5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
4IL6U 3A0HU 5H2FU 5KAFU 5TISU 5KAIU 5B66U 4UB8U 5B5EU 4UB6U 3WU2U 5GTHU 2DUYA 1S5LU 4PJ0U 5GTIU 5E79U 3A0BU 2AXTU 3KZIU
chains in the Genus database with same CATH superfamily
1QQ6A 8ICKA 3PR5B 3T5LA 2EAPA 4O9MA 3AN1A 2VKQA 2W54A 3H0LB 1O08A 1ZQBA 3C29A 1PK3A 2BGWA 3MR5A 3O0FA 1UQVA 3KHRA 3V6KA 4DFJA 4P4OA 1SGGA 3M9MB 3AQEA 2NV3A 7ICJA 4P0QB 2HHWA 4KLGA 2B21A 2GLEA 1PK1A 1J97A 3DEEA 3HPOA 1ZQIA 3ZDBA 3B9JA 3OJUA 2RP5A 3C5GA 2J6SA 4YMMA 3MFIA 3G6VA 2EQYA 4F2RA 3Q8QB 4QWAA 3AU2A 4I2JA 2LM4A 1D8YA 1MC8A 4O3RA 3VCBA 4EYHB 4YXMA 1DK2A 8ICHA 5AI8A 4C8NA 3RF9A 2FMSA 4R8UA 7ICUA 5J0TA 1IG6A 1NKBA 4CE6A 3PW2A 3K1ZA 5KFFA 2HHTA 1DOQA 4UB2A 4YR2A 2H3VA 1ZQKA 5AM5A 2WTFA 2A1AA 5ALIA 5J2KA 4HAIA 4O0IA 2KKVA 2QB0A 2VA2A 1XS9D 4DWIA 4NY8A 1WWVA 3ISBA 1KDHA 4F4XA 2BDPA 1NJZA 2BR0A 3H8JA 1COOA 2H3IA 1VLBA 2BCVA 1Z1BA 3A0BU 2WAQF 3QU4A 3NGDA 3HKZC 4BXOB 3N28A 7ICGA 5KAFU 2HBMA 1K1SA 1P7DA 5EWEA 8ICXA 2KOBA 4YMOA 3BZCA 4I2HA 4F92B 3UXOA 4OJPA 1L8OA 4OJLA 4DQQA 2ZIXA 2UVRA 4KITB 4P0QA 1WCNA 4Y2RA 2WF7A 2ZIVB 5AIBA 4X5VA 2JV3A 4EEYA 2UVVA 2HBLA 5AKLA 1VJ5A 4BXOA 2NRWA 5KFBA 4Y2TA 1NJXA 4DSFA 1OUQA 2D8CA 1JXLA 2K4HA 2ZXIA 2DF4B 1AROP 2G5IB 4RQMA 5KT3A 4PGXA 8ICJA 5B5EU 4DQRA 4DL3A 3PMNA 4TUQA 2W9CA 2IOFK 9ICGA 2H3FA 3QU5A 2W55A 3H0RB 3GZFA 4UAZA 3PX0A 3RH4A 5HR6A 3ZDCA 4GLXA 5KFVA 4IRDA 8ICUA 2G09A 4JB3A 1XWLA 2KZMA 1RM6C 4FBUA 2KHVA 2CRXA 3N7SC 3KZXA 3ZDDA 1UA0A 2Y1JA 4Q8EA 1S8OA 4ACOA 3SENA 4UAWA 2IMWP 2K89A 4O3QA 4HYKA 3JPSA 8ICOA 1QLNA 3C1YA 2DBYA 4YCXA 4MFAA 4I2GA 2KJ9A 4PL2A 9ICVA 1CRXA 5CB1A 3RJIA 2W3SA 1KFSA 3NVYA 2WF9A 4UB8U 2AQ0A 1KSPA 3H0MB 3B0XA 5AK5A 1IIPA 2ZG6A 4PPXA 4F2SA 4RNMA 1K5OA 4P0PA 2E8NA 1OXJA 5G5GA 3MR2A 3WKAA 9ICIA 5AI0A 1SB3C 1Z00B 4FZLA 5KTQA 2HHXA 2JXJA 2ESEA 4PHEA 3EPGA 4NJ8A 2D3DA 1TK0A 4PL1A 4ICAA 2OWOA 3GDXA 3RJKA 4DF4A 3RJGA 3MABA 4XUSA 2R8KA 1Q3VA 4EELA 3MGVA 4J9QA 1SXDA 8ICMA 3HKZF 4F5RA 2VJ5A 1ZQRA 4QW8A 2VA8A 9ICTA 3JPRA 1YZ7A 1MQ2A 2M0NA 3VC8A 3C2LA 5D46A 5B66U 4F8RA 4NWIA 4R65A 4B9LA 4YN4A 2AH5A 5CR0A 3UQ0A 2IHNA 1C20A 5ALMA 2FLLA 1X9XA 3UQ2A 1TAUA 5K4LA 4EBEA 2VJ4A 4CNQA 4DOAA 4ELTA 1ZQWA 3L4PA 3C2MA 1RZTA 1ZQ1C 5J2CA 2ZIUA 2IBKA 2RDJA 1U4BA 5D49A 1IXRA 1B0XA 4DFPA 4RQ4A 3QUQA 4EBDA 4UASA 5KT6A 3LWLA 1ECWA 5L1MA 2QARB 4OJ6A 4YQWA 3MGHA 1Z3EB 3SEIA 5AKGA 1SWWA 3WK9A 4PH5A 4M9HA 2LBOA 3CNHA 5GTIU 4KLEA 2JZBA 3SR6A 2PFOA 2VA3A 9ICLA 4Z6DA 4ECQA 4B9MA 5CP2A 2KFNA 5KFNA 4KLMA 4EENA 4KLSA 4DQPA 3RB4A 2WFAA 3EUB2 4NM2A 3GU3A 5ALZA 1ZOLA 2ODGA 1Z19A 3RFAA 3SV3A 2OXOA 3IP4B 3BZKA 1NK8A 4UB5A 2K8BB 1ZD4A 2HOIA 2W9AA 1UPHA 4I2EA 