ZQXA 2DL0A 4EYIB 5J2HA 2V4RA 3AQFA 1BPZA 4EBEA 2ZG6A 4DQQA 2E8MA 2YN4A 4QZ9A 1N48A 3PY8A 2KZMA 3DEEA 2XI9A 3OHAA 1B22A 4K4HA 2HHQA 5ALLA 3RH5A 5AI4A 4FZMA 4Q43A 1NKCA 2ISOA 9ICWA 4DQRA 1NJXA 3PVXA 3F5EA 1RQNA 1XSLA 2ZTEA 1ZQJA 4YVZA 5IIJA 4F4WA 2J6TA 1NK8A 8ICMA 2ZTDA 2NV3A 3M9NB 5J2GA 3IP4B 2PMZF 4YR3A 1HJPA 2EZXA 5F3XB 5KFPA 3KHLA 1XSNA 2P66A 2KIVA 2PKEA 2DPIA 5ALHA 1ED1A 2VA2A 1NJYA 5IINA 2JV3A 2RDIA 2JEJA 5KG7A 1WCNA 2YY6A 3SAGA 3GV8B 3H8JA 5TZVA 4I28A 1U47A 3M9MB 4Q45A 3RJEA 8ICSA 5AK4A 3C2KA 3ZDAA 3NS1A 4RQ5A 2UVUA 3PZPA 5CRXA 5J2EA 4NLGA 4F2SA 4X5VA 1OUQA 3LYSA 4PZOA 4PL2A 1DRGA 5HR6A 2HW3A 4C4TA 4XRHA 1K1QA 2I9GA 4KX3A 4NLNA 4KLOA 4FZLA 5J0XA 7ICQA 4JV0A 3LWLA 2H3VA 1CI4A 3ZD8A 2W9AA 3U26A 4OJOA 4YP3A 2V4QA 3QUCA 3HW8A 1URJA 2R8KA 3JPNA 3C2MA 1U48A 2EZYA 3ETRA 1SL0A 4DQSA 1U49A 4KMUA 2G07A
chains in the Genus database with same CATH topology
4PPXA 5J2BA 4EBDA 2BPGA 4J9RA 1NJZA 4RNMA 2DFLA 4BGDA 4UB4A 1ZQLA 4KLHA 5DGAA 4ED7A 2BQUA 5CWRA 3EZ5A 3TI0A 2BQ3A 2KTQA 3V6JA 4O9MA 5BPCA 5DQGA 2IBKA 1AROP 4B9UA 5J2CA 4PGXA 2I1QA 4F4YA 4ECWA 1ZQEA 4IR1A 8ICXA 2FMQA 4DF8A 4R8UB 5IILA 2NRZA 4DEZA 4O3OA 4R64A 2BCVA 2W8LA 2P6UA 1QTMA 9ICEA 3MR6A 1ZETA 5KT7A 3MR3A 5J2AA 1ZQYA 3N4MB 1S10A 4DQIA 4RPXA 2UVWA 2XC9A 4QW8A 1X2IA 3Q8KA 8ICBA 2JZBA 4YR0A 1QSLA 2FPLA 2WTFA 2F1HA 1ZQHA 9ICXA 9ICBA 1TAUA 1PZNA 9ICVA 2BCRA 4F2RA 2PFQA 5KFYA 3T5JA 3B0YA 4YXJA 4J9LA 4DF4A 2BDPA 1XU4A 1ZQCA 4DL3A 1SKRA 1XWLA 4JWNA 4RUCA 1SZPA 3SV4A 5KFBA 1ZQAA 4KLEA 4I2GA 3KHRA 1B43A 5KFMA 1U4BA 4GC7A 2BGWA 4UQGA 4DS4A 4QW9A 3UPQA 9ICTA 3V7JA 1HUZA 1ZQSA 4JK1A 5KG6A 4P4PA 4B9SA 4F4KA 4C8OA 8ICZA 4QWDA 7ICEA 2C2EA 3AUOA 3JPTA 5KFHA 4DFPA 2Y1IA 9ICAA 5J0OA 4FO6A 4KLUA 4CCHA 4I29A 1TAQA 3QZ7A 2AGQA 2KZZA 4M6WB 2XY5A 1ZQNA 5IIIA 3OSNA 2MAXA 3MFIA 3GV5B 2ALZA 1TKDA 3RRGA 2M9NA 4ED1A 4YD2A 1S0OA 2PFNA 4KLJA 3SI8A 4BWJA 5D4BA 4B9MA 2C22A 4DSKA 3T5LA 3H4DA 1D8YA 9ICPA 2W9MA 2ASJA 2FPMA 4J9QA 1NOMA 1NK5A 4DFMA 2FPKA 4PHDA 3MABA 2J6UA 9ICQA 1JXEA 4C8NA 1TVAA 2Y1JA 5KT4A 1T3NA 3RAXA 2BKEA 2DPJA 3IHQB 3JPQA 1MQ3A 8ICOA 5DG9A 3RBDA 4DSFA 5L1JA 5L1KA 4QZEA 5CHGA 1ZQFA 4O0IA 1X9MA 4UBBA 4ECZA 5DG8A 2XGPA 3T5KA 5DB8A 2FMPA 5KFUA 3TARA 8ICTA 3QEBZ 5J2FA 2BHNA 4GC6A 1ZYQA 2IMWP 5CP2A 1KFDA 4RQ1A 4IQVA 4F4ZA 2HHWA 9ICJA 4QZAA 4TURA 1HUOA 4B9VA 4KLMA 3RBEA 1SL2A 1Z00A 4NLZA 9ICGA 5J0UA 1SL1A 1ZQGA 8ICRA 2XY7A 8ICKA 1BPXA 7ICKA 8ICPA 4I2DA 5KFWA 2IHNA 5DBCA 4F93B 5DLGA 2KN7A 1ZQZA 7ICHA 1IM4A 2H5XA 1NK4A 3PO5A 1NK6A 1KEJA 5HHIA 3PMLA 4Q44A 3UXOA 4QWCA 4DLGA 4KLDA 3M8RA 7ICSA 2JEFA 1D9DA 4J9SA 9ICLA 2VA3A 2J6SA 4KN4A 5IIMA 3TAQA 3EYZA 8ICJA 3C1ZA 3RJFA 3AU2A 3Q8SB 4M9JA 3KHHA 4MF8A 3RH4A 1N56A 4M9LA 1LV5A 5KG0A 4J9OA 1ZQKA 8ICQA 3SZ2A 4ZH4A 2ASLA 4K4IA 7ICIA 4ELTA 1RXVA 7ICTA 4RNOA 4YFKA 5J0PA 1S0MA 4ELUA 4MFFA 4KLTA 9ICFA 3MGHA 3OSPA 1NK9A 4RQ2A 4R66A 5DGBA 2HVHA 4ED8A 4I2HA 4I2AA 3T5HA 2XCPA 4UAZA 4ECTA 4F5NA 2IHMA 3LK9A 1U9LA 5CB1A 4DQPA 3PX6A 5J2IA 1KLNA 4KLFA 4KLLA 5KTQA 3H4BA 2KZ3A 5KFIA 5DB9A 5J2KA 4QWAA 5KFCA 4BXOA 4JWMA 4F3OA 3KHGA 2PI4A 1KTQA 2HHTA 8ICVA 4JUZA 4I27A 1S0VA 5KFXA 2OWOA 4RUAA 4B9NA 3PMNA 2BQRA 4MF2A 2MUTA 5L9XA 1X9SA 5DLFA 1SKSA 1T8EA 5KT6A 3BJYA 1CEZA 9ICSA 4KLIA 5J0YA 5KFFA 3JPPA 4ED3A 1T4GA 4NXZA 5KFLA 3OJSA 4EYHB 4P2HA 5DBBA 4QWBA 9ICMA 3MGIA 4DLEA 7ICLA 4I2CA 1BPDA 5J0TA 4Z6EA 3OJUA 3V6KA 4IQUA 4YXMA 4DL2A 3C23A 4M47A 8ICIA 4M0AA 1ZQOA 2ISPA 3EWAA 4RQ7A 2AQ4A 1ZQVA 1RYRA 1CUKA 2HHXA 3PV8A 3UQ2A 1JIHA 5DQIA 4TQSA 1KFSA 4RPZA 1KRPA 3PR4A 9ICRA 4GXKA 1JN3A 2AU0A 4J9MA 3RR7A 4PH5A 1K1SA 3JPSA 3V7KA 3UQ0A 3Q8PB 2F1IA 4JV1A 2KFNA 3JPRA 2IA6A 2UVRA 2ZJAA 4GXJA 7ICMA 4J9NA 4DFKA 3SV3A 1ZQIA 2KFZA 2XY6A 3EW9A 2A1JB 4YR2A 3HP6A 3M9OB 1ZQBA 4ED6A 3RB3A 5J2JA 4M9GA 1KFTA 4DSLA 1RZTA 3Q8RB 5J0SA 4FS2A 4ECUA 1QSSA 1X9WA 4R65A 5L1LA 4M6WA 4I2BA 1XC9A 4DWIA 1JMSA 1IXRA 4E0DA 1NKBA 4O3RA 1L3VA 3Q8LA 5KFKA 3PO4A 1XS9D 4RU9A 4ECSA 3ZDDA 3MR5A 2ZUCA 1TV9A 4GXIA 1JXLA 2RDJA 4YQWA 4F8RA 4ED0A 1JX4A 4MEXA 3NGDA 3PW0A 2W9CB 4K4GA 1DGSA 3Q8QB 5BOLA 3OGUA 3G6YA 4I2IA 2ATLA 5J0WA 3G6XA 4DSJA 9ICUA 8ICWA 2W8KA 5J0RA 4LZGA 5CA7A 3Q8MA 3RB4A 5DDYA 4DO9A 1S9FA 7ICRA 3IM1A 3PW7A 3GQCA 4I2JA 4KN7A 3ETLA 4PHPA 5IIKA 7ICGA 4KITB 5KG5A 1ZQRA 4DL6A 8ICGA 3TANA 2HHVA 5KFQA 3HPOA 3QE9Y 4IRDA 1ZQMA 4Q8EA 7ICFA 2JEGA 8ICNA 4RPYA 2AJQA 4F50A 1ZQTA 2XO7A 3ZDBA 5D49A 4ECYA 3RJGA 1T7PA 4XUSA 5DBAA 2HHUA 4YMOA 5BOMA 4ECVA 4UB1A 4YD1A 5KG3A 2W9CA 5EWEA 5DKWA 2PI5A 1ZQUA 3H8WA 5HMLA 4G3IA 3PW4A 1TK8A 2PFOA 1UT8A 1XO1A 3C2LA 2FLPA 2BPCA 4I2EA 4QZGA 4YG2A 4O5CA 4DOAA 1D9FA 5KFAA 1Z00B 4DSEA 3RJKA 4BXOB 5J29A 4O3SA 4R63A 2HVIA 5KFSA 4FBUA 4R8UA 2ASDA 4BWMA 3TFRA 1ZQPA 4M2YA 3KTQA 7ICUA 3RJIA 4HYKA 4RQ8A 4DSIA 1DOQA 7ICJA 4UB3A 5JUMA 5EWGA 4Z6DA 4DFJA 2LYHA 3H8SA 4YN4A 4M04A 4NM1A 1BPBA 1MSWD 4F5RA 3MDAA 4I2FA 3C5FA 2A1JA 3GIMA 2FMSA 4FBTA 9ICNA 4Z6CA 4TQRA 4EZ6A 3BQ0A 4EEYA 5KG2A 4EBCA 4B9LA 4MEYA 3PNCA 3MDCA 4O5EA 3C5GA 4EZ9A 3E2EA 5DG7A 4QZDA 4RT3A 1L3TA 1RXWA 3ISDA 4ECQA 9ICOA 5DB6A 3BQ1A 3N97B 3BQTA 5L1IA 1Z3EB 2NRXA 3K4GA 4C8MA 4RQ4A 2AGPA 1NK7A 2R8GA 4KLQA 4QWEA 4J9KA 3GIIA 4ED2A 4MFCA 4TUQA 4KLSA 1SKWA 4IR9A 4DL7A 4KTQA 5KT5A 2C2DA 1ZQQA 3V6HA 1TFRA 2NRVA 5IIOA 5KT3A 2C28A 4DL5A 1MC8A 5KFJA 1MQ2A 1ZQXA 3ORYA 1S97A 1ZQWA 2R8IA 4EYIB 5J2HA 4DOCA 2V4RA 1BPZA 2XCAA 4EBEA 1D8LA 4QZ8A 2ZTCA 4O3NA 4IRCA 2Q0ZX 5HHHA 5F9LA 4DQQA 8ICLA 2XGQA 4M9HA 3OHBA 4QZ9A 2MUTB 3AU6A 1N48A 3QEAZ 3PY8A 1L3SA 5CJ7A 2JZBB 4PGQA 4Q8FA 2KZMA 7ICNA 3RJHA 4O3QA 3HT3A 3RAQA 5DDMA 9ICKA 