1WCLA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
total genus 21
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wclA00
4Q8EA 5KFVA 4RNOA 3TARA 3MFIA 2W9BB 4DLEA 4YVZA 8ICKA 2KZ3A 2BKEA 1SKRA 7ICEA 5KT7A 4B9LA 3RBDA 4QZDA 1SZPA 3ISCA 4RQ7A 4QZHA 4F4XA 2V9WA 3BQTA 4ED1A 1H38A 1S0OA 4J9PA 2XGQA 4PGYA 1COOA 4C8LA 4ECSA 4PHAA 5BPCA 1HJPA 1QSSA 8ICHA 4QWCA 9ICIA 4M9NA 4Z6DA 2KZMA 1ZYQA 2Q0ZX 5DDYA 5KFUA 1TK8A 1NKBA 7ICIA 3ZD8A 5HMLA 2MUTA 2FLNA 2IA6A 4DL4A 3MR6A 1SL1A 4C8KA 7ICGA 1S0NA 2NRTA 1JXLA 3T5LA 4P4OA 4M0AA 1TK5A 9ICBA 3TQ1A 3PW0A 3RR8A 8ICMA 5D46A 3V7JA 1SKWA 4KLDA 4J9SA 5DB9A 1U48A 4EBDA 1TV9A 4UB2A 2ZJ5A 2W9MA 3GILA 3AU2A 1S0MA 1UT5A 5EWGA 3ISBA 3Q8KA 8ICAA 1ZQHA 1U9LA 3V6HA 3RTVA 5KT4A 3V6KA 4EEYA 3K75D 1ZQBA 5KFKA 2BQRA 3RJEA 4DQPA 3V6JA 4NLZA 9ICQA 3JPRA 3HT3A 4RT2A 3QEAZ 5J0OA 2FPKA 4DSKA 1DOQA 1Z00A 1ZQUA 3ZDEA 3E2EA 5KFXA 4YXJA 2A1JB 4DFKA 3N4MB 3Q8MA 4RQ1A 3H8SA 4DOCA 2NRXA 1UT8A 5J2IA 3RB0A 3RJJA 9ICLA 7ICUA 1Z00B 5DQHA 4KLOA 4QZEA 5KFMA 1LV5A 4O9MA 4UB4A 2Y1IA 5KFLA 3LWLA 3EPIA 4RPYA 4KLSA 4DL5A 3T5KA 4F93B 1KEJA 1KTQA 2ASJA 1KSPA 4PPXA 4R8UB 9ICUA 1BPXA 3RH6A 4K4GA 3EYZA 9ICVA 4IRCA 2PFOA 4I2DA 7ICLA 5CP2A 3BQ1A 2ASLA 3PO5A 4KN4A 5KG0A 4RT3A 5KG7A 4IR9A 4B9NA 4PH5A 2IMWP 2J6TA 3Q8QB 4DOAA 2P6RA 4MFAA 5KFDA 4DS5A 4DL2A 2FPMA 2MUTB 4I29A 4CCHA 2W8LA 4DL6A 2ALZA 3Q8SB 3LDAA 4Q44A 1ZQOA 8ICJA 4ECYA 5KFRA 3PR4A 1MQ2A 1NK4A 2HW3A 4Z6EA 7ICTA 1WCLA 2I9GA 5KTQA 1BPBA 4I2GA 9ICOA 4QZCA 1T7PA 3C2LA 4O3RA 4MF2A 4B9MA 8ICFA 1C7YA 4K4HA 1BVSA 2W8KA 4RQ5A 5KT3A 4Q45A 3QE9Y 2AQ0A 3JPQA 8ICXA 1KFTA 1TVAA 5J2BA 2HHUA 3KHRA 5KFEA 4XA5A 3RBEA 3BQ2A 8ICUA 2W9BA 1AROP 2IHMA 2AJQA 2ZJ8A 4ED8A 5KFJA 5BOMA 1SL2A 1KFSA 8ICNA 1NJZA 1L3SA 9ICSA 4DWIA 4YCXA 4EYHB 2ISPA 3SV4A 3H8WA 2VA2A 1T4GA 3PVXA 1S9FA 2ZUDA 3RJKA 7ICOA 4DSEA 2FLPA 4JK1A 4B9UA 4M2YA 4KLIA 3HPOA 8ICQA 8ICOA 4Z6FA 8ICZA 3NTUA 5J2KA 5HP4A 3RB4A 1X2IA 1ZQYA 4QWEA 3H40A 3RB6A 2ISOA 4F4YA 4O3PA 2V4QA 2XC9A 1TK0A 1L3UA 3PMLA 1UA0A 2BPFA 9ICKA 3QEBZ 3M9MB 4ED6A 5J0RA 5F9LA 4ECUA 1XO1A 4YMOA 1ZQQA 4DF4A 2W9AA 8ICWA 3BQ0A 2HHVA 4I28A 4TUPA 1U47A 5DGAA 4C8NA 3RJFA 3RH4A 4KLFA 2RDIA 3LWMA 3PO4A 4KTQA 2W9CB 3TFSA 5J0QA 3C21A 2C2DA 4ZH4A 4DF8A 1XSPA 2VANA 3BJYA 4LZDA 4TUQA 4F5NA 4IRKA 5IIMA 4YR0A 2PFPA 4JV1A 4XRHA 2AGQA 4UQGA 4J9NA 4DQRA 1ZQIA 4O5CA 2KFNA 4J9QA 4TQRA 1QLNA 3C5GA 5CWRA 4F4ZA 2JEGA 1XU4A 4GXKA 5KG5A 2DPIA 4FBTA 4UAZA 4DSIA 1RYRA 5CR0A 3RRHA 5KG2A 4B9VA 2A1JA 5J0PA 5CB1A 4YN4A 5KFTA 5KFFA 3GIIA 4DFPA 4P4PA 3RH5A 4F92B 5J2FA 3KHLA 2P6UA 4DLGA 2PI5A 4IQTA 5KFIA 1LB2B 4GLXA 4ELTA 1ZQTA 3HW8A 1KLNA 1KFDA 3C5FA 1ZQPA 1ZQCA 2UVVA 4F3OA 1NOMA 4R66A 4XUSA 4RQ8A 4QWBA 4YD1A 1N56A 5KT6A 5KFBA 1ZJNA 5DGBA 5DB7A 4RQ2A 4DQQA 8ICTA 1ZQSA 2XCAA 1NK6A 8ICLA 3TI0A 1UA1A 4F5RA 4KN7A 2HHXA 3HX0A 1ZQVA 2PFQA 4IQVA 4XQ8A 5DB6A 5EWEA 1RZTA 2FMSA 3MR5A 3BDPA 3FDSA 5J2GA 4RPXA 2JEIA 2KFZA 7ICSA 3V72A 1IXRA 3RRGA 4YFKA 5CJ7A 5J2CA 3SV3A 1TKDA 2BCVA 3TFRA 3K4GA 4QZ8A 1QSYA 3RJIA 4DQIA 4KLGA 1DGSA 4RU9A 4YMNA 5DQGA 4J9LA 4YD2A 3FYHA 4UB3A 4QZGA 1BGXT 1JN3A 1K1QA 4FS1A 3V7KA 5J0UA 4J9MA 4ECWA 3N97B 3C1ZA 2KTQA 2R8JA 1V9PA 5J0SA 2AU0A 4NLGA 4ED0A 4F91B 1NK9A 2C2RA 2KN7A 1ZQEA 1EXNA 2PXIA 4QW9A 2C28A 4IQUA 3PR5B 3GV7B 4RZRA 4F4WA 4Z6CA 2Y1JA 9ICMA 8ICRA 4DL7A 1ZQLA 2BQUA 1MC8A 1RPLA 2BQ3A 1NKCA 5D49A 5IIJA 1L3VA 4B9SA 2NRZA 1ZQNA 3JPOA 3MDAA 4NLNA 4O3OA 4KLEA 2J6UA 4JWMA 4LVSA 1SL0A 1CEZA 5KFWA 3GV5B 4RQ6A 3GIJA 1Y88A 3EW9A 4MFCA 1NK5A 4QZBA 3PW2A 2BGWA 5J2AA 4TUSA 5DBAA 4EBCA 4I2HA 4NLKA 2BPGA 1ZETA 3G6VA 1NKEA 4QWAA 2JEJA 4I2FA 5DDMA 4KLMA 5IIOA 4O5KA 2W9CA 2C22A 4YQWA 2B21A 5KFNA 5L1LA 2XGPA 5KFAA 4X5VA 1B43A 4ED3A 3TANA 4F2RA 4NXZA 1IM4A 1ZQFA 3SI8A 3C23A 3B0YA 2BPCA 1XWLA 2V4RA 1S10A 1RXVA 3H8JA 3QZ7A 1TFRA 3Q8PB 3JPNA 3IM1A 3SZ2A 9ICRA 4M6WB 8ICVA 3AUOA 4RNMA 5KFOA 4KMUA 3LK9A 2M9NA 1Z3EB 5J0YA 4QWDA 1NJXA 3GIMA 3MBYA 8ICPA 7ICHA 5L1IA 4F5PA 4YR2A 2ZTCA 5JUMA 4DOBA 1BPEA 3T5HA 8ICCA 3M8SA 4J9KA 4PHEA 2HHQA 4DSFA 2ATLA 1BPDA 3B0XA 4GC7A 1NK7A 1RXWA 8ICEA 4RPZA 4I2BA 2LYHA 7ICRA 3H7IA 1D9FA 1B22A 3OSPA 2VA3A 1NK0A 4RQ0A 5KT5A 4DFJA 3SYZA 3Q8RB 2HVIA 4BDPA 3OHAA 2FPLA 3JPTA 5J0WA 2P66A 4KLQA 4G3IA 2RDJA 4PHDA 1S0VA 5HMMA 1MQ3A 9ICXA 3GIKA 1D8YA 2BCRA 1XSLA 1XS9D 3UQ0A 4P4MA 3GDXA 2F1JA 1XC9A 4I2IA 2BCUA 4I2EA 4RNNA 4QZ9A 4R65A 2HHWA 4ECRA 4DS4A 1JXEA 4O3QA 4RQ4A 4BGDA 4TURA 3JPSA 2PFNA 5KG6A 1ZJMA 3NGDA 2ZTEA 5DG9A 5IINA 4Q8FA 5L1KA 1ZQWA 4RUAA 1X9MA 5DB8A 4EZ9A 4Q43A 9ICAA 1ZQAA 5DLGA 4JUZA 3C2KA 4BWJA 4HYKA 2DPJA 1TAUA 3OJUA 1S76D 2ZTDA 3T3FA 3PW7A 5C5JA 3PNCA 3RJGA 3MDCA 3OJSA 4J9OA 2F1IA 3EPGA 7ICFA 4MEYA 4NM2A 1ZQJA 7ICMA 4C8MA 4O3NA 3V7LA 4BWMA 3PMNA 2HVHA 7ICVA 4UAYA 3OHBA 1ZQMA 5HHHA 4DSJA 5KT2A 5D4BA 2DFLA 3AU6A 4BXOA 4GXJA 2R8HA 4DO9A 4RUCA 4KLHA 3G6YA 1JIHA 2XY7A 2J6SA 2ASDA 5KFHA 4O0IA 3HP6A 3GFKB 2XY5A 4M9GA 1XSNA 7ICQA 4GC6A 4YMMA 1ZQRA 3ZDCA 1ZQGA 4ECVA 4B9TA 3M9NB 3MGHA 2BCSA 2IHNA 4R63A 8ICSA 1X9WA 1KDHA 3JPPA 1NK8A 1U49A 4R64A 5DBCA 2F1HA 4M04A 4KLJA 1D9DA 4ED7A 4UBBA 1ZQKA 4O5EA 4O3SA 1RYSA 7ICKA 4I2JA 1KRPA 2R8KA 9ICGA 9ICWA 5IIIA 3UXOA 1QTMA 5L9XA 3ETLA 1NJWA 4UB5A 2XCPA 4QZIA 5J0TA 4FS2A 3GQCA 9ICJA 1WCNA 4F8RA 1MSWD 5J2EA 3OGUA 2C2EA 4KLUA 3PY8A 3M9OB 1JX4A 3UXPA 4YXMA 4BXOB 7ICJA 3C2MA 2R8GA 5EOZA 3ISDA 4FBUA 1S97A 2JZBA 3PX6A 4M9JA 4YP3A 4F50A 3KTQA 4GXIA 3UXNA 3EZ5A 3C1YA 3PX0A 3PX4A 5F9NA 4EZ6A 4UB1A 1S77D 2JZBB 3H4BA 3UPQA 3TAQA 4IQWA 8ICBA 2I1QA 5KG4A 5HHIA 1L3TA 9ICCA 2FLLA 1U4BA 5EWFA 5IILA 2FMQA 4ELUA 5KFQA 4P2HA 2WTFA 2JEFA 4ECXA 4LZGA 1A77A 4PHPA 4RQ3A 5DKWA 3MFHA 4ED2A 3ZDDA 4YG2A 3MR3A 5J29A 3UQ2A 3PW5A 3RJHA 2HHTA 4IRDA 5J0XA 2MAXA 1NJYA 4E0DA 3OSNA 3KHHA 4JWNA 9ICTA 2UVWA 1PZNA 2AQ4A 2FMPA 1D8LA 4F5QA 2BCQA 3QZ8A 4EYIB 4TQSA 1BPZA 1X9SA 1HUZA 9ICEA 4KITB 4JV0A 4PGQA 8ICYA 9ICNA 1K1SA 4F5OA 5DQIA 3ZD9A 4DEZA 1BPYA 4DL3A 2IBKA 4UBCA 2UVRA 7ICNA 4JV2A 3T5JA 2XY6A 4IR1A 2HHSA 5KFYA 3H4DA 3RAQA 4I2CA 1TAQA 5J2DA 5J2HA 4DFMA 4F2SA 4M9HA 2VA8A 4QZAA 4MEXA 8ICIA 3KHGA 5DLFA 9ICHA 2R8IA 2BR0A 3MR2A 1JMSA 1ZQDA 4ECTA 2ZUBA 5KFCA 5KFSA 3ORYA 3ZDAA 4ELVA 4EBEA 2AGPA 2BDPA 2BHNA 3RR7A 4KLLA 4K4IA 4DSLA 4M6WA 5KFZA 4I27A 5KG3A 4I2AA 1A76A 1ZQXA 8ICGA 4FO6A 4NY8A 3G6XA 3PV8A 3MGIA 5KG1A 5DBBA 4M47A 5HNKA 3RAXA 2NRWA 2H5XA 1L5UA 3THVA 5TZVA 3PW4A 5DG7A 5BOLA 4R8UA 1T3NA 4C8OA 1T8EA 2NRVA 2ZJAA 2OWOA 4QZFA 3ZDBA 7ICPA 4ECQA 5KFPA 4J9RA 4KLTA 4M9LA 5DG8A 5J2JA 3IHQB 4YR3A 3HWTA 4ECZA 3TAPA 1HUOA 4MFFA 4F4KA 2AGOA 4NM1A 2XO7A 5L1JA 3MABA 2UVUA 9ICFA 3RB3A 1QSLA 2KZZA 9ICPA 4QW8A 3M8RA 1N48A 1SKSA 5CHGA 4PGXA 2ZUCA 1ZQZA 1CUKA 3Q8LA 1U45A 4MF8A 2PI4A 5KFGA 4DQSA 3GV8B 5CA7A 4UAWA 3EWAA 5IIKA 2GWSA
chains in the Genus database with same CATH superfamily