4RQ3A 1Z1VA 1KEJA 1OW5A 9ICCA 4YR0A 2ASJA 3TAPA 2FPLA 3NVWA 1WCLA 2LPEA 5KT2A 4DCCA 4K4HA 4DL7A 3KZIU 5KFWA 5IIMA 3PW0A 3LYSA 2DQNB 3C2KA 1ZQEA 5KG5A 4M6WA 2BPCA 1DGSA 4NL9A 5KFPA 3AUOA 4ED1A 1TE2A 2YQEA 4Y2SA 9ICXA 2F2AB 1V97A 3PW5A 4DO9A 2HSZA 4ED2A 3GIMA 5CEHA 3H4BA 4QNLA 1L7PA 1KRPA 4KTQA 1S0VA 5AI5A 1L7NA 1S77D 5J2AA 1JUDA 3C21A 3BQ7A 2DPIA 4ECZA 1XO1A 2RRDA 5J0OA 2FJ6A 5IINA 4B9UA 3ZD8A 2HHQA 4RZRA 1JX4A 4RQ5A 1BPYA 5JTIA 4YD2A 4DEZA 2J6TA 2AU0A 5AKHA 5J2HA 4BWMA 1ZQCA 4YMNA 4J9OA 4TQRA 2WB1C 3NASA 4CRXA 2E8MA 3PY8A 5F9LA 3IG8A 2DWQA 3IG5A 1RQLA 5KAIU 1J2MA 2W3RA 5HHHA 1LV5A 7ICTA 2BZFA 1XNSA 1HUZA 1N5XA 4IQTA 3PR4A 4RNOA 4UBCA 3AQFA 1ZQYA 5ALHA 3BQ0A 4R63A 7ICQA 1SIJA 5AM4A 3N4MB 4C7ZA 5G5HA 3WKEA 3RRHA 4J9NA 1ZD5A 4C4SA 3H7IA 1NJWA 4FFDA 1NKEA 2PFQA 1T94A 2ZUDA 2RQ5A 2JRZA 4E0DA 5CA7A 1SV0C 2ZIXB 4QZFA 1UT5A 5HMLA 5BOMA 3ALRA 4UAYA 2HBKA 4OD0A 1LVHA 3JPQA 3KHLA 1L7OA 2I5HA 4I2AA 1A6SA 8ICYA 4CF5A 1K1QA 5AI6A 5AM3A 2K8CB 2C22A 4RT2A 4LZDA 4OCZA 4QZDA 1DRGA 3KKAA 3NUQA 2XIDA 1B43A 2PMZC 4ECUA 1IV8A 1V38A 4DLEA 4DFDA 4GXKA 3SV4A 1SZHA 4U6PA 4UARA 4Y2UA 1KLNA 7ICOA 8ICZA 5L1JA 2W11A 5KFDA 2R8GA 3K75D 5J2BA 5J2EA 1IM4A 5KFLA 1MQ3A 4G9BA 1ZQZA 1TAMA 4DSJA 2OM6A 8ICAA 5ALWA 2PFPA 1ZD3A 2C28A 3FAHA 5AKZA 3NVZA 1U45A 3LK9A 9ICHA 4DSLA 3IRUA 3AMZA 1XSLA 5DQIA 4EZ9A 3ED5A 2HHUA 3BQ1A 2H5XA 4I2FA 3RH6A 4ECVA 1N2XA 5KL1B 4YD1A 2DUYA 4I2CA 4Y2QA 4Q45A 2I6XA 2N1RA 3TACB 2MAXA 2AHOB 4Y2PA 2P6RA 4RT3A 3HILA 4NLCA 1J2NA 2NRXA 4Y2XA 5DB7A 4P4PA 4M9LA 2AJQA 1ZRMA 4QIWF 3WU2U 3ICXA 3D2QA 4GXJA 3I76A 4MHVA 4RQNA 1JALA 2JEFA 5J0RA 2RLTA 2W9CB 4R8UB 5DBAA 1XU4A 3T5HA 2HMXA 4JV0A 4DSKA 4DOBA 5J0YA 4MFCA 2KIVA 3OPXA 4AYBF 4KLDA 2ZUBA 2KZZA 2HCFA 4JWNA 1X40A 4O5EA 2IOHA 1L6NA 2ISPA 3QUBA 5JUMA 2KNJA 4B9NA 3GV7B 5DGAA 4UAUA 4KX5A 5J2FA 3H8WA 3D2NA 2A1JA 2F77X 4BGDA 2F8KA 8ICCA 2K4PA 2HI0A 4QIWC 4ED3A 8ICVA 1ZQNA 1NNLA 3TADC 2YMQA 1X6IA 4KLOA 5EE9A 3PX4A 2PFNA 5ALUA 3UMGA 4Z6EA 1HEKA 3MDCA 3F53A 5ALGA 5KG4A 5BPCA 7ICKA 1SV0A 4R64A 1CEZA 4B9TA 5ALOA 2JEGA 2D6FC 2G0AA 1NK6A 2HVIA 2ZIVA 1JN3A 4FE3A 1SL1A 5ALVA 2A19A 2ASLA 2HOFA 4RQ6A 2OEHA 4J03A 3PZPA 5J0PA 2KD1A 3OHBA 1CUKA 5IIIA 1S5LU 4QWCA 1WUDA 2KJ8A 4RPZA 4NLNA 4ELVA 4TQSA 4F93B 3H8SA 4DFKA 4LZGA 3KTQA 3MR6A 3PSPA 9ICJA 2UVWA 1FFUA 2LMRA 1BNOA 5EWGA 3MGIA 2P35A 3MDAA 3ZD9A 1SXEA 5ALDA 3HP6A 5F9NA 3RAXA 4ZOHC 5AM1A 4RQ7A 1V9PA 2O6KA 5IIOA 3OSNA 3C5FA 7ICEA 1V85A 3DDHA 1F0MA 3FM9A 3N7PD 5AHXA 2MUTA 3BQ2A 3GV5B 4BX9C 4TUPA 2KN7A 1N48A 4NLGA 2FPKA 4XQ8A 2BCUA 4G3IA 2EDUA 4DL5A 1QTMA 4PZNA 2Y0SF 9ICAA 4RPXA 1QSYA 1ZETA 2JEJA 1TK5A 4F4ZA 3HX0A 3HT3A 2W8KA 5KFQA 