5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
4UB8U 4IL6U 1S5LU 5GTIU 2AXTU 2DUYA 5B66U 5B5EU 3A0BU 4PJ0U 3KZIU 5KAFU 3A0HU 4UB6U 5TISU 5KAIU 3WU2U 5GTHU 5E79U 5H2FU
chains in the Genus database with same CATH superfamily
9ICXA 3NTUA 4RUAA 5J0WA 5ALDA 2E3TA 4DFJA 1BPYA 2XCPA 3PW7A 5KFCA 8ICWA 4UBBA 4R66A 2JEIA 3DEEA 3D2SA 9ICFA 1KN5A 2ZTEA 4YFKA 1TVAA 7ICSA 3QU5A 4M6WA 1TK5A 3IG5A 1JALA 5DB6A 2O6KA 2WAQC 2HVIA 4ZH4A 3BS5A 4JV2A 1PK1B 1AQ6A 3D6JA 1ZD2P 2W9CB 2IBKA 5AKGA 1U48A 2CRXA 3N28A 3AU6A 1RG6A 3UQ2A 2M0NA 4QWCA 2YMQA 1SXDA 2OWOA 1NJXA 4PHAA 3GFKB 2AXTU 4GLXA 1ZQKA 4ECSA 3TKAA 1ZQTA 2ASJA 3G6XA 2EZZA 4O3NA 4OCZA 9ICRA 2XC9A 4US9A 1XS9D 5ALGA 5CB1A 2YMPA 1CI4A 2QB0A 5J0UA 2K89A 8ICFA 5KFAA 1BVSA 2YN4A 4F91B 5KFFA 2MUTB 2W04A 4Q45A 1ZQUA 1QLNA 5KFRA 4Y2QA 4DF8A 4R8UB 4RUCA 3H40A 1SKWA 1URJA 3GV7B 1X9SA 3LWLA 4DSLA 2GWSA 2KOBA 5DDYA 4J9QA 4C8KA 2FJ6A 3NASA 1FO4A 9ICMA 3WKDA 4IQUA 2IMWP 2MRLA 1A76A 4DFDA 1KSPA 3V7JA 1ZQMA 4DO9A 4C8NA 3MDAA 2HHXA 4PPXA 1MQ3A 3Q8MA 3RJEA 3RJJA 3RBEA 4EX7A 1Z1BA 2DPJA 2LHTA 5KT6A 3SQIA 1TAMA 4NLZA 2UVWA 2L5YA 3F2DA 5ALRA 3KZIU 4F2RA 4LVSA 2F3NA 1X6JA 1OXJA 1X42A 4P0QA 4CCHA 3F53A 5DG9A 4QW8A 3GQCA 3UQ0A 5CRXA 1ZQDA 4UAUA 1UQVA 2R8HA 3F2CA 1TAUA 2F77X 4UARA 2KFNA 1FFUA 4HAIA 1JX4A 3UXPA 2GO7A 5HR7A 1D8BA 5AIAA 2WF5A 4Y2XA 1QQ5A 3C2LA 4A8EA 2HW3A 4M2YA 4KLSA 2W7PA 7ICRA 2ZXHA 2DGZA 3C1ZA 4KN4A 3EWAA 2W9BA 3JPSA 9ICGA 1UPHA 3WK9A 4DSFA 2BKEA 3H8MA 3O0FA 3ZD9A 3T79A 1ZJMA 1RYSA 1KBUA 2DF4B 3H8WA 1QSYA 2KN7A 2W9AA 3KD3A 5DDMA 4I28A 3UMCA 4Q8FA 1BPDA 3HILA 4JMUA 4OJPA 4P2HA 2A1JB 4HYKA 4C4RA 3UMGA 4F5QA 2EAPA 1ZQCA 2YMMA 5AKIA 4ECZA 2RLTA 2RQ5A 1ZQRA 5J29A 2ZIWA 2FDRA 2ZUDA 4YXJA 1X9MA 4F5NA 5ALUA 1YZ7A 1SZPA 1Y88A 4KMOB 1XSLA 1RQNA 3PW0A 4UB8U 4PGYA 5F9LA 9ICWA 4C8LA 5A0LA 4Q44A 3S6JA 4IQVA 1ZJNA 4RT2A 3RJFA 1IV8A 5AKLA 3M7DA 1ZD5A 4RQ3A 4TUQA 2BR0A 3OGUA 4Z6EA 4C7YA 3H8JA 1ZRMA 2LYBA 1S10A 1LB2B 3C28A 1WG8A 2OHFA 5KFMA 2ISPA 2K4PA 2BQ3A 5KFUA 4E0DA 3A0HU 5DKWA 8ICIA 2R8JA 5D4BA 5HP4A 5EE1A 4NLNA 7ICJA 4NL9C 3M6ZA 4U7CA 3EPIA 4F5OA 4DL4A 5KG4A 3TI0A 2ZJ5A 3MR3A 3ZI4A 1PVRA 3AQFA 9ICIA 2VANA 1WYGA 3R9KA 2LBOA 2JR5A 3RH4A 1L3TA 2JZBA 7ICOA 2NO5A 3FM9A 3NVZA 1N60A 2XY5A 4O3MA 4F71A 1PVQA 2ODGA 2F44A 3IM1A 2XGPA 2HCFA 3RRGA 3FAHA 3NUQA 5BOLA 2Y9TA 4RQ5A 2W11A 2ZIXA 3SR6A 1SWVA 4RQ0A 1T8EA 1TAQA 2Z7JA 5DBBA 9ICSA 1RXWA 1S97A 3ISDA 1N2XA 4QIWF 2JHDA 4JK1A 1L3VA 1N63A 4J03A 1XSNA 2AQ0A 2ZJ8A 4Y2UA 4DEZA 4EX6A 8ICJA 4B9VA 5KFKA 5J2AA 4YD2A 3UMBA 3ICXA 1NJWA 5L1KA 5KFOA 3D2QA 3KHHA 8ICVA 3RB3A 2KVSA 2VJ5A 2JH7A 3RFAA 4G3IA 3AU2A 7ICLA 7ICMA 4ED0A 5AK5A 3TAPA 2HHWA 3WKCA 3K1RB 3QU4A 1LKYA 2EAMA 3T5HA 3WKAA 3NGDA 3PR5B 2BPFA 3OHAA 4WJ3B 1T4GA 3AEVA 2CXYA 4F5PA 3THVA 4EZ9A 4IC9A 3FDSA 4ECTA 1YT3A 4RQ2A 2YTUA 3C2KA 3Q8RB 7ICPA 2JGAA 4FBUA 4UAWA 2AQ4A 4KLUA 2XI9A 4QIWC 4DS4A 3LK9A 4XA5A 4KLEA 5AM0A 4NV0A 1HIWA 1C20A 5ALLA 4K4HA 3LYSA 2KNJA 1O03A 8ICLA 3KOOA 5L1IA 1X2IA 2M9NA 5KG1A 1WWVA 5CA7A 5J0YA 4C0ZA 2DFLA 2E8NA 4UB4A 4QZHA 1K1QA 2W3SA 4YVZA 1LVHA 4KLHA 1Q3VA 4P0PA 1Z00B 2NRWA 3N7SC 1RXVA 3KFUF 1KEJA 8ICSA 3IHQB 5ALJA 4ED6A 2N1RA 1JIHA 1X6IA 2KSOA 4RQ6A 1T7PA 1HUOA 2ALZA 4YMNA 1HUZA 4KLOA 5F3XB 2DL0A 2HBMA 4DS5A 2KVCA 4RQMA 5HMLA 2G5IB 3SD7A 3PY8A 4Y2RA 3GV8B 2AGQA 1DOQA 1F0MA 3LVVA 4UB5A 1UA1A 3H0LB 2WTFA 1CUKA 4J9OA 5KFGA 2KEYA 4F72A 4MF2A 4IR1A 7ICVA 4CE6A 3C1YA 2ATLA 5EE3A 5KG5A 4O3OA 3KHGA 3C23A 4PH5A 4K4GA 1NNLA 9ICQA 5DB7A 5AK6A 2GOLA 3TFSA 9ICUA 1COOA 2F76X 4QZGA 4LZDA 3IV6A 5ALOA 3JPTA 5AM2A 3Q8SB 1CEZA 3GIJA 4J9LA 4ECWA 4O0IA 5KL8B 3T5JA 2HOFA 5T14A 1J2MA 1DGSA 4YP3A 2ZIUB 2I5HA 3BJYA 