2G08A 2ZIUB 4RNOA 2XIDA 2KZ3A 2BKEA 5KT7A 4B9LA 2FI1A 4CGZA 4ED1A 4J03A 4J9PA 2XGQA 2AHOB 2F76X 2JH1A 3BZKA 4ECSA 1HJPA 8ICHA 4QWCA 2KZMA 7ICIA 5ALMA 2IA6A 4C8KA 2OM6A 4P4OA 1TK5A 2E8OA 5DB9A 1M6YA 3NRWA 1A6SA 2F3NA 3V6HA 3V6KA 5KFKA 2A19A 3V6JA 1SXDA 3QEAZ 3SAGA 5KFXA 3Q8MA 2A1JB 4DFKA 3N4MB 4DOCA 3RJJA 2K4PA 7ICUA 5ALPA 4GIBA 2OYYA 4KLOA 1UQVA 4UB4A 3LWLA 3PSPA 4KLSA 4DL5A 2EDUA 2ASJA 3A0BU 3EYZA 4I2DA 2KIWA 1RDFA 3H0MB 5KG0A 4IC9A 2IMWP 2P6RA 4DS5A 1DRGA 2DQNB 5KL8B 3QYPA 3LDAA 1ZQOA 4ECYA 1MQ2A 2KNJA 2HW3A 7ICTA 4U7CA 2I9GA 4Y2TA 1ZD5A 3C2LA 4O3RA 8ICFA 3LYSA 4K4HA 2W8KA 4RQ5A 3QE9Y 1KFTA 1TVAA 2HHUA 3KHRA 3SD7A 1SL2A 2CXYA 1KFSA 4YCXA 3H8WA 1T4GA 5C0YA 2ZUDA 3RJKA 4JK1A 2DWQA 4Z6FA 8ICZA 4JMUA 3WKBA 3NTUA 5J2KA 1ZQYA 2W3SA 3H40A 2LYBA 5AM3A 2V4QA 1TK0A 4Y2JA 1UA0A 5AKKA 2KJ8A 5AK5A 1ZD2P 5ALEA 1N61A 8ICWA 4I28A 1KQQA 2L5YA 1X42A 4DF8A 2EZZA 2DKZA 2VANA 4IRKA 5IIMA 2PFPA 2AGQA 5ALUA 5L1MA 3WKAA 5ALDA 5CWRA 1XU4A 2YQEA 1RYRA 5CR0A 5KG2A 5J0PA 4YN4A 4P0PA 5KFFA 3N7SC 3BS5B 1KL9A 2P6UA 4DLGA 4FFDA 4F3OA 5DB7A 4UW9A 2K60A 4F5RA 3WU2U 4C4TA 2W04A 4XQ8A 3QUBA 1ECWA 3KD3A 1QQ6A 2JEIA 1IXRA 2LM4A 2LI6A 2KP7A 1DGSA 3BQ7A 4RU9A 4J9LA 4UB3A 1BGXT 1FO4A 3V7KA 3C1ZA 2R8JA 3O0FA 1V9PA 5J0SA 4F91B 1NK9A 1L7OA 2PXIA 4QW9A 2EZXA 4PL2A 8ICRA 4DL7A 2JV3A 4FZMA 3IRUA 1ZQNA 3MDAA 4NLNA 2Y9UA 2WFAA 4QWAA 5IIOA 2CN1A 2W9CA 2B21A 3FAHA 4X5VA 4C7YA 4ED3A 4NXZA 1IM4A 3SI8A 1B4FA 3B0YA 3DDHA 1S10A 2XI9A 8ICVA 3RF9A 3QNMA 3AUOA 5KFOA 4KMUA 3QUQA 7ICHA 4F5PA 2W7PA 4J9KA 2HHQA 2HDOA 2YN4A 2H3VA 2AXTU 4I2BA 1D9FA 4RQ0A 1SWWA 1T3QA 3SYZA 3OHAA 2FPLA 3BZCA 5J0WA 4KLQA 4G3IA 2E8PA 1D8YA 1RM6C 5ALXA 3GDXA 1XC9A 4I2EA 3N7PD 4R65A 5ALWA 2F44A 2HHWA 3QUCA 3PSFA 3EUB2 1ZJMA 4U6PA 4Q8FA 5DG9A 4EZ9A 4Q43A 3KKAA 4JUZA 1ZRNA 1TAUA 3RJGA 3OJSA 3EPGA 4NM2A 7ICVA 4BWMA 1SWVA 4CNQA 4BX9C 2I6XA 4RUCA 3M6ZA 3AM9A 4GFJA 4Y2PA 3HP6A 3GFKB 2WAQF 4M9GA 4GC6A 2ZIVB 4ECVA 1N2XA 4IL6U 4QNLA 3AQEA 3CNHA 2IHNA 3JPPA 1U49A 2KKPA 4R64A 3U26A 1A0PA 1SXEA 1X6JA 4O5EA 4UBBA 2R8KA 1QTMA 5AI9A 9ICJA 2KICA 5EE0A 1J2NA 2Y9TA 5J2EA 3WK6A 3CYMA 3ISDA 5HR6A 2NO4A 5JRTA 2G06A 4OD0A 2R18A 3UXNA 3EZ5A 2JZBB 4IQWA 8ICBA 4UATA 5EWFA 2JEFA 1HEKA 3MFHA 1L6NA 3ZDDA 3I28A 3MR3A 3UQ2A 2ZIXB 4IRDA 1NJYA 3OSNA 3KHHA 2AQ4A 4Y2VA 1QQ7A 4EENA 2BCQA 4EYIB 3NVWA 4JV0A 9ICNA 1Q8KA 4PZOA 4JV2A 3T5JA 2XY6A 3WKCA 2WF9A 4I2CA 5J2DA 5J2HA 4DFMA 2VA8A 4QZAA 2N1RA 4OCZA 4ECTA 2ZUBA 4FE3A 4EBEA 2BDPA 2BHNA 1X6IA 4DSLA 4I27A 2JGAA 4I2AA 3F2DA 1ZQXA 5GTHU 3PV8A 3MGIA 1RG6A 4M47A 2EAOA 2BZFA 5TZVA 1SIJA 3HILA 5KFPA 4KMOB 3SEIA 3TAPA 3NVYA 2XO7A 3MABA 1L7NA 4EEKA 1XNSA 5ALGA 4QW8A 3M8RA 1PUZA 1N48A 2WB1C 5CHGA 1ZQZA 4MF8A 2PI4A 3MR2A 5KFVA 3TARA 2W9BB 1YT3A 4YVZA 1S5LU 7ICEA 3KZXA 2BDUA 3HKZF 4QZDA 1NI3A 3ISCA 4RQ7A 4F4XA 1N5WA 1Q3VA 1H38A 1S0OA 5AK4A 1COOA 2K4IA 4C8LA 4USAA 4PHAA 4M9NA 2MUTA 2FLNA 4DL4A 7ICGA 8ICMA 2ZXHA 5D46A 1SKWA 2A1AA 4EBDA 2Q4TA 4UB2A 2F8LA 2ZJ5A 1S0MA 3ISBA 3Q8KA 1ZQHA 1U9LA 5KT4A 3K75D 1ZQBA 4CRXA 3RJEA 4DQPA 5HR7A 3JPRA 2FDRA 5ALHA 1DOQA 1Z00A 1ZQUA 3ZDEA 2HSZA 2RHFA 4YXJA 4RQ1A 3WK8A 3H8SA 1UT8A 1KN5A 3J81j 3F5AA 1LV5A 4P0QB 2CRXA 1KSPA 1KEJA 1KTQA 1CI4A 2HOFA 4R8UB 9ICVA 1COKA 1VDVA 1SZHA 4RT3A 4IR9A 4B9NA 2J6TA 3UM9A 2D8CA 4DOAA 1TAMA 3Q8SB 8ICJA 5AM2A 3PR4A 2NO5A 1NK4A 1MN8A 1AQ6A 4F71A 5KTQA 9ICOA 4QZCA 1T7PA 4MF2A 1C7YA 3JPQA 5J2BA 1JRPA 2QLTA 4XA5A 3GZFA 1AROP 2AJQA 1QCKA 2FJ6A 4EYHB 2VA2A 2YTUA 7ICOA 4M2YA 1UCVA 3RB4A 1X2IA 2H3IA 4P0PB 2BPFA 2IOHA 4MHVA 4ED6A 3TACB 5J0RA 5F9LA 1SV0A 1XO1A 1ZQQA 3NRZA 4OJ6A 5AM0A 2HHVA 4UARA 3RH4A 1PVQA 3TFSA 2HOIA 2C2DA 4PL1A 5TISU 2JMGA 4TUQA 2D3DA 4YR0A 2MU2A 1ZQIA 2KFNA 4J9QA 1L8OA 1ZRMA 2ZIUA 4F4ZA 2W43A 2DPIA 4UAZA 5AI8A 1BNOA 2KEYA 3UMBA 5CB1A 5KFTA 2WB1F 3GIIA 5J8YC 1IV8A 3RH5A 2IOFA 5KFIA 1QQ5A 1NOMA 2JHDA 4DFDA 1ZJNA 5DGBA 4RQ2A 4RQMA 3TI0A 2F77X 5DB6A 1DK2A 5ALTA 2KFZA 7ICSA 3V72A 1LKYB 3RRGA 4YFKA 1OXJA 3K4GA 4DQIA 3RJIA 4KLGA 4YMNA 2LMRA 5DQGA 4QZGA 2W7OA 1JN3A 5ALOA 4FS1A 2KTQA 1NZPA 4NWIA 4US8A 2C28A 1NNLA 4IQUA 3GV7B 2Y1JA 2ESEA 1NKCA 5D49A 3JPOA 1SV4A 1V85A 3M1YA 1CEZA 3GV5B 3NASA 2KIVA 3AQFA 1NK5A 2BGWA 2M0NA 4EBCA 5DBAA 4NLKA 5AM4A 3G6VA 1N63A 2DGZA 3D2NA 2C22A 2XGPA 3E0FA 2RLTA 1WG8A 1ZQFA 2RQ5A 2V4RA 3H8JA 3IM1A 3SZ2A 2M9NA 1NJXA 3GIMA 5L1IA 4UAVA 4YR2A 2ZTCA 2IOFK 3M8SA 4PHEA 2LPEA 4DSFA 1NK7A 1RXWA 4RPZA 2LYHA 2VKQA 3H7IA 3OSPA 2WAQC 2KHQA 2EZYA 2RRDA 4BDPA 2RDJA 1S0VA 3S6JA 1MQ3A 1F44A 4P4MA 4I2IA 1LKYA 1LVHA 4QZ9A 4ECRA 1VLBA 1JXEA 2PFNA 5KG6A 2ZTEA 5DB8A 3C2KA 4HYKA 3D2SA 5AKXA 3OJUA 2ZTDA 3T3FA 5C5JA 2F1IA 7ICFA 2WF7A 4O3NA 3V7LA 4UAYA 3OHBA 3ALRA 4GXJA 4NL9A 3ED5A 3G6YA 2XY7A 2ASDA 2Y0SF 7ICQA 1XSNA 1ZQRA 3ZDCA 5CEHA 4OJOA 5DBCA 1ZQKA 4O3SA 9ICWA 5IIIA 5L9XA 1NJWA 3KKAC 5J0TA 1WCNA 4F8RA 1MSWD 2C2EA 2RP5A 4KLUA 3HKZC 1KBUA 1J2MA 5EE9A 4Y2RA 4M9JA 4YP3A 3KTQA 1JI7A 1DXSA 2W03A 2I1QA 5KG4A 5HHIA 1U4BA 5IILA 5KFQA 4O3MA 4ECXA 4LZGA 5DKWA 4RQ3A 3IP4B 2KG5A 3QU2A 3BS7A 5KAFU 3PSTA 3HRDD 2FMPA 1D8LA 4F5QA 4C80A 1BPZA 2ZIWB 1JUDA 1HUZA 3KOOA 4KITB 4PGQA 4F5OA 4UBCA 2UVRA 7ICNA 1D8BA 4IR1A 3RAQA 3VCBA 2JH7A 1TAQA 4F2SA 2HBKA 1OW5A 5AKIA 3NS1A 3QUTA 4MEXA 4WJ3B 4Y2QA 1JMSA 2ZIXA 3H8MA 5AKLA 3ORYA 1UPHA 5KFSA 2AGPA 4KLLA 3A0HU 3AMZA 5KG3A 5DBBA 5HNKA 3RAXA 5ALQA 3THVA 4P0QA 5DG7A 1JROA 4R8UA 1FEZA 1T8EA 2NRVA 2OWOA 4QZFA 5DG8A 4YR3A 3TKAA 2D6FC 1C20A 9ICFA 4OJ5A 1SKSA 4PGXA 2ZUCA 1Q3UA 5ALZA 5KFGA 3GV8B 1S97A 4UAWA 5IIKA 2GWSA 4Q8EA 3MFIA 2LYAA 8ICKA 3RBDA 3QU9A 4QZHA 3BQTA 1Z19A 3AN1A 9ICIA 2Q0ZX 5HMLA 3MR6A 1SL1A 1JXLA 3T5LA 1SV0C 9ICBA 3TQ1A 3PW0A 3RR8A 2EAPA 4CE6A 4KLDA 4J9SA 3GILA 8ICAA 4RQNA 1O03A 1ED1A 4EEYA 2BQRA 3K1ZA 9ICQA 3HT3A 4RT2A 2KE7A 5J0OA 2FPKA 2ZIVA 2KHVA 5KNIA 4CF3A 5J2IA 2EH9A 4BJQA 5DQHA 2HOQA 4QZEA 5KFMA 4O9MA 3T79A 2Y1IA 3MC1A 3WKEA 5KFLA 1S76D 4RPYA 1O08A 2K4EA 2K8AA 4F93B 3T5KA 4PPXA 2KVCA 2YMPA 2K8BB 2VJ5A 4IRCA 7ICLA 5CP2A 2ASLA 3PO5A 4IS7A 4PH5A 1PK3A 5KFDA 4C0ZA 2ZXIA 4CCHA 2W8LA 4DL6A 2PMZF 4EELA 5ALIA 3L5KA 1WCLA 4I2GA 3IG5A 5KT3A 4Q45A 8ICXA 5KFEA 5AK6A 3BQ2A 1KW4A 8ICUA 2IHMA 4ED8A 5BOMA 1WWVA 9ICSA 2KJ5A 2G09A 2GLEA 1Z4NA 3RFAA 2FLPA 3ETRA 4B9UA 2JR5A 2E1EA 8ICQA 2NV3A 5HP4A 2ISOA 3RB6A 1FFVA 4O3PA 2XC9A 1L3UA 2G07A 5AKYA 4OJPA 1F5SA 4AYBF 2JXJA 3M9MB 2K89A 4YMOA 4DF4A 2EANA 2W9AA 2QKQA 1PK1B 2EAMA 4ZOHC 4TUPA 2KKVA 3CRXA 4C8NA 3RJFA 4KLFA 3LWMA 3PO4A 4KTQA 4JB3A 2W9CB 3I1YA 4BUGA 4F5NA 1PVPA 3HJEA 4UQGA 1NZBA 2KV2A 4DQRA 4O5CA 3C5GA 1N60A 2JEGA 4GXKA 4FBTA 1URJA 4FZLA 1S8OA 3RRHA 3UMGA 4B9VA 2A1JA 2E3TA 4Y2SA 4P4PA 4F92B 3ICXA 3PZPA 4IQTA 4F72A 1LB2B 4GLXA 4ELTA 3HW8A 1KLNA 1KFDA 2ZIWA 3C5FA 1ZQPA 2UVVA 4R66A 4QWBA 1N56A 4US9A 5KT6A 3D6JA 4DQQA 8ICTA 3L3FX 2XCAA 1NK6A 1DGJA 8ICLA 1UA1A 5KL1B 4KN7A 1YZ7A 4NLBA 1CRXA 4IQVA 3BDPA 2FMSA 3FDSA 2WHEA 5ALFA 5J2GA 5G5HA 3SV3A 2BCVA 1TKDA 4QZ8A 1QSYA 2XVTA 5H2FU 3E58A 2DF4B 3L4PA 1K1QA 3AL0B 5J0UA 4J9MA 4ED0A 2K4HA 2C2RA 1EXNA 3PR5B 1X40A 4RZRA 4F4WA 1SGGA 5AI4A 2ES6A 3WK9A 5IIJA 1L3VA 5K4LA 4EX6A 2NRZA 4KLEA 4O3OA 5JU5A 2J6UA 2ODGA 4JWMA 4LVSA 4LJXA 5KFWA 3VC8A 5AI5A 1Y88A 4MFCA 4QZBA 1GO3F 5AIBA 4I2HA 1ZETA 1FFUA 4KLMA 5DDMA 5KFNA 2Z7JA 4NJ8A 5A0LA 3TANA 2OEHA 5CRXA 1T94A 1XWLA 2MA1A 2DUYA 1MA7A 1TE2A 3Q8PB 9ICRA 4M6WB 4NV0A 4RNMA 3LK9A 3MBYA 2E1FA 5AKJA 1J97A 4DOBA 1BPEA 3T5HA 2ATLA 1BPDA 3B0XA 2B0CA 4GC7A 8ICEA 1Z1VA 5AK3A 7ICRA 3SENA 2CPRA 5KT5A 4DFJA 2HVIA 3JPTA 2P66A 3MGVA 3F2BA 4PHDA 4CDGA 1DK3A 5HMMA 3GIKA 5B5EU 2BCRA 3UQ0A 4NLCA 2F1JA 2BCUA 1L7PA 4Y2XA 3QU7A 4DS4A 5AI6A 4BGDA 2HBJA 4FZNA 5ALSA 4G9BA 5FP0A 5L1KA 4BWJA 1ZOLA 1WYGA 3PW7A 3PNCA 5F3XB 3TADC 3MDCA 4DCCA 4MEYA 2HVHA 3CW2C 3QU4A 1ZQMA 4DSJA 2I5HA 1IG6A 5ALKA 3WK7A 3WK4A 1JIHA 5AICA 4CF5A 2J6SA 3BS5A 5KFHA 3QU5A 3UMCA 4YMMA 1ZQGA 3MGHA 2BCSA 3QX7A 8ICSA 1X9WA 2OXOA 3SQIA 4M04A 4ED7A 5JTIA 1RYSA 3ETLA 4QIWC 3GQCA 3PY8A 1JX4A 3UXPA 4BXOB 7ICJA 1SB3C 3PX6A 5AIAA 3DV9A 1RQLA 3PX4A 3PX0A 1S77D 3UPQA 5G5GA 4ACOA 9ICCA 2FE9A 2P35A 2KD1A 5ALYA 3IN5A 3LVWA 2DKXA 4ELUA 1X66A 4P2HA 2WTFA 4ED2A 2HBMA 4YG2A 2HHTA 3RJHA 3PW5A 5J0XA 9ICTA 4E0DA 2LM1A 1PZNA 3M6KA 4HAIA 2YB4A 1X9SA 2W3RA 4CF4A 8ICYA 5DQIA 3OPXA 1BPYA 2IBKA 4DL3A 5KFYA 3B9JA 3FM9A 2O6KA 3KHGA 5DLFA 1ZQDA 5KFCA 4KX5A 2KSOB 4ELVA 3M7DA 3RR7A 4K4IA 3GU3A 3K1RB 1A76A 8ICGA 4NY8A 3G6XA 2H5XA 2YMMA 1L5UA 2KJ9A 5T14A 3PW4A 3D2QA 1T3NA 2HBLA 3DEEA 2F2AB 2KVSA 4ECQA 5J2JA 2MSNA 3IHQB 3HWTA 1HUOA 4MFFA 2F8KA 4F4KA 4NM1A 3H0LB 5L1JA 2UVUA 3NUQA 3RB3A 1QSLA 9ICPA 3SAFA 1U45A 4DQSA 5CA7A 3EWAA 2OCEA 4DLEA 1SKRA 1SZPA 1N5XA 2YY6A 2V9WA 3H0RB 4C4RA 1Z4OA 4PGYA 4QIWF 1PVRA 5BPCA 4QJFB 1QSSA 