4KX3A 1SWVA 5KT4A 4O3NA 4F5PA 3TQ1A 3KFUF 2XCPA 2JMGA 5AI4A 1TV9A 4C80A 1ZRNA 3TANA 1NOMA 5C5JA 2PI4A 5KG0A 4Q44A 4RUCA 4QWBA 2WF8A 3TI0A 3M8RA 5KFHA 3C1ZA 9ICEA 4F72A 3PMLA 2Y1IA 1ZQMA 2W04A 1D8BA 5IIKA 4J9RA 2LHTA 8ICTA 5D4BA 3G6YA 1RYSA 3RTVA 3NVVA 1RDFA 4IQVA 2HHSA 2Y0SC 3PNCA 3H4DA 1X9MA 4ED6A 1UHUA 4M6WB 4MFFA 3BS7A 3BDPA 1C7YA 3JPTA 4GC7A 1XSNA 2WF5A 1Q46A 2NRTA 2Q0ZX 3SD7A 2LYHA 5HR7A 4JK1A 2K8AA 4DF8A 2XY6A 1BNPA 4US9A 9ICFA 8ICFA 4MF8A 2BPGA 1Z4NA 2W9BB 5DG7A 2W9MA 1S0NA 1ZYQA 5AIAA 1TAQA 2ZJ8A 4QWDA 2EZZA 5HP4A 3Q8KA 4JWMA 7ICRA 4MF2A 4B6JA 8ICRA 1TVAA 3BS5A 2F3NA 4WJ3B 4EZ6A 1A76A 5ALPA 1UA1A 2I1QA 2XO7A 2W03A 1MA7A 1NK5A 3G6XA 2H3QA 2KICA 3RAQA 1U48A 4UATA 5KG7A 3E0FA 1T4GA 5GTHU 1QSLA 1T7PA 4I2IA 4I2BA 5KFAA 2E8PA 3TAQA 3SQIA 2LKYA 2YX8A 2IOFA 5DDYA 2CN1A 4EBCA 1KN5A 1FEZA 7ICLA 1Z4OA 5DB8A 4J9KA 4J9LA 3QYPA 4ECYA 4GC6A 4IR1A 4YFKA 1CI4A 2DFLA 3JPPA 3AEVA 1PVRA 2XCAA 1L5UA 1QSSA 2YMMA 3I28A 4B9VA 1PK1B 3ZDEA 3QU2A 4F5OA 1MN8A 3KHHA 3RBEA 1X66A 1L3UA 3U26A 1ZQFA 3UM9A 3RRGA 2HHVA 5HHIA 2MU2A 1BPDA 1WWUA 4ECRA 3RR7A 5DBCA 3RB0A 1JMSA 5CWRA 3EW9A 5DB6A 2F44A 3RJEA 2YMLA 1YT3A 1N62A 1JROA 4DL2A 2XY7A 4CF3A 4F4WA 1KKXA 3N97B 2AQ4A 4O3SA 2WB1F 3T3FA 2QKQA 3RB3A 3SAFA 5KFOA 4F4YA 3KD3A 5DQHA 2LI6A 1KBUA 3IHQB 1S76D 3ISCA 4CCHA 5H2FU 5ALEA 4Z6CA 2JHDA 2G5HB 4RPYA 1DGJA 1SKRA 5AKYA 1N61A 3PV8A 1NK7A 5AKJA 1ZJNA 4NLKA 5ALLA 2JZBB 3WK7A 1VDVA 1KW4A 2BCSA 2NO4A 1FO4A 4F5QA 2ZJAA 4J9PA 3RR8A 2XC9A 3ORYA 2LYBA 1XSPA 5CJ7A 1FIQA 2FE9A 2DL0A 5TZVA 2IHMA 3HW8A 8ICQA 2FI1A 5ALFA 5J8YC 4AYBC 4Y2JA 2R8JA 2JR5A 2I9GA 3QU7A 5KFMA 1ZQUA 4F91B 2FMPA 3QNMA 2MRLA 3IM1A 2KV2A 4NM1A 2FDRA 1ZQVA 5J8YA 9ICKA 1T3QA 4MEXA 3H40A 5EE0A 2ALZA 4USAA 1B4FA 5KFKA 5AM0A 1TFRA 1ZQJA 4QZGA 1ZQDA 3AL0B 3PX6A 2EAMA 2KKPA 5KFUA 5AK4A 3IDWA 2YY6A 5KFGA 7ICIA 1SL2A 3B0YA 2Q4TA 4YVZA 1WG8A 1X6JA 2PKEA 4ED0A 1FFVA 3UMCA 3K1RB 2HBJA 4FS1A 1LKYA 2EZYA 4ELUA 5F3XB 1XO0A 4UB6U 2KFZA 3WK6A 1NKCA 3DV9A 3RJFA 4FS2A 2LM1A 2P66A 3ZI4A 3JPOA 1NZPA 5A0LA 5JU5A 1L3VA 3SMVA 1XC9A 4DS5A 3SZ2A 4PHAA 9ICNA 5AKKA 1YZ6A 3PW4A 5T14A 2XVTA 4DSEA 1ZQXA 3K4GA 2JH7A 4GIBA 5L9XA 2HVHA 1BPZA 1RG6A 2W9BA 4C8MA 1EXNA 5KFZA 4U7CA 8ICPA 2DKXA 2BQRA 3GIIA 3T79A 2LYAA 4IS7A 3E58A 2CPRA 2JGAA 2KEYA 5E79U 3KHGA 3F5EA 1F44A 4UBBA 4DS4A 3GIJA 1Y88A 1HJPA 4QZAA 1QH9A 5DLGA 2ISOA 4M9JA 4M9GA 1SL0A 1COKA 2OHFA 3AM9A 2L5YA 5KL8B 3LVVA 1L3SA 2OCEA 4PHDA 1MSWD 2ASDA 4PJ0U 2W8LA 2YN4A 5ALYA 2F76X 2AGPA 4DQSA 5EWFA 4M2YA 4I29A 2E1FA 5AICA 3UPQA 3ETLA 3M9NB 4CF4A 4KLHA 3M8SA 1TKDA 4I27A 2KE7A 2FPMA 2FMQA 3N7RC 3EYZA 4ECTA 3QE9Y 4EEKA 1ZQSA 4I28A 2BCRA 4BJQA 4JV1A 