1ZQFA 1RYRA 4XRHA 3QYPA 2AGPA 9ICCA 5AI5A 1V38A 5KFDA 4QZEA 1PK1A 3GDXA 5ALXA 4DQPA 1VLBA 2UVVA 5AI4A 2W9CA 2MAXA 2PFQA 4I2CA 2EZXA 4Y2JA 5DGBA 5J2FA 2KZZA 2D3DA 2HBKA 5CWRA 3M8RA 5DB8A 3RB4A 5HHIA 4FS1A 1L3UA 3OHBA 2EANA 1TV9A 3E0FA 3C29A 4LJXA 5L9XA 4B6JA 2Y1JA 4NL9A 2JEGA 1B22A 4IRKA 1XNSA 1SIJA 3KHRA 2RRDA 4AYBC 3IRUA 4YN4A 1SL2A 2ZJAA 5ALYA 4JV0A 3OJUA 3K75D 5DLFA 2MUTA 5CHGA 4BDPA 1DK3A 5EE9A 5J0RA 4M0AA 4EENA 4R8UA 3PX4A 4BWJA 3AQEA 3H4DA 2ASLA 2VIXA 4R64A 4UATA 2W9MA 4EEKA 5IILA 3I1YA 5KFIA 4MEYA 3WK6A 4B9NA 2K60A 3QEBZ 3M9NB 2G08A 1KL9A 3ISCA 1SV0A 3H8SA 2KG5A 3E2EA 3BQ1A 4Y2YA 3PX6A 4RZRA 2EDUA 3UXOA 3RJIA 2JRZA 4NWIA 2E1FA 4M9LA 5J2GA 3QZ8A 4F2SA 2FMSA 3WK4A 4KLLA 1M6YA 2IHMA 2YY6A 2DKXA 4QZFA 2W3RA 4BJQA 4O9MA 3SEIA 3PO4A 1PZNA 1A77A 1MC8A 2FLNA 1ZQOA 2A3VA 4NY8A 1MQ2A 8ICOA 2DWQA 3Q8LA 2KHVA 5DG7A 9ICLA 3UPQA 5DG8A 4QZBA 4QWDA 1SZHA 3QNMA 4MEXA 2DQNB 2G5HB 3SAHA 4M9GA 3WU2U 3VC8A 4R63A 2W7OA 1T94A 8ICGA 4QNLA 2W03A 3KKAA 1S76D 5IIJA 1ZQ1C 4OJ5A 2NRXA 4CGZA 3RJHA 5JRTA 2V4RA 2LM1A 1RM6C 2KP7A 4C4SA 4YR2A 2OCEA 1KQQA 9ICAA 5DQGA 4NM2A 2KV2A 3OJSA 5AM3A 3PNCA 2K8BB 5HR6A 4DQQA 1N5WA 2JEFA 2PFOA 1FFVA 5E79U 2A1JA 2E5SA 4C8OA 4M47A 1OUQA 1IG6A 2WF9A 4IL6U 5AI6A 9ICEA 4NLBA 2EQYA 3RJKA 2D8CA 3GU3A 1FEZA 3I28A 3PO5A 5ALHA 1LV5A 5KFTA 5ALEA 2J6SA 3PMLA 2KD1A 3TANA 1MN8A 4UW9A 1KFDA 5J2DA 2HDOA 3AM9A 3PW4A 1S0OA 2G06A 2BCQA 2P6RA 4RNNA 4ED3A 1BPEA 2OEHA 5AKHA 1A0PA 5AICA 1NI3A 5L1MA 4J9MA 1NK7A 1JROA 2J6TA 2H5XA 1QSSA 4CRXA 4P4PA 1U47A 1D9DA 4ED1A 4DFKA 4JV1A 2XY6A 3MC1A 4I2HA 2F1JA 4I2FA 1ZYQA 4P0QB 3F2BA 2K8AA 3HW8A 2BCSA 2Y0SF 3RR7A 3BZKA 3EW9A 4F8RA 3PSTA 3KHLA 1S9FA 4BWMA 3QZ7A 3H0MB 1B0XA 1NKCA 1BNOA 3V7LA 2ISOA 5J0SA 4KLIA 2G07A 4Y2VA 5IINA 2H3FA 2ZIVB 5ALSA 2YX8A 5KTQA 4ICAA 1NK4A 2BQUA 4F3OA 5ALWA 2FLPA 4ECQA 4NXZA 1XU4A 3M8SA 4UAYA 3BZCA 5GTHU 4Z6FA 5ALVA 4C4TA 2RDIA 4J9PA 3BQ7A 4F4XA 1X9WA 1U45A 4KX5A 1NK0A 2XO7A 3JPRA 4OJOA 2HHVA 1S5LU 3AUOA 2R18A 1KKXA 1K5OA 2LI6A 4PHDA 2LM4A 1S8OA 4NM1A 4UQGA 4K4IA 2WB1F 1XWLA 3B0YA 1KW4A 3L3FX 4F93B 1SWWA 3PV8A 1KFSA 4RT3A 3NVVA 3FYHA 2Y0SC 1S0NA 4F4WA 1XC9A 3G6YA 4UB2A 4RNOA 3QU2A 5DBCA 3MR6A 4IQWA 5ALZA 5KAIU 3V6KA 4KLGA 4J9NA 2CN1A 4I2BA 5K4LA 4YQWA 4BUGA 3AMZA 5KFHA 5J8YA 3U26A 1QQ7A 4IRCA 8ICHA 4Y2PA 1UHUA 2MSNA 2ZUBA 5AI9A 2Q0ZX 2LYHA 3SAGA 5HHHA 5AK3A 4YR3A 3LWMA 1JUDA 4YMOA 1KTQA 5KT4A 3SMVA 1SV0C 5KFSA 1U4BA 2KTQA 2UVUA 1D8YA 2WB1C 1IM4A 2F2AB 4ECRA 4PGXA 4EYIB 3VCBA 2C2DA 5AKKA 4QZAA 4KLQA 8ICTA 2LKYA 2BCVA 3HP6A 3F5EA 2ASDA 3CYMA 4IQTA 4Y2TA 5DQIA 5KT3A 3B9JA 4U6PA 4UBCA 4DFMA 3JPQA 1L8LA 3PX0A 8ICEA 4DQRA 2XGQA 3PVXA 5KFYA 2F8KA 2JV3A 5J0OA 2HBLA 2YQEA 2OXOA 3QUTA 3E58A 8ICRA 3IG8A 2VA2A 4OJ6A 2I6XA 2NRVA 4I2JA 3IP4B 5KFNA 1ZQZA 1Z00A 2D6FC 2KE7A 4JWMA 3T5KA 8ICPA 5D46A 2G09A 5HNKA 3C5GA 3KKAC 2OYYA 5AKZA 5KG2A 4RU9A 4ED7A 1N62A 2EAOA 5ALIA 3JPPA 5GTIU 3TFRA 2BGWA 4I2AA 4F4ZA 3RAQA 3NRZA 5L1LA 3N97B 1PUZA 5EWGA 4KLFA 3NVYA 3QE9Y 4EBCA 5AM4A 8ICMA 3RB0A 3KBBA 4IR9A 4DL2A 5KT2A 3TQ1A 1X40A 5AKYA 2KIWA 5AKJA 4J9KA 2HBJA 1S0VA 3GILA 1B43A 2HMXA 1NK9A 2KK0A 4KTQA 2RP5A 4YMMA 3EUB2 2E1EA 3GIMA 1N61A 5KG6A 1KFTA 1L7MA 3GIIA 8ICQA 1TK0A 4DL5A 4XUSA 3MFIA 2JXJA 2OM6A 1WCLA 1VJ5A 2CPRA 1ZQSA 2NYVA 8ICXA 3Q8PB 1F44A 3MFHA 4EBDA 3V6HA 2ESEA 2HOQA 5KL1B 2RHFA 8ICNA 1PVPA 4PL1A 2AU0A 4KLDA 3SAFA 3L5KA 2A19A 4FFDA 3T3FA 1SL0A 3ZDEA 4RQNA 4FBTA 1ZQNA 2ZIUA 3DV9A 7ICUA 4CF3A 5B5EU 4O3RA 4RQ4A 3L4PA 4F4YA 3KTQA 2F1HA 4FZMA 1ZQEA 2KKPA 3OTQA 4JB3A 4BGDA 5DLGA 5KFLA 4QZ9A 1ZQHA 4F50A 5KG3A 1VDVA 4X5VA 1O08A 4UASA 5KG7A 7ICEA 2KJ5A 4DF4A 2PI5A 4F92B 3HJEA 4G9BA 4BX9C 3RH5A 3DDHA 