4Z6DA 1ZYQA 5DDYA 2YMQA 5KFUA 1TK8A 4Y2UA 1NKBA 3ZD8A 1S0NA 2NRTA 4UB6U 1X9XA 4M0AA 5EE1A 2KK0A 2K8CB 3V7JA 1U48A 1TV9A 2W9MA 3AU2A 1UT5A 2HCFA 5EWGA 1L8LA 1HIWA 2QB0B 5ALJA 3RTVA 5E79U 2AH5A 5ALVA 4NLZA 4DSKA 4KX3A 4NL9C 3E2EA 3C28A 2NRXA 3RB0A 9ICLA 1Z00B 2ZG6A 2QB0A 3TADA 3EPIA 1WUDA 2PMZC 2VIXA 9ICUA 1BPXA 3RH6A 4K4GA 2PFOA 3BQ1A 4KN4A 5KG7A 2G5IB 3Q8QB 4MFAA 4DL2A 1IIPA 2YX8A 2FPMA 2MUTB 5AI0A 4I29A 4OO1J 2ALZA 2OHFA 4Q44A 3ZI4A 5KFRA 1L7MA 4Z6EA 1BPBA 2A3VA 2B6GA 4B9MA 3F2CA 1BNPA 1BVSA 3NVVA 2AQ0A 1B0XA 5J8YA 3ONNA 3RBEA 4AP9A 2W9BA 2ZJ8A 5KFJA 8ICNA 1NJZA 1L3SA 4DWIA 2ISPA 3SV4A 3PVXA 1S9FA 4DSEA 2GH1A 4KLIA 3HPOA 8ICOA 2PKEA 4QWEA 4F4YA 2YB1A 3PMLA 2H3QA 9ICKA 3QEBZ 1Q46A 4ECUA 1RYUA 3BQ0A 5ALRA 1U47A 5DGAA 1XO0A 2RDIA 5J0QA 3C21A 4ZH4A 3CP8A 1XSPA 3WK5A 3BJYA 4LZDA 4JV1A 4XRHA 2OH2A 4A8EA 3KZIU 4J9NA 3SMVA 1UHUA 4TQRA 1QLNA 1V38A 5KG5A 4UASA 4DSIA 5KAIU 4DFPA 5J2FA 3KHLA 2PI5A 1ZQTA 1ZQCA 4B6JA 4XUSA 4RQ8A 4YD1A 4Y2YA 2JRZA 5KFBA 1ZQSA 2HHXA 3HX0A 1ZQVA 2PFQA 5EWEA 1RZTA 3MR5A 3I76A 4RPXA 1QH9A 2YMLA 5CJ7A 5J2CA 3TFRA 4YD2A 3FYHA 3N7RC 2H3FA 1JALA 4ECWA 3N97B 3WKDA 4NLGA 2AU0A 2KN7A 1ZQEA 3LVVA 4Z6CA 9ICMA 3PSIA 1ZQLA 2BQUA 1MC8A 1RPLA 5ALNA 2BQ3A 5AHXA 4B9SA 2LHTA 2H3ZA 1SL0A 4RQ6A 3GIJA 3EW9A 4AYBC 3PW2A 5J2AA 4TUSA 2BPGA 1NKEA 2JEJA 4I2FA 4O5KA 4YQWA 5L1LA 1WWUA 5KFAA 3IG8A 1B43A 1F0MA 4F2RA 5AM5A 3SR6A 2XICA 3C23A 5AKGA 5AKZA 2BPCA 3NVZA 3F53A 1RXVA 3QZ7A 1TFRA 3OTQA 3JPNA 4UAUA 2WF8A 3C29A 1ZXIA 1Z3EB 5J0YA 4QWDA 8ICPA 5JUMA 8ICCA 2LBOA 2EQYA 2QARA 1YZ6A 3IV6A 2VA3A 1NK0A 3Q8RB 3N28A 4OJLA 2GO7A 9ICXA 2E8NA 2LKYA 2QB1A 1XSLA 1XS9D 2Y0SC 4RNNA 4O3QA 3F5EA 4RQ4A 4TURA 3JPSA 3NGDA 5IINA 1ZQWA 4RUAA 1X9MA 1KKXA 9ICAA 1ZQAA 5DLGA 1RQNA 2DPJA 4J9OA 7ICMA 1ZQJA 4C8MA 3FC4A 3PMNA 5HHHA 5KT2A 5D4BA 2DFLA 4ICAA 2HI0A 3AU6A 4BXOA 2R8HA 4DO9A 3AEVA 4KLHA 1ZD4A 1Z1BA 5ALLA 4O0IA 2WF6A 2XY5A 1N62A 2MRLA 4B9TA 4C4SA 3M9NB 5GTIU 4R63A 1KDHA 1NK8A 2F1HA 2KMDA 1D9DA 4KLJA 7ICKA 3KFUF 4I2JA 1KRPA 9ICGA 3UXOA 5AM1A 1K5OA 4UB5A 2XCPA 4QZIA 4FS2A 5AKHA 3OGUA 3M9OB 5AKEA 4YXMA 3C2MA 2R8GA 5EOZA 4FBUA 2JZBA 2HMXA 4F50A 2W55A 4GXIA 3C1YA 5F9NA 2VJ4A 4UB1A 4EZ6A 3H4BA 3SAHA 3TAQA 3IDWA 1L3TA 5EE3A 2FLLA 1FIQA 2FMQA 2KSOA 4UB8U 1A77A 4PHPA 3R9KA 5J29A 2MAXA 4JWNA 1ZD3A 2NYVA 2UVWA 1ZQ1C 4C7ZA 3QZ8A 1V97A 4TQSA 2KOBA 9ICEA 1K1SA 3KBBA 3ZD9A 4DEZA 2GOLA 2HHSA 3H4DA 5B66U 4M9HA 2E5SA 8ICIA 9ICHA 2R8IA 2BR0A 2G0AA 3ZDAA 1P7DA 1VJ5A 4PJ0U 4M6WA 5KFZA 2G5HB 1OUQA 4FO6A 4EX7A 5KG1A 2NRWA 1PK1A 5BOLA 4C8OA 2W54A 2ZJAA 3ZDBA 7ICPA 4J9RA 4KLTA 4M9LA 4ECZA 2WF5A 2AGOA 4PZNA 2E8MA 2DBYA 2DL0A 2KZZA 2QARB 2W11A 1CUKA 3Q8LA 3QXGA 1B22A
chains in the Genus database with same CATH topology
4Q8EA 5KFVA 4RNOA 3TARA 3MFIA 2W9BB 4DLEA 4YVZA 8ICKA 2KZ3A 2BKEA 1SKRA 7ICEA 5KT7A 4B9LA 3RBDA 4QZDA 1SZPA 3ISCA 4RQ7A 4QZHA 4F4XA 2V9WA 3BQTA 4ED1A 1H38A 1S0OA 4J9PA 2XGQA 4PGYA 1COOA 4C8LA 4ECSA 4PHAA 5BPCA 1HJPA 1QSSA 8ICHA 4QWCA 9ICIA 4M9NA 4Z6DA 2KZMA 1ZYQA 2Q0ZX 5DDYA 5KFUA 1TK8A 1NKBA 7ICIA 3ZD8A 5HMLA 2MUTA 2FLNA 2IA6A 4DL4A 3MR6A 1SL1A 4C8KA 7ICGA 1S0NA 2NRTA 1JXLA 3T5LA 4P4OA 4M0AA 1TK5A 9ICBA 3TQ1A 3PW0A 3RR8A 8ICMA 5D46A 3V7JA 1SKWA 4KLDA 4J9SA 5DB9A 1U48A 4EBDA 1TV9A 4UB2A 2ZJ5A 2W9MA 3GILA 3AU2A 1S0MA 1UT5A 5EWGA 3ISBA 3Q8KA 8ICAA 1ZQHA 1U9LA 3V6HA 3RTVA 5KT4A 3V6KA 4EEYA 3K75D 1ZQBA 5KFKA 2BQRA 3RJEA 4DQPA 3V6JA 4NLZA 9ICQA 3JPRA 3HT3A 4RT2A 3QEAZ 5J0OA 2FPKA 4DSKA 1DOQA 1Z00A 1ZQUA 3ZDEA 3E2EA 5KFXA 4YXJA 2A1JB 4DFKA 3N4MB 3Q8MA 4RQ1A 3H8SA 4DOCA 2NRXA 1UT8A 5J2IA 3RB0A 3RJJA 9ICLA 7ICUA 1Z00B 5DQHA 4KLOA 4QZEA 5KFMA 1LV5A 4O9MA 4UB4A 2Y1IA 5KFLA 3LWLA 3EPIA 4RPYA 4KLSA 4DL5A 3T5KA 4F93B 1KEJA 1KTQA 2ASJA 1KSPA 4PPXA 4R8UB 9ICUA 1BPXA 3RH6A 4K4GA 3EYZA 9ICVA 4IRCA 2PFOA 4I2DA 7ICLA 5CP2A 3BQ1A 2ASLA 3PO5A 4KN4A 5KG0A 4RT3A 5KG7A 4IR9A 4B9NA 4PH5A 2IMWP 2J6TA 3Q8QB 4DOAA 2P6RA 4MFAA 5KFDA 4DS5A 4DL2A 2FPMA 2MUTB 4I29A 4CCHA 2W8LA 4DL6A 2ALZA 3Q8SB 3LDAA 4Q44A 1ZQOA 8ICJA 4ECYA 5KFRA 3PR4A 1MQ2A 1NK4A 2HW3A 4Z6EA 7ICTA 1WCLA 2I9GA 5KTQA 1BPBA 4I2GA 9ICOA 4QZCA 1T7PA 3C2LA 4O3RA 4MF2A 4B9MA 8ICFA 1C7YA 4K4HA 1BVSA 2W8KA 4RQ5A 5KT3A 4Q45A 3QE9Y 2AQ0A 3JPQA 8ICXA 1KFTA 1TVAA 5J2BA 2HHUA 3KHRA 5KFEA 4XA5A 3RBEA 3BQ2A 8ICUA 2W9BA 1AROP 2IHMA 2AJQA 2ZJ8A 4ED8A 5KFJA 5BOMA 1SL2A 1KFSA 8ICNA 1NJZA 1L3SA 9ICSA 4DWIA 4YCXA 4EYHB 2ISPA 3SV4A 3H8WA 2VA2A 1T4GA 3PVXA 1S9FA 2ZUDA 3RJKA 7ICOA 4DSEA 2FLPA 4JK1A 4B9UA 4M2YA 4KLIA 3HPOA 8ICQA 8ICOA 4Z6FA 8ICZA 3NTUA 5J2KA 5HP4A 3RB4A 1X2IA 1ZQYA 4QWEA 3H40A 3RB6A 2ISOA 4F4YA 4O3PA 2V4QA 2XC9A 1TK0A 1L3UA 3PMLA 1UA0A 2BPFA 9ICKA 3QEBZ 3M9MB 4ED6A 5J0RA 5F9LA 4ECUA 1XO1A 4YMOA 1ZQQA 4DF4A 2W9AA 8ICWA 3BQ0A 2HHVA 4I28A 4TUPA 1U47A 5DGAA 4C8NA 3RJFA 3RH4A 4KLFA 2RDIA 3LWMA 3PO4A 4KTQA 2W9CB 3TFSA 5J0QA 3C21A 2C2DA 4ZH4A 4DF8A 1XSPA 2VANA 3BJYA 4LZDA 4TUQA 4F5NA 4IRKA 5IIMA 4YR0A 2PFPA 4JV1A 4XRHA 2AGQA 4UQGA 4J9NA 4DQRA 1ZQIA 4O5CA 2KFNA 4J9QA 4TQRA 1QLNA 3C5GA 5CWRA 4F4ZA 2JEGA 1XU4A 4GXKA 5KG5A 2DPIA 4FBTA 4UAZA 4DSIA 1RYRA 5CR0A 3RRHA 5KG2A 4B9VA 2A1JA 5J0PA 5CB1A 4YN4A 5KFTA 5KFFA 3GIIA 4DFPA 4P4PA 3RH5A 4F92B 5J2FA 3KHLA 2P6UA 4DLGA 2PI5A 4IQTA 5KFIA 1LB2B 4GLXA 4ELTA 1ZQTA 3HW8A 1KLNA 1KFDA 3C5FA 1ZQPA 1ZQCA 2UVVA 4F3OA 1NOMA 4R66A 4XUSA 4RQ8A 4QWBA 4YD1A 1N56A 5KT6A 5KFBA 1ZJNA 5DGBA 5DB7A 4RQ2A 4DQQA 8ICTA 1ZQSA 2XCAA 1NK6A 8ICLA 3TI0A 1UA1A 4F5RA 4KN7A 2HHXA 3HX0A 1ZQVA 2PFQA 4IQVA 4XQ8A 5DB6A 5EWEA 1RZTA 2FMSA 3MR5A 3BDPA 3FDSA 5J2GA 4RPXA 2JEIA 2KFZA 7ICSA 3V72A 1IXRA 3RRGA 4YFKA 5CJ7A 5J2CA 3SV3A 1TKDA 2BCVA 3TFRA 3K4GA 4QZ8A 1QSYA 3RJIA 4DQIA 4KLGA 1DGSA 4RU9A 4YMNA 5DQGA 4J9LA 4YD2A 3FYHA 4UB3A 4QZGA 1BGXT 1JN3A 1K1QA 4FS1A 3V7KA 5J0UA 4J9MA 4ECWA 3N97B 3C1ZA 2KTQA 2R8JA 1V9PA 5J0SA 2AU0A 4NLGA 4ED0A 4F91B 1NK9A 2C2RA 2KN7A 1ZQEA 1EXNA 2PXIA 4QW9A 2C28A 4IQUA 3PR5B 3GV7B 4RZRA 4F4WA 4Z6CA 2Y1JA 9ICMA 8ICRA 4DL7A 1ZQLA 2BQUA 1MC8A 1RPLA 2BQ3A 1NKCA 5D49A 5IIJA 1L3VA 4B9SA 2NRZA 1ZQNA 3JPOA 3MDAA 4NLNA 4O3OA 4KLEA 2J6UA 4JWMA 4LVSA 1SL0A 1CEZA 5KFWA 3GV5B 4RQ6A 3GIJA 1Y88A 3EW9A 4MFCA 1NK5A 4QZBA 3PW2A 2BGWA 5J2AA 4TUSA 5DBAA 4EBCA 4I2HA 4NLKA 2BPGA 1ZETA 3G6VA 1NKEA 4QWAA 2JEJA 4I2FA 5DDMA 4KLMA 5IIOA 4O5KA 2W9CA 2C22A 4YQWA 2B21A 5KFNA 5L1LA 2XGPA 5KFAA 4X5VA 1B43A 4ED3A 3TANA 4F2RA 4NXZA 1IM4A 1ZQFA 3SI8A 3C23A 3B0YA 2BPCA 1XWLA 2V4RA 1S10A 1RXVA 3H8JA 3QZ7A 1TFRA 3Q8PB 3JPNA 3IM1A 3SZ2A 9ICRA 4M6WB 8ICVA 3AUOA 4RNMA 5KFOA 4KMUA 3LK9A 2M9NA 1Z3EB 5J0YA 4QWDA 1NJXA 3GIMA 3MBYA 8ICPA 7ICHA 5L1IA 4F5PA 4YR2A 2ZTCA 5JUMA 4DOBA 1BPEA 3T5HA 8ICCA 3M8SA 4J9KA 4PHEA 2HHQA 4DSFA 2ATLA 1BPDA 3B0XA 4GC7A 1NK7A 1RXWA 8ICEA 4RPZA 4I2BA 2LYHA 7ICRA 3H7IA 1D9FA 1B22A 3OSPA 2VA3A 1NK0A 4RQ0A 5KT5A 4DFJA 3SYZA 3Q8RB 2HVIA 4BDPA 3OHAA 2FPLA 3JPTA 5J0WA 2P66A 4KLQA 4G3IA 2RDJA 4PHDA 1S0VA 5HMMA 1MQ3A 9ICXA 3GIKA 1D8YA 2BCRA 1XSLA 1XS9D 3UQ0A 4P4MA 3GDXA 2F1JA 1XC9A 4I2IA 2BCUA 4I2EA 4RNNA 4QZ9A 4R65A 2HHWA 4ECRA 4DS4A 1JXEA 4O3QA 4RQ4A 4BGDA 4TURA 3JPSA 2PFNA 5KG6A 1ZJMA 3NGDA 2ZTEA 5DG9A 5IINA 4Q8FA 5L1KA 1ZQWA 4RUAA 1X9MA 5DB8A 4EZ9A 4Q43A 9ICAA 1ZQAA 5DLGA 4JUZA 3C2KA 4BWJA 4HYKA 2DPJA 1TAUA 3OJUA 1S76D 2ZTDA 3T3FA 3PW7A 5C5JA 3PNCA 3RJGA 3MDCA 3OJSA 4J9OA 2F1IA 3EPGA 7ICFA 4MEYA 4NM2A 1ZQJA 7ICMA 4C8MA 4O3NA 3V7LA 4BWMA 3PMNA 2HVHA 7ICVA 4UAYA 3OHBA 1ZQMA 5HHHA 4DSJA 5KT2A 5D4BA 2DFLA 3AU6A 4BXOA 4GXJA 2R8HA 4DO9A 4RUCA 4KLHA 3G6YA 1JIHA 2XY7A 2J6SA 2ASDA 5KFHA 4O0IA 3HP6A 3GFKB 2XY5A 4M9GA 1XSNA 7ICQA 4GC6A 4YMMA 1ZQRA 3ZDCA 1ZQGA 4ECVA 4B9TA 3M9NB 3MGHA 2BCSA 2IHNA 4R63A 8ICSA 1X9WA 1KDHA 3JPPA 1NK8A 1U49A 4R64A 5DBCA 2F1HA 4M04A 4KLJA 1D9DA 4ED7A 4UBBA 1ZQKA 4O5EA 4O3SA 1RYSA 7ICKA 