7ICSA 2V4RA 1ZQAA 1JI7A 2AGQA 4IL6U 3M1YA 5HNKA 8ICLA 2R8HA 2CXYA 4QZBA 3A0HU 4KLUA 5JRTA 3WKCA 3KBBA 5ALTA 3MR3A 3HJEA 1S9FA 4FZNA 2HDOA 3ISDA 3QEBZ 2ZUCA 4KLQA 2K4EA 3WKBA 1O03A 4MEYA 7ICHA 2KG5A 4UB3A 2F8LA 4OO1J 3PO5A 5KG6A 2MUTB 2BCQA 4IQWA 3T5KA 4RQ2A 1PZNA 2ZIWA 4QZEA 4QWEA 2Y9UA 3FYHA 2KVCA 5J29A 3OHAA 2IA6A 4FO6A 4F50A 4QJFB 3OGUA 3C23A 4I2DA 5KG3A 1N5WA 2XY5A 8ICEA 4RQ8A 2BPFA 9ICWA 3S6JA 9ICBA 4R66A 1RYUA 4M0AA 7ICPA 3KKAC 2XICA 1X9WA 2KP7A 2B6GA 1N56A 1ZQQA 3Q8LA 3NRZA 4IRKA 2K60A 5J0SA 2BHNA 2ZTDA 2FLNA 2RHFA 5ALXA 2Y9TA 4BUGA 2G06A 5BOLA 3I1YA 1U47A 1KFTA 4M9NA 1L8LA 5EE3A 3C28A 4YR3A 3V7KA 1NZBA 4KMOB 3V6HA 5J0UA 2KJ5A 4DLGA 2MSNA 4DL6A 4QZCA 4P2HA 3H8MA 1KL9A 4BWJA 2E8OA 4C8LA 3QU9A 4O3PA 4KN4A 4M47A 5KFXA 9ICMA 4DSIA 5TISU 5J0WA 1ED1A 2FLPA 2EZXA 4YG2A 4RUAA 3PSTA 2P6UA 1RYRA 7ICVA 4F3OA 1F5SA 5DG8A 1AQ6A 4RQ1A 5L1IA 9ICUA 2OYYA 3F2BA 4KLLA 4OJOA 4UB4A 2G07A 2KTQA 2PMZF 4O3OA 4K4GA 4NXZA 2OH2A 2XI9A 3TFRA 1TK8A 4PZOA 4UB1A 3RBDA 3QUCA 3THVA 5J0QA 3IV6A 5KFSA 1L7MA 3SAHA 2F1JA 3MFHA 1RXVA 3WK4A 4Y2YA 5EE1A 2G08A 3NRWA 2Z7JA 5AKXA 2EAOA 2DPJA 4DOCA 1KTQA 2H3ZA 5DB9A 4P0PB 2KVSA 2BKEA 4JMUA 2C2RA 2A3VA 1U9LA 2BQUA 2W7OA 3D6JA 2ZJ5A 8ICIA 5EOZA 4IR9A 3FC4A 3ONNA 1ZD2P 1BPBA 2F1HA 4KLJA 3QZ8A 4FZMA 2PI5A 2M9NA 2F1IA 5ALRA 5KNIA 1ZQTA 5AI9A 4QZ8A 2WHEA 3MBYA 3Q8PB 4KLTA 3GIKA 4OJ5A 5J2JA 3CYMA 5DLFA 3QZ7A 4DFMA 1HUOA 2QB0B 3RJHA 1NI3A 7ICMA 1D8LA 2ZIUB 1L3TA 4IC9A 3WKDA 4BDPA 3ETRA 1B22A 2XGPA 2K4IA 3RH5A 4RNNA 3OJSA 1SKWA 1H38A 3BQTA 4QZIA 2J6UA 1UT8A 1ZQOA 5KFJA 4XRHA 3IN5A 4IQUA 5DKWA 3TARA 1JXEA 5IIJA 2QARA 5AM2A 4LVSA 2BQ3A 3E2EA 4C8OA 4F5NA 5J0XA 5HMMA 3PSFA 5KFRA 4UQGA 2YTUA 5KFYA 1DK3A 4DL4A 3LDAA 2BDUA 2KSOA 1KFDA 4EYIB 4UW9A 7ICFA 2XGQA 3PO4A 3F2DA 4PHPA 4QW9A 1S97A 3AU6A 2ZTCA 2V4QA 4TURA 3EPIA 1ZQHA 1S10A 4CGZA 4Y2VA 3T5JA 1ZQLA 9ICSA 3JPNA 1SZPA 4P4MA 2KMDA 2YB1A 4NLBA 9ICRA 4F4KA 4ED7A 2AGOA 1WYGA 4AP9A 8ICNA 3PW7A 2QB1A 8ICGA 1U49A 1ZQGA 4A8EA 4FBTA 2KSOB 3SI8A 3QXGA 2C2DA 3CW2C 2R8IA 4J9SA 1QQ5A 1RQNA 4ZH4A 1BGXT 4JUZA 3CRXA 2ATLA 3WK5A 2KIWA 2QLTA 4Q43A 3TKAA 3RB6A 2V9WA 2W43A 9ICQA 1A0PA 1QCKA 8ICBA 1PUZA 7ICNA 2JH1A 4O5KA 4ECWA 4LJXA 2UVUA 5ALQA 4TUSA 2AXTU 2GOLA 2HOQA 4QZ9A 3TFSA 4DQIA 4KN7A 1SV4A 1Q3UA 2NRVA 2RDIA 1BPEA 5CHGA 4JV2A 4KLFA 4KLIA 2EH9A 4O3MA 3V7LA 4C8KA 1X9SA 3TADA 2KHQA 4RQ0A 2JEIA 3M6ZA 4J9MA 3F5AA 1UCVA 3Q8MA 1X2IA 4B9SA 3GQCA 1LKYB 1N63A 1T3NA 3GILA 3V6JA 3NTUA 3QX7A 4Q8FA 3L3FX 3EZ5A 4ED8A 3PSIA 3V72A 1NJYA 2E5SA 5KT7A 3J81j 5AKIA 3CP8A 2GO7A 5KT5A 3MC1A 4C4TA 5KFIA 1M6YA 5ALSA 1KQQA 5IILA 1DXSA 1Q8KA 1T8EA 4C0ZA 1N60A 4C7YA 5AK6A 5L1LA 