2IOFK 3CRXA 1V97A 4MFAA 2C2EA 4AYBF 4O5CA 4LZGA 3M1YA 4KLJA 7ICHA 8ICUA 3ORYA 3OSPA 3V7KA 4P4MA 5AM5A 4Z6CA 4DL7A 1QH9A 2OH2A 3KZXA 2LMRA 3QUCA 5KFPA 4DSJA 3TACB 4YR0A 4YD1A 2R8KA 2WF8A 4EZ6A 1DXSA 2K4HA 2BCRA 1ZD4A 3PSIA 2W55A 1NJZA 5J0PA 3M9OB 1C7YA 3GIKA 3RB6A 9ICBA 3NVWA 2BHNA 4B9SA 4RPXA 7ICTA 1ZQXA 3BQ0A 2HOIA 4CF5A 2HHQA 4O3PA 3BDPA 2QARB 2GLEA 1SB3C 5ALFA 2JMGA 3D2NA 5H2FU 1RQLA 9ICJA 5F9NA 2ZXIA 2HHSA 5J8YC 4C7ZA 1DGJA 5J0TA 3MGVA 2FPLA 2E8OA 2H3IA 3WKEA 2R8GA 4BXOB 4XQ8A 2C22A 3TARA 3HKZF 5AIBA 5KFEA 5AKEA 2XICA 4O3QA 1SV4A 4FE3A 2GH1A 4O5KA 4DSEA 1RZTA 3ALRA 3ISBA 3C5FA 4ED8A 3N4MB 2FI1A 5TZVA 3JPNA 2LPEA 4YXMA 2FPKA 2PFNA 2V4QA 2ZTCA 1COKA 3ZDAA 3RH6A 1HJPA 5KT7A 4IRDA 9ICVA 1NZBA 2FPMA 2DPIA 1L3SA 5ALPA 4ELTA 3IDWA 4I2GA 1BPXA 3UM9A 4ECYA 4GC6A 5G5GA 2R8IA 4DOAA 2W43A 9ICOA 3F5AA 4C8MA 4O3SA 3TAQA 3QXGA 5KFJA 8ICYA 1L7OA 5AI0A 4UAZA 2Q4TA 1SKRA 1XO1A 3CP8A 5AK4A 4UB1A 4B9TA 3WK8A 2P66A 5AI8A 1MSWD 2NO4A 3MDCA 4UB3A 4US8A 4DSKA 1K1SA 1RDFA 4GXIA 1B4FA 2I9GA 2ZG6A 4M6WB 3SENA 1D8LA 3HKZC 2VKQA 5JTIA 5BPCA 2H3VA 5KFVA 4DLGA 3BS5B 5ALMA 2KZMA 4OD0A 2YMLA 5AKXA 4KLMA 4USAA 5L1JA 2DUYA 1J97A 2NRTA 2FMPA 2F1IA 5ALNA 4PL2A 2PKEA 4UB6U 3N7PD 2MU2A 4M04A 3AN1A 1XO0A 4MHVA 5J2EA 1SL1A 2KFZA 3RF9A 4C80A 2PXIA 1BPBA 1GO3F 2JEJA 3IN5A 5KFQA 3MGIA 5IIOA 4QZCA 3QX7A 5KAFU 1S0MA 4F5RA 2B0CA 4AP9A 2V9WA 2BPCA 2WHEA 2BCUA 4GXJA 2P35A 2HHUA 2FLLA 2QB0B 1QCKA 3PSPA 1MA7A 2EH9A 3H0RB 1ZETA 3TADA 3QEAZ 2BDUA 1ZQVA 2B21A 5ALKA 1KLNA 4QZDA 4B9LA 5IIKA 2A1AA 2C2RA 4P4OA 4TQRA 1UA0A 4OJLA 3PSFA 1L8OA 4DQIA 2KMDA 5J2BA 7ICFA 2WFAA 4Z6DA 2VA3A 4DWIA 2WF7A 1NK8A 4PHPA 3QUBA 4RQ1A 2ZIVA 3ZD8A 3GV5B 3ZDDA 2IA6A 5KNIA 4CNQA 4OO1J 1OW5A 1JI7A 3FC4A 1DK2A 1ZRNA 1ZQQA 4NLGA 1ZQWA 3J81j 2QB1A 4QWBA 1Z4NA 4FS2A 4NLKA 3HPOA 4J9SA 1D9FA 1WWUA 3M9MB 5KT5A 2NRZA 3N7RC 1BGXT 5TISU 3PW2A 1Q46A 4PHEA 4QWAA 4EYHB 1Z3EB 2HHTA 3SV3A 1SKSA 4KN7A 3OSNA 1TE2A 1T3NA 4FO6A 7ICIA 4ELVA 2IOHA 1N5XA 4NJ8A 4J9RA 1IIPA 4FZNA 3PW5A 4QZIA 2K4IA 3RR8A 4DLEA 3ONNA 3SYZA 5CJ7A 3JPOA 4ECVA 1Q8KA 7ICGA 1L6NA 2W9BB 1U9LA 7ICQA 1NKEA 4ZOHC 1N48A 4EELA 4ACOA 5B66U 5DQHA 4I29A 5HMMA 4TURA 9ICNA 1TKDA 2PI4A 2RDJA 1TFRA 1RYUA 3V6JA 8ICKA 4KLTA 1L5UA 2Y9UA 3V72A 2C28A 3HT3A 2WF6A 3RTVA 2ES6A 2BZFA 1NK5A 2KZ3A 4DFPA 1ZQPA 3SZ2A 5EE0A 5CP2A 3MABA 5EOZA 2J6UA 2ZIWB 1ZOLA 3NRWA 4I2IA 2QLTA 5IIIA 2EZYA 4UAVA 8ICCA 4IS7A 5CEHA 8ICBA 1X9XA 1ZQGA 1X66A 4F4KA 2KJ8A 5KG0A 3RRHA 4I2DA 3QU9A 4EEYA 7ICKA 1ZD3A 5KFBA 1NZPA 1V9PA 3HWTA 4PZNA 2NV3A 1KRPA 3WKBA 3EYZA 3K4GA 5J0QA 3NS1A 2KHQA 4B9MA 2Y1IA 1ZQBA 5J2JA 3ED5A 4MFCA 1NOMA 4DL3A 2H3ZA 3EZ5A 3SI8A 2DKZA 2K4EA 3WK7A 3BS7A 2IOFA 5FP0A 4ECUA 1NK6A 4RQ7A 4CDGA 1Z4OA 4QWEA 3H4BA 4EBEA 4Q43A 3RAXA 4TQSA 5BOMA 3SV4A 5G5HA 1JRPA 2B6GA 4RPZA 5KFZA 2UVRA 4ELUA 2AJQA 2FE9A 1ZQAA 3CW2C 3HX0A 1IXRA 3BQTA 4YCXA 2JZBB 2PFPA 5ALQA 5IIMA 1UT8A 2AHOB 1JN3A 1JMSA 1JXLA 3EPGA 2KKVA 4QZ8A 3Q8QB 3WK5A 3MBYA 1BPZA 1QSLA 9ICHA 4FZLA 3OPXA 3M6KA 2DBYA 4Q8EA 2ZIXB 4DCCA 4ECXA 4TUPA 1F5SA 4YG2A 4RQ8A 2VJ4A 1S77D 2XY7A 1L7NA 3ETRA 1HEKA 4I27A 4GFJA 5DB9A 1V85A 5C0YA 7ICNA 1ED1A 4GXKA 4RPYA 5CR0A 1KDHA 4GC7A 3PZPA 4QW9A 9ICKA 3TADC 8ICZA 4GIBA 5EWFA 4QJFB 2MA1A 3RJGA 3UXNA 2BDPA 2VA8A 2HVHA 2PMZF 3K1ZA 1QQ6A 2I1QA 2JH1A 9ICTA 1BNPA 2HI0A 3ZDBA 1LKYB 2YB4A 4DL6A 1CRXA 1ZQIA 3MGHA 1A6SA 1N56A 3AL0B 2E8MA 1RPLA 3C2MA 1NKBA 2ZTDA 1EXNA 5DBAA 4PZOA 2W8KA 4O5EA 1XSPA 3MR2A 4DSIA 1FIQA 4MF8A 4ED2A 4JWNA 1Q3UA 3BQ2A 2LYAA 2K8CB 4RNMA 4JUZA 3Q8KA 2AH5A 1T3QA 5EWEA 3RBDA 4PGQA 1ZQYA 1ZQJA 2E8PA 1UCVA 4CF4A 1H38A 4Y2SA 4R65A 4M9HA 5KFXA 4KX3A 2KJ9A 1JXEA 3QUQA 5J0XA 1P7DA 2FMQA 