3OHAA 1XSPA 1TK0A 1S0NA 4K4HA 1B22A 2HHQA 7ICVA 4RNNA 2FLLA 4C8LA 4F5OA 5CR0A 3RH5A 4IQWA 5HP4A 5KFVA 4PHEA 5KFDA 4NY8A 8ICAA 4Q43A 1NKCA 4P4MA 2ISOA 5KFEA 4YMMA 5J2DA 3T3FA 4DQRA 9ICWA 1NJXA 4UAYA 4UB2A 4RZRA 3PVXA 8ICFA 1H38A 1XSLA 4ECRA 3RR8A 2ZTEA 1ZQJA 4YVZA 5IIJA 5EOZA 3TQ1A 1ZJMA 4JV2A 4F4WA 1L3UA 8ICCA 2J6TA 2VANA 1NK8A 2P6RA 3FYHA 3PW5A 8ICMA 2ZTDA 2B21A 4QZIA 2NRWA 3M9NB 4UAWA 2ZJ5A 1UA1A 4O5KA 3V72A 4RQ0A 1TK5A 4LZDA 5J2GA 4QZFA 4F5QA 3PW2A 4UBCA 4LVSA 4ELVA 9ICCA 1A77A 1RYSA 1V9PA 5F9NA 2BCSA 5HNKA 3C21A 4P4OA 1EXNA 1RPLA 5KG1A 2UVVA 3RTVA 1COOA 1HJPA 4YR3A 4F91B 3G6VA 1BPEA 1NJWA 5KFPA 2W9BA 3KHLA 1XSNA 1S76D 4ECXA 2P66A 4RQ3A 4B9TA 3TAPA 3TFSA 3FDSA 3SYZA 3BDPA 1LB2B 2DPIA 3NTUA 5C5JA 4PGYA 5J0QA 3MBYA 3ZD9A 3K75D 2VA2A 4RQ6A 1NJYA 1BPYA 2W9BB 3PR5B 3RRHA 4KLGA 2JEIA 4QZHA 3LDAA 3GIKA 1ZJNA 4XQ8A 8ICHA 4C8KA 3PX0A 5KFZA 5IINA 2RDIA 3MFHA 5KFTA 2JEJA 8ICEA 5KG7A 3BQ2A 4F5PA 5KFGA 4DL4A 1WCNA 8ICYA 3ISBA 2ZUDA 3RB6A 3GV8B 3PX4A 3H8JA 3V7LA 3ISCA 1NK0A 3EPGA 3ZDEA 5TZVA 2BCUA 2NRTA 4IRKA 3GFKB 3MR2A 2R8JA 4Z6FA 4I28A 2BPFA 4RT2A 1QLNA 4IQTA 3HWTA 1U47A 4YCXA 3M9MB 4Q45A 3RJEA 8ICSA 4YMNA 3LWMA 3C2KA 3RH6A 3ZDAA 3M8SA 4F92B 3B0XA 9ICIA 4RQ5A 4M9NA 3EPIA 2UVUA 3ZDCA 5KG4A 1BGXT 2GWSA 2VA8A 2R8HA 1KSPA 5J2EA 1U45A 4TUSA 3UXPA 4UB5A 2PFPA 4QZBA 4NLGA 4F2SA 5KFRA 4X5VA 5DQHA 4NLKA 3GILA 4O3PA 4J9PA 2HW3A 7ICOA 4XRHA 3C1YA 4XA5A 4MFAA 1K1QA 3JPOA 2C2RA 2AGOA 7ICPA 4TUPA 2I9GA 4F4XA 4NLNA 5KT2A 1QSYA 4KLOA 4FS1A 2HHSA 2AQ0A 5KFOA 9ICHA 3UXNA 1S77D 2F1JA 5EWFA 3H40A 2ZUBA 5J0XA 7ICQA 3RJJA 4DOBA 4JV0A 3LWLA 3GV7B 1BVSA 3GDXA 4DS5A 3ZD8A 2W9AA 1UT5A 2PXIA 8ICUA 5DB7A 4GLXA 2BCQA 4YP3A 1A76A 4NM2A 2V4QA 3H7IA 2ZJ8A 3HW8A 3GIJA 5HMMA 1KDHA 1NKEA 2BR0A 1Y88A 1L5UA 1C7YA 2V9WA 1ZQDA 4BDPA 2R8KA 4QZCA 3JPNA 3C2MA 1U48A 3RB0A 4PHAA 3THVA 1WCLA 1UA0A 1SL0A 5KFNA 4DQSA 4KMUA 1U49A 5D46A 3QZ8A 3HX0A 2FLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPX A;  5J2B A;  4EBD A;  2BPG A;  4J9R A;  1NJZ A;  4RNM A;  2DFL A;  4BGD A;  4UB4 A;  1ZQL A;  4KLH A;  5DGA A;  4ED7 A;  2BQU A;  5CWR A;  3EZ5 A;  3TI0 A;  2BQ3 A;  2KTQ A;  3V6J A;  4O9M A;  5BPC A;  5DQG A;  2IBK A;  1ARO P;  4B9U A;  5J2C A;  4PGX A;  2I1Q A;  4F4Y A;  4ECW A;  1ZQE A;  4IR1 A;  8ICX A;  2FMQ A;  4DF8 A;  4R8U B;  5IIL A;  2NRZ A;  4DEZ A;  4O3O A;  4R64 A;  2BCV A;  2W8L A;  2P6U A;  1QTM A;  9ICE A;  3MR6 A;  1ZET A;  5KT7 A;  3MR3 A;  5J2A A;  1ZQY A;  3N4M B;  1S10 A;  4DQI A;  4RPX A;  2UVW A;  2XC9 A;  4QW8 A;  1X2I A;  3Q8K A;  8ICB A;  2JZB A;  4YR0 A;  1QSL A;  2FPL A;  2WTF A;  2F1H A;  1ZQH A;  9ICX A;  9ICB A;  1TAU A;  1PZN A;  9ICV A;  2BCR A;  4F2R A;  2PFQ A;  5KFY A;  3T5J A;  3B0Y A;  4YXJ A;  4J9L A;  4DF4 A;  2BDP A;  1XU4 A;  1ZQC A;  4DL3 A;  1SKR A;  1XWL A;  4JWN A;  4RUC A;  1SZP A;  3SV4 A;  5KFB A;  1ZQA A;  4KLE A;  4I2G A;  3KHR A;  1B43 A;  5KFM A;  1U4B A;  4GC7 A;  2BGW A;  4UQG A;  4DS4 A;  4QW9 A;  3UPQ A;  9ICT A;  3V7J A;  1HUZ A;  1ZQS A;  4JK1 A;  5KG6 A;  4P4P A;  4B9S A;  4F4K A;  4C8O A;  8ICZ A;  4QWD A;  7ICE A;  2C2E A;  3AUO A;  3JPT A;  5KFH A;  4DFP A;  2Y1I A;  9ICA A;  5J0O A;  4FO6 A;  4KLU A;  4CCH A;  4I29 A;  1TAQ A;  3QZ7 A;  2AGQ A;  2KZZ A;  4M6W B;  2XY5 A;  1ZQN A;  5III A;  3OSN A;  2MAX A;  3MFI A;  3GV5 B;  2ALZ A;  1TKD A;  3RRG A;  2M9N A;  4ED1 A;  4YD2 A;  1S0O A;  2PFN A;  4KLJ A;  3SI8 A;  4BWJ A;  5D4B A;  4B9M A;  2C22 A;  4DSK A;  3T5L A;  3H4D A;  1D8Y A;  9ICP A;  2W9M A;  2ASJ A;  2FPM A;  4J9Q A;  1NOM A;  1NK5 A;  4DFM A;  2FPK A;  4PHD A;  3MAB A;  2J6U A;  9ICQ A;  1JXE A;  4C8N A;  1TVA A;  2Y1J A;  5KT4 A;  1T3N A;  3RAX A;  2BKE A;  2DPJ A;  3IHQ B;  3JPQ A;  1MQ3 A;  8ICO A;  5DG9 A;  3RBD A;  4DSF A;  5L1J A;  5L1K A;  4QZE A;  5CHG A;  1ZQF A;  4O0I A;  1X9M A;  4UBB A;  4ECZ A;  5DG8 A;  2XGP A;  3T5K A;  5DB8 A;  2FMP A;  5KFU A;  3TAR A;  8ICT A;  3QEB Z;  5J2F A;  2BHN A;  4GC6 A;  1ZYQ A;  2IMW P;  5CP2 A;  1KFD A;  4RQ1 A;  4IQV A;  4F4Z A;  2HHW A;  9ICJ A;  4QZA A;  4TUR A;  1HUO A;  4B9V A;  4KLM A;  3RBE A;  1SL2 A;  1Z00 A;  4NLZ A;  9ICG A;  5J0U A;  1SL1 A;  1ZQG A;  8ICR A;  2XY7 A;  8ICK A;  1BPX A;  7ICK A;  8ICP A;  4I2D A;  5KFW A;  2IHN A;  5DBC A;  4F93 B;  5DLG A;  2KN7 A;  1ZQZ A;  7ICH A;  1IM4 A;  2H5X A;  1NK4 A;  3PO5 A;  1NK6 A;  1KEJ A;  5HHI A;  3PML A;  4Q44 A;  3UXO A;  4QWC A;  4DLG A;  4KLD A;  3M8R A;  7ICS A;  2JEF A;  1D9D A;  4J9S A;  9ICL A;  2VA3 A;  2J6S A;  4KN4 A;  5IIM A;  3TAQ A;  3EYZ A;  8ICJ A;  3C1Z A;  3RJF A;  3AU2 A;  3Q8S B;  4M9J A;  3KHH A;  4MF8 A;  3RH4 A;  1N56 A;  4M9L A;  1LV5 A;  5KG0 A;  4J9O A;  1ZQK A;  8ICQ A;  3SZ2 A;  4ZH4 A;  2ASL A;  4K4I A;  7ICI A;  4ELT A;  1RXV A;  7ICT A;  4RNO A;  4YFK A;  5J0P A;  1S0M A;  4ELU A;  4MFF A;  4KLT A;  9ICF A;  3MGH A;  3OSP A;  1NK9 A;  4RQ2 A;  4R66 A;  5DGB A;  2HVH A;  4ED8 A;  4I2H A;  4I2A A;  3T5H A;  2XCP A;  4UAZ A;  4ECT A;  4F5N A;  2IHM A;  3LK9 A;  1U9L A;  5CB1 A;  4DQP A;  3PX6 A;  5J2I A;  1KLN A;  4KLF A;  4KLL A;  5KTQ A;  3H4B A;  2KZ3 A;  5KFI A;  5DB9 A;  5J2K A;  4QWA A;  5KFC A;  4BXO A;  4JWM A;  4F3O A;  3KHG A;  2PI4 A;  1KTQ A;  2HHT A;  8ICV A;  4JUZ A;  4I27 A;  1S0V A;  5KFX A;  2OWO A;  4RUA A;  4B9N A;  3PMN A;  2BQR A;  4MF2 A;  2MUT A;  5L9X A;  1X9S A;  5DLF A;  1SKS A;  1T8E A;  5KT6 A;  3BJY A;  1CEZ A;  9ICS A;  4KLI A;  5J0Y A;  5KFF A;  3JPP A;  4ED3 A;  1T4G A;  4NXZ A;  5KFL A;  3OJS