5ALKA 1Z00A 2YMPA 4NLZA 4ECXA 5C0YA 4XA5A 4EX6A 2HW3A 3OSPA 2EANA 3UMBA 3GFKB 2WF6A 4ECSA 5L1KA 1RPLA 3ZDAA 3Q8RB 1PVQA 5KG2A 1HIWA 4NL9C 2ES6A 3M6KA 5AK3A 5ALJA 2NYVA 3QUTA 4CDGA 4PGYA 3L5KA 3OTQA 2DGZA 4PGQA 3KOOA 3NS1A 5J2DA 5FP0A 3R9KA 4GXIA 1A77A 1NK0A 5DBBA 1D9DA 4NV0A 1QQ7A 1JRPA 1URJA 2A1JB 3PVXA 2KZ3A 4IRCA 2YB4A 4M04A 3D2SA 2C2EA 3WK8A 5KFEA 3V7JA 1D9FA 2MA1A 5AKEA 4EX7A 5DGBA 2GWSA 2DKZA 4QZHA 9ICPA 2NO5A 3HRDD 2VIXA 3UXNA 2ZXHA 5KFTA 1BVSA 2GH1A 2KK0A 5KG1A 2NRZA 1LB2B 2WAQC 3LVWA 1S0OA 4US8A 1BPXA 4K4IA 3F2CA 3RJJA 3M7DA 5CRXA 3SAGA 9ICOA 2E3TA 4YP3A 5DG9A 5DQGA 1ZXIA 3BJYA 4O5CA 1SKSA 3Q8SB 1ZQPA 4YXJA 1NK4A 8ICSA 2ZIWB 2B0CA 1GO3F 1X42A 5ALNA 5KFCA 3UXPA 2R18A 2W7PA 5J2GA 1PVPA 2PXIA 2VANA 1NK9A 3GV8B 3QEAZ 4KMUA 4C4RA 3BS5B 1RXWA 5J2IA 3M9OB 2E1EA 5DDMA 8ICWA 4RU9A 3LWMA 3FDSA 3SYZA 1S0MA 1JIHA 3HWTA 4GFJA 4Z6FA 1ZJMA 3EWAA 4F71A 4UAVA 2ZTEA
chains in the Genus database with same CATH topology
4IL6U 3A0HU 5H2FU 5KAFU 5TISU 5KAIU 5B66U 4UB8U 5B5EU 4UB6U 3WU2U 5GTHU 2DUYA 1S5LU 4PJ0U 5GTIU 5E79U 3A0BU 2AXTU 3KZIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 U;  3A0H U;  5H2F U;  5KAF U;  5TIS U;  5KAI U;  5B66 U;  4UB8 U;  5B5E U;  4UB6 U;  3WU2 U;  5GTH U;  2DUY A;  1S5L U;  4PJ0 U;  5GTI U;  5E79 U;  3A0B U;  2AXT U;  3KZI U; 
#chains in the Genus database with same CATH topology
 1QQ6 A;  8ICK A;  3PR5 B;  3T5L A;  2EAP A;  4O9M A;  3AN1 A;  2VKQ A;  2W54 A;  3H0L B;  1O08 A;  1ZQB A;  3C29 A;  1PK3 A;  2BGW A;  3MR5 A;  3O0F A;  1UQV A;  3KHR A;  3V6K A;  4DFJ A;  4P4O A;  1SGG A;  3M9M B;  3AQE A;  2NV3 A;  7ICJ A;  4P0Q B;  2HHW A;  4KLG A;  2B21 A;  2GLE A;  1PK1 A;  1J97 A;  3DEE A;  3HPO A;  1ZQI A;  3ZDB A;  3B9J A;  3OJU A;  2RP5 A;  3C5G A;  2J6S A;  4YMM A;  3MFI A;  3G6V A;  2EQY A;  4F2R A;  3Q8Q B;  4QWA A;  3AU2 A;  4I2J A;  2LM4 A;  1D8Y A;  1MC8 A;  4O3R A;  3VCB A;  4EYH B;  4YXM A;  1DK2 A;  8ICH A;  5AI8 A;  4C8N A;  3RF9 A;  2FMS A;  4R8U A;  7ICU A;  5J0T A;  1IG6 A;  1NKB A;  4CE6 A;  3PW2 A;  3K1Z A;  5KFF A;  2HHT A;  1DOQ A;  4UB2 A;  4YR2 A;  2H3V A;  1ZQK A;  5AM5 A;  2WTF A;  2A1A A;  5ALI A;  5J2K A;  4HAI A;  4O0I A;  2KKV A;  2QB0 A;  2VA2 A;  1XS9 D;  4DWI A;  4NY8 A;  1WWV A;  3ISB A;  1KDH A;  4F4X A;  2BDP A;  1NJZ A;  2BR0 A;  3H8J A;  1COO A;  2H3I A;  1VLB A;  2BCV A;  1Z1B A;  3A0B U;  2WAQ F;  3QU4 A;  3NGD A;  3HKZ C;  4BXO B;  3N28 A;  7ICG A;  5KAF U;  2HBM A;  1K1S A;  1P7D A;  5EWE A;  8ICX A;  2KOB A;  4YMO A;  3BZC A;  4I2H A;  4F92 B;  3UXO A;  4OJP A;  1L8O A;  4OJL A;  4DQQ A;  2ZIX A;  2UVR A;  4KIT B;  4P0Q A;  