3I76A 3QU7A 4DOCA 4M9JA 2BQRA 2XCAA 3G6VA 5D49A 2PMZC 1SGGA 3MR5A 2BPGA 1UT5A 3LVWA 2YB1A 9ICPA 3PMNA 8ICAA 5KFWA 4P0PB 1Z19A 4DQSA 2P6UA 2QKQA 4PJ0U 5J2CA 1QTMA 2KICA 1PK3A 1WCNA 2H3QA 2HSZA 1ZQLA 3ETLA 4M9NA 1ZXIA 2IHNA 1AROP 2KIVA 3HRDD 2KSOB 1J2NA 5JU5A 5AHXA 2QARA 5AM1A 3LDAA 2W54A 3PR4A 5J2IA 1YZ6A 2F8LA 2XVTA 1L7PA 5JUMA 1U49A 3H7IA 4BXOA 5DGAA 4MFFA 2W8LA 3B0XA 3C21A 2WAQF 1WUDA 3T5LA 3ZDCA 4B9UA 5J2KA 2XIDA 1Z1VA 4TUSA 4DOBA 1NJYA 4I2EA 2AGOA 1SXEA 3A0BU 1ECWA 4KITB 4NLCA 5J2HA 1TK8A 2ZUCA 4KMUA 2G0AA 5ALTA 3GZFA 5C5JA 3CNHA 1DRGA
chains in the Genus database with same CATH topology
4UB8U 4IL6U 1S5LU 5GTIU 2AXTU 2DUYA 5B66U 5B5EU 3A0BU 4PJ0U 3KZIU 5KAFU 3A0HU 4UB6U 5TISU 5KAIU 3WU2U 5GTHU 5E79U 5H2FU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  4IL6 U;  1S5L U;  5GTI U;  2AXT U;  2DUY A;  5B66 U;  5B5E U;  3A0B U;  4PJ0 U;  3KZI U;  5KAF U;  3A0H U;  4UB6 U;  5TIS U;  5KAI U;  3WU2 U;  5GTH U;  5E79 U;  5H2F U; 
#chains in the Genus database with same CATH topology
 9ICX A;  3NTU A;  4RUA A;  5J0W A;  5ALD A;  2E3T A;  4DFJ A;  1BPY A;  2XCP A;  3PW7 A;  5KFC A;  8ICW A;  4UBB A;  4R66 A;  2JEI A;  3DEE A;  3D2S A;  9ICF A;  1KN5 A;  2ZTE A;  4YFK A;  1TVA A;  7ICS A;  3QU5 A;  4M6W A;  1TK5 A;  3IG5 A;  1JAL A;  5DB6 A;  2O6K A;  2WAQ C;  2HVI A;  4ZH4 A;  3BS5 A;  4JV2 A;  1PK1 B;  1AQ6 A;  3D6J A;  1ZD2 P;  2W9C B;  2IBK A;  5AKG A;  1U48 A;  2CRX A;  3N28 A;  3AU6 A;  1RG6 A;  3UQ2 A;  2M0N A;  4QWC A;  2YMQ A;  1SXD A;  2OWO A;  1NJX A;  4PHA A;  3GFK B;  2AXT U;  4GLX A;  1ZQK A;  4ECS A;  3TKA A;  1ZQT A;  2ASJ A;  3G6X A;  2EZZ A;  4O3N A;  4OCZ A;  9ICR A;  2XC9 A;  4US9 A;  1XS9 D;  5ALG A;  5CB1 A;  2YMP A;  1CI4 A;  2QB0 A;  5J0U A;  2K89 A;  8ICF A;  5KFA A;  1BVS A;  2YN4 A;  4F91 B;  5KFF A;  2MUT B;  2W04 A;  4Q45 A;  1ZQU A;  1QLN A;  5KFR A;  4Y2Q A;  4DF8 A;  4R8U B;  4RUC A;  3H40 A;  1SKW A;  1URJ A;  3GV7 B;  1X9S A;  3LWL A;  4DSL A;  2GWS A;  2KOB A;  5DDY A;  4J9Q A;  4C8K A;  2FJ6 A;  3NAS A;  1FO4 A;  9ICM A;  3WKD A;  4IQU A;  2IMW P;  2MRL A;  1A76 A;  4DFD A;  1KSP A;  3V7J A;  1ZQM A;  4DO9 A;  4C8N A;  3MDA A;  2HHX A;  4PPX A;  1MQ3 A;  3Q8M A;  3RJE A;  3RJJ A;  3RBE A;  4EX7 A;  1Z1B A;  2DPJ A;  2LHT A;  5KT6 A;  3SQI A;  1TAM A;  4NLZ A;  2UVW A;  2L5Y A;  3F2D A;  5ALR A;  3KZI U;  4F2R A;  4LVS A;  2F3N A;  1X6J A;  1OXJ A;  1X42 A;  4P0Q A;  4CCH A;  3F53 A;  5DG9 A;  4QW8 A;  3GQC A;  3UQ0 A;  5CRX A;  1ZQD A;  4UAU A;  1UQV A;  2R8H A;  3F2C A;  1TAU A;  2F77 X;  4UAR A;  2KFN A;  1FFU A;  4HAI A;  1JX4 A;  3UXP A;  2GO7 A;  5HR7 A;  1D8B A;  5AIA A;  2WF5 A;  4Y2X A;  1QQ5 A;  3C2L A;  4A8E A;  2HW3 A;  4M2Y A;  4KLS A;  2W7P A;  7ICR A;  2ZXH A;  2DGZ A;  3C1Z A;  4KN4 A;  3EWA A;  2W9B A;  3JPS A;  9ICG A;  1UPH A;  3WK9 A;  4DSF A;  2BKE A;  3H8M A;  3O0F A;  3ZD9 A;  3T79 A;  1ZJM A;  1RYS A;  1KBU A;  2DF4 B;  3H8W A;  1QSY A;  2KN7 A;  2W9A A;  3KD3 A;  5DDM A;  4I28 A;  3UMC A;  4Q8F A;  1BPD A;  3HIL A;  4JMU A;  4OJP A;  4P2H A;  2A1J B;  4HYK A;  4C4R A;  3UMG A;  4F5Q A;  2EAP A;  1ZQC A;  2YMM A;  5AKI A;  4ECZ A;  2RLT A;  2RQ5 A;  1ZQR A;  5J29 A;  2ZIW A;  2FDR A;  2ZUD A;  4YXJ A;  1X9M A;  4F5N A;  5ALU A;  1YZ7 A;  1SZP A;  1Y88 A;  4KMO B;  1XSL A;  1RQN A;  3PW0 A;  4UB8 U;  4PGY A;  5F9L A;  9ICW A;  4C8L A;  5A0L A;  4Q44 A;  3S6J A;  4IQV A;  1ZJN A;  4RT2 A;  3RJF A;  1IV8 A;  5AKL A;  3M7D A;  1ZD5 A;  4RQ3 A;  4TUQ A;  2BR0 A;  3OGU A;  4Z6E A;  4C7Y A;  3H8J A;  1ZRM A;  2LYB A;  1S10 A;  1LB2 B;  3C28 A;  1WG8 A;  2OHF A;  5KFM A;  2ISP