A;  4EYH B;  4P2H A;  5DBB A;  4QWB A;  9ICM A;  3MGI A;  4DLE A;  7ICL A;  4I2C A;  1BPD A;  5J0T A;  4Z6E A;  3OJU A;  3V6K A;  4IQU A;  4YXM A;  4DL2 A;  3C23 A;  4M47 A;  8ICI A;  4M0A A;  1ZQO A;  2ISP A;  3EWA A;  4RQ7 A;  2AQ4 A;  1ZQV A;  1RYR A;  1CUK A;  2HHX A;  3PV8 A;  3UQ2 A;  1JIH A;  5DQI A;  4TQS A;  1KFS A;  4RPZ A;  1KRP A;  3PR4 A;  9ICR A;  4GXK A;  1JN3 A;  2AU0 A;  4J9M A;  3RR7 A;  4PH5 A;  1K1S A;  3JPS A;  3V7K A;  3UQ0 A;  3Q8P B;  2F1I A;  4JV1 A;  2KFN A;  3JPR A;  2IA6 A;  2UVR A;  2ZJA A;  4GXJ A;  7ICM A;  4J9N A;  4DFK A;  3SV3 A;  1ZQI A;  2KFZ A;  2XY6 A;  3EW9 A;  2A1J B;  4YR2 A;  3HP6 A;  3M9O B;  1ZQB A;  4ED6 A;  3RB3 A;  5J2J A;  4M9G A;  1KFT A;  4DSL A;  1RZT A;  3Q8R B;  5J0S A;  4FS2 A;  4ECU A;  1QSS A;  1X9W A;  4R65 A;  5L1L A;  4M6W A;  4I2B A;  1XC9 A;  4DWI A;  1JMS A;  1IXR A;  4E0D A;  1NKB A;  4O3R A;  1L3V A;  3Q8L A;  5KFK A;  3PO4 A;  1XS9 D;  4RU9 A;  4ECS A;  3ZDD A;  3MR5 A;  2ZUC A;  1TV9 A;  4GXI A;  1JXL A;  2RDJ A;  4YQW A;  4F8R A;  4ED0 A;  1JX4 A;  4MEX A;  3NGD A;  3PW0 A;  2W9C B;  4K4G A;  1DGS A;  3Q8Q B;  5BOL A;  3OGU A;  3G6Y A;  4I2I A;  2ATL A;  5J0W A;  3G6X A;  4DSJ A;  9ICU A;  8ICW A;  2W8K A;  5J0R A;  4LZG A;  5CA7 A;  3Q8M A;  3RB4 A;  5DDY A;  4DO9 A;  1S9F A;  7ICR A;  3IM1 A;  3PW7 A;  3GQC A;  4I2J A;  4KN7 A;  3ETL A;  4PHP A;  5IIK A;  7ICG A;  4KIT B;  5KG5 A;  1ZQR A;  4DL6 A;  8ICG A;  3TAN A;  2HHV A;  5KFQ A;  3HPO A;  3QE9 Y;  4IRD A;  1ZQM A;  4Q8E A;  7ICF A;  2JEG A;  8ICN A;  4RPY A;  2AJQ A;  4F50 A;  1ZQT A;  2XO7 A;  3ZDB A;  5D49 A;  4ECY A;  3RJG A;  1T7P A;  4XUS A;  5DBA A;  2HHU A;  4YMO A;  5BOM A;  4ECV A;  4UB1 A;  4YD1 A;  5KG3 A;  2W9C A;  5EWE A;  5DKW A;  2PI5 A;  1ZQU A;  3H8W A;  5HML A;  4G3I A;  3PW4 A;  1TK8 A;  2PFO A;  1UT8 A;  1XO1 A;  3C2L A;  2FLP A;  2BPC A;  4I2E A;  4QZG A;  4YG2 A;  4O5C A;  4DOA A;  1D9F A;  5KFA A;  1Z00 B;  4DSE A;  3RJK A;  4BXO B;  5J29 A;  4O3S A;  4R63 A;  2HVI A;  5KFS A;  4FBU A;  4R8U A;  2ASD A;  4BWM A;  3TFR A;  1ZQP A;  4M2Y A;  3KTQ A;  7ICU A;  3RJI A;  4HYK A;  4RQ8 A;  4DSI A;  1DOQ A;  7ICJ A;  4UB3 A;  5JUM A;  5EWG A;  4Z6D A;  4DFJ A;  2LYH A;  3H8S A;  4YN4 A;  4M04 A;  4NM1 A;  1BPB A;  1MSW D;  4F5R A;  3MDA A;  4I2F A;  3C5F A;  2A1J A;  3GIM A;  2FMS A;  4FBT A;  9ICN A;  4Z6C A;  4TQR A;  4EZ6 A;  3BQ0 A;  4EEY A;  5KG2 A;  4EBC A;  4B9L A;  4MEY A;  3PNC A;  3MDC A;  4O5E A;  3C5G A;  4EZ9 A;  3E2E A;  5DG7 A;  4QZD A;  4RT3 A;  1L3T A;  1RXW A;  3ISD A;  4ECQ A;  9ICO A;  5DB6 A;  3BQ1 A;  3N97 B;  3BQT A;  5L1I A;  1Z3E B;  2NRX A;  3K4G A;  4C8M A;  4RQ4 A;  2AGP A;  1NK7 A;  2R8G A;  4KLQ A;  4QWE A;  4J9K A;  3GII A;  4ED2 A;  4MFC A;  4TUQ A;  4KLS A;  1SKW A;  4IR9 A;  4DL7 A;  4KTQ A;  5KT5 A;  2C2D A;  1ZQQ A;  3V6H A;  1TFR A;  2NRV A;  5IIO A;  5KT3 A;  2C28 A;  4DL5 A;  1MC8 A;  5KFJ A;  1MQ2 A;  1ZQX A;  3ORY A;  1S97 A;  1ZQW A;  2R8I A;  4EYI B;  5J2H A;  4DOC A;  2V4R A;  1BPZ A;  2XCA A;  4EBE A;  1D8L A;  4QZ8 A;  2ZTC A;  4O3N A;  4IRC A;  2Q0Z X;  5HHH A;  5F9L A;  4DQQ A;  8ICL A;  2XGQ A;  4M9H A;  3OHB A;  4QZ9 A;  2MUT B;  3AU6 A;  1N48 A;  3QEA Z;  3PY8 A;  1L3S A;  5CJ7 A;  2JZB B;  4PGQ A;  4Q8F A;  2KZM A;  7ICN A;  3RJH A;  4O3Q A;  3HT3 A;  3RAQ A;  5DDM A;  9ICK A;  3OHA A;  1XSP A;  1TK0 A;  1S0N A;  4K4H A;  1B22 A;  2HHQ A;  7ICV A;  4RNN A;  2FLL A;  4C8L A;  4F5O A;  5CR0 A;  3RH5 A;  4IQW A;  5HP4 A;  5KFV A;  4PHE A;  5KFD A;  4NY8 A;  8ICA A;  4Q43 A;  1NKC A;  4P4M A;  2ISO A;  5KFE A;  4YMM A;  5J2D A;  3T3F A;  4DQR A;  9ICW A;  1NJX A;  4UAY A;  4UB2 A;  4RZR A;  3PVX A;  8ICF A;  1H38 A;  1XSL A;  4ECR A;  3RR8 A;  2ZTE A;  1ZQJ A;  4YVZ A;  5IIJ A;  5EOZ A;  3TQ1 A;  1ZJM A;  4JV2 A;  4F4W A;  1L3U A;  8ICC A;  2J6T A;  2VAN A;  1NK8 A;  2P6R A;  3FYH A;  3PW5 A;  8ICM A;  2ZTD A;  2B21 A;  4QZI A;  2NRW A;  3M9N B;  4UAW A;  2ZJ5 A;  1UA1 A;  4O5K A;  3V72 A;  4RQ0 A;  1TK5 A;  4LZD A;  5J2G A;  4QZF A;  4F5Q A;  3PW2 A;  4UBC A;  4LVS A;  4ELV A;  9ICC A;  1A77 A;  1RYS A;  1V9P A;  5F9N A;  2BCS A;  5HNK A;  3C21 A;  4P4O A;  1EXN A;  1RPL A;  5KG1 A;  2UVV A;  3RTV A;  1COO A;  1HJP A;  4YR3 A;  4F91 B;  3G6V A;  1BPE A;  1NJW A;  5KFP A;  2W9B A;  3KHL A;  1XSN A;  1S76 D;  4ECX A;  2P66 A;  4RQ3 A;  4B9T A;  3TAP A;  3TFS A;  3FDS A;  3SYZ A;  3BDP A;  1LB2 B;  2DPI A;  3NTU A;  5C5J A;  4PGY A;  5J0Q A;  3MBY A;  3ZD9 A;  3K75 D;  2VA2 A;  4RQ6 A;  1NJY A;  1BPY A;  2W9B B;  3PR5 B;  3RRH A;  4KLG A;  2JEI A;  4QZH A;  3LDA A;  3GIK A;  1ZJN A;  4XQ8 A;  8ICH A;  4C8K A;  3PX0 A;  5KFZ A;  5IIN A;  2RDI A;  3MFH A;  5KFT A;  2JEJ A;  8ICE A;  5KG7 A;  3BQ2 A;  4F5P A;  5KFG A;  4DL4 A;  1WCN A;  8ICY A;  3ISB A;  2ZUD A;  3RB6 A;  3GV8 B;  3PX4 A;  3H8J A;  3V7L A;  3ISC A;  1NK0 A;  3EPG A;  3ZDE A;  5TZV A;  2BCU A;  2NRT A;  4IRK A;  3GFK B;  3MR2 A;  2R8J A;  4Z6F A;  4I28 A;  2BPF A;  4RT2 A;  1QLN A;  4IQT A;  3HWT A;  1U47 A;  4YCX A;  3M9M B;  4Q45 A;  3RJE A;  8ICS A;  4YMN A;  3LWM A;  3C2K A;  3RH6 A;  3ZDA A;  3M8S A;  4F92 B;  3B0X A;  9ICI A;  4RQ5 A;  4M9N A;  3EPI A;  2UVU A;  3ZDC A;  5KG4 A;  1BGX T;  2GWS A;  2VA8 A;  2R8H A;  1KSP A;  5J2E A;  1U45 A;  4TUS A;  3UXP A;  4UB5 A;  2PFP A;  4QZB A;  4NLG A;  4F2S A;  5KFR A;  4X5V A;  5DQH A;  4NLK A;  3GIL A;  4O3P A;  4J9P A;  2HW3 A;  7ICO A;  4XRH A;  3C1Y A;  4XA5 A;  4MFA A;  1K1Q A;  3JPO A;  2C2R A;  2AGO A;  7ICP A;  4TUP A;  2I9G A;  4F4X A;  4NLN A;  5KT2 A;  1QSY A;  4KLO A;  4FS1 A;  2HHS A;  2AQ0 A;  5KFO A;  9ICH A;  3UXN A;  1S77 D;  2F1J A;  5EWF A;  3H40 A;  2ZUB A;  5J0X A;  7ICQ A;  3RJJ A;  4DOB A;  4JV0 A;  3LWL A;  3GV7 B;  1BVS A;  3GDX A;  4DS5 A;  3ZD8 A;  2W9A A;  1UT5 A;  2PXI A;  8ICU A;  5DB7 A;  4GLX A;  2BCQ A;  4YP3 A;  1A76 A;  4NM2 A;  2V4Q A;  3H7I A;  2ZJ8 A;  3HW8 A;  3GIJ A;  5HMM A;  1KDH A;  1NKE A;  2BR0 A;  1Y88 A;  1L5U A;  1C7Y A;  2V9W A;  1ZQD A;  4BDP A;  2R8K A;  4QZC A;  3JPN A;  3C2M A;  1U48 A;  3RB0 A;  4PHA A;  3THV A;  1WCL A;  1UA0 A;  1SL0 A;  5KFN A;  4DQS A;  4KMU A;  1U49 A;  5D46 A;  3QZ8 A;  3HX0 A;  2FLN A; 