4I2JA 1KRPA 2R8KA 9ICGA 9ICWA 5IIIA 3UXOA 1QTMA 5L9XA 3ETLA 1NJWA 4UB5A 2XCPA 4QZIA 5J0TA 4FS2A 3GQCA 9ICJA 1WCNA 4F8RA 1MSWD 5J2EA 3OGUA 2C2EA 4KLUA 3PY8A 3M9OB 1JX4A 3UXPA 4YXMA 4BXOB 7ICJA 3C2MA 2R8GA 5EOZA 3ISDA 4FBUA 1S97A 2JZBA 3PX6A 4M9JA 4YP3A 4F50A 3KTQA 4GXIA 3UXNA 3EZ5A 3C1YA 3PX0A 3PX4A 5F9NA 4EZ6A 4UB1A 1S77D 2JZBB 3H4BA 3UPQA 3TAQA 4IQWA 8ICBA 2I1QA 5KG4A 5HHIA 1L3TA 9ICCA 2FLLA 1U4BA 5EWFA 5IILA 2FMQA 4ELUA 5KFQA 4P2HA 2WTFA 2JEFA 4ECXA 4LZGA 1A77A 4PHPA 4RQ3A 5DKWA 3MFHA 4ED2A 3ZDDA 4YG2A 3MR3A 5J29A 3UQ2A 3PW5A 3RJHA 2HHTA 4IRDA 5J0XA 2MAXA 1NJYA 4E0DA 3OSNA 3KHHA 4JWNA 9ICTA 2UVWA 1PZNA 2AQ4A 2FMPA 1D8LA 4F5QA 2BCQA 3QZ8A 4EYIB 4TQSA 1BPZA 1X9SA 1HUZA 9ICEA 4KITB 4JV0A 4PGQA 8ICYA 9ICNA 1K1SA 4F5OA 5DQIA 3ZD9A 4DEZA 1BPYA 4DL3A 2IBKA 4UBCA 2UVRA 7ICNA 4JV2A 3T5JA 2XY6A 4IR1A 2HHSA 5KFYA 3H4DA 3RAQA 4I2CA 1TAQA 5J2DA 5J2HA 4DFMA 4F2SA 4M9HA 2VA8A 4QZAA 4MEXA 8ICIA 3KHGA 5DLFA 9ICHA 2R8IA 2BR0A 3MR2A 1JMSA 1ZQDA 4ECTA 2ZUBA 5KFCA 5KFSA 3ORYA 3ZDAA 4ELVA 4EBEA 2AGPA 2BDPA 2BHNA 3RR7A 4KLLA 4K4IA 4DSLA 4M6WA 5KFZA 4I27A 5KG3A 4I2AA 1A76A 1ZQXA 8ICGA 4FO6A 4NY8A 3G6XA 3PV8A 3MGIA 5KG1A 5DBBA 4M47A 5HNKA 3RAXA 2NRWA 2H5XA 1L5UA 3THVA 5TZVA 3PW4A 5DG7A 5BOLA 4R8UA 1T3NA 4C8OA 1T8EA 2NRVA 2ZJAA 2OWOA 4QZFA 3ZDBA 7ICPA 4ECQA 5KFPA 4J9RA 4KLTA 4M9LA 5DG8A 5J2JA 3IHQB 4YR3A 3HWTA 4ECZA 3TAPA 1HUOA 4MFFA 4F4KA 2AGOA 4NM1A 2XO7A 5L1JA 3MABA 2UVUA 9ICFA 3RB3A 1QSLA 2KZZA 9ICPA 4QW8A 3M8RA 1N48A 1SKSA 5CHGA 4PGXA 2ZUCA 1ZQZA 1CUKA 3Q8LA 1U45A 4MF8A 2PI4A 5KFGA 4DQSA 3GV8B 5CA7A 4UAWA 3EWAA 5IIKA 2GWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8E A;  5KFV A;  4RNO A;  3TAR A;  3MFI A;  2W9B B;  4DLE A;  4YVZ A;  8ICK A;  2KZ3 A;  2BKE A;  1SKR A;  7ICE A;  5KT7 A;  4B9L A;  3RBD A;  4QZD A;  1SZP A;  3ISC A;  4RQ7 A;  4QZH A;  4F4X A;  2V9W A;  3BQT A;  4ED1 A;  1H38 A;  1S0O A;  4J9P A;  2XGQ A;  4PGY A;  1COO A;  4C8L A;  4ECS A;  4PHA A;  5BPC A;  1HJP A;  1QSS A;  8ICH A;  4QWC A;  9ICI A;  4M9N A;  4Z6D A;  2KZM A;  1ZYQ A;  2Q0Z X;  5DDY A;  5KFU A;  1TK8 A;  1NKB A;  7ICI A;  3ZD8 A;  5HML A;  2MUT A;  2FLN A;  2IA6 A;  4DL4 A;  3MR6 A;  1SL1 A;  4C8K A;  7ICG A;  1S0N A;  2NRT A;  1JXL A;  3T5L A;  4P4O A;  4M0A A;  1TK5 A;  9ICB A;  3TQ1 A;  3PW0 A;  3RR8 A;  8ICM A;  5D46 A;  3V7J A;  1SKW A;  4KLD A;  4J9S A;  5DB9 A;  1U48 A;  4EBD A;  1TV9 A;  4UB2 A;  2ZJ5 A;  2W9M A;  3GIL A;  3AU2 A;  1S0M A;  1UT5 A;  5EWG A;  3ISB A;  3Q8K A;  8ICA A;  1ZQH A;  1U9L A;  3V6H A;  3RTV A;  5KT4 A;  3V6K A;  4EEY A;  3K75 D;  1ZQB A;  5KFK A;  2BQR A;  3RJE A;  4DQP A;  3V6J A;  4NLZ A;  9ICQ A;  3JPR A;  3HT3 A;  4RT2 A;  3QEA Z;  5J0O A;  2FPK A;  4DSK A;  1DOQ A;  1Z00 A;  1ZQU A;  3ZDE A;  3E2E A;  5KFX A;  4YXJ A;  2A1J B;  4DFK A;  3N4M B;  3Q8M A;  4RQ1 A;  3H8S A;  4DOC A;  2NRX A;  1UT8 A;  5J2I A;  3RB0 A;  3RJJ A;  9ICL A;  7ICU A;  1Z00 B;  5DQH A;  4KLO A;  4QZE A;  5KFM A;  1LV5 A;  4O9M A;  4UB4 A;  2Y1I A;  5KFL A;  3LWL A;  3EPI A;  4RPY A;  4KLS A;  4DL5 A;  3T5K A;  4F93 B;  1KEJ A;  1KTQ A;  2ASJ A;  1KSP A;  4PPX A;  4R8U B;  9ICU A;  1BPX A;  3RH6 A;  4K4G A;  3EYZ A;  9ICV A;  4IRC A;  2PFO A;  4I2D A;  7ICL A;  5CP2 A;  3BQ1 A;  2ASL A;  3PO5 A;  4KN4 A;  5KG0 A;  4RT3 A;  5KG7 A;  4IR9 A;  4B9N A;  4PH5 A;  2IMW P;  2J6T A;  3Q8Q B;  4DOA A;  2P6R A;  4MFA A;  5KFD A;  4DS5 A;  4DL2 A;  2FPM A;  2MUT B;  4I29 A;  4CCH A;  2W8L A;  4DL6 A;  2ALZ A;  3Q8S B;  3LDA A;  4Q44 A;  1ZQO A;  8ICJ A;  4ECY A;  5KFR A;  3PR4 A;  1MQ2 A;  1NK4 A;  2HW3 A;  4Z6E A;  7ICT A;  1WCL A;  2I9G A;  5KTQ A;  1BPB A;  4I2G A;  9ICO A;  4QZC A;  1T7P A;  3C2L A;  4O3R A;  4MF2 A;  4B9M A;  8ICF A;  1C7Y A;  4K4H A;  1BVS A;  2W8K A;  4RQ5 A;  5KT3 A;  4Q45 A;  3QE9 Y;  2AQ0 A;  3JPQ A;  8ICX A;  1KFT A;  1TVA A;  5J2B A;  2HHU A;  3KHR A;  5KFE A;  4XA5 A;  3RBE A;  3BQ2 A;  8ICU A;  2W9B A;  1ARO P;  2IHM A;  2AJQ A;  2ZJ8 A;  4ED8 A;  5KFJ A;  5BOM A;  1SL2 A;  1KFS A;  8ICN A;  1NJZ A;  1L3S A;  9ICS A;  4DWI A;  4YCX A;  4EYH B;  2ISP A;  3SV4 A;  3H8W A;  2VA2 A;  1T4G A;  3PVX A;  1S9F A;  2ZUD A;  3RJK A;  7ICO A;  4DSE A;  2FLP A;  4JK1 A;  4B9U A;  4M2Y A;  4KLI A;  3HPO A;  8ICQ A;  8ICO A;  4Z6F A;  8ICZ A;  3NTU A;  5J2K A;  5HP4 A;  3RB4 A;  1X2I A;  1ZQY A;  4QWE A;  3H40 A;  3RB6 A;  2ISO A;  4F4Y A;  4O3P A;  2V4Q A;  2XC9 A;  1TK0 A;  1L3U A;  3PML A;  1UA0 A;  2BPF A;  9ICK A;  3QEB Z;  3M9M B;  4ED6 A;  5J0R A;  5F9L A;  4ECU A;  1XO1 A;  4YMO A;  1ZQQ A;  4DF4 A;  2W9A A;  8ICW A;  3BQ0 A;  2HHV A;  4I28 A;  4TUP A;  1U47 A;  5DGA A;  4C8N A;  3RJF A;  3RH4 A;  4KLF A;  2RDI A;  3LWM A;  3PO4 A;  4KTQ A;  2W9C B;  3TFS A;  5J0Q A;  3C21 A;  2C2D A;  4ZH4 A;  4DF8 A;  1XSP A;  2VAN A;  3BJY A;  4LZD A;  4TUQ A;  4F5N A;  4IRK A;  5IIM A;  4YR0 A;  2PFP A;  4JV1 A;  4XRH A;  2AGQ A;  4UQG A;  4J9N A;  4DQR A;  1ZQI A;  4O5C A;  2KFN A;  4J9Q A;  4TQR A;  1QLN A;  3C5G A;  5CWR A;  4F4Z A;  2JEG A;  1XU4 A;  4GXK A;  5KG5 A;  2DPI A;  4FBT A;  4UAZ A;  4DSI A;  1RYR A;  5CR0 A;  3RRH A;  5KG2 A;  4B9V A;  2A1J A;  5J0P A;  5CB1 A;  4YN4 A;  5KFT A;  5KFF A;  3GII A;  4DFP A;  4P4P A;  3RH5 A;  4F92 B;  5J2F A;  3KHL A;  2P6U A;  4DLG A;  2PI5 A;  4IQT A;  5KFI A;  1LB2 B;  4GLX A;  4ELT A;  1ZQT A;  3HW8 A;  1KLN A;  1KFD A;  3C5F A;  1ZQP A;  1ZQC A;  2UVV A;  4F3O A;  1NOM A;  4R66 A;  4XUS A;  4RQ8 A;  4QWB A;  4YD1 A;  1N56 A;  5KT6 A;  5KFB A;  1ZJN A;  5DGB A;  5DB7 A;  4RQ2 A;  4DQQ A;  8ICT A;  1ZQS A;  2XCA A;  1NK6 A;  8ICL A;  3TI0 A;  1UA1 A;  4F5R A;  4KN7 A;  2HHX A;  3HX0 A;  1ZQV A;  2PFQ A;  4IQV A;  4XQ8 A;  5DB6 A;  5EWE A;  1RZT A;  2FMS A;  3MR5 A;  3BDP A;  3FDS A;  5J2G A;  4RPX A;  2JEI A;  2KFZ A;  7ICS A;  3V72 A;  1IXR A;  3RRG A;  4YFK A;  5CJ7 A;  5J2C A;  3SV3 A;  1TKD A;  2BCV A;  3TFR A;  3K4G A;  4QZ8 A;  1QSY A;  3RJI A;  4DQI A;  4KLG A;  1DGS A;  4RU9 A;  4YMN A;  5DQG A;  4J9L A;  4YD2 A;  3FYH A;  4UB3 A;  4QZG A;  1BGX T;  1JN3 A;  1K1Q A;  4FS1 A;  3V7K A;  5J0U A;  4J9M A;  4ECW A;  3N97 B;  3C1Z A;  2KTQ A;  2R8J A;  1V9P A;  5J0S A;  2AU0 A;  4NLG A;  4ED0 A;  4F91 B;  1NK9 A;  2C2R A;  2KN7 A;  1ZQE A;  1EXN A;  2PXI A;  4QW9 A;  2C28 A;  4IQU A;  3PR5 B;  3GV7 B;  4RZR A;  4F4W A;  4Z6C A;  2Y1J A;  9ICM A;  8ICR A;  4DL7 A;  1ZQL A;  2BQU A;  1MC8 A;  1RPL A;  2BQ3 A;  1NKC A;  5D49 A;  5IIJ A;  1L3V A;  4B9S A;  2NRZ A;  1ZQN A;  3JPO A;  3MDA A;  4NLN A;  4O3O A;  4KLE A;  2J6U A;  4JWM A;  4LVS A;  1SL0 A;  1CEZ A;  5KFW A;  3GV5 B;  4RQ6 A;  3GIJ A;  1Y88 A;  3EW9 A;  4MFC A;  1NK5 A;  4QZB A;  3PW2 A;  2BGW A;  5J2A A;  4TUS A;  5DBA A;  4EBC A;  4I2H A;  4NLK A;  2BPG A;  1ZET A;  3G6V A;  1NKE A;  4QWA A;  2JEJ A;  4I2F A;  5DDM A;  4KLM A;  5IIO A;  4O5K A;  2W9C A;  2C22 A;  4YQW A;  2B21 A;  5KFN A;  5L1L A;  2XGP A;  5KFA A;  4X5V A;  1B43 A;  4ED3 A;  3TAN A;  4F2R A;  4NXZ A;  1IM4 A;  1ZQF A;  3SI8 A;  3C23 A;  3B0Y A;  2BPC A;  1XWL A;  2V4R A;  1S10 A;  1RXV A;  3H8J A;  3QZ7 A;  1TFR A;  3Q8P B;  3JPN A;  3IM1 A;  3SZ2 A;  9ICR A;  4M6W B;  8ICV A;  3AUO A;  4RNM A;  5KFO A;  4KMU A;  3LK9 A;  2M9N A;  1Z3E B;  5J0Y A;  4QWD A;  1NJX A;  3GIM A;  3MBY A;  8ICP A;  7ICH A;  5L1I A;  4F5P A;  4YR2 A;  2ZTC A;  5JUM A;  4DOB A;  1BPE A;  3T5H A;  8ICC A;  3M8S A;  4J9K A;  4PHE A;  2HHQ A;  4DSF A;  2ATL A;  1BPD A;  3B0X A;  4GC7 A;  1NK7 A;  1RXW A;  8ICE A;  4RPZ A;  4I2B A;  2LYH A;  7ICR A;  3H7I A;  1D9F A;  1B22 A;  3OSP A;  2VA3 A;  1NK0 A;  4RQ0 A;  5KT5 A;  4DFJ A;  3SYZ A;  3Q8R B;  2HVI A;  