A;  2K4P A;  2BQ3 A;  5KFU A;  4E0D A;  3A0H U;  5DKW A;  8ICI A;  2R8J A;  5D4B A;  5HP4 A;  5EE1 A;  4NLN A;  7ICJ A;  4NL9 C;  3M6Z A;  4U7C A;  3EPI A;  4F5O A;  4DL4 A;  5KG4 A;  3TI0 A;  2ZJ5 A;  3MR3 A;  3ZI4 A;  1PVR A;  3AQF A;  9ICI A;  2VAN A;  1WYG A;  3R9K A;  2LBO A;  2JR5 A;  3RH4 A;  1L3T A;  2JZB A;  7ICO A;  2NO5 A;  3FM9 A;  3NVZ A;  1N60 A;  2XY5 A;  4O3M A;  4F71 A;  1PVQ A;  2ODG A;  2F44 A;  3IM1 A;  2XGP A;  2HCF A;  3RRG A;  3FAH A;  3NUQ A;  5BOL A;  2Y9T A;  4RQ5 A;  2W11 A;  2ZIX A;  3SR6 A;  1SWV A;  4RQ0 A;  1T8E A;  1TAQ A;  2Z7J A;  5DBB A;  9ICS A;  1RXW A;  1S97 A;  3ISD A;  1N2X A;  4QIW F;  2JHD A;  4JK1 A;  1L3V A;  1N63 A;  4J03 A;  1XSN A;  2AQ0 A;  2ZJ8 A;  4Y2U A;  4DEZ A;  4EX6 A;  8ICJ A;  4B9V A;  5KFK A;  5J2A A;  4YD2 A;  3UMB A;  3ICX A;  1NJW A;  5L1K A;  5KFO A;  3D2Q A;  3KHH A;  8ICV A;  3RB3 A;  2KVS A;  2VJ5 A;  2JH7 A;  3RFA A;  4G3I A;  3AU2 A;  7ICL A;  7ICM A;  4ED0 A;  5AK5 A;  3TAP A;  2HHW A;  3WKC A;  3K1R B;  3QU4 A;  1LKY A;  2EAM A;  3T5H A;  3WKA A;  3NGD A;  3PR5 B;  2BPF A;  3OHA A;  4WJ3 B;  1T4G A;  3AEV A;  2CXY A;  4F5P A;  3THV A;  4EZ9 A;  4IC9 A;  3FDS A;  4ECT A;  1YT3 A;  4RQ2 A;  2YTU A;  3C2K A;  3Q8R B;  7ICP A;  2JGA A;  4FBU A;  4UAW A;  2AQ4 A;  4KLU A;  2XI9 A;  4QIW C;  4DS4 A;  3LK9 A;  4XA5 A;  4KLE A;  5AM0 A;  4NV0 A;  1HIW A;  1C20 A;  5ALL A;  4K4H A;  3LYS A;  2KNJ A;  1O03 A;  8ICL A;  3KOO A;  5L1I A;  1X2I A;  2M9N A;  5KG1 A;  1WWV A;  5CA7 A;  5J0Y A;  4C0Z A;  2DFL A;  2E8N A;  4UB4 A;  4QZH A;  1K1Q A;  2W3S A;  4YVZ A;  1LVH A;  4KLH A;  1Q3V A;  4P0P A;  1Z00 B;  2NRW A;  3N7S C;  1RXV A;  3KFU F;  1KEJ A;  8ICS A;  3IHQ B;  5ALJ A;  4ED6 A;  2N1R A;  1JIH A;  1X6I A;  2KSO A;  4RQ6 A;  1T7P A;  1HUO A;  2ALZ A;  4YMN A;  1HUZ A;  4KLO A;  5F3X B;  2DL0 A;  2HBM A;  4DS5 A;  2KVC A;  4RQM A;  5HML A;  2G5I B;  3SD7 A;  3PY8 A;  4Y2R A;  3GV8 B;  2AGQ A;  1DOQ A;  1F0M A;  3LVV A;  4UB5 A;  1UA1 A;  3H0L B;  2WTF A;  1CUK A;  4J9O A;  5KFG A;  2KEY A;  4F72 A;  4MF2 A;  4IR1 A;  7ICV A;  4CE6 A;  3C1Y A;  2ATL A;  5EE3 A;  5KG5 A;  4O3O A;  3KHG A;  3C23 A;  4PH5 A;  4K4G A;  1NNL A;  9ICQ A;  5DB7 A;  5AK6 A;  2GOL A;  3TFS A;  9ICU A;  1COO A;  2F76 X;  4QZG A;  4LZD A;  3IV6 A;  5ALO A;  3JPT A;  5AM2 A;  3Q8S B;  1CEZ A;  3GIJ A;  4J9L A;  4ECW A;  4O0I A;  5KL8 B;  3T5J A;  2HOF A;  5T14 A;  1J2M A;  1DGS A;  4YP3 A;  2ZIU B;  2I5H A;  3BJY A;  1ZQF A;  1RYR A;  4XRH A;  3QYP A;  2AGP A;  9ICC A;  5AI5 A;  1V38 A;  5KFD A;  4QZE A;  1PK1 A;  3GDX A;  5ALX A;  4DQP A;  1VLB A;  2UVV A;  5AI4 A;  2W9C A;  2MAX A;  2PFQ A;  4I2C A;  2EZX A;  4Y2J A;  5DGB A;  5J2F A;  2KZZ A;  2D3D A;  2HBK A;  5CWR A;  3M8R A;  5DB8 A;  3RB4 A;  5HHI A;  4FS1 A;  1L3U A;  3OHB A;  2EAN A;  1TV9 A;  3E0F A;  3C29 A;  4LJX A;  5L9X A;  4B6J A;  2Y1J A;  4NL9 A;  2JEG A;  1B22 A;  4IRK A;  1XNS A;  1SIJ A;  3KHR A;  2RRD A;  4AYB C;  3IRU A;  4YN4 A;  1SL2 A;  2ZJA A;  5ALY A;  4JV0 A;  3OJU A;  3K75 D;  5DLF A;  2MUT A;  5CHG A;  4BDP A;  1DK3 A;  5EE9 A;  5J0R A;  4M0A A;  4EEN A;  4R8U A;  3PX4 A;  4BWJ A;  3AQE A;  3H4D A;  2ASL A;  2VIX A;  4R64 A;  4UAT A;  2W9M A;  4EEK A;  5IIL A;  3I1Y A;  5KFI A;  4MEY A;  3WK6 A;  4B9N A;  2K60 A;  3QEB Z;  3M9N B;  2G08 A;  1KL9 A;  3ISC A;  1SV0 A;  3H8S A;  2KG5 A;  3E2E A;  3BQ1 A;  4Y2Y A;  3PX6 A;  4RZR A;  2EDU A;  3UXO A;  3RJI A;  2JRZ A;  4NWI A;  2E1F A;  4M9L A;  5J2G A;  3QZ8 A;  4F2S A;  2FMS A;  3WK4 A;  4KLL A;  1M6Y A;  2IHM A;  2YY6 A;  2DKX A;  4QZF A;  2W3R A;  4BJQ A;  4O9M A;  