#chains in the Genus database with same CATH topology
 4RNM A;  2DFL A;  4BGD A;  1DK3 A;  2BQ3 A;  4O9M A;  5DQG A;  1ARO P;  1ZD2 P;  5ALP A;  4DF8 A;  1YZ6 A;  2G5I B;  2N1R A;  2QKQ A;  3DV9 A;  2UVW A;  2XC9 A;  3IG5 A;  5AKH A;  2WTF A;  2F1H A;  9ICX A;  1RYU A;  3ALR A;  9ICV A;  4F2R A;  4YXJ A;  2GLE A;  1XU4 A;  4JWN A;  4IC9 A;  4RUC A;  5KFB A;  1ZQA A;  4AP9 A;  3GU3 A;  3KKA A;  3WKD A;  4AYB C;  9ICT A;  4JK1 A;  4B9S A;  4C8O A;  2C2E A;  3JPT A;  1V97 A;  3H0R B;  1KKX A;  3SR6 A;  2WF8 A;  4Y2Y A;  3MGV A;  4CCH A;  4Y2S A;  1ZQN A;  2ALZ A;  3MFI A;  3GV5 B;  3RRG A;  1S0O A;  1Z19 A;  5H2F U;  4OJP A;  3SI8 A;  5D4B A;  1JUD A;  2W9M A;  1JAL A;  5EE1 A;  2FPM A;  2K8C B;  4J9Q A;  4DFM A;  1HIW A;  1SV0 C;  3A0B U;  4OJ6 A;  9ICQ A;  1TVA A;  5KT4 A;  3RAX A;  2BKE A;  8ICO A;  3JPQ A;  1MQ3 A;  2GO7 A;  4KMO B;  1C20 A;  5DG9 A;  2F76 X;  5CHG A;  3F53 A;  1ZQF A;  8ICT A;  3NUQ A;  3I28 A;  1AQ6 A;  2BHN A;  3M6K A;  2IMW P;  9ICJ A;  4C4S A;  1UHU A;  9ICG A;  5J0U A;  8ICK A;  8ICP A;  4I2D A;  5KFW A;  2K89 A;  3WU2 U;  2VJ5 A;  7ICS A;  4DLG A;  2QB0 A;  2K8A A;  2ZXH A;  5AKI A;  5ALY A;  2JEF A;  1D9D A;  4J9S A;  1TE2 A;  1X40 A;  3AU2 A;  4J03 A;  8ICQ A;  3WKB A;  2ASL A;  4K4I A;  2HMX A;  3PSI A;  1V38 A;  5T14 A;  1Z1B A;  2ZIV A;  4MFF A;  9ICF A;  3AMZ A;  3T5H A;  2XCP A;  4F5N A;  2IHM A;  3PX6 A;  4KLF A;  4OJL A;  4BXO A;  4JWM A;  4F3O A;  4JUZ A;  4I27 A;  5KFX A;  2EH9 A;  2OWO A;  3B9J A;  4RUA A;  2BQR A;  4NXZ A;  1ZRM A;  1F0M A;  4QWB A;  2LKY A;  5KL8 B;  2F8K A;  3F2D A;  4YXM A;  2AH5 A;  4M47 A;  4M0A A;  4RQ7 A;  5G5G A;  1KL9 A;  3PV8 A;  3UQ2 A;  4TQS A;  1JN3 A;  4IS7 A;  3N7P D;  4PH5 A;  1LKY B;  3V7K A;  3UQ0 A;  2F1I A;  4JV1 A;  3JPR A;  2UVR A;  3SV3 A;  2WAQ F;  2XY6 A;  3O0F A;  5J2J A;  1XO0 A;  1QSS A;  3PSF A;  1M6Y A;  4OO1 J;  1XC9 A;  1N2X A;  2ODG A;  1L3V A;  3ZDD A;  4ECS A;  3QUB A;  1JXL A;  4YQW A;  4UAS A;  5BOL A;  4I2I A;  4DSJ A;  9ICU A;  1XNS A;  1S8O A;  4LZG A;  5CA7 A;  5DDY A;  4DO9 A;  3TAC B;  7ICG A;  4KIT B;  4DL6 A;  3IV6 A;  2W3R A;  2YMQ A;  1ZQM A;  2F8L A;  4BUG A;  2CN1 A;  8ICN A;  2AJQ A;  3EUB 2;  1QQ7 A;  4YD1 A;  5HML A;  3PW4 A;  1TK8 A;  2PFO A;  1BNP A;  1UT8 A;  1Z00 B;  2XIC A;  4DSE A;  4O3S A;  5J29 A;  3WKC A;  4FBU A;  4M2Y A;  3VC8 A;  4HYK A;  2AXT U;  5AM5 A;  1DOQ A;  5JUM A;  4Z6D A;  3C5F A;  2A1J A;  1WG8 A;  3SEI A;  4B9L A;  5AI9 A;  4O5E A;  5ALX A;  3E2E A;  2ESE A;  4QZD A;  4RT3 A;  4ECQ A;  4C7Y A;  3BQ1 A;  2NRX A;  3K4G A;  4C8M A;  2R8G A;  4KLQ A;  7ICI A;  3WK6 A;  2MRL A;  4IR9 A;  4DL7 A;  4KTQ A;  5KT5 A;  3SAF A;  1TFR A;  2NRV A;  3AM9 A;  3SQI A;  1L8O A;  1A6S A;  1S97 A;  2HBM A;  3FC4 A;  2ZTC A;  4IRC A;  5HHH A;  2GOL A;  4MHV A;  4M9H A;  3OHB A;  3QEA Z;  1L3S A;  5CJ7 A;  2JZB B;  3SD7 A;  4F72 A;  3RAQ A;  3QXG A;  1XSP A;  1TK0 A;  4KX5 A;  4RNN A;  4F5O A;  4IQW A;  5HP4 A;  2E8P A;  5KFD A;  3HKZ C;  8ICA A;  3T3F A;  4UAY A;  4UB2 A;  4RZR A;  1ZOL A;  5EOZ A;  3TQ1 A;  3D2S A;  8ICC A;  3QX7 A;  1WWV A;  2VAN A;  2WF5 A;  3FYH A;  4QZI A;  2NRW A;  2ZJ5 A;  1UA1 A;  4QZF A;  1A77 A;  2OH2 A;  2FJ6 A;  2GH1 A;  4P4O A;  4OJ5 A;  3D2N A;  2W9B A;  1Z4O A;  2KMD A;  4B9T A;  4U7C A;  4EEK A;  3SYZ A;  1LB2 B;  4PGY A;  3MBY A;  1BPY A;  3WKA A;  3PR5 B;  2KIW A;  3RRH A;  4KLG A;  2JEI A;  4QZH A;  8ICH A;  4XQ8 A;  2D3D A;  2LMR A;  5AKY A;  4DL4 A;  3ISB A;  2ZUD A;  3V7L A;  2WB1 F;  1NK0 A;  2A3V A;  3EPG A;  3GFK B;  2ZIW B;  4Z6F A;  4RT2 A;  4YCX A;  4FFD A;  2IOF K;  3RH6 A;  3NVV A;  2KHQ A;  2DBY A;  3EPI A;  4Y2J A;  5KG4 A;  1BGX T;  1DK2 A;  1U45 A;  2HBK A;  3UXP A;  4QZB A;  2W43 A;  2Y0S F;  4UAV A;  4ZOH C;  4XA5 A;  7ICP A;  2C2R A;  1L6N A;  3D6J A;  4F4X A;  5KT2 A;  1QSY A;  4EEL A;  3CW2 C;  2ZUB A;  4UAU A;  4DOB A;  5AKZ A;  3WKE A;  1UT5 A;  8ICU A;  5DB7 A;  3KOO A;  1QQ6 A;  3GIJ A;  2BR0 A;  1Y88 A;  1C7Y A;  2V9W A;  2KSO B;  1K5O A;  4QZC A;  3RB0 A;  1WCL A;  3HX0 A;  2G0A A;  1SV4 A;  4PPX A;  4KLH A;  4UB4 A;  2W55 A;  2YX8 A;  5CWR A;  3EZ5 A;  3TI0 A;  2ES6 A;  3V6J A;  2I1Q A;  2OYY A;  1NZP A;  5IIL A;  4O3O A;  4R64 A;  2W8L A;  3LVW A;  1QTM A;  5AKX A;  5ALT A;  1ZQY A;  4JMU A;  4RPX A;  4QW8 A;  4OD0 A;  3Q8K A;  2AHO B;  3HRD D;  1PZN A;  5KFY A;  4DL3 A;  3H0M B;  1SKR A;  1XWL A;  8ICL A;  3SV4 A;  1SZP A;  5KFM A;  1NZB A;  1Q3U A;  4Y2Q A;  3UPQ A;  1PVQ A;  8ICZ A;  4QWD A;  3AUO A;  4DFP A;  2ZXI A;  1KBU A;  3CRX A;  3IDW A;  3SEN A;  9ICA A;  4FO6 A;  4KLU A;  2W04 A;  3TAD A;  4I29 A;  1TAQ A;  2JH7 A;  3J81 j;  2G09 A;  2KZZ A;  2XY5 A;  1B4F A;  1JRP A;  5AKE A;  2XVT A;  3T5L A;  2E5S A;  1N61 