4BDP A;  3OHA A;  2FPL A;  3JPT A;  5J0W A;  2P66 A;  4KLQ A;  4G3I A;  2RDJ A;  4PHD A;  1S0V A;  5HMM A;  1MQ3 A;  9ICX A;  3GIK A;  1D8Y A;  2BCR A;  1XSL A;  1XS9 D;  3UQ0 A;  4P4M A;  3GDX A;  2F1J A;  1XC9 A;  4I2I A;  2BCU A;  4I2E A;  4RNN A;  4QZ9 A;  4R65 A;  2HHW A;  4ECR A;  4DS4 A;  1JXE A;  4O3Q A;  4RQ4 A;  4BGD A;  4TUR A;  3JPS A;  2PFN A;  5KG6 A;  1ZJM A;  3NGD A;  2ZTE A;  5DG9 A;  5IIN A;  4Q8F A;  5L1K A;  1ZQW A;  4RUA A;  1X9M A;  5DB8 A;  4EZ9 A;  4Q43 A;  9ICA A;  1ZQA A;  5DLG A;  4JUZ A;  3C2K A;  4BWJ A;  4HYK A;  2DPJ A;  1TAU A;  3OJU A;  1S76 D;  2ZTD A;  3T3F A;  3PW7 A;  5C5J A;  3PNC A;  3RJG A;  3MDC A;  3OJS A;  4J9O A;  2F1I A;  3EPG A;  7ICF A;  4MEY A;  4NM2 A;  1ZQJ A;  7ICM A;  4C8M A;  4O3N A;  3V7L A;  4BWM A;  3PMN A;  2HVH A;  7ICV A;  4UAY A;  3OHB A;  1ZQM A;  5HHH A;  4DSJ A;  5KT2 A;  5D4B A;  2DFL A;  3AU6 A;  4BXO A;  4GXJ A;  2R8H A;  4DO9 A;  4RUC A;  4KLH A;  3G6Y A;  1JIH A;  2XY7 A;  2J6S A;  2ASD A;  5KFH A;  4O0I A;  3HP6 A;  3GFK B;  2XY5 A;  4M9G A;  1XSN A;  7ICQ A;  4GC6 A;  4YMM A;  1ZQR A;  3ZDC A;  1ZQG A;  4ECV A;  4B9T A;  3M9N B;  3MGH A;  2BCS A;  2IHN A;  4R63 A;  8ICS A;  1X9W A;  1KDH A;  3JPP A;  1NK8 A;  1U49 A;  4R64 A;  5DBC A;  2F1H A;  4M04 A;  4KLJ A;  1D9D A;  4ED7 A;  4UBB A;  1ZQK A;  4O5E A;  4O3S A;  1RYS A;  7ICK A;  4I2J A;  1KRP A;  2R8K A;  9ICG A;  9ICW A;  5III A;  3UXO A;  1QTM A;  5L9X A;  3ETL A;  1NJW A;  4UB5 A;  2XCP A;  4QZI A;  5J0T A;  4FS2 A;  3GQC A;  9ICJ A;  1WCN A;  4F8R A;  1MSW D;  5J2E A;  3OGU A;  2C2E A;  4KLU A;  3PY8 A;  3M9O B;  1JX4 A;  3UXP A;  4YXM A;  4BXO B;  7ICJ A;  3C2M A;  2R8G A;  5EOZ A;  3ISD A;  4FBU A;  1S97 A;  2JZB A;  3PX6 A;  4M9J A;  4YP3 A;  4F50 A;  3KTQ A;  4GXI A;  3UXN A;  3EZ5 A;  3C1Y A;  3PX0 A;  3PX4 A;  5F9N A;  4EZ6 A;  4UB1 A;  1S77 D;  2JZB B;  3H4B A;  3UPQ A;  3TAQ A;  4IQW A;  8ICB A;  2I1Q A;  5KG4 A;  5HHI A;  1L3T A;  9ICC A;  2FLL A;  1U4B A;  5EWF A;  5IIL A;  2FMQ A;  4ELU A;  5KFQ A;  4P2H A;  2WTF A;  2JEF A;  4ECX A;  4LZG A;  1A77 A;  4PHP A;  4RQ3 A;  5DKW A;  3MFH A;  4ED2 A;  3ZDD A;  4YG2 A;  3MR3 A;  5J29 A;  3UQ2 A;  3PW5 A;  3RJH A;  2HHT A;  4IRD A;  5J0X A;  2MAX A;  1NJY A;  4E0D A;  3OSN A;  3KHH A;  4JWN A;  9ICT A;  2UVW A;  1PZN A;  2AQ4 A;  2FMP A;  1D8L A;  4F5Q A;  2BCQ A;  3QZ8 A;  4EYI B;  4TQS A;  1BPZ A;  1X9S A;  1HUZ A;  9ICE A;  4KIT B;  4JV0 A;  4PGQ A;  8ICY A;  9ICN A;  1K1S A;  4F5O A;  5DQI A;  3ZD9 A;  4DEZ A;  1BPY A;  4DL3 A;  2IBK A;  4UBC A;  2UVR A;  7ICN A;  4JV2 A;  3T5J A;  2XY6 A;  4IR1 A;  2HHS A;  5KFY A;  3H4D A;  3RAQ A;  4I2C A;  1TAQ A;  5J2D A;  5J2H A;  4DFM A;  4F2S A;  4M9H A;  2VA8 A;  4QZA A;  4MEX A;  8ICI A;  3KHG A;  5DLF A;  9ICH A;  2R8I A;  2BR0 A;  3MR2 A;  1JMS A;  1ZQD A;  4ECT A;  2ZUB A;  5KFC A;  5KFS A;  3ORY A;  3ZDA A;  4ELV A;  4EBE A;  2AGP A;  2BDP A;  2BHN A;  3RR7 A;  4KLL A;  4K4I A;  4DSL A;  4M6W A;  5KFZ A;  4I27 A;  5KG3 A;  4I2A A;  1A76 A;  1ZQX A;  8ICG A;  4FO6 A;  4NY8 A;  3G6X A;  3PV8 A;  3MGI A;  5KG1 A;  5DBB A;  4M47 A;  5HNK A;  3RAX A;  2NRW A;  2H5X A;  1L5U A;  3THV A;  5TZV A;  3PW4 A;  5DG7 A;  5BOL A;  4R8U A;  1T3N A;  4C8O A;  1T8E A;  2NRV A;  2ZJA A;  2OWO A;  4QZF A;  3ZDB A;  7ICP A;  4ECQ A;  5KFP A;  4J9R A;  4KLT A;  4M9L A;  5DG8 A;  5J2J A;  3IHQ B;  4YR3 A;  3HWT A;  4ECZ A;  3TAP A;  1HUO A;  4MFF A;  4F4K A;  2AGO A;  4NM1 A;  2XO7 A;  5L1J A;  3MAB A;  2UVU A;  9ICF A;  3RB3 A;  1QSL A;  2KZZ A;  9ICP A;  4QW8 A;  3M8R A;  1N48 A;  1SKS A;  5CHG A;  4PGX A;  2ZUC A;  1ZQZ A;  1CUK A;  3Q8L A;  1U45 A;  4MF8 A;  2PI4 A;  5KFG A;  4DQS A;  3GV8 B;  5CA7 A;  4UAW A;  3EWA A;  5IIK A;  2GWS A; 
#chains in the Genus database with same CATH topology
 2G08 A;  2ZIU B;  4RNO A;  2XID A;  2KZ3 A;  2BKE A;  5KT7 A;  4B9L A;  2FI1 A;  4CGZ A;  4ED1 A;  4J03 A;  4J9P A;  2XGQ A;  2AHO B;  2F76 X;  2JH1 A;  3BZK A;  4ECS A;  1HJP A;  8ICH A;  4QWC A;  2KZM A;  7ICI A;  5ALM A;  2IA6 A;  4C8K A;  2OM6 A;  4P4O A;  1TK5 A;  2E8O A;  5DB9 A;  1M6Y A;  3NRW A;  1A6S A;  2F3N A;  3V6H A;  3V6K A;  5KFK A;  2A19 A;  3V6J A;  1SXD A;  3QEA Z;  3SAG A;  5KFX A;  3Q8M A;  2A1J B;  4DFK A;  3N4M B;  4DOC A;  3RJJ A;  2K4P A;  7ICU A;  5ALP A;  4GIB A;  2OYY A;  4KLO A;  1UQV A;  4UB4 A;  3LWL A;  3PSP A;  4KLS A;  4DL5 A;  2EDU A;  2ASJ A;  3A0B U;  3EYZ A;  4I2D A;  2KIW A;  1RDF A;  3H0M B;  5KG0 A;  4IC9 A;  2IMW P;  2P6R A;  4DS5 A;  1DRG A;  2DQN B;  5KL8 B;  3QYP A;  3LDA A;  1ZQO A;  4ECY A;  1MQ2 A;  2KNJ A;  2HW3 A;  7ICT A;  4U7C A;  2I9G A;  4Y2T A;  1ZD5 A;  3C2L A;  4O3R A;  8ICF A;  3LYS A;  4K4H A;  2W8K A;  4RQ5 A;  3QE9 Y;  1KFT A;  1TVA A;  2HHU A;  3KHR A;  3SD7 A;  1SL2 A;  2CXY A;  1KFS A;  4YCX A;  3H8W A;  1T4G A;  5C0Y A;  2ZUD A;  3RJK A;  4JK1 A;  2DWQ A;  4Z6F A;  8ICZ A;  4JMU A;  3WKB A;  3NTU A;  5J2K A;  1ZQY A;  2W3S A;  3H40 A;  2LYB A;  5AM3 A;  2V4Q A;  1TK0 A;  4Y2J A;  1UA0 A;  5AKK A;  2KJ8 A;  5AK5 A;  1ZD2 P;  5ALE A;  1N61 A;  8ICW A;  4I28 A;  1KQQ A;  2L5Y A;  1X42 A;  4DF8 A;  2EZZ A;  2DKZ A;  2VAN A;  4IRK A;  5IIM A;  2PFP A;  2AGQ A;  5ALU A;  5L1M A;  3WKA A;  5ALD A;  5CWR A;  1XU4 A;  2YQE A;  1RYR A;  5CR0 A;  5KG2 A;  5J0P A;  4YN4 A;  4P0P A;  5KFF A;  3N7S C;  3BS5 B;  1KL9 A;  2P6U A;  4DLG A;  4FFD A;  4F3O A;  5DB7 A;  4UW9 A;  2K60 A;  4F5R A;  3WU2 U;  4C4T A;  2W04 A;  4XQ8 A;  3QUB A;  1ECW A;  3KD3 A;  1QQ6 A;  2JEI A;  1IXR A;  2LM4 A;  2LI6 A;  2KP7 A;  1DGS A;  3BQ7 A;  4RU9 A;  4J9L A;  4UB3 A;  1BGX T;  1FO4 A;  3V7K A;  3C1Z A;  2R8J A;  3O0F A;  1V9P A;  5J0S A;  4F91 B;  1NK9 A;  1L7O A;  2PXI A;  4QW9 A;  2EZX A;  4PL2 A;  8ICR A;  4DL7 A;  2JV3 A;  4FZM A;  3IRU A;  1ZQN A;  3MDA A;  4NLN A;  2Y9U A;  2WFA A;  4QWA A;  5IIO A;  2CN1 A;  2W9C A;  2B21 A;  3FAH A;  4X5V A;  4C7Y A;  4ED3 A;  4NXZ A;  1IM4 A;  3SI8 A;  1B4F A;  3B0Y A;  3DDH A;  1S10 A;  2XI9 A;  8ICV A;  3RF9 A;  3QNM A;  3AUO A;  5KFO A;  4KMU A;  3QUQ A;  7ICH A;  4F5P A;  2W7P A;  4J9K A;  2HHQ A;  2HDO A;  2YN4 A;  2H3V A;  2AXT U;  4I2B A;  1D9F A;  4RQ0 A;  1SWW A;  1T3Q A;  3SYZ A;  3OHA A;  2FPL A;  3BZC A;  5J0W A;  4KLQ A;  4G3I A;  2E8P A;  1D8Y A;  1RM6 C;  5ALX A;  3GDX A;  1XC9 A;  4I2E A;  3N7P D;  4R65 A;  5ALW A;  2F44 A;  2HHW A;  3QUC A;  3PSF A;  3EUB 2;  1ZJM A;  4U6P A;  4Q8F A;  5DG9 A;  4EZ9 A;  4Q43 A;  3KKA A;  4JUZ A;  1ZRN A;  1TAU A;  3RJG A;  3OJS A;  3EPG A;  4NM2 A;  7ICV A;  4BWM A;  1SWV A;  4CNQ A;  4BX9 C;  2I6X A;  4RUC A;  3M6Z A;  3AM9 A;  4GFJ A;  4Y2P A;  3HP6 A;  3GFK B;  2WAQ F;  4M9G A;  4GC6 A;  2ZIV B;  4ECV A;  1N2X A;  4IL6 U;  4QNL A;  3AQE A;  3CNH A;  2IHN A;  3JPP A;  1U49 A;  2KKP A;  4R64 A;  3U26 A;  1A0P A;  1SXE A;  1X6J A;  4O5E A;  4UBB A;  2R8K A;  1QTM A;  5AI9 A;  9ICJ A;  2KIC A;  5EE0 A;  1J2N A;  2Y9T A;  5J2E A;  3WK6 A;  3CYM A;  3ISD A;  5HR6 A;  2NO4 A;  5JRT A;  2G06 A;  4OD0 A;  2R18 A;  3UXN A;  3EZ5 A;  2JZB B;  4IQW A;  8ICB A;  4UAT A;  5EWF A;  2JEF A;  1HEK A;  3MFH A;  1L6N A;  3ZDD A;  3I28 A;  3MR3 A;  3UQ2 A;  2ZIX B;  4IRD A;  1NJY A;  3OSN A;  3KHH A;  2AQ4 A;  4Y2V A;  1QQ7 A;  4EEN A;  2BCQ A;  4EYI B;  3NVW A;  4JV0 A;  9ICN A;  1Q8K A;  4PZO A;  4JV2 A;  3T5J A;  2XY6 A;  3WKC A;  2WF9 A;  4I2C A;  5J2D A;  5J2H A;  4DFM A;  2VA8 A;  4QZA A;  2N1R A;  4OCZ A;  4ECT A;  2ZUB A;  4FE3 A;  4EBE A;  2BDP A;  2BHN A;  1X6I A;  4DSL A;  4I27 A;  2JGA A;  4I2A A;  3F2D A;  1ZQX A;  5GTH U;  3PV8 A;  3MGI A;  1RG6 A;  4M47 A;  2EAO