3SEI A;  3PO4 A;  1PZN A;  1A77 A;  1MC8 A;  2FLN A;  1ZQO A;  2A3V A;  4NY8 A;  1MQ2 A;  8ICO A;  2DWQ A;  3Q8L A;  2KHV A;  5DG7 A;  9ICL A;  3UPQ A;  5DG8 A;  4QZB A;  4QWD A;  1SZH A;  3QNM A;  4MEX A;  2DQN B;  2G5H B;  3SAH A;  4M9G A;  3WU2 U;  3VC8 A;  4R63 A;  2W7O A;  1T94 A;  8ICG A;  4QNL A;  2W03 A;  3KKA A;  1S76 D;  5IIJ A;  1ZQ1 C;  4OJ5 A;  2NRX A;  4CGZ A;  3RJH A;  5JRT A;  2V4R A;  2LM1 A;  1RM6 C;  2KP7 A;  4C4S A;  4YR2 A;  2OCE A;  1KQQ A;  9ICA A;  5DQG A;  4NM2 A;  2KV2 A;  3OJS A;  5AM3 A;  3PNC A;  2K8B B;  5HR6 A;  4DQQ A;  1N5W A;  2JEF A;  2PFO A;  1FFV A;  5E79 U;  2A1J A;  2E5S A;  4C8O A;  4M47 A;  1OUQ A;  1IG6 A;  2WF9 A;  4IL6 U;  5AI6 A;  9ICE A;  4NLB A;  2EQY A;  3RJK A;  2D8C A;  3GU3 A;  1FEZ A;  3I28 A;  3PO5 A;  5ALH A;  1LV5 A;  5KFT A;  5ALE A;  2J6S A;  3PML A;  2KD1 A;  3TAN A;  1MN8 A;  4UW9 A;  1KFD A;  5J2D A;  2HDO A;  3AM9 A;  3PW4 A;  1S0O A;  2G06 A;  2BCQ A;  2P6R A;  4RNN A;  4ED3 A;  1BPE A;  2OEH A;  5AKH A;  1A0P A;  5AIC A;  1NI3 A;  5L1M A;  4J9M A;  1NK7 A;  1JRO A;  2J6T A;  2H5X A;  1QSS A;  4CRX A;  4P4P A;  1U47 A;  1D9D A;  4ED1 A;  4DFK A;  4JV1 A;  2XY6 A;  3MC1 A;  4I2H A;  2F1J A;  4I2F A;  1ZYQ A;  4P0Q B;  3F2B A;  2K8A A;  3HW8 A;  2BCS A;  2Y0S F;  3RR7 A;  3BZK A;  3EW9 A;  4F8R A;  3PST A;  3KHL A;  1S9F A;  4BWM A;  3QZ7 A;  3H0M B;  1B0X A;  1NKC A;  1BNO A;  3V7L A;  2ISO A;  5J0S A;  4KLI A;  2G07 A;  4Y2V A;  5IIN A;  2H3F A;  2ZIV B;  5ALS A;  2YX8 A;  5KTQ A;  4ICA A;  1NK4 A;  2BQU A;  4F3O A;  5ALW A;  2FLP A;  4ECQ A;  4NXZ A;  1XU4 A;  3M8S A;  4UAY A;  3BZC A;  5GTH U;  4Z6F A;  5ALV A;  4C4T A;  2RDI A;  4J9P A;  3BQ7 A;  4F4X A;  1X9W A;  1U45 A;  4KX5 A;  1NK0 A;  2XO7 A;  3JPR A;  4OJO A;  2HHV A;  1S5L U;  3AUO A;  2R18 A;  1KKX A;  1K5O A;  2LI6 A;  4PHD A;  2LM4 A;  1S8O A;  4NM1 A;  4UQG A;  4K4I A;  2WB1 F;  1XWL A;  3B0Y A;  1KW4 A;  3L3F X;  4F93 B;  1SWW A;  3PV8 A;  1KFS A;  4RT3 A;  3NVV A;  3FYH A;  2Y0S C;  1S0N A;  4F4W A;  1XC9 A;  3G6Y A;  4UB2 A;  4RNO A;  3QU2 A;  5DBC A;  3MR6 A;  4IQW A;  5ALZ A;  5KAI U;  3V6K A;  4KLG A;  4J9N A;  2CN1 A;  4I2B A;  5K4L A;  4YQW A;  4BUG A;  3AMZ A;  5KFH A;  5J8Y A;  3U26 A;  1QQ7 A;  4IRC A;  8ICH A;  4Y2P A;  1UHU A;  2MSN A;  2ZUB A;  5AI9 A;  2Q0Z X;  2LYH A;  3SAG A;  5HHH A;  5AK3 A;  4YR3 A;  3LWM A;  1JUD A;  4YMO A;  1KTQ A;  5KT4 A;  3SMV A;  1SV0 C;  5KFS A;  1U4B A;  2KTQ A;  2UVU A;  1D8Y A;  2WB1 C;  1IM4 A;  2F2A B;  4ECR A;  4PGX A;  4EYI B;  3VCB A;  2C2D A;  5AKK A;  4QZA A;  4KLQ A;  8ICT A;  2LKY A;  2BCV A;  3HP6 A;  3F5E A;  2ASD A;  3CYM A;  4IQT A;  4Y2T A;  5DQI A;  5KT3 A;  3B9J A;  4U6P A;  4UBC A;  4DFM A;  3JPQ A;  1L8L A;  3PX0 A;  8ICE A;  4DQR A;  2XGQ A;  3PVX A;  5KFY A;  2F8K A;  2JV3 A;  5J0O A;  2HBL A;  2YQE A;  2OXO A;  3QUT A;  3E58 A;  8ICR A;  3IG8 A;  2VA2 A;  4OJ6 A;  2I6X A;  2NRV A;  4I2J A;  3IP4 B;  5KFN A;  1ZQZ A;  1Z00 A;  2D6F C;  2KE7 A;  4JWM A;  3T5K A;  8ICP A;  5D46 A;  2G09 A;  5HNK A;  3C5G A;  3KKA C;  2OYY A;  5AKZ A;  5KG2 A;  4RU9 A;  4ED7 A;  1N62 A;  2EAO A;  5ALI A;  3JPP A;  5GTI U;  3TFR A;  2BGW A;  4I2A A;  4F4Z A;  3RAQ A;  3NRZ A;  5L1L A;  3N97 B;  1PUZ A;  5EWG A;  4KLF A;  3NVY A;  3QE9 Y;  4EBC A;  5AM4 A;  8ICM A;  3RB0 A;  3KBB A;  4IR9 A;  4DL2 A;  5KT2 A;  3TQ1 A;  1X40 A;  5AKY A;  2KIW A;  5AKJ A;  4J9K A;  2HBJ A;  1S0V A;  3GIL A;  1B43 A;  2HMX A;  1NK9 A;  2KK0 A;  4KTQ A;  2RP5 A;  4YMM A;  3EUB 2;  2E1E A;  3GIM A;  1N61 A;  5KG6 A;  1KFT A;  1L7M A;  3GII A;  8ICQ A;  1TK0 A;  4DL5 A;  