A;  2EZZ A;  1CRX A;  4JB3 A;  2QB1 A;  3DDH A;  4PHD A;  3MAB A;  2YTU A;  2VJ4 A;  4G9B A;  4Y2U A;  3SAH A;  1N5W A;  3QYP A;  3IHQ B;  2KD1 A;  3RBD A;  4ECZ A;  3T5K A;  2FMP A;  2IOH A;  5J2F A;  1Z4N A;  4Y2V A;  4RQ1 A;  4IQV A;  4Y2T A;  4TUR A;  1HUO A;  2XY7 A;  5DBC A;  2KJ9 A;  1DXS A;  2BDU A;  1IM4 A;  3F2B A;  1KEJ A;  5HHI A;  4KLD A;  9ICL A;  2J6S A;  3TAQ A;  1SXD A;  5AKK A;  3RJF A;  4MF8 A;  3RH4 A;  4M9L A;  3ZI4 A;  1LV5 A;  4ELT A;  5KNI A;  5AK5 A;  1RXV A;  7ICT A;  4YFK A;  5J0P A;  4ELU A;  2HVH A;  5ALO A;  4I2A A;  4UAZ A;  4ECT A;  3PST A;  3QU2 A;  4DQP A;  5KFI A;  3KHG A;  2PI4 A;  1KTQ A;  2HHT A;  1PK1 B;  4B9N A;  4KLI A;  5J0Y A;  1VJ5 A;  1T4G A;  2OM6 A;  4ED3 A;  2ZIV B;  3A0H U;  1PVR A;  7ICL A;  4I2C A;  2K4P A;  2E8O A;  3S6J A;  4Z6E A;  3OJU A;  4IQU A;  2QB0 B;  1ZD5 A;  2K8B B;  1CUK A;  3WK8 A;  2HHX A;  5ALK A;  2KE7 A;  5JTI A;  5DQI A;  1KFS A;  4RPZ A;  1KRP A;  3PR4 A;  4GXK A;  1RM6 C;  2K60 A;  3AL0 B;  1D8B A;  4CRX A;  2ZJA A;  3NVY A;  2EAP A;  3EW9 A;  4M9G A;  4ED6 A;  3Q8R B;  4R65 A;  5KAI U;  4I2B A;  1IXR A;  4E0D A;  1OW5 A;  5KFK A;  1VDV A;  3PO4 A;  2FI1 A;  2WF7 A;  5KL1 B;  1LKY A;  2WHE A;  4MEX A;  1PK1 A;  2G5H B;  3OGU A;  2ATL A;  2EDU A;  3WK7 A;  1X9X A;  3Q8M A;  5TIS U;  7ICR A;  3GQC A;  1F44 A;  5KG5 A;  4EX6 A;  1ZQR A;  3HPO A;  3QE9 Y;  4IRD A;  3F5A A;  2W03 A;  5D49 A;  4ECY A;  4XUS A;  5DBA A;  2LYA A;  4YMO A;  5BOM A;  1P7D A;  5DKW A;  1ZQU A;  4G3I A;  2RP5 A;  1XO1 A;  3C2L A;  2FLP A;  4I2E A;  2HDO A;  4NL9 A;  4O5C A;  2HCF A;  3FAH A;  1D9F A;  3LVV A;  4R63 A;  5KFS A;  2W11 A;  2ASD A;  4BWM A;  3TFR A;  2LHT A;  4PZN A;  3KTQ A;  3RJI A;  1B0X A;  4DSI A;  5EWG A;  4DFJ A;  4YN4 A;  4M04 A;  2ZIU B;  4CF3 A;  4GIB A;  3BQ0 A;  3MDC A;  3PNC A;  4EZ9 A;  3M7D A;  1L3T A;  3ISD A;  1YZ7 A;  5DB6 A;  1Z3E B;  4RQ4 A;  2AGP A;  5AIB A;  1DGJ A;  4P0Q A;  4ED2 A;  3GII A;  4MFC A;  1SV0 A;  4KLS A;  4DCC A;  1SKW A;  3QUQ A;  2R18 A;  1L7P A;  1V85 A;  1ZQ1 C;  5KT3 A;  4DL5 A;  3ORY A;  1A0P A;  4QZ8 A;  4O3N A;  3OPX A;  4Y2R A;  5F9L A;  2D6F C;  3PSP A;  3AU6 A;  5ALZ A;  4PGQ A;  1L7O A;  5DDM A;  9ICK A;  1S0N A;  3C29 A;  4NY8 A;  2KIC A;  1SB3 C;  8ICF A;  4ECR A;  1WUD A;  2HSZ A;  1SGG A;  1ZJM A;  2P6R A;  3PW5 A;  2NO5 A;  4UAW A;  5ALE A;  1TK5 A;  2B6G A;  2ZIU A;  4LVS A;  9ICC A;  1RYS A;  1V9P A;  5F9N A;  3C21 A;  1RPL A;  5KG1 A;  1GO3 F;  3RTV A;  1COO A;  3G6V A;  1BPE A;  1TAM A;  4ECX A;  4RQ3 A;  3BDP A;  3NTU A;  2NYV A;  5B66 U;  3ZD9 A;  4RQ6 A;  4P0Q B;  1OXJ A;  1RQL A;  3LDA A;  1ZJN A;  3KKA C;  5KFZ A;  3PX0 A;  3KBB A;  3MFH A;  5KFT A;  8ICE A;  4C7Z A;  4F5P A;  5GTH U;  2KKP A;  5ALS A;  1LVH A;  3RB6 A;  3VCB A;  3ZDE A;  2BCU A;  4IRK A;  3MR2 A;  2R8J A;  1QLN A;  5ALI A;  4UAT A;  2LM4 A;  3CNH A;  4EX7 A;  3L3F X;  1Q3V A;  3M8S A;  3N28 A;  2KOB A;  3B0X A;  9ICI A;  2JHD A;  5ALN A;  3AEV A;  4WJ3 B;  2R8H A;  1T3Q A;  4UB6 U;  3BZC A;  4U6P A;  5EE0 A;  2KJ8 A;  5DQH A;  4NLK A;  3GIL A;  5AI0 A;  4J9P A;  2VIX A;  2YQE A;  3C1Y A;  4MFA A;  4TUP A;  4FS1 A;  4PJ0 U;  2F1J A;  3I76 A;  1BVS A;  3GDX A;  4DS5 A;  2O6K A;  1O08 A;  4GLX A;  2BCQ A;  2JMG A;  4NM2 A;  5AKL A;  2ZJ8 A;  1KDH A;  5HMM A;  1RDF A;  3RF9 A;  4CGZ A;  1UA0 A;  2ZIW A;  1SXE A;  5KFN A;  3CP8 A;  3QZ8 A;  2K4I A;  5J2B A;  4EBD A;  2HBJ A;  2K4E A;  3L4P A;  2OXO A;  1NJZ A;  5AK3 A;  2E1E A;  2BQU A;  2KTQ A;  2EAN A;  2IOF A;  4B9U A;  4F4Y A;  1ZQE A;  4IR1 A;  2FMQ A;  4R8U B;  2JH1 A;  4DEZ A;  2BCV A;  1ZET A;  5J2A A;  1X6I A;  8ICB A;  4YR0 A;  3D2Q A;  1ZXI A;  1SWV A;  3T5J A;  3B0Y A;  4DF4 A;  2BDP A;  1ZQC A;  4KLE A;  3KHR A;  2M0N A;  1U4B A;  2RLT A;  4GC7 A;  2CRX A;  1FO4 A;  1IV8 A;  1PVP A;  1FFV A;  4QW9 A;  4NJ8 A;  3NVZ A;  1ZQS A;  4F4K A;  7ICE A;  4RQN A;  5KFH A;  3UMB A;  1UPH A;  1IIP A;  5J0O A;  3FM9 A;  3NVW A;  1MA7 A;  3QZ7 A;  4UAR A;  4A8E A;  1MN8 A;  5III A;  1TKD A;  2P35 A;  1UCV A;  4C0Z A;  4YD2 A;  2FDR A;  2PFN A;  4BWJ A;  4B9M A;  2C22 A;  4DSK A;  3BQ7 A;  9ICP A;  2YB1 A;  1KQQ A;  5ALD A;  2FE9 A;  2H3I A;  3QNM A;  2F3N A;  1JXE A;  2H3Z A;  4ICA A;  3I1Y A;  4QNL A;  4O0I A;  5ALR A;  2MSN A;  5JRT A;  1X9M A;  4UBB A;  3IRU A;  2XGP A;  5DB8 A;  5KFU A;  3TAR A;  5B5E U;  2F77 X;  5CP2 A;  1KFD A;  2HHW A;  2LBO A;  4US9 A;  1SL2 A;  1Z00 A;  1QH9 A;  3SMV A;  2Z7J A;  1SL1 A;  1ZQG A;  8ICR A;  1BPX A;  5AIC A;  7ICK A;  4F93 B;  3TAD C;  5DLG A;  2KN7 A;  1ZQZ A;  3ONN A;  1NK4 A;  3PML A;  4Q44 A;  3UXO A;  5C0Y A;  3M8R A;  3QU4 A;  4KN4 A;  5IIM A;  3EYZ A;  3C1Z A;  3Q8S B;  3KHH A;  1N56 A;  4J9O A;  5AKG A;  3SZ2 A;  2DWQ A;  2ZIX B;  1S0M A;  4KLT A;  4R66 A;  1WWU A;  5E79 U;  5CB1 A;  4PL1 A;  1KLN A;  4KLL A;  5DB9 A;  5J2K A;  8ICV A;  2W54 A;  5ALF A;  4USA A;  1S0V A;  4UB8 U;  2KNJ A;  1L8L A;  3PMN A;  4MF2 A;  2MUT A;  5L9X A;  1SKS A;  5KT6 A;  3BJY A;  9ICS A;  5KFF A;  2XID A;  3OJS A;  3E0F A;  3MGI A;  2E8N A;  2HBL A;  4FE3 A;  2E3T A;  1BPD A;  1QCK A;  2WB1 C;  5J0T A;  2KVS A;  3C23 A;  8ICI A;  1KW4 A;  1ZQO A;  1ZQV A;  2I5H A;  1RYR A;  5AI6 A;  5EE3 A;  9ICR A;  4J9M A;  3JPS A;  1FEZ A;  3Q8P B;  2RQ5 A;  5ALV A;  2NO4 A;  7ICM A;  2A1A A;  4J9N A;  2Y9T A;  4DFK A;  1Z1V A;  1ZQI A;  2KFZ A;  2Y0S C;  4IL6 U;  1ZQB A;  2A1J B;  3M9O B;  2DKX A;  2QAR B;  4NLB A;  5AK6 A;  5GTI U;  