A;  2BZF A;  5TZV A;  1SIJ A;  3HIL A;  5KFP A;  4KMO B;  3SEI A;  3TAP A;  3NVY A;  2XO7 A;  3MAB A;  1L7N A;  4EEK A;  1XNS A;  5ALG A;  4QW8 A;  3M8R A;  1PUZ A;  1N48 A;  2WB1 C;  5CHG A;  1ZQZ A;  4MF8 A;  2PI4 A;  3MR2 A;  5KFV A;  3TAR A;  2W9B B;  1YT3 A;  4YVZ A;  1S5L U;  7ICE A;  3KZX A;  2BDU A;  3HKZ F;  4QZD A;  1NI3 A;  3ISC A;  4RQ7 A;  4F4X A;  1N5W A;  1Q3V A;  1H38 A;  1S0O A;  5AK4 A;  1COO A;  2K4I A;  4C8L A;  4USA A;  4PHA A;  4M9N A;  2MUT A;  2FLN A;  4DL4 A;  7ICG A;  8ICM A;  2ZXH A;  5D46 A;  1SKW A;  2A1A A;  4EBD A;  2Q4T A;  4UB2 A;  2F8L A;  2ZJ5 A;  1S0M A;  3ISB A;  3Q8K A;  1ZQH A;  1U9L A;  5KT4 A;  3K75 D;  1ZQB A;  4CRX A;  3RJE A;  4DQP A;  5HR7 A;  3JPR A;  2FDR A;  5ALH A;  1DOQ A;  1Z00 A;  1ZQU A;  3ZDE A;  2HSZ A;  2RHF A;  4YXJ A;  4RQ1 A;  3WK8 A;  3H8S A;  1UT8 A;  1KN5 A;  3J81 j;  3F5A A;  1LV5 A;  4P0Q B;  2CRX A;  1KSP A;  1KEJ A;  1KTQ A;  1CI4 A;  2HOF A;  4R8U B;  9ICV A;  1COK A;  1VDV A;  1SZH A;  4RT3 A;  4IR9 A;  4B9N A;  2J6T A;  3UM9 A;  2D8C A;  4DOA A;  1TAM A;  3Q8S B;  8ICJ A;  5AM2 A;  3PR4 A;  2NO5 A;  1NK4 A;  1MN8 A;  1AQ6 A;  4F71 A;  5KTQ A;  9ICO A;  4QZC A;  1T7P A;  4MF2 A;  1C7Y A;  3JPQ A;  5J2B A;  1JRP A;  2QLT A;  4XA5 A;  3GZF A;  1ARO P;  2AJQ A;  1QCK A;  2FJ6 A;  4EYH B;  2VA2 A;  2YTU A;  7ICO A;  4M2Y A;  1UCV A;  3RB4 A;  1X2I A;  2H3I A;  4P0P B;  2BPF A;  2IOH A;  4MHV A;  4ED6 A;  3TAC B;  5J0R A;  5F9L A;  1SV0 A;  1XO1 A;  1ZQQ A;  3NRZ A;  4OJ6 A;  5AM0 A;  2HHV A;  4UAR A;  3RH4 A;  1PVQ A;  3TFS A;  2HOI A;  2C2D A;  4PL1 A;  5TIS U;  2JMG A;  4TUQ A;  2D3D A;  4YR0 A;  2MU2 A;  1ZQI A;  2KFN A;  4J9Q A;  1L8O A;  1ZRM A;  2ZIU A;  4F4Z A;  2W43 A;  2DPI A;  4UAZ A;  5AI8 A;  1BNO A;  2KEY A;  3UMB A;  5CB1 A;  5KFT A;  2WB1 F;  3GII A;  5J8Y C;  1IV8 A;  3RH5 A;  2IOF A;  5KFI A;  1QQ5 A;  1NOM A;  2JHD A;  4DFD A;  1ZJN A;  5DGB A;  4RQ2 A;  4RQM A;  3TI0 A;  2F77 X;  5DB6 A;  1DK2 A;  5ALT A;  2KFZ A;  7ICS A;  3V72 A;  1LKY B;  3RRG A;  4YFK A;  1OXJ A;  3K4G A;  4DQI A;  3RJI A;  4KLG A;  4YMN A;  2LMR A;  5DQG A;  4QZG A;  2W7O A;  1JN3 A;  5ALO A;  4FS1 A;  2KTQ A;  1NZP A;  4NWI A;  4US8 A;  2C28 A;  1NNL A;  4IQU A;  3GV7 B;  2Y1J A;  2ESE A;  1NKC A;  5D49 A;  3JPO A;  1SV4 A;  1V85 A;  3M1Y A;  1CEZ A;  3GV5 B;  3NAS A;  2KIV A;  3AQF A;  1NK5 A;  2BGW A;  2M0N A;  4EBC A;  5DBA A;  4NLK A;  5AM4 A;  3G6V A;  1N63 A;  2DGZ A;  3D2N A;  2C22 A;  2XGP A;  3E0F A;  2RLT A;  1WG8 A;  1ZQF A;  2RQ5 A;  2V4R A;  3H8J A;  3IM1 A;  3SZ2 A;  2M9N A;  1NJX A;  3GIM A;  5L1I A;  4UAV A;  4YR2 A;  2ZTC A;  2IOF K;  3M8S A;  4PHE A;  2LPE A;  4DSF A;  1NK7 A;  1RXW A;  4RPZ A;  2LYH A;  2VKQ A;  3H7I A;  3OSP A;  2WAQ C;  2KHQ A;  2EZY A;  2RRD A;  4BDP A;  2RDJ A;  1S0V A;  3S6J A;  1MQ3 A;  1F44 A;  4P4M A;  4I2I A;  1LKY A;  1LVH A;  4QZ9 A;  4ECR A;  1VLB A;  1JXE A;  2PFN A;  5KG6 A;  2ZTE A;  5DB8 A;  3C2K A;  4HYK A;  3D2S A;  5AKX A;  3OJU A;  2ZTD A;  3T3F A;  5C5J A;  2F1I A;  7ICF A;  2WF7 A;  4O3N A;  3V7L A;  4UAY A;  3OHB A;  3ALR A;  4GXJ A;  4NL9 A;  3ED5 A;  3G6Y A;  2XY7 A;  2ASD A;  2Y0S F;  7ICQ A;  1XSN A;  1ZQR A;  3ZDC A;  5CEH A;  4OJO A;  5DBC A;  1ZQK A;  4O3S A;  9ICW A;  5III A;  5L9X A;  1NJW A;  3KKA C;  5J0T A;  1WCN A;  4F8R A;  1MSW D;  2C2E A;  2RP5 A;  4KLU A;  3HKZ C;  1KBU A;  1J2M A;  5EE9 A;  4Y2R A;  4M9J A;  4YP3 A;  3KTQ A;  1JI7 A;  1DXS A;  2W03 A;  2I1Q A;  5KG4 A;  5HHI A;  1U4B A;  5IIL A;  5KFQ A;  4O3M A;  4ECX A;  4LZG A;  5DKW A;  4RQ3 A;  3IP4 B;  2KG5 A;  3QU2 A;  3BS7 A;  5KAF U;  3PST A;  3HRD D;  2FMP A;  1D8L A;  4F5Q A;  4C80 A;  1BPZ A;  2ZIW B;  1JUD A;  1HUZ A;  3KOO A;  4KIT B;  4PGQ A;  4F5O A;  4UBC A;  2UVR A;  7ICN A;  1D8B A;  4IR1 A;  3RAQ A;  3VCB A;  2JH7 A;  1TAQ A;  4F2S A;  2HBK A;  1OW5 A;  5AKI A;  3NS1 A;  3QUT A;  4MEX A;  4WJ3 B;  4Y2Q A;  1JMS A;  2ZIX A;  3H8M A;  5AKL A;  3ORY A;  1UPH A;  5KFS A;  2AGP A;  4KLL A;  3A0H U;  3AMZ A;  5KG3 A;  5DBB A;  5HNK A;  3RAX A;  5ALQ A;  3THV A;  4P0Q A;  5DG7 A;  1JRO A;  4R8U A;  1FEZ A;  1T8E A;  2NRV A;  2OWO A;  4QZF A;  5DG8 A;  4YR3 A;  3TKA A;  2D6F C;  1C20 A;  9ICF A;  4OJ5 A;  1SKS A;  4PGX A;  2ZUC A;  1Q3U A;  5ALZ A;  5KFG A;  3GV8 B;  1S97 A;  4UAW A;  5IIK A;  2GWS A;  4Q8E A;  3MFI A;  2LYA A;  8ICK A;  3RBD A;  3QU9 A;  4QZH A;  3BQT A;  1Z19 A;  3AN1 A;  9ICI A;  2Q0Z X;  5HML A;  3MR6 A;  1SL1 A;  1JXL A;  3T5L A;  1SV0 C;  9ICB A;  3TQ1 A;  3PW0 A;  3RR8 A;  2EAP A;  4CE6 A;  4KLD A;  4J9S A;  3GIL A;  8ICA A;  4RQN A;  1O03 A;  1ED1 A;  4EEY A;  2BQR A;  3K1Z A;  9ICQ A;  3HT3 A;  4RT2 A;  2KE7 A;  5J0O A;  2FPK A;  2ZIV A;  2KHV A;  5KNI A;  4CF3 A;  5J2I A;  2EH9 A;  4BJQ A;  5DQH A;  2HOQ A;  4QZE A;  5KFM A;  4O9M A;  3T79 A;  2Y1I A;  3MC1 A;  3WKE A;  5KFL A;  1S76 D;  4RPY A;  1O08 A;  2K4E A;  2K8A A;  4F93 B;  3T5K A;  4PPX A;  2KVC A;  2YMP A;  2K8B B;  2VJ5 A;  4IRC A;  7ICL A;  5CP2 A;  2ASL A;  3PO5 A;  4IS7 A;  4PH5 A;  1PK3 A;  5KFD A;  4C0Z A;  2ZXI A;  4CCH A;  2W8L A;  4DL6 A;  2PMZ F;  4EEL A;  5ALI A;  3L5K A;  1WCL A;  4I2G A;  3IG5 A;  5KT3 A;  4Q45 A;  8ICX A;  5KFE A;  5AK6 A;  3BQ2 A;  1KW4 A;  8ICU A;  2IHM A;  4ED8 A;  5BOM A;  1WWV A;  9ICS A;  2KJ5 A;  2G09 A;  2GLE A;  1Z4N A;  3RFA A;  2FLP A;  3ETR A;  4B9U A;  2JR5 A;  2E1E A;  8ICQ A;  2NV3 A;  5HP4 A;  2ISO A;  3RB6 A;  1FFV A;  4O3P A;  2XC9 A;  1L3U A;  2G07 A;  5AKY A;  4OJP A;  1F5S A;  4AYB F;  2JXJ A;  3M9M B;  2K89 A;  4YMO A;  4DF4 A;  2EAN A;  2W9A A;  2QKQ A;  1PK1 B;  2EAM A;  4ZOH C;  4TUP A;  2KKV A;  3CRX A;  4C8N A;  3RJF A;  4KLF A;  3LWM A;  3PO4 A;  4KTQ A;  4JB3 A;  2W9C B;  3I1Y A;  4BUG A;  4F5N A;  1PVP A;  3HJE A;  4UQG A;  1NZB A;  2KV2 A;  4DQR A;  4O5C A;  3C5G A;  1N60 A;  2JEG A;  4GXK A;  4FBT A;  1URJ A;  4FZL A;  1S8O A;  3RRH A;  3UMG A;  4B9V A;  2A1J A;  2E3T A;  4Y2S A;  4P4P A;  4F92 B;  3ICX A;  3PZP A;  4IQT A;  4F72 A;  1LB2 B;  4GLX A;  4ELT A;  3HW8 A;  1KLN A;  1KFD A;  2ZIW A;  3C5F A;  1ZQP A;  2UVV A;  4R66 A;  4QWB A;  1N56 A;  4US9 A;  5KT6 A;  3D6J A;  4DQQ A;  8ICT A;  3L3F X;  2XCA A;  1NK6 A;  1DGJ A;  8ICL A;  1UA1 A;  5KL1 B;  4KN7 A;  1YZ7 A;  4NLB A;  1CRX A;  4IQV A;  3BDP A;  2FMS A;  3FDS A;  2WHE A;  5ALF A;  5J2G A;  5G5H A;  3SV3 A;  2BCV A;  1TKD A;  4QZ8 A;  1QSY A;  2XVT A;  5H2F U;  3E58 A;  2DF4 B;  3L4P A;  1K1Q A;  3AL0 B;  5J0U A;  4J9M A;  4ED0 A;  2K4H A;  2C2R A;  1EXN A;  3PR5 B;  1X40 A;  4RZR A;  4F4W A;  1SGG A;  5AI4 A;  2ES6 A;  3WK9 A;  5IIJ A;  1L3V A;  5K4L A;  4EX6 A;  2NRZ A;  4KLE A;  4O3O A;  5JU5 A;  2J6U A;  2ODG A;  4JWM A;  4LVS A;  4LJX A;  5KFW A;  3VC8 A;  5AI5 A;  1Y88 A;  4MFC A;  4QZB A;  1GO3 F;  5AIB A;  4I2H A;  1ZET A;  1FFU A;  4KLM A;  5DDM A;  5KFN A;  2Z7J A;  4NJ8 A;  5A0L A;  3TAN A;  2OEH A;  5CRX A;  1T94 A;  1XWL A;  2MA1 A;  2DUY A;  1MA7 A;  1TE2 A;  3Q8P B;  9ICR A;  4M6W B;  4NV0 A;  4RNM A;  3LK9 A;  3MBY A;  2E1F A;  5AKJ A;  1J97 A;  4DOB A;  1BPE A;  3T5H A;  2ATL A;  1BPD A;  3B0X A;  2B0C A;  4GC7 A;  8ICE A;  1Z1V A;  5AK3 A;  7ICR A;  3SEN A;  2CPR A;  5KT5 A;  4DFJ A;  2HVI A;  3JPT A;  2P66 A;  3MGV A;  3F2B A;  4PHD A;  4CDG A;  1DK3 A;  5HMM A;  3GIK A;  5B5E U;  2BCR A;  3UQ0 A;  4NLC A;  2F1J A;  2BCU A;  1L7P A;  4Y2X A;  3QU7 A;  4DS4 A;  5AI6 A;  4BGD A;  2HBJ A;  4FZN A;  5ALS A;  4G9B A;  5FP0 A;  5L1K A;  4BWJ A;  1ZOL A;  1WYG A;  3PW7 A;  3PNC A;  5F3X B;  3TAD C;  3MDC A;  4DCC A;  4MEY A;  2HVH A;  3CW2 C;  3QU4 A;  1ZQM A;  4DSJ A;  2I5H