4XUS A;  3MFI A;  2JXJ A;  2OM6 A;  1WCL A;  1VJ5 A;  2CPR A;  1ZQS A;  2NYV A;  8ICX A;  3Q8P B;  1F44 A;  3MFH A;  4EBD A;  3V6H A;  2ESE A;  2HOQ A;  5KL1 B;  2RHF A;  8ICN A;  1PVP A;  4PL1 A;  2AU0 A;  4KLD A;  3SAF A;  3L5K A;  2A19 A;  4FFD A;  3T3F A;  1SL0 A;  3ZDE A;  4RQN A;  4FBT A;  1ZQN A;  2ZIU A;  3DV9 A;  7ICU A;  4CF3 A;  5B5E U;  4O3R A;  4RQ4 A;  3L4P A;  4F4Y A;  3KTQ A;  2F1H A;  4FZM A;  1ZQE A;  2KKP A;  3OTQ A;  4JB3 A;  4BGD A;  5DLG A;  5KFL A;  4QZ9 A;  1ZQH A;  4F50 A;  5KG3 A;  1VDV A;  4X5V A;  1O08 A;  4UAS A;  5KG7 A;  7ICE A;  2KJ5 A;  4DF4 A;  2PI5 A;  4F92 B;  3HJE A;  4G9B A;  4BX9 C;  3RH5 A;  3DDH A;  2IOF K;  3CRX A;  1V97 A;  4MFA A;  2C2E A;  4AYB F;  4O5C A;  4LZG A;  3M1Y A;  4KLJ A;  7ICH A;  8ICU A;  3ORY A;  3OSP A;  3V7K A;  4P4M A;  5AM5 A;  4Z6C A;  4DL7 A;  1QH9 A;  2OH2 A;  3KZX A;  2LMR A;  3QUC A;  5KFP A;  4DSJ A;  3TAC B;  4YR0 A;  4YD1 A;  2R8K A;  2WF8 A;  4EZ6 A;  1DXS A;  2K4H A;  2BCR A;  1ZD4 A;  3PSI A;  2W55 A;  1NJZ A;  5J0P A;  3M9O B;  1C7Y A;  3GIK A;  3RB6 A;  9ICB A;  3NVW A;  2BHN A;  4B9S A;  4RPX A;  7ICT A;  1ZQX A;  3BQ0 A;  2HOI A;  4CF5 A;  2HHQ A;  4O3P A;  3BDP A;  2QAR B;  2GLE A;  1SB3 C;  5ALF A;  2JMG A;  3D2N A;  5H2F U;  1RQL A;  9ICJ A;  5F9N A;  2ZXI A;  2HHS A;  5J8Y C;  4C7Z A;  1DGJ A;  5J0T A;  3MGV A;  2FPL A;  2E8O A;  2H3I A;  3WKE A;  2R8G A;  4BXO B;  4XQ8 A;  2C22 A;  3TAR A;  3HKZ F;  5AIB A;  5KFE A;  5AKE A;  2XIC A;  4O3Q A;  1SV4 A;  4FE3 A;  2GH1 A;  4O5K A;  4DSE A;  1RZT A;  3ALR A;  3ISB A;  3C5F A;  4ED8 A;  3N4M B;  2FI1 A;  5TZV A;  3JPN A;  2LPE A;  4YXM A;  2FPK A;  2PFN A;  2V4Q A;  2ZTC A;  1COK A;  3ZDA A;  3RH6 A;  1HJP A;  5KT7 A;  4IRD A;  9ICV A;  1NZB A;  2FPM A;  2DPI A;  1L3S A;  5ALP A;  4ELT A;  3IDW A;  4I2G A;  1BPX A;  3UM9 A;  4ECY A;  4GC6 A;  5G5G A;  2R8I A;  4DOA A;  2W43 A;  9ICO A;  3F5A A;  4C8M A;  4O3S A;  3TAQ A;  3QXG A;  5KFJ A;  8ICY A;  1L7O A;  5AI0 A;  4UAZ A;  2Q4T A;  1SKR A;  1XO1 A;  3CP8 A;  5AK4 A;  4UB1 A;  4B9T A;  3WK8 A;  2P66 A;  5AI8 A;  1MSW D;  2NO4 A;  3MDC A;  4UB3 A;  4US8 A;  4DSK A;  1K1S A;  1RDF A;  4GXI A;  1B4F A;  2I9G A;  2ZG6 A;  4M6W B;  3SEN A;  1D8L A;  3HKZ C;  2VKQ A;  5JTI A;  5BPC A;  2H3V A;  5KFV A;  4DLG A;  3BS5 B;  5ALM A;  2KZM A;  4OD0 A;  2YML A;  5AKX A;  4KLM A;  4USA A;  5L1J A;  2DUY A;  1J97 A;  2NRT A;  2FMP A;  2F1I A;  5ALN A;  4PL2 A;  2PKE A;  4UB6 U;  3N7P D;  2MU2 A;  4M04 A;  3AN1 A;  1XO0 A;  4MHV A;  5J2E A;  1SL1 A;  2KFZ A;  3RF9 A;  4C80 A;  2PXI A;  1BPB A;  1GO3 F;  2JEJ A;  3IN5 A;  5KFQ A;  3MGI A;  5IIO A;  4QZC A;  3QX7 A;  5KAF U;  1S0M A;  4F5R A;  2B0C A;  4AP9 A;  2V9W A;  2BPC A;  2WHE A;  2BCU A;  4GXJ A;  2P35 A;  2HHU A;  2FLL A;  2QB0 B;  1QCK A;  3PSP A;  1MA7 A;  2EH9 A;  3H0R B;  1ZET A;  3TAD A;  3QEA Z;  2BDU A;  1ZQV A;  2B21 A;  5ALK A;  1KLN A;  4QZD A;  4B9L A;  5IIK A;  2A1A A;  2C2R A;  4P4O A;  4TQR A;  1UA0 A;  4OJL A;  3PSF A;  1L8O A;  4DQI A;  2KMD A;  5J2B A;  7ICF A;  2WFA A;  4Z6D A;  2VA3 A;  4DWI A;  2WF7 A;  1NK8 A;  4PHP A;  3QUB A;  4RQ1 A;  2ZIV A;  3ZD8 A;  3GV5 B;  3ZDD A;  2IA6 A;  5KNI A;  4CNQ A;  4OO1 J;  1OW5 A;  1JI7 A;  3FC4 A;  1DK2 A;  1ZRN A;  1ZQQ A;  4NLG A;  1ZQW A;  3J81 j;  2QB1 A;  4QWB A;  1Z4N A;  4FS2 A;  4NLK A;  3HPO A;  4J9S A;  1D9F A;  1WWU A;  3M9M B;  5KT5 A;  2NRZ A;  3N7R C;  1BGX T;  5TIS U;  3PW2 A;  1Q46 A;  4PHE A;  4QWA A;  4EYH B;  1Z3E B;  2HHT A;  3SV3 A;  1SKS A;  4KN7 A;  3OSN A;  1TE2 A;  1T3N A;  4FO6 A;  7ICI A;  4ELV A;  2IOH A;  1N5X A;  4NJ8 