3QUT A;  2JRZ A;  3HP6 A;  1KFT A;  4DSL A;  5J0S A;  4FS2 A;  4ECU A;  1JMS A;  1X66 A;  1NKB A;  3Q8L A;  3WK4 A;  5JU5 A;  1S5L U;  2KHV A;  2W9C B;  4K4G A;  1DGS A;  3BS5 B;  5J0W A;  1L7N A;  5J0R A;  4CE6 A;  5AM2 A;  4QJF B;  4US8 A;  3PW7 A;  4I2J A;  5IIK A;  8ICG A;  2PMZ C;  2HHV A;  2KEY A;  4FZN A;  4Q8E A;  7ICF A;  2JEG A;  2L5Y A;  1ZQT A;  1J2M A;  3RJG A;  1T7P A;  2HOI A;  3BZK A;  2JXJ A;  5EWE A;  2PI5 A;  3H8W A;  3NAS A;  1YT3 A;  4CDG A;  3RJK A;  2HVI A;  5AM4 A;  4R8U A;  7ICU A;  7ICJ A;  4UB3 A;  4NM1 A;  4Y2P A;  3MDA A;  4I2F A;  3GIM A;  9ICN A;  4EZ6 A;  5KG2 A;  4EBC A;  4MEY A;  5ALQ A;  2D8C A;  3C5G A;  5A0L A;  2KSO A;  5DG7 A;  3BS7 A;  4GFJ A;  9ICO A;  3N97 B;  1IG6 A;  3BQT A;  2LM1 A;  2HOF A;  4QWE A;  4J9K A;  4TUQ A;  1F5S A;  2C2D A;  1ZQQ A;  3V6H A;  3MC1 A;  2C28 A;  2KP7 A;  1MQ2 A;  1JRO A;  2MA1 A;  1ZQW A;  4NLC A;  2R8I A;  4DOC A;  2H3F A;  2XCA A;  1D8L A;  2Q0Z X;  2XGQ A;  2MUT B;  1ECW A;  4Q8F A;  7ICN A;  3RJH A;  4O3Q A;  4CNQ A;  3HT3 A;  2BZF A;  7ICV A;  2FLL A;  4C8L A;  3CYM A;  5CR0 A;  5KFV A;  4PHE A;  2OCE A;  3NRZ A;  4P4M A;  5KFE A;  4YMM A;  5J2D A;  1H38 A;  3RR8 A;  4JV2 A;  1PK3 A;  1L3U A;  3C28 A;  3K1Z A;  2B21 A;  4O5K A;  5CEH A;  3V72 A;  4RQ0 A;  4LZD A;  3PW2 A;  4F5Q A;  4UBC A;  4ELV A;  2BCS A;  5EE9 A;  5HNK A;  2ZIX A;  1EXN A;  2UVV A;  4F91 B;  1NJW A;  5FP0 A;  1S76 D;  1T94 A;  3TAP A;  3TFS A;  3FDS A;  5C5J A;  5J0Q A;  3K75 D;  1L7M A;  2W9B B;  3GIK A;  1HEK A;  1SIJ A;  4C8K A;  3BQ2 A;  8ICY A;  5KFG A;  2A19 A;  3PX4 A;  3ISC A;  3OTQ A;  4BJQ A;  2NRT A;  3BS5 A;  2BPF A;  4IQT A;  3HWT A;  2HOQ A;  4YMN A;  3LWM A;  4F92 B;  4M9N A;  1J97 A;  3ZDC A;  5HR7 A;  2GWS A;  2VA8 A;  5AI5 A;  1KSP A;  2PFP A;  2F2A B;  4TUS A;  4UB5 A;  4OCZ A;  5KFR A;  5ALW A;  1NNL A;  5G5H A;  4O3P A;  7ICO A;  4P0P B;  2AGO A;  3JPO A;  1N60 A;  5ALG A;  2HHS A;  2AQ0 A;  5KFO A;  9ICH A;  4RQM A;  5AIA A;  3UXN A;  1S77 D;  2YMM A;  5EWF A;  3H40 A;  2G08 A;  4QIW F;  3RJJ A;  3GV7 B;  2W3S A;  1WYG A;  5KAF U;  2PXI A;  2WF6 A;  1A76 A;  3H7I A;  1NKE A;  1L5U A;  3E58 A;  2W7P A;  1ZQD A;  4BDP A;  4PHA A;  3THV A;  3IG8 A;  2KKV A;  5D46 A;  3HIL A;  2FLN A;  4LJX A;  4O3M A;  2BPG A;  4J9R A;  5AHX A;  1ZQL A;  5DGA A;  2LYB A;  4ED7 A;  2DUY A;  3NRW A;  5BPC A;  2IBK A;  5AM1 A;  5J2C A;  5J8Y A;  4PGX A;  4ECW A;  8ICX A;  2I6X A;  3AQE A;  2NRZ A;  2EQY A;  2P6U A;  9ICE A;  4EEN A;  3MR6 A;  5KT7 A;  3L5K A;  3MR3 A;  2KVC A;  1FFU A;  3N4M B;  1S10 A;  4DQI A;  1X2I A;  2JZB A;  1QSL A;  2FPL A;  1ZQH A;  9ICB A;  1TAU A;  2KK0 A;  2BCR A;  2PFQ A;  4J9L A;  2W7O A;  4I2G A;  1B43 A;  2LPE A;  2BGW A;  4UQG A;  4DS4 A;  3V7J A;  3T79 A;  1HUZ A;  4P4P A;  5KG6 A;  2LI6 A;  1VLB A;  1N5X A;  3GZF A;  3KD3 A;  2Y1I A;  1PUZ A;  3KZX A;  3TKA A;  1X6J A;  2AGQ A;  4M6W B;  3OSN A;  2MAX A;  2M9N A;  4ED1 A;  3M6Z A;  4KLJ A;  4HAI A;  3H4D A;  1D8Y A;  2ASJ A;  1NOM A;  2RRD A;  1SZH A;  1NK5 A;  2RHF A;  1QQ5 A;  2FPK A;  2J6U A;  4C8N A;  2Y1J A;  3M1Y A;  1T3N A;  2DPJ A;  3QU5 A;  2WAQ C;  4Y2X A;  4DSF A;  5L1J A;  5L1K A;  4QZE A;  3HKZ F;  2B0C A;  5DG8 A;  1ZD3 A;  3QEB Z;  2QAR A;  4NV0 A;  4GC6 A;  1ZYQ A;  2H3Q A;  5AM3 A;  2QLT A;  4F4Z A;  4QZA A;  4KLM A;  4B9V A;  3AN1 A;  3RBE A;  2HI0 A;  4NLZ A;  2DF4 B;  3F2C A;  2CXY A;  2YMP A;  4CF5 A;  5AKJ A;  2IHN A;  2CPR A;  7ICH A;  3RFA A;  3ICX A;  2H5X A;  1X42 A;  3PO5 A;  2KV2 A;  2WF9 A;  1NK6 A;  2K4H A;  4QWC A;  1J2N A;  5J8Y C;  2VA3 A;  2OEH A;  3IN5 A;  5AI8 A;  3N7S C;  2JGA A;  8ICJ A;  2DGZ A;  2MU2 A;  4M9J A;  5KG0 A;  1ZQK A;  1KN5 A;  4ZH4 A;  4RNO A;  3MGH A;  3OSP A;  1NK9 A;  4RQ2 A;  1NI3 A;  5DGB A;  1SWW A;  4ED8 A;  4I2H A;  3H8M A;  1BNO A;  3ED5 A;  3LK9 A;  1U9L A;  3QU9 A;  5J2I A;  5KTQ A;  3H4B A;  2KZ3 A;  4QWA A;  5KFC A;  2Y9U A;  1Q8K A;  3WK5 A;  1X9S A;  5DLF A;  1T8E A;  1CEZ A;  3JPP A;  4C4R A;  5KFL A;  4P2H A;  4EYH B;  5DBB A;  9ICM A;  4DLE A;  1RG6 A;  2VKQ A;  1O03 A;  3V6K A;  4DL2 A;  2ISP A;  3EWA A;  2AQ4 A;  4C80 A;  3UMC A;  1JIH A;  2EAO A;  2JR5 A;  3HJE A;  2YML A;  2AU0 A;  3RR7 A;  1K1S A;  2WFA A;  2KFN A;  2IA6 A;  4CF4 A;  5L1M A;  4GXJ A;  4AYB F;  4YR2 A;  3QU7 A;  3RB3 A;  2OHF A;  1RZT A;  3WK9 A;  1X9W A;  5L1L A;  4M6W A;  3UM9 A;  3R9K A;  4DWI A;  4O3R A;  3UMG A;  1XS9 D;  4RU9 A;  5K4L A;  3MR5 A;  2ZUC A;  1TV9 A;  2KJ5 A;  4GXI A;  2RDJ A;  4F8R A;  4ED0 A;  1JX4 A;  3NGD A;  2G06 A;  3PW0 A;  1Q46 A;  3K1R B;  2F44 A;  3Q8Q B;  3G6Y A;  1UQV A;  3G6X A;  8ICW A;  2W8K A;  3RB4 A;  1S9F A;  3IM1 A;  5ALJ A;  4KN7 A;  3ETL A;  4PHP A;  2DQN B;  4ACO A;  3TAN A;  5KFQ A;  4P0P A;  2YB4 A;  4RPY A;  4F50 A;  5ALM A;  2XO7 A;  3ZDB A;  2HHU A;  2Q4T A;  3H0L B;  4ECV A;  4UB1 A;  5KG3 A;  2W9C A;  1N62 A;  2BPC A;  4QZG A;  4YG2 A;  4DOA A;  4NWI A;  5KFA A;  4BXO B;  4UW9 A;  2DKZ A;  4QIW C;  4F71 A;  1ZQP A;  1N63 A;  1COK A;  4RQ8 A;  3KZI U;  1MSW D;  2LYH A;  3H8S A;  1ZRN A;  1BPB A;  4F5R A;  4NL9 C;  2FMS A;  4FBT A;  1JI7 A;  4Z6C A;  4TQR A;  3N7R C;  5AM0 A;  4EEY A;  1RXW A;  1FIQ A;  2EAM A;  5L1I A;  4B6J A;  1NK7 A;  1ZD4 A;  3KFU F;  2KG5 A;  4BX9 C;  5IIO A;  5ALU A;  1MC8 A;  4DFD A;  5KFJ A;  2E1F A;  1ZQX A;  2DL0 A;  4EYI B;  5J2H A;  2V4R A;  3AQF A;  1BPZ A;  4EBE A;  2ZG6 A;  4DQQ A;  2E8M A;  2YN4 A;  4QZ9 A;  1N48 A;  3PY8 A;  