A;  1IG6 A;  5ALK A;  3WK7 A;  3WK4 A;  1JIH A;  5AIC A;  4CF5 A;  2J6S A;  3BS5 A;  5KFH A;  3QU5 A;  3UMC A;  4YMM A;  1ZQG A;  3MGH A;  2BCS A;  3QX7 A;  8ICS A;  1X9W A;  2OXO A;  3SQI A;  4M04 A;  4ED7 A;  5JTI A;  1RYS A;  3ETL A;  4QIW C;  3GQC A;  3PY8 A;  1JX4 A;  3UXP A;  4BXO B;  7ICJ A;  1SB3 C;  3PX6 A;  5AIA A;  3DV9 A;  1RQL A;  3PX4 A;  3PX0 A;  1S77 D;  3UPQ A;  5G5G A;  4ACO A;  9ICC A;  2FE9 A;  2P35 A;  2KD1 A;  5ALY A;  3IN5 A;  3LVW A;  2DKX A;  4ELU A;  1X66 A;  4P2H A;  2WTF A;  4ED2 A;  2HBM A;  4YG2 A;  2HHT A;  3RJH A;  3PW5 A;  5J0X A;  9ICT A;  4E0D A;  2LM1 A;  1PZN A;  3M6K A;  4HAI A;  2YB4 A;  1X9S A;  2W3R A;  4CF4 A;  8ICY A;  5DQI A;  3OPX A;  1BPY A;  2IBK A;  4DL3 A;  5KFY A;  3B9J A;  3FM9 A;  2O6K A;  3KHG A;  5DLF A;  1ZQD A;  5KFC A;  4KX5 A;  2KSO B;  4ELV A;  3M7D A;  3RR7 A;  4K4I A;  3GU3 A;  3K1R B;  1A76 A;  8ICG A;  4NY8 A;  3G6X A;  2H5X A;  2YMM A;  1L5U A;  2KJ9 A;  5T14 A;  3PW4 A;  3D2Q A;  1T3N A;  2HBL A;  3DEE A;  2F2A B;  2KVS A;  4ECQ A;  5J2J A;  2MSN A;  3IHQ B;  3HWT A;  1HUO A;  4MFF A;  2F8K A;  4F4K A;  4NM1 A;  3H0L B;  5L1J A;  2UVU A;  3NUQ A;  3RB3 A;  1QSL A;  9ICP A;  3SAF A;  1U45 A;  4DQS A;  5CA7 A;  3EWA A;  2OCE A;  4DLE A;  1SKR A;  1SZP A;  1N5X A;  2YY6 A;  2V9W A;  3H0R B;  4C4R A;  1Z4O A;  4PGY A;  4QIW F;  1PVR A;  5BPC A;  4QJF B;  1QSS A;  4Z6D A;  1ZYQ A;  5DDY A;  2YMQ A;  5KFU A;  1TK8 A;  4Y2U A;  1NKB A;  3ZD8 A;  1S0N A;  2NRT A;  4UB6 U;  1X9X A;  4M0A A;  5EE1 A;  2KK0 A;  2K8C B;  3V7J A;  1U48 A;  1TV9 A;  2W9M A;  3AU2 A;  1UT5 A;  2HCF A;  5EWG A;  1L8L A;  1HIW A;  2QB0 B;  5ALJ A;  3RTV A;  5E79 U;  2AH5 A;  5ALV A;  4NLZ A;  4DSK A;  4KX3 A;  4NL9 C;  3E2E A;  3C28 A;  2NRX A;  3RB0 A;  9ICL A;  1Z00 B;  2ZG6 A;  2QB0 A;  3TAD A;  3EPI A;  1WUD A;  2PMZ C;  2VIX A;  9ICU A;  1BPX A;  3RH6 A;  4K4G A;  2PFO A;  3BQ1 A;  4KN4 A;  5KG7 A;  2G5I B;  3Q8Q B;  4MFA A;  4DL2 A;  1IIP A;  2YX8 A;  2FPM A;  2MUT B;  5AI0 A;  4I29 A;  4OO1 J;  2ALZ A;  2OHF A;  4Q44 A;  3ZI4 A;  5KFR A;  1L7M A;  4Z6E A;  1BPB A;  2A3V A;  2B6G A;  4B9M A;  3F2C A;  1BNP A;  1BVS A;  3NVV A;  2AQ0 A;  1B0X A;  5J8Y A;  3ONN A;  3RBE A;  4AP9 A;  2W9B A;  2ZJ8 A;  5KFJ A;  8ICN A;  1NJZ A;  1L3S A;  4DWI A;  2ISP A;  3SV4 A;  3PVX A;  1S9F A;  4DSE A;  2GH1 A;  4KLI A;  3HPO A;  8ICO A;  2PKE A;  4QWE A;  4F4Y A;  2YB1 A;  3PML A;  2H3Q A;  9ICK A;  3QEB Z;  1Q46 A;  4ECU A;  1RYU A;  3BQ0 A;  5ALR A;  1U47 A;  5DGA A;  1XO0 A;  2RDI A;  5J0Q A;  3C21 A;  4ZH4 A;  3CP8 A;  1XSP A;  3WK5 A;  3BJY A;  4LZD A;  4JV1 A;  4XRH A;  2OH2 A;  4A8E A;  3KZI U;  4J9N A;  3SMV A;  1UHU A;  4TQR A;  1QLN A;  1V38 A;  5KG5 A;  4UAS A;  4DSI A;  5KAI U;  4DFP A;  5J2F A;  3KHL A;  2PI5 A;  1ZQT A;  1ZQC A;  4B6J A;  4XUS A;  4RQ8 A;  4YD1 A;  4Y2Y A;  2JRZ A;  5KFB A;  1ZQS A;  2HHX A;  3HX0 A;  1ZQV A;  2PFQ A;  5EWE A;  1RZT A;  3MR5 A;  3I76 A;  4RPX A;  1QH9 A;  2YML A;  5CJ7 A;  5J2C A;  3TFR A;  4YD2 A;  3FYH A;  3N7R C;  2H3F A;  1JAL A;  4ECW A;  3N97 B;  3WKD A;  4NLG A;  2AU0 A;  2KN7 A;  1ZQE A;  3LVV A;  4Z6C A;  9ICM A;  3PSI A;  1ZQL A;  2BQU A;  1MC8 A;  1RPL A;  5ALN A;  2BQ3 A;  5AHX A;  4B9S A;  2LHT A;  2H3Z A;  1SL0 A;  4RQ6 A;  3GIJ A;  3EW9 A;  4AYB C;  3PW2 A;  5J2A A;  4TUS A;  2BPG A;  1NKE A;  2JEJ A;  4I2F A;  4O5K A;  4YQW A;  5L1L A;  1WWU A;  5KFA A;  3IG8 A;  1B43 A;  1F0M A;  4F2R A;  5AM5 A;  3SR6 A;  2XIC A;  3C23 A;  5AKG A;  5AKZ A;  2BPC A;  3NVZ A;  3F53 A;  1RXV A;  3QZ7 A;  1TFR A;  3OTQ A;  3JPN A;  4UAU A;  2WF8 A;  3C29 A;  1ZXI A;  1Z3E B;  5J0Y A;  4QWD A;  8ICP A;  5JUM A;  8ICC A;  2LBO A;  2EQY A;  2QAR A;  1YZ6 A;  3IV6 A;  2VA3 A;  1NK0 A;  3Q8R B;  3N28 A;  4OJL A;  2GO7 A;  9ICX A;  2E8N A;  2LKY A;  2QB1 A;  1XSL A;  1XS9 D;  2Y0S C;  4RNN A;  4O3Q A;  3F5E A;  4RQ4 A;  4TUR A;  3JPS A;  3NGD A;  5IIN A;  1ZQW A;  4RUA A;  1X9M A;  1KKX A;  9ICA A;  1ZQA A;  5DLG A;  1RQN A;  2DPJ A;  4J9O A;  7ICM A;  1ZQJ A;  4C8M A;  3FC4 A;  3PMN A;  5HHH A;  5KT2 A;  5D4B A;  2DFL A;  4ICA A;  2HI0 A;  3AU6 A;  4BXO A;  2R8H A;  4DO9 A;  3AEV A;  4KLH A;  1ZD4 A;  1Z1B A;  5ALL A;  4O0I A;  2WF6 A;  2XY5 A;  1N62 A;  2MRL A;  4B9T A;  4C4S A;  3M9N B;  5GTI U;  4R63 A;  1KDH A;  1NK8 A;  2F1H A;  2KMD A;  1D9D A;  4KLJ A;  7ICK A;  3KFU F;  4I2J A;  1KRP A;  9ICG A;  3UXO A;  5AM1 A;  1K5O A;  4UB5 A;  2XCP A;  4QZI A;  4FS2 A;  5AKH A;  3OGU A;  3M9O B;  5AKE A;  4YXM A;  3C2M A;  2R8G A;  5EOZ A;  4FBU A;  2JZB A;  2HMX A;  4F50 A;  2W55 A;  4GXI A;  3C1Y A;  5F9N A;  2VJ4 A;  4UB1 A;  4EZ6 A;  3H4B A;  3SAH A;  3TAQ A;  3IDW A;  1L3T A;  5EE3 A;  2FLL A;  1FIQ A;  2FMQ A;  2KSO A;  4UB8 U;  1A77 A;  4PHP A;  3R9K A;  5J29 A;  2MAX A;  4JWN A;  1ZD3 A;  2NYV A;  2UVW A;  1ZQ1 C;  4C7Z A;  3QZ8 A;  1V97 A;  4TQS A;  2KOB A;  9ICE A;  1K1S A;  3KBB A;  3ZD9 A;  4DEZ A;  2GOL A;  2HHS A;  3H4D A;  5B66 U;  4M9H A;  2E5S A;  8ICI A;  9ICH A;  2R8I A;  2BR0 A;  2G0A A;  3ZDA A;  1P7D A;  1VJ5 A;  4PJ0 U;  4M6W A;  5KFZ A;  2G5H B;  1OUQ A;  4FO6 A;  4EX7 A;  5KG1 A;  2NRW A;  1PK1 A;  5BOL A;  4C8O A;  2W54 A;  2ZJA A;  3ZDB A;  7ICP A;  4J9R A;  4KLT A;  4M9L A;  4ECZ A;  2WF5 A;  2AGO A;  4PZN A;  2E8M A;  2DBY A;  2DL0 A;  2KZZ A;  2QAR B;  2W11 A;  1CUK A;  3Q8L A;  3QXG A;  1B22 A; 
#chains in the Genus database with same CATH homology
 4Q8E A;  5KFV A;  4RNO A;  3TAR A;  3MFI A;  2W9B B;  4DLE A;  4YVZ A;  8ICK A;  2KZ3 A;  2BKE A;  1SKR A;  7ICE A;  5KT7 A;  4B9L A;  3RBD A;  4QZD A;  1SZP A;  3ISC A;  4RQ7 A;  4QZH A;  4F4X A;  2V9W A;  3BQT A;  4ED1 A;  1H38 A;  1S0O A;  4J9P A;  2XGQ A;  4PGY A;  1COO A;  4C8L A;  4ECS A;  4PHA A;  5BPC A;  1HJP A;  1QSS A;  8ICH A;  4QWC A;  9ICI A;  4M9N A;  4Z6D A;  2KZM A;  1ZYQ A;  2Q0Z X;  5DDY A;  5KFU A;  1TK8 A;  1NKB A;  7ICI A;  3ZD8 A;  5HML A;  2MUT A;  2FLN A;  2IA6 A;  4DL4 A;  3MR6 A;  1SL1 A;  4C8K A;  7ICG A;  1S0N A;  2NRT A;  1JXL A;  3T5L A;  4P4O A;  4M0A A;  1TK5 A;  9ICB A;  3TQ1 A;  3PW0 A;  3RR8 A;  8ICM A;  5D46 A;  3V7J A;  1SKW A;  4KLD A;  4J9S A;  5DB9 A;  1U48 A;  4EBD A;  1TV9 A;  4UB2 A;  2ZJ5 A;  2W9M A;  3GIL A;  3AU2 A;  1S0M A;  1UT5 A;  5EWG A;  3ISB A;  3Q8K A;  8ICA A;  1ZQH A;  1U9L A;  3V6H A;  3RTV A;  5KT4 A;  3V6K A;  4EEY A;  3K75 D;  1ZQB A;  5KFK A;  2BQR A;  3RJE A;  4DQP A;  3V6J A;  4NLZ A;  9ICQ A;  3JPR A;  3HT3 A;  4RT2 A;  3QEA Z;  5J0O A;  2FPK A;  4DSK A;  1DOQ A;  1Z00 A;  1ZQU A;  3ZDE A;  3E2E A;  5KFX A;  4YXJ A;  2A1J B;  4DFK A;  3N4M B;  3Q8M A;  4RQ1 A;  3H8S A;  4DOC A;  2NRX A;  1UT8 A;  5J2I A;  3RB0 A;  3RJJ A;  9ICL A;  7ICU A;  1Z00 B;  5DQH A;  4KLO A;  4QZE A;  5KFM A;  1LV5 A;  4O9M A;  4UB4 A;  2Y1I A;  5KFL A;  3LWL A;  3EPI A;  4RPY A;  4KLS A;  4DL5 A;  3T5K A;  4F93 B;  1KEJ A;  1KTQ A;  2ASJ A;  1KSP A;  4PPX A;  4R8U B;  9ICU A;  1BPX A;  3RH6 A;  4K4G A;  3EYZ A;  9ICV A;  4IRC A;  2PFO A;  4I2D A;  7ICL A;  5CP2 A;  3BQ1 A;  2ASL A;  3PO5 A;  4KN4 A;  5KG0 A;  4RT3 A;  5KG7 A;  4IR9 A;  4B9N A;  4PH5 A;  2IMW P;  2J6T A;  3Q8Q B;  4DOA A;  2P6R A;  4MFA A;  5KFD A;  4DS5 A;  4DL2 A;  2FPM A;  2MUT B;  4I29 A;  4CCH A;  2W8L A;  4DL6 A;  2ALZ A;  3Q8S B;  3LDA A;  4Q44 A;  1ZQO A;  8ICJ A;  4ECY A;  5KFR A;  3PR4 A;  1MQ2 A;  1NK4 A;  2HW3 A;  4Z6E A;  7ICT A;  1WCL A;  2I9G A;  5KTQ A;  1BPB A;  4I2G A;  9ICO A;  4QZC A;  1T7P A;  3C2L A;  4O3R A;  4MF2 A;  4B9M A;  8ICF A;  1C7Y A;  4K4H A;  1BVS A;  2W8K A;  4RQ5 A;  5KT3 A;  4Q45 A;  3QE9 Y;  2AQ0 A;  3JPQ A;  8ICX