1WCN A;  4Y2R A;  2WF7 A;  2ZIV B;  5AIB A;  4X5V A;  2JV3 A;  4EEY A;  2UVV A;  2HBL A;  5AKL A;  1VJ5 A;  4BXO A;  2NRW A;  5KFB A;  4Y2T A;  1NJX A;  4DSF A;  1OUQ A;  2D8C A;  1JXL A;  2K4H A;  2ZXI A;  2DF4 B;  1ARO P;  2G5I B;  4RQM A;  5KT3 A;  4PGX A;  8ICJ A;  5B5E U;  4DQR A;  4DL3 A;  3PMN A;  4TUQ A;  2W9C A;  2IOF K;  9ICG A;  2H3F A;  3QU5 A;  2W55 A;  3H0R B;  3GZF A;  4UAZ A;  3PX0 A;  3RH4 A;  5HR6 A;  3ZDC A;  4GLX A;  5KFV A;  4IRD A;  8ICU A;  2G09 A;  4JB3 A;  1XWL A;  2KZM A;  1RM6 C;  4FBU A;  2KHV A;  2CRX A;  3N7S C;  3KZX A;  3ZDD A;  1UA0 A;  2Y1J A;  4Q8E A;  1S8O A;  4ACO A;  3SEN A;  4UAW A;  2IMW P;  2K89 A;  4O3Q A;  4HYK A;  3JPS A;  8ICO A;  1QLN A;  3C1Y A;  2DBY A;  4YCX A;  4MFA A;  4I2G A;  2KJ9 A;  4PL2 A;  9ICV A;  1CRX A;  5CB1 A;  3RJI A;  2W3S A;  1KFS A;  3NVY A;  2WF9 A;  4UB8 U;  2AQ0 A;  1KSP A;  3H0M B;  3B0X A;  5AK5 A;  1IIP A;  2ZG6 A;  4PPX A;  4F2S A;  4RNM A;  1K5O A;  4P0P A;  2E8N A;  1OXJ A;  5G5G A;  3MR2 A;  3WKA A;  9ICI A;  5AI0 A;  1SB3 C;  1Z00 B;  4FZL A;  5KTQ A;  2HHX A;  2JXJ A;  2ESE A;  4PHE A;  3EPG A;  4NJ8 A;  2D3D A;  1TK0 A;  4PL1 A;  4ICA A;  2OWO A;  3GDX A;  3RJK A;  4DF4 A;  3RJG A;  3MAB A;  4XUS A;  2R8K A;  1Q3V A;  4EEL A;  3MGV A;  4J9Q A;  1SXD A;  8ICM A;  3HKZ F;  4F5R A;  2VJ5 A;  1ZQR A;  4QW8 A;  2VA8 A;  9ICT A;  3JPR A;  1YZ7 A;  1MQ2 A;  2M0N A;  3VC8 A;  3C2L A;  5D46 A;  5B66 U;  4F8R A;  4NWI A;  4R65 A;  4B9L A;  4YN4 A;  2AH5 A;  5CR0 A;  3UQ0 A;  2IHN A;  1C20 A;  5ALM A;  2FLL A;  1X9X A;  3UQ2 A;  1TAU A;  5K4L A;  4EBE A;  2VJ4 A;  4CNQ A;  4DOA A;  4ELT A;  1ZQW A;  3L4P A;  3C2M A;  1RZT A;  1ZQ1 C;  5J2C A;  2ZIU A;  2IBK A;  2RDJ A;  1U4B A;  5D49 A;  1IXR A;  1B0X A;  4DFP A;  4RQ4 A;  3QUQ A;  4EBD A;  4UAS A;  5KT6 A;  3LWL A;  1ECW A;  5L1M A;  2QAR B;  4OJ6 A;  4YQW A;  3MGH A;  1Z3E B;  3SEI A;  5AKG A;  1SWW A;  3WK9 A;  4PH5 A;  4M9H A;  2LBO A;  3CNH A;  5GTI U;  4KLE A;  2JZB A;  3SR6 A;  2PFO A;  2VA3 A;  9ICL A;  4Z6D A;  4ECQ A;  4B9M A;  5CP2 A;  2KFN A;  5KFN A;  4KLM A;  4EEN A;  4KLS A;  4DQP A;  3RB4 A;  2WFA A;  3EUB 2;  4NM2 A;  3GU3 A;  5ALZ A;  1ZOL A;  2ODG A;  1Z19 A;  3RFA A;  3SV3 A;  2OXO A;  3IP4 B;  3BZK A;  1NK8 A;  4UB5 A;  2K8B B;  1ZD4 A;  2HOI A;  2W9A A;  1UPH A;  4I2E A;  4RQ3 A;  1Z1V A;  1KEJ A;  1OW5 A;  9ICC A;  4YR0 A;  2ASJ A;  3TAP A;  2FPL A;  3NVW A;  1WCL A;  2LPE A;  5KT2 A;  4DCC A;  4K4H A;  4DL7 A;  3KZI U;  5KFW A;  5IIM A;  3PW0 A;  3LYS A;  2DQN B;  3C2K A;  1ZQE A;  5KG5 A;  4M6W A;  2BPC A;  1DGS A;  4NL9 A;  5KFP A;  3AUO A;  4ED1 