2KZM A;  3DEE A;  2XI9 A;  3OHA A;  1B22 A;  4K4H A;  2HHQ A;  5ALL A;  3RH5 A;  5AI4 A;  4FZM A;  4Q43 A;  1NKC A;  2ISO A;  9ICW A;  4DQR A;  1NJX A;  3PVX A;  3F5E A;  1RQN A;  1XSL A;  2ZTE A;  1ZQJ A;  4YVZ A;  5IIJ A;  4F4W A;  2J6T A;  1NK8 A;  8ICM A;  2ZTD A;  2NV3 A;  3M9N B;  5J2G A;  3IP4 B;  2PMZ F;  4YR3 A;  1HJP A;  2EZX A;  5F3X B;  5KFP A;  3KHL A;  1XSN A;  2P66 A;  2KIV A;  2PKE A;  2DPI A;  5ALH A;  1ED1 A;  2VA2 A;  1NJY A;  5IIN A;  2JV3 A;  2RDI A;  2JEJ A;  5KG7 A;  1WCN A;  2YY6 A;  3SAG A;  3GV8 B;  3H8J A;  5TZV A;  4I28 A;  1U47 A;  3M9M B;  4Q45 A;  3RJE A;  8ICS A;  5AK4 A;  3C2K A;  3ZDA A;  3NS1 A;  4RQ5 A;  2UVU A;  3PZP A;  5CRX A;  5J2E A;  4NLG A;  4F2S A;  4X5V A;  1OUQ A;  3LYS A;  4PZO A;  4PL2 A;  1DRG A;  5HR6 A;  2HW3 A;  4C4T A;  4XRH A;  1K1Q A;  2I9G A;  4KX3 A;  4NLN A;  4KLO A;  4FZL A;  5J0X A;  7ICQ A;  4JV0 A;  3LWL A;  2H3V A;  1CI4 A;  3ZD8 A;  2W9A A;  3U26 A;  4OJO A;  4YP3 A;  2V4Q A;  3QUC A;  3HW8 A;  1URJ A;  2R8K A;  3JPN A;  3C2M A;  1U48 A;  2EZY A;  3ETR A;  1SL0 A;  4DQS A;  1U49 A;  4KMU A;  2G07 A; 
#chains in the Genus database with same CATH homology
 4PPX A;  5J2B A;  4EBD A;  2BPG A;  4J9R A;  1NJZ A;  4RNM A;  2DFL A;  4BGD A;  4UB4 A;  1ZQL A;  4KLH A;  5DGA A;  4ED7 A;  2BQU A;  5CWR A;  3EZ5 A;  3TI0 A;  2BQ3 A;  2KTQ A;  3V6J A;  4O9M A;  5BPC A;  5DQG A;  2IBK A;  1ARO P;  4B9U A;  5J2C A;  4PGX A;  2I1Q A;  4F4Y A;  4ECW A;  1ZQE A;  4IR1 A;  8ICX A;  2FMQ A;  4DF8 A;  4R8U B;  5IIL A;  2NRZ A;  4DEZ A;  4O3O A;  4R64 A;  2BCV A;  2W8L A;  2P6U A;  1QTM A;  9ICE A;  3MR6 A;  1ZET A;  5KT7 A;  3MR3 A;  5J2A A;  1ZQY A;  3N4M B;  1S10 A;  4DQI A;  4RPX A;  2UVW A;  2XC9 A;  4QW8 A;  1X2I A;  3Q8K A;  8ICB A;  2JZB A;  4YR0 A;  1QSL A;  2FPL A;  2WTF A;  2F1H A;  1ZQH A;  9ICX A;  9ICB A;  1TAU A;  1PZN A;  9ICV A;  2BCR A;  4F2R A;  2PFQ A;  5KFY A;  3T5J A;  3B0Y A;  4YXJ A;  4J9L A;  4DF4 A;  2BDP A;  1XU4 A;  1ZQC A;  4DL3 A;  1SKR A;  1XWL A;  4JWN A;  4RUC A;  1SZP A;  3SV4 A;  5KFB A;  1ZQA A;  4KLE A;  4I2G A;  3KHR A;  1B43 A;  5KFM A;  1U4B A;  4GC7 A;  2BGW A;  4UQG A;  4DS4 A;  4QW9 A;  3UPQ A;  9ICT A;  3V7J A;  1HUZ A;  1ZQS A;  4JK1 A;  5KG6 A;  4P4P A;  4B9S A;  4F4K A;  4C8O A;  8ICZ A;  4QWD A;  7ICE A;  2C2E A;  3AUO A;  3JPT A;  5KFH A;  4DFP A;  2Y1I A;  9ICA A;  5J0O A;  4FO6 A;  4KLU A;  4CCH A;  4I29 A;  1TAQ A;  3QZ7 A;  2AGQ A;  2KZZ A;  4M6W B;  2XY5 A;  1ZQN A;  5III A;  3OSN A;  2MAX A;  3MFI A;  3GV5 B;  2ALZ A;  1TKD A;  3RRG A;  2M9N A;  4ED1 A;  4YD2 A;  1S0O A;  2PFN A;  4KLJ A;  3SI8 A;  4BWJ A;  5D4B A;  4B9M A;  2C22 A;  4DSK A;  3T5L A;  3H4D A;  1D8Y A;  9ICP A;  2W9M A;  2ASJ A;  2FPM A;  4J9Q A;  1NOM A;  1NK5 A;  4DFM A;  2FPK A;  4PHD A;  3MAB A;  2J6U A;  9ICQ A;  1JXE A;  4C8N A;  1TVA A;  2Y1J A;  5KT4 A;  1T3N A;  3RAX A;  2BKE A;  2DPJ A;  3IHQ B;  3JPQ A;  1MQ3 A;  8ICO A;  5DG9 A;  3RBD A;  4DSF A;  5L1J A;  5L1K A;  4QZE A;  5CHG A;  1ZQF A;  4O0I A;  1X9M A;  4UBB A;  4ECZ A;  5DG8 A;  2XGP A;  3T5K A;  5DB8 A;  2FMP A;  5KFU A;  3TAR A;  8ICT A;  3QEB Z;  5J2F A;  2BHN A;  4GC6 A;  1ZYQ A;  2IMW P;  5CP2 A;  1KFD A;  4RQ1 A;  4IQV A;  4F4Z A;  2HHW A;  9ICJ A;  4QZA A;  4TUR A;  1HUO A;  4B9V A;  4KLM A;  3RBE A;  1SL2 A;  1Z00 A;  4NLZ A;  9ICG A;  5J0U A;  1SL1 A;  1ZQG A;  8ICR A;  2XY7 A;  8ICK A;  1BPX A;  7ICK A;  8ICP A;  4I2D A;  5KFW A;  2IHN A;  5DBC A;  4F93 B;  5DLG A;  2KN7 A;  1ZQZ A;  7ICH A;  1IM4 A;  2H5X A;  1NK4 A;  3PO5 A;  1NK6 A;  1KEJ A;  5HHI A;  3PML A;  4Q44 A;  3UXO A;  4QWC A;  4DLG A;  4KLD A;  3M8R A;  7ICS A;  2JEF A;  1D9D A;  4J9S A;  9ICL A;  2VA3 A;  2J6S A;  4KN4 A;  5IIM A;  3TAQ A;  3EYZ A;  8ICJ A;  3C1Z A;  3RJF A;  3AU2 A;  3Q8S B;  4M9J A;  3KHH A;  4MF8 A;  3RH4 A;  1N56 A;  4M9L A;  1LV5 A;  5KG0 A;  4J9O A;  1ZQK A;  8ICQ A;  3SZ2 A;  4ZH4 A;  2ASL A;  4K4I A;  7ICI A;  4ELT A;  1RXV A;  7ICT A;  4RNO A;  4YFK A;  5J0P A;  1S0M A;  4ELU A;  4MFF A;  4KLT A;  9ICF A;  3MGH A;  3OSP A;  1NK9 A;  4RQ2 A;  4R66 A;  5DGB A;  2HVH A;  4ED8 A;  4I2H A;  4I2A A;  3T5H A;  2XCP A;  4UAZ A;  4ECT A;  4F5N A;  2IHM A;  3LK9 A;  1U9L A;  5CB1 A;  4DQP A;  3PX6 A;  5J2I A;  1KLN A;  4KLF A;  4KLL A;  5KTQ A;  3H4B A;  2KZ3 A;  5KFI A;  5DB9 A;  5J2K A;  4QWA A;  5KFC A;  4BXO A;  4JWM A;  4F3O A;  3KHG A;  2PI4 A;  1KTQ A;  2HHT A;  8ICV A;  4JUZ A;  4I27 A;  1S0V A;  5KFX A;  2OWO A;  4RUA A;  4B9N A;  3PMN A;  2BQR A;  4MF2 A;  2MUT A;  5L9X A;  1X9S A;  5DLF A;  1SKS A;  1T8E A;  5KT6 A;  3BJY A;  1CEZ A;  9ICS A;  4KLI A;  5J0Y A;  5KFF A;  3JPP A;  4ED3 A;  1T4G A;  4NXZ A;  5KFL A;  3OJS A;  4EYH B;  4P2H A;  5DBB A;  4QWB A;  9ICM A;  3MGI A;  4DLE A;  7ICL A;  4I2C A;  1BPD A;  5J0T A;  4Z6E A;  3OJU A;  3V6K A;  4IQU A;  4YXM A;  4DL2 A;  3C23 A;  4M47 A;  8ICI A;  4M0A A;  1ZQO A;  2ISP A;  3EWA A;  4RQ7 A;  2AQ4 A;  1ZQV A;  1RYR A;  1CUK A;  2HHX A;  3PV8 A;  3UQ2 A;  1JIH A;  5DQI A;  4TQS A;  1KFS A;  4RPZ A;  1KRP A;  3PR4 A;  9ICR A;  4GXK A;  1JN3 A;  2AU0 A;  4J9M A;  3RR7 A;  4PH5 A;  1K1S A;  3JPS A;  3V7K A;  3UQ0 A;  3Q8P B;  2F1I A;  4JV1 A;  2KFN A;  3JPR A;  2IA6 A;  2UVR A;  2ZJA A;  4GXJ A;  7ICM A;  4J9N A;  4DFK A;  3SV3 A;  1ZQI A;  2KFZ A;  2XY6 A;  3EW9 A;  2A1J B;  4YR2 A;  3HP6 A;  3M9O B;  1ZQB A;  4ED6 A;  3RB3 A;  5J2J A;  4M9G A;  1KFT A;  4DSL A;  1RZT A;  3Q8R B;  5J0S A;  4FS2 A;  4ECU