A;  4J9R A;  1IIP A;  4FZN A;  3PW5 A;  4QZI A;  2K4I A;  3RR8 A;  4DLE A;  3ONN A;  3SYZ A;  5CJ7 A;  3JPO A;  4ECV A;  1Q8K A;  7ICG A;  1L6N A;  2W9B B;  1U9L A;  7ICQ A;  1NKE A;  4ZOH C;  1N48 A;  4EEL A;  4ACO A;  5B66 U;  5DQH A;  4I29 A;  5HMM A;  4TUR A;  9ICN A;  1TKD A;  2PI4 A;  2RDJ A;  1TFR A;  1RYU A;  3V6J A;  8ICK A;  4KLT A;  1L5U A;  2Y9U A;  3V72 A;  2C28 A;  3HT3 A;  2WF6 A;  3RTV A;  2ES6 A;  2BZF A;  1NK5 A;  2KZ3 A;  4DFP A;  1ZQP A;  3SZ2 A;  5EE0 A;  5CP2 A;  3MAB A;  5EOZ A;  2J6U A;  2ZIW B;  1ZOL A;  3NRW A;  4I2I A;  2QLT A;  5III A;  2EZY A;  4UAV A;  8ICC A;  4IS7 A;  5CEH A;  8ICB A;  1X9X A;  1ZQG A;  1X66 A;  4F4K A;  2KJ8 A;  5KG0 A;  3RRH A;  4I2D A;  3QU9 A;  4EEY A;  7ICK A;  1ZD3 A;  5KFB A;  1NZP A;  1V9P A;  3HWT A;  4PZN A;  2NV3 A;  1KRP A;  3WKB A;  3EYZ A;  3K4G A;  5J0Q A;  3NS1 A;  2KHQ A;  4B9M A;  2Y1I A;  1ZQB A;  5J2J A;  3ED5 A;  4MFC A;  1NOM A;  4DL3 A;  2H3Z A;  3EZ5 A;  3SI8 A;  2DKZ A;  2K4E A;  3WK7 A;  3BS7 A;  2IOF A;  5FP0 A;  4ECU A;  1NK6 A;  4RQ7 A;  4CDG A;  1Z4O A;  4QWE A;  3H4B A;  4EBE A;  4Q43 A;  3RAX A;  4TQS A;  5BOM A;  3SV4 A;  5G5H A;  1JRP A;  2B6G A;  4RPZ A;  5KFZ A;  2UVR A;  4ELU A;  2AJQ A;  2FE9 A;  1ZQA A;  3CW2 C;  3HX0 A;  1IXR A;  3BQT A;  4YCX A;  2JZB B;  2PFP A;  5ALQ A;  5IIM A;  1UT8 A;  2AHO B;  1JN3 A;  1JMS A;  1JXL A;  3EPG A;  2KKV A;  4QZ8 A;  3Q8Q B;  3WK5 A;  3MBY A;  1BPZ A;  1QSL A;  9ICH A;  4FZL A;  3OPX A;  3M6K A;  2DBY A;  4Q8E A;  2ZIX B;  4DCC A;  4ECX A;  4TUP A;  1F5S A;  4YG2 A;  4RQ8 A;  2VJ4 A;  1S77 D;  2XY7 A;  1L7N A;  3ETR A;  1HEK A;  4I27 A;  4GFJ A;  5DB9 A;  1V85 A;  5C0Y A;  7ICN A;  1ED1 A;  4GXK A;  4RPY A;  5CR0 A;  1KDH A;  4GC7 A;  3PZP A;  4QW9 A;  9ICK A;  3TAD C;  8ICZ A;  4GIB A;  5EWF A;  4QJF B;  2MA1 A;  3RJG A;  3UXN A;  2BDP A;  2VA8 A;  2HVH A;  2PMZ F;  3K1Z A;  1QQ6 A;  2I1Q A;  2JH1 A;  9ICT A;  1BNP A;  2HI0 A;  3ZDB A;  1LKY B;  2YB4 A;  4DL6 A;  1CRX A;  1ZQI A;  3MGH A;  1A6S A;  1N56 A;  3AL0 B;  2E8M A;  1RPL A;  3C2M A;  1NKB A;  2ZTD A;  1EXN A;  5DBA A;  4PZO A;  2W8K A;  4O5E A;  1XSP A;  3MR2 A;  4DSI A;  1FIQ A;  4MF8 A;  4ED2 A;  4JWN A;  1Q3U A;  3BQ2 A;  2LYA A;  2K8C B;  4RNM A;  4JUZ A;  3Q8K A;  2AH5 A;  1T3Q A;  5EWE A;  3RBD A;  4PGQ A;  1ZQY A;  1ZQJ A;  2E8P A;  1UCV A;  4CF4 A;  1H38 A;  4Y2S A;  4R65 A;  4M9H A;  5KFX A;  4KX3 A;  2KJ9 A;  1JXE A;  3QUQ A;  5J0X A;  1P7D A;  2FMQ A;  3I76 A;  3QU7 A;  4DOC A;  4M9J A;  2BQR A;  2XCA A;  3G6V A;  5D49 A;  2PMZ C;  1SGG A;  3MR5 A;  2BPG A;  1UT5 A;  3LVW A;  2YB1 A;  9ICP A;  3PMN A;  8ICA A;  5KFW A;  4P0P B;  1Z19 A;  4DQS A;  2P6U A;  2QKQ A;  4PJ0 U;  5J2C A;  1QTM A;  2KIC A;  1PK3 A;  1WCN A;  2H3Q A;  2HSZ A;  1ZQL A;  3ETL A;  4M9N A;  1ZXI A;  2IHN A;  1ARO P;  2KIV A;  3HRD D;  2KSO B;  1J2N A;  5JU5 A;  5AHX A;  2QAR A;  5AM1 A;  3LDA A;  2W54 A;  3PR4 A;  5J2I A;  1YZ6 A;  2F8L A;  2XVT A;  1L7P A;  5JUM A;  1U49 A;  3H7I A;  4BXO A;  5DGA A;  4MFF A;  2W8L A;  3B0X A;  3C21 A;  2WAQ F;  1WUD A;  3T5L A;  3ZDC A;  4B9U A;  5J2K A;  2XID A;  1Z1V A;  4TUS A;  4DOB A;  1NJY A;  4I2E A;  2AGO A;  1SXE A;  3A0B U;  1ECW A;  4KIT B;  4NLC A;  5J2H A;  1TK8 A;  2ZUC A;  4KMU A;  2G0A A;  5ALT A;  3GZF A;  5C5J A;  3CNH A;  1DRG A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  4IL6 U;  1S5L U;  5GTI U;  2AXT U;  2DUY A;  5B66 U;  5B5E U;  3A0B U;  4PJ0 U;  3KZI U;  5KAF U;  3A0H U;  4UB6 U;  5TIS U;  5KAI U;  3WU2 U;  5GTH U;  5E79 U;  5H2F U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...