A;  1TE2 A;  2YQE A;  4Y2S A;  9ICX A;  2F2A B;  1V97 A;  3PW5 A;  4DO9 A;  2HSZ A;  4ED2 A;  3GIM A;  5CEH A;  3H4B A;  4QNL A;  1L7P A;  1KRP A;  4KTQ A;  1S0V A;  5AI5 A;  1L7N A;  1S77 D;  5J2A A;  1JUD A;  3C21 A;  3BQ7 A;  2DPI A;  4ECZ A;  1XO1 A;  2RRD A;  5J0O A;  2FJ6 A;  5IIN A;  4B9U A;  3ZD8 A;  2HHQ A;  4RZR A;  1JX4 A;  4RQ5 A;  1BPY A;  5JTI A;  4YD2 A;  4DEZ A;  2J6T A;  2AU0 A;  5AKH A;  5J2H A;  4BWM A;  1ZQC A;  4YMN A;  4J9O A;  4TQR A;  2WB1 C;  3NAS A;  4CRX A;  2E8M A;  3PY8 A;  5F9L A;  3IG8 A;  2DWQ A;  3IG5 A;  1RQL A;  5KAI U;  1J2M A;  2W3R A;  5HHH A;  1LV5 A;  7ICT A;  2BZF A;  1XNS A;  1HUZ A;  1N5X A;  4IQT A;  3PR4 A;  4RNO A;  4UBC A;  3AQF A;  1ZQY A;  5ALH A;  3BQ0 A;  4R63 A;  7ICQ A;  1SIJ A;  5AM4 A;  3N4M B;  4C7Z A;  5G5H A;  3WKE A;  3RRH A;  4J9N A;  1ZD5 A;  4C4S A;  3H7I A;  1NJW A;  4FFD A;  1NKE A;  2PFQ A;  1T94 A;  2ZUD A;  2RQ5 A;  2JRZ A;  4E0D A;  5CA7 A;  1SV0 C;  2ZIX B;  4QZF A;  1UT5 A;  5HML A;  5BOM A;  3ALR A;  4UAY A;  2HBK A;  4OD0 A;  1LVH A;  3JPQ A;  3KHL A;  1L7O A;  2I5H A;  4I2A A;  1A6S A;  8ICY A;  4CF5 A;  1K1Q A;  5AI6 A;  5AM3 A;  2K8C B;  2C22 A;  4RT2 A;  4LZD A;  4OCZ A;  4QZD A;  1DRG A;  3KKA A;  3NUQ A;  2XID A;  1B43 A;  2PMZ C;  4ECU A;  1IV8 A;  1V38 A;  4DLE A;  4DFD A;  4GXK A;  3SV4 A;  1SZH A;  4U6P A;  4UAR A;  4Y2U A;  1KLN A;  7ICO A;  8ICZ A;  5L1J A;  2W11 A;  5KFD A;  2R8G A;  3K75 D;  5J2B A;  5J2E A;  1IM4 A;  5KFL A;  1MQ3 A;  4G9B A;  1ZQZ A;  1TAM A;  4DSJ A;  2OM6 A;  8ICA A;  5ALW A;  2PFP A;  1ZD3 A;  2C28 A;  3FAH A;  5AKZ A;  3NVZ A;  1U45 A;  3LK9 A;  9ICH A;  4DSL A;  3IRU A;  3AMZ A;  1XSL A;  5DQI A;  4EZ9 A;  3ED5 A;  2HHU A;  3BQ1 A;  2H5X A;  4I2F A;  3RH6 A;  4ECV A;  1N2X A;  5KL1 B;  4YD1 A;  2DUY A;  4I2C A;  4Y2Q A;  4Q45 A;  2I6X A;  2N1R A;  3TAC B;  2MAX A;  2AHO B;  4Y2P A;  2P6R A;  4RT3 A;  3HIL A;  4NLC A;  1J2N A;  2NRX A;  4Y2X A;  5DB7 A;  4P4P A;  4M9L A;  2AJQ A;  1ZRM A;  4QIW F;  3WU2 U;  3ICX A;  3D2Q A;  4GXJ A;  3I76 A;  4MHV A;  4RQN A;  1JAL A;  2JEF A;  5J0R A;  2RLT A;  2W9C B;  4R8U B;  5DBA A;  1XU4 A;  3T5H A;  2HMX A;  4JV0 A;  4DSK A;  4DOB A;  5J0Y A;  4MFC A;  2KIV A;  3OPX A;  4AYB F;  4KLD A;  2ZUB A;  2KZZ A;  2HCF A;  4JWN A;  1X40 A;  4O5E A;  2IOH A;  1L6N A;  2ISP A;  3QUB A;  5JUM A;  2KNJ A;  4B9N A;  3GV7 B;  5DGA A;  4UAU A;  4KX5 A;  5J2F A;  3H8W A;  3D2N A;  2A1J A;  2F77 X;  4BGD A;  2F8K A;  8ICC A;  2K4P A;  2HI0 A;  4QIW C;  4ED3 A;  8ICV A;  1ZQN A;  1NNL A;  3TAD C;  2YMQ A;  1X6I A;  4KLO A;  5EE9 A;  3PX4 A;  2PFN A;  5ALU