A;  1KFT A;  1TVA A;  5J2B A;  2HHU A;  3KHR A;  5KFE A;  4XA5 A;  3RBE A;  3BQ2 A;  8ICU A;  2W9B A;  1ARO P;  2IHM A;  2AJQ A;  2ZJ8 A;  4ED8 A;  5KFJ A;  5BOM A;  1SL2 A;  1KFS A;  8ICN A;  1NJZ A;  1L3S A;  9ICS A;  4DWI A;  4YCX A;  4EYH B;  2ISP A;  3SV4 A;  3H8W A;  2VA2 A;  1T4G A;  3PVX A;  1S9F A;  2ZUD A;  3RJK A;  7ICO A;  4DSE A;  2FLP A;  4JK1 A;  4B9U A;  4M2Y A;  4KLI A;  3HPO A;  8ICQ A;  8ICO A;  4Z6F A;  8ICZ A;  3NTU A;  5J2K A;  5HP4 A;  3RB4 A;  1X2I A;  1ZQY A;  4QWE A;  3H40 A;  3RB6 A;  2ISO A;  4F4Y A;  4O3P A;  2V4Q A;  2XC9 A;  1TK0 A;  1L3U A;  3PML A;  1UA0 A;  2BPF A;  9ICK A;  3QEB Z;  3M9M B;  4ED6 A;  5J0R A;  5F9L A;  4ECU A;  1XO1 A;  4YMO A;  1ZQQ A;  4DF4 A;  2W9A A;  8ICW A;  3BQ0 A;  2HHV A;  4I28 A;  4TUP A;  1U47 A;  5DGA A;  4C8N A;  3RJF A;  3RH4 A;  4KLF A;  2RDI A;  3LWM A;  3PO4 A;  4KTQ A;  2W9C B;  3TFS A;  5J0Q A;  3C21 A;  2C2D A;  4ZH4 A;  4DF8 A;  1XSP A;  2VAN A;  3BJY A;  4LZD A;  4TUQ A;  4F5N A;  4IRK A;  5IIM A;  4YR0 A;  2PFP A;  4JV1 A;  4XRH A;  2AGQ A;  4UQG A;  4J9N A;  4DQR A;  1ZQI A;  4O5C A;  2KFN A;  4J9Q A;  4TQR A;  1QLN A;  3C5G A;  5CWR A;  4F4Z A;  2JEG A;  1XU4 A;  4GXK A;  5KG5 A;  2DPI A;  4FBT A;  4UAZ A;  4DSI A;  1RYR A;  5CR0 A;  3RRH A;  5KG2 A;  4B9V A;  2A1J A;  5J0P A;  5CB1 A;  4YN4 A;  5KFT A;  5KFF A;  3GII A;  4DFP A;  4P4P A;  3RH5 A;  4F92 B;  5J2F A;  3KHL A;  2P6U A;  4DLG A;  2PI5 A;  4IQT A;  5KFI A;  1LB2 B;  4GLX A;  4ELT A;  1ZQT A;  3HW8 A;  1KLN A;  1KFD A;  3C5F A;  1ZQP A;  1ZQC A;  2UVV A;  4F3O A;  1NOM A;  4R66 A;  4XUS A;  4RQ8 A;  4QWB A;  4YD1 A;  1N56 A;  5KT6 A;  5KFB A;  1ZJN A;  5DGB A;  5DB7 A;  4RQ2 A;  4DQQ A;  8ICT A;  1ZQS A;  2XCA A;  1NK6 A;  8ICL A;  3TI0 A;  1UA1 A;  4F5R A;  4KN7 A;  2HHX A;  3HX0 A;  1ZQV A;  2PFQ A;  4IQV A;  4XQ8 A;  5DB6 A;  5EWE A;  1RZT A;  2FMS A;  3MR5 A;  3BDP A;  3FDS A;  5J2G A;  4RPX A;  2JEI A;  2KFZ A;  7ICS A;  3V72 A;  1IXR A;  3RRG A;  4YFK A;  5CJ7 A;  5J2C A;  3SV3 A;  1TKD A;  2BCV A;  3TFR A;  3K4G A;  4QZ8 A;  1QSY A;  3RJI A;  4DQI A;  4KLG A;  1DGS A;  4RU9 A;  4YMN A;  5DQG A;  4J9L A;  4YD2 A;  3FYH A;  4UB3 A;  4QZG A;  1BGX T;  1JN3 A;  1K1Q A;  4FS1 A;  3V7K A;  5J0U A;  4J9M A;  4ECW A;  3N97 B;  3C1Z A;  2KTQ A;  2R8J A;  1V9P A;  5J0S A;  2AU0 A;  4NLG A;  4ED0 A;  4F91 B;  1NK9 A;  2C2R A;  2KN7 A;  1ZQE A;  1EXN A;  2PXI A;  4QW9 A;  2C28 A;  4IQU A;  3PR5 B;  3GV7 B;  4RZR A;  4F4W A;  4Z6C A;  2Y1J A;  9ICM A;  8ICR A;  4DL7 A;  1ZQL A;  2BQU A;  1MC8 A;  1RPL A;  2BQ3 A;  1NKC A;  5D49 A;  5IIJ A;  1L3V A;  4B9S A;  2NRZ A;  1ZQN A;  3JPO A;  3MDA A;  4NLN A;  4O3O A;  4KLE A;  2J6U A;  4JWM A;  4LVS A;  1SL0 A;  1CEZ A;  5KFW A;  3GV5 B;  4RQ6 A;  3GIJ A;  1Y88 A;  3EW9 A;  4MFC A;  1NK5 A;  4QZB A;  3PW2 A;  2BGW A;  5J2A A;  4TUS A;  5DBA A;  4EBC A;  4I2H A;  4NLK A;  2BPG A;  1ZET A;  3G6V A;  1NKE A;  4QWA A;  2JEJ A;  4I2F A;  5DDM A;  4KLM A;  5IIO A;  4O5K A;  2W9C A;  2C22 A;  4YQW A;  2B21 A;  5KFN A;  5L1L A;  2XGP A;  5KFA A;  4X5V A;  1B43 A;  4ED3 A;  3TAN A;  4F2R A;  4NXZ A;  1IM4 A;  1ZQF A;  3SI8 A;  3C23 A;  3B0Y A;  2BPC A;  1XWL A;  2V4R A;  1S10 A;  1RXV A;  3H8J A;  3QZ7 A;  1TFR A;  3Q8P B;  3JPN A;  3IM1 A;  3SZ2 A;  9ICR A;  4M6W B;  8ICV A;  3AUO A;  4RNM A;  5KFO A;  4KMU A;  3LK9 A;  2M9N A;  1Z3E B;  5J0Y A;  4QWD A;  1NJX A;  3GIM A;  3MBY A;  8ICP A;  7ICH A;  5L1I A;  4F5P A;  4YR2 A;  2ZTC A;  5JUM A;  4DOB A;  1BPE A;  3T5H A;  8ICC A;  3M8S A;  4J9K A;  4PHE A;  2HHQ A;  4DSF A;  2ATL A;  1BPD A;  3B0X A;  4GC7 A;  1NK7 A;  1RXW A;  8ICE A;  4RPZ A;  4I2B A;  2LYH A;  7ICR A;  3H7I A;  1D9F A;  1B22 A;  3OSP A;  2VA3 A;  1NK0 A;  4RQ0 A;  5KT5 A;  4DFJ A;  3SYZ A;  3Q8R B;  2HVI A;  4BDP A;  3OHA A;  2FPL A;  3JPT A;  5J0W A;  2P66 A;  4KLQ A;  4G3I A;  2RDJ A;  4PHD A;  1S0V A;  5HMM A;  1MQ3 A;  9ICX A;  3GIK A;  1D8Y A;  2BCR A;  1XSL A;  1XS9 D;  3UQ0 A;  4P4M A;  3GDX A;  2F1J A;  1XC9 A;  4I2I A;  2BCU A;  4I2E A;  4RNN A;  4QZ9 A;  4R65 A;  2HHW A;  4ECR A;  4DS4 A;  1JXE A;  4O3Q A;  4RQ4 A;  4BGD A;  4TUR A;  3JPS A;  2PFN A;  5KG6 A;  1ZJM A;  3NGD A;  2ZTE A;  5DG9 A;  5IIN A;  4Q8F A;  5L1K A;  1ZQW A;  4RUA A;  1X9M A;  5DB8 A;  4EZ9 A;  4Q43 A;  9ICA A;  1ZQA A;  5DLG A;  4JUZ A;  3C2K A;  4BWJ A;  4HYK A;  2DPJ A;  1TAU A;  3OJU A;  1S76 D;  2ZTD A;  3T3F A;  3PW7 A;  5C5J A;  3PNC A;  3RJG A;  3MDC A;  3OJS A;  4J9O A;  2F1I A;  3EPG A;  7ICF A;  4MEY A;  4NM2 A;  1ZQJ A;  7ICM A;  4C8M A;  4O3N A;  3V7L A;  4BWM A;  3PMN A;  2HVH A;  7ICV A;  4UAY A;  3OHB A;  1ZQM A;  5HHH A;  4DSJ A;  5KT2 A;  5D4B A;  2DFL A;  3AU6 A;  4BXO A;  4GXJ A;  2R8H A;  4DO9 A;  4RUC A;  4KLH A;  3G6Y A;  1JIH A;  2XY7 A;  2J6S A;  2ASD A;  5KFH A;  4O0I A;  3HP6 A;  3GFK B;  2XY5 A;  4M9G A;  1XSN A;  7ICQ A;  4GC6 A;  4YMM A;  1ZQR A;  3ZDC A;  1ZQG A;  4ECV A;  4B9T A;  3M9N B;  3MGH A;  2BCS A;  2IHN A;  4R63 A;  8ICS A;  1X9W A;  1KDH A;  3JPP A;  1NK8 A;  1U49 A;  4R64 A;  5DBC A;  2F1H A;  4M04 A;  4KLJ A;  1D9D A;  4ED7 A;  4UBB A;  1ZQK A;  4O5E A;  4O3S A;  1RYS A;  7ICK A;  4I2J A;  1KRP A;  2R8K A;  9ICG A;  9ICW A;  5III A;  3UXO A;  1QTM A;  5L9X A;  3ETL A;  1NJW A;  4UB5 A;  2XCP A;  4QZI A;  5J0T A;  4FS2 A;  3GQC A;  9ICJ A;  1WCN A;  4F8R A;  1MSW D;  5J2E A;  3OGU A;  2C2E A;  4KLU A;  3PY8 A;  3M9O B;  1JX4 A;  3UXP A;  4YXM A;  4BXO B;  7ICJ A;  3C2M A;  2R8G A;  5EOZ A;  3ISD A;  4FBU A;  1S97 A;  2JZB A;  3PX6 A;  4M9J A;  4YP3 A;  4F50 A;  3KTQ A;  4GXI A;  3UXN A;  3EZ5 A;  3C1Y A;  3PX0 A;  3PX4 A;  5F9N A;  4EZ6 A;  4UB1 A;  1S77 D;  2JZB B;  3H4B A;  3UPQ A;  3TAQ A;  4IQW A;  8ICB A;  2I1Q A;  5KG4 A;  5HHI A;  1L3T A;  9ICC A;  2FLL A;  1U4B A;  5EWF A;  5IIL A;  2FMQ A;  4ELU A;  5KFQ A;  4P2H A;  2WTF A;  2JEF A;  4ECX A;  4LZG A;  1A77 A;  4PHP A;  4RQ3 A;  5DKW A;  3MFH A;  4ED2 A;  3ZDD A;  4YG2 A;  3MR3 A;  5J29 A;  3UQ2 A;  3PW5 A;  3RJH A;  2HHT A;  4IRD A;  5J0X A;  2MAX A;  1NJY A;  4E0D A;  3OSN A;  3KHH A;  4JWN A;  9ICT A;  2UVW A;  1PZN A;  2AQ4 A;  2FMP A;  1D8L A;  4F5Q A;  2BCQ A;  3QZ8 A;  4EYI B;  4TQS A;  1BPZ A;  1X9S A;  1HUZ A;  9ICE A;  4KIT B;  4JV0 A;  4PGQ A;  8ICY A;  9ICN A;  1K1S A;  4F5O A;  5DQI A;  3ZD9 A;  4DEZ A;  1BPY A;  4DL3 A;  2IBK A;  4UBC A;  2UVR A;  7ICN A;  4JV2 A;  3T5J A;  2XY6 A;  4IR1 A;  2HHS A;  5KFY A;  3H4D A;  3RAQ A;  4I2C A;  1TAQ A;  5J2D A;  5J2H A;  4DFM A;  4F2S A;  4M9H A;  2VA8 A;  4QZA A;  4MEX A;  8ICI A;  3KHG A;  5DLF A;  9ICH A;  2R8I A;  2BR0 A;  3MR2 A;  1JMS A;  1ZQD A;  4ECT A;  2ZUB A;  5KFC A;  5KFS A;  3ORY A;  3ZDA A;  4ELV A;  4EBE A;  2AGP A;  2BDP A;  2BHN A;  3RR7 A;  4KLL A;  4K4I A;  4DSL A;  4M6W A;  5KFZ A;  4I27 A;  5KG3 A;  4I2A A;  1A76 A;  1ZQX A;  8ICG A;  4FO6 A;  4NY8 A;  3G6X A;  3PV8 A;  3MGI A;  5KG1 A;  5DBB A;  4M47 A;  5HNK A;  3RAX A;  2NRW A;  2H5X A;  1L5U A;  3THV A;  5TZV A;  3PW4 A;  5DG7 A;  5BOL A;  4R8U A;  1T3N A;  4C8O A;  1T8E A;  2NRV A;  2ZJA A;  2OWO A;  4QZF A;  3ZDB A;  7ICP A;  4ECQ A;  5KFP A;  4J9R A;  4KLT A;  4M9L A;  5DG8 A;  5J2J A;  3IHQ B;  4YR3 A;  3HWT A;  4ECZ A;  3TAP A;  1HUO A;  4MFF A;  4F4K A;  2AGO A;  4NM1 A;  2XO7 A;  5L1J A;  3MAB A;  2UVU A;  9ICF A;  3RB3 A;  1QSL A;  2KZZ A;  9ICP A;  4QW8 A;  3M8R A;  1N48 A;  1SKS A;  5CHG A;  4PGX A;  2ZUC A;  1ZQZ A;  1CUK A;  3Q8L A;  1U45 A;  4MF8 A;  2PI4 A;  5KFG A;  4DQS A;  3GV8 B;  5CA7 A;  4UAW A;  3EWA A;  5IIK A;  2GWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...