A;  1QSS A;  1X9W A;  4R65 A;  5L1L A;  4M6W A;  4I2B A;  1XC9 A;  4DWI A;  1JMS A;  1IXR A;  4E0D A;  1NKB A;  4O3R A;  1L3V A;  3Q8L A;  5KFK A;  3PO4 A;  1XS9 D;  4RU9 A;  4ECS A;  3ZDD A;  3MR5 A;  2ZUC A;  1TV9 A;  4GXI A;  1JXL A;  2RDJ A;  4YQW A;  4F8R A;  4ED0 A;  1JX4 A;  4MEX A;  3NGD A;  3PW0 A;  2W9C B;  4K4G A;  1DGS A;  3Q8Q B;  5BOL A;  3OGU A;  3G6Y A;  4I2I A;  2ATL A;  5J0W A;  3G6X A;  4DSJ A;  9ICU A;  8ICW A;  2W8K A;  5J0R A;  4LZG A;  5CA7 A;  3Q8M A;  3RB4 A;  5DDY A;  4DO9 A;  1S9F A;  7ICR A;  3IM1 A;  3PW7 A;  3GQC A;  4I2J A;  4KN7 A;  3ETL A;  4PHP A;  5IIK A;  7ICG A;  4KIT B;  5KG5 A;  1ZQR A;  4DL6 A;  8ICG A;  3TAN A;  2HHV A;  5KFQ A;  3HPO A;  3QE9 Y;  4IRD A;  1ZQM A;  4Q8E A;  7ICF A;  2JEG A;  8ICN A;  4RPY A;  2AJQ A;  4F50 A;  1ZQT A;  2XO7 A;  3ZDB A;  5D49 A;  4ECY A;  3RJG A;  1T7P A;  4XUS A;  5DBA A;  2HHU A;  4YMO A;  5BOM A;  4ECV A;  4UB1 A;  4YD1 A;  5KG3 A;  2W9C A;  5EWE A;  5DKW A;  2PI5 A;  1ZQU A;  3H8W A;  5HML A;  4G3I A;  3PW4 A;  1TK8 A;  2PFO A;  1UT8 A;  1XO1 A;  3C2L A;  2FLP A;  2BPC A;  4I2E A;  4QZG A;  4YG2 A;  4O5C A;  4DOA A;  1D9F A;  5KFA A;  1Z00 B;  4DSE A;  3RJK A;  4BXO B;  5J29 A;  4O3S A;  4R63 A;  2HVI A;  5KFS A;  4FBU A;  4R8U A;  2ASD A;  4BWM A;  3TFR A;  1ZQP A;  4M2Y A;  3KTQ A;  7ICU A;  3RJI A;  4HYK A;  4RQ8 A;  4DSI A;  1DOQ A;  7ICJ A;  4UB3 A;  5JUM A;  5EWG A;  4Z6D A;  4DFJ A;  2LYH A;  3H8S A;  4YN4 A;  4M04 A;  4NM1 A;  1BPB A;  1MSW D;  4F5R A;  3MDA A;  4I2F A;  3C5F A;  2A1J A;  3GIM A;  2FMS A;  4FBT A;  9ICN A;  4Z6C A;  4TQR A;  4EZ6 A;  3BQ0 A;  4EEY A;  5KG2 A;  4EBC A;  4B9L A;  4MEY A;  3PNC A;  3MDC A;  4O5E A;  3C5G A;  4EZ9 A;  3E2E A;  5DG7 A;  4QZD A;  4RT3 A;  1L3T A;  1RXW A;  3ISD A;  4ECQ A;  9ICO A;  5DB6 A;  3BQ1 A;  3N97 B;  3BQT A;  5L1I A;  1Z3E B;  2NRX A;  3K4G A;  4C8M A;  4RQ4 A;  2AGP A;  1NK7 A;  2R8G A;  4KLQ A;  4QWE A;  4J9K A;  3GII A;  4ED2 A;  4MFC A;  4TUQ A;  4KLS A;  1SKW A;  4IR9 A;  4DL7 A;  4KTQ A;  5KT5 A;  2C2D A;  1ZQQ A;  3V6H A;  1TFR A;  2NRV A;  5IIO A;  5KT3 A;  2C28 A;  4DL5 A;  1MC8 A;  5KFJ A;  1MQ2 A;  1ZQX A;  3ORY A;  1S97 A;  1ZQW A;  2R8I A;  4EYI B;  5J2H A;  4DOC A;  2V4R A;  1BPZ A;  2XCA A;  4EBE A;  1D8L A;  4QZ8 A;  2ZTC A;  4O3N A;  4IRC A;  2Q0Z X;  5HHH A;  5F9L A;  4DQQ A;  8ICL A;  2XGQ A;  4M9H A;  3OHB A;  4QZ9 A;  2MUT B;  3AU6 A;  1N48 A;  3QEA Z;  3PY8 A;  1L3S A;  5CJ7 A;  2JZB B;  4PGQ A;  4Q8F A;  2KZM A;  7ICN A;  3RJH A;  4O3Q A;  3HT3 A;  3RAQ A;  5DDM A;  9ICK A;  3OHA A;  1XSP A;  1TK0 A;  1S0N A;  4K4H A;  1B22 A;  2HHQ A;  7ICV A;  4RNN A;  2FLL A;  4C8L A;  4F5O A;  5CR0 A;  3RH5 A;  4IQW A;  5HP4 A;  5KFV A;  4PHE A;  5KFD A;  4NY8 A;  8ICA A;  4Q43 A;  1NKC A;  4P4M A;  2ISO A;  5KFE A;  4YMM A;  5J2D A;  3T3F A;  4DQR A;  9ICW A;  1NJX A;  4UAY A;  4UB2 A;  4RZR A;  3PVX A;  8ICF A;  1H38 A;  1XSL A;  4ECR A;  3RR8 A;  2ZTE A;  1ZQJ A;  4YVZ A;  5IIJ A;  5EOZ A;  3TQ1 A;  1ZJM A;  4JV2 A;  4F4W A;  1L3U A;  8ICC A;  2J6T A;  2VAN A;  1NK8 A;  2P6R A;  3FYH A;  3PW5 A;  8ICM A;  2ZTD A;  2B21 A;  4QZI A;  2NRW A;  3M9N B;  4UAW A;  2ZJ5 A;  1UA1 A;  4O5K A;  3V72 A;  4RQ0 A;  1TK5 A;  4LZD A;  5J2G A;  4QZF A;  4F5Q A;  3PW2 A;  4UBC A;  4LVS A;  4ELV A;  9ICC A;  1A77 A;  1RYS A;  1V9P A;  5F9N A;  2BCS A;  5HNK A;  3C21 A;  4P4O A;  1EXN A;  1RPL A;  5KG1 A;  2UVV A;  3RTV A;  1COO A;  1HJP A;  4YR3 A;  4F91 B;  3G6V A;  1BPE A;  1NJW A;  5KFP A;  2W9B A;  3KHL A;  1XSN A;  1S76 D;  4ECX A;  2P66 A;  4RQ3 A;  4B9T A;  3TAP A;  3TFS A;  3FDS A;  3SYZ A;  3BDP A;  1LB2 B;  2DPI A;  3NTU A;  5C5J A;  4PGY A;  5J0Q A;  3MBY A;  3ZD9 A;  3K75 D;  2VA2 A;  4RQ6 A;  1NJY A;  1BPY A;  2W9B B;  3PR5 B;  3RRH A;  4KLG A;  2JEI A;  4QZH A;  3LDA A;  3GIK A;  1ZJN A;  4XQ8 A;  8ICH A;  4C8K A;  3PX0 A;  5KFZ A;  5IIN A;  2RDI A;  3MFH A;  5KFT A;  2JEJ A;  8ICE A;  5KG7 A;  3BQ2 A;  4F5P A;  5KFG A;  4DL4 A;  1WCN A;  8ICY A;  3ISB A;  2ZUD A;  3RB6 A;  3GV8 B;  3PX4 A;  3H8J A;  3V7L A;  3ISC A;  1NK0 A;  3EPG A;  3ZDE A;  5TZV A;  2BCU A;  2NRT A;  4IRK A;  3GFK B;  3MR2 A;  2R8J A;  4Z6F A;  4I28 A;  2BPF A;  4RT2 A;  1QLN A;  4IQT A;  3HWT A;  1U47 A;  4YCX A;  3M9M B;  4Q45 A;  3RJE A;  8ICS A;  4YMN A;  3LWM A;  3C2K A;  3RH6 A;  3ZDA A;  3M8S A;  4F92 B;  3B0X A;  9ICI A;  4RQ5 A;  4M9N A;  3EPI A;  2UVU A;  3ZDC A;  5KG4 A;  1BGX T;  2GWS A;  2VA8 A;  2R8H A;  1KSP A;  5J2E A;  1U45 A;  4TUS A;  3UXP A;  4UB5 A;  2PFP A;  4QZB A;  4NLG A;  4F2S A;  5KFR A;  4X5V A;  5DQH A;  4NLK A;  3GIL A;  4O3P A;  4J9P A;  2HW3 A;  7ICO A;  4XRH A;  3C1Y A;  4XA5 A;  4MFA A;  1K1Q A;  3JPO A;  2C2R A;  2AGO A;  7ICP A;  4TUP A;  2I9G A;  4F4X A;  4NLN A;  5KT2 A;  1QSY A;  4KLO A;  4FS1 A;  2HHS A;  2AQ0 A;  5KFO A;  9ICH A;  3UXN A;  1S77 D;  2F1J A;  5EWF A;  3H40 A;  2ZUB A;  5J0X A;  7ICQ A;  3RJJ A;  4DOB A;  4JV0 A;  3LWL A;  3GV7 B;  1BVS A;  3GDX A;  4DS5 A;  3ZD8 A;  2W9A A;  1UT5 A;  2PXI A;  8ICU A;  5DB7 A;  4GLX A;  2BCQ A;  4YP3 A;  1A76 A;  4NM2 A;  2V4Q A;  3H7I A;  2ZJ8 A;  3HW8 A;  3GIJ A;  5HMM A;  1KDH A;  1NKE A;  2BR0 A;  1Y88 A;  1L5U A;  1C7Y A;  2V9W A;  1ZQD A;  4BDP A;  2R8K A;  4QZC A;  3JPN A;  3C2M A;  1U48 A;  3RB0 A;  4PHA A;  3THV A;  1WCL A;  1UA0 A;  1SL0 A;  5KFN A;  4DQS A;  4KMU A;  1U49 A;  5D46 A;  3QZ8 A;  3HX0 A;  2FLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...