A;  3UMG A;  4Z6E A;  1HEK A;  3MDC A;  3F53 A;  5ALG A;  5KG4 A;  5BPC A;  7ICK A;  1SV0 A;  4R64 A;  1CEZ A;  4B9T A;  5ALO A;  2JEG A;  2D6F C;  2G0A A;  1NK6 A;  2HVI A;  2ZIV A;  1JN3 A;  4FE3 A;  1SL1 A;  5ALV A;  2A19 A;  2ASL A;  2HOF A;  4RQ6 A;  2OEH A;  4J03 A;  3PZP A;  5J0P A;  2KD1 A;  3OHB A;  1CUK A;  5III A;  1S5L U;  4QWC A;  1WUD A;  2KJ8 A;  4RPZ A;  4NLN A;  4ELV A;  4TQS A;  4F93 B;  3H8S A;  4DFK A;  4LZG A;  3KTQ A;  3MR6 A;  3PSP A;  9ICJ A;  2UVW A;  1FFU A;  2LMR A;  1BNO A;  5EWG A;  3MGI A;  2P35 A;  3MDA A;  3ZD9 A;  1SXE A;  5ALD A;  3HP6 A;  5F9N A;  3RAX A;  4ZOH C;  5AM1 A;  4RQ7 A;  1V9P A;  2O6K A;  5IIO A;  3OSN A;  3C5F A;  7ICE A;  1V85 A;  3DDH A;  1F0M A;  3FM9 A;  3N7P D;  5AHX A;  2MUT A;  3BQ2 A;  3GV5 B;  4BX9 C;  4TUP A;  2KN7 A;  1N48 A;  4NLG A;  2FPK A;  4XQ8 A;  2BCU A;  4G3I A;  2EDU A;  4DL5 A;  1QTM A;  4PZN A;  2Y0S F;  9ICA A;  4RPX A;  1QSY A;  1ZET A;  2JEJ A;  1TK5 A;  4F4Z A;  3HX0 A;  3HT3 A;  2W8K A;  5KFQ A;  4KX3 A;  1SWV A;  5KT4 A;  4O3N A;  4F5P A;  3TQ1 A;  3KFU F;  2XCP A;  2JMG A;  5AI4 A;  1TV9 A;  4C80 A;  1ZRN A;  3TAN A;  1NOM A;  5C5J A;  2PI4 A;  5KG0 A;  4Q44 A;  4RUC A;  4QWB A;  2WF8 A;  3TI0 A;  3M8R A;  5KFH A;  3C1Z A;  9ICE A;  4F72 A;  3PML A;  2Y1I A;  1ZQM A;  2W04 A;  1D8B A;  5IIK A;  4J9R A;  2LHT A;  8ICT A;  5D4B A;  3G6Y A;  1RYS A;  3RTV A;  3NVV A;  1RDF A;  4IQV A;  2HHS A;  2Y0S C;  3PNC A;  3H4D A;  1X9M A;  4ED6 A;  1UHU A;  4M6W B;  4MFF A;  3BS7 A;  3BDP A;  1C7Y A;  3JPT A;  4GC7 A;  1XSN A;  2WF5 A;  1Q46 A;  2NRT A;  2Q0Z X;  3SD7 A;  2LYH A;  5HR7 A;  4JK1 A;  2K8A A;  4DF8 A;  2XY6 A;  1BNP A;  4US9 A;  9ICF A;  8ICF A;  4MF8 A;  2BPG A;  1Z4N A;  2W9B B;  5DG7 A;  2W9M A;  1S0N A;  1ZYQ A;  5AIA A;  1TAQ A;  2ZJ8 A;  4QWD A;  2EZZ A;  5HP4 A;  3Q8K A;  4JWM A;  7ICR A;  4MF2 A;  4B6J A;  8ICR A;  1TVA A;  3BS5 A;  2F3N A;  4WJ3 B;  4EZ6 A;  1A76 A;  5ALP A;  1UA1 A;  2I1Q A;  2XO7 A;  2W03 A;  1MA7 A;  1NK5 A;  3G6X A;  2H3Q A;  2KIC A;  3RAQ A;  1U48 A;  4UAT A;  5KG7 A;  3E0F A;  1T4G A;  5GTH U;  1QSL A;  1T7P A;  4I2I A;  4I2B A;  5KFA A;  2E8P A;  3TAQ A;  3SQI A;  2LKY A;  2YX8 A;  2IOF A;  5DDY A;  2CN1 A;  4EBC A;  1KN5 A;  1FEZ A;  7ICL A;  1Z4O A;  5DB8 A;  4J9K A;  4J9L A;  3QYP A;  4ECY A;  4GC6 A;  4IR1 A;  4YFK A;  1CI4 A;  2DFL A;  3JPP A;  3AEV A;  1PVR A;  2XCA A;  1L5U A;  1QSS A;  2YMM A;  3I28 A;  4B9V A;  1PK1 B;  3ZDE A;  3QU2 A;  4F5O A;  1MN8 A;  3KHH A;  3RBE A;  1X66 A;  1L3U A;  3U26 A;  1ZQF A;  3UM9 A;  3RRG A;  2HHV A;  5HHI A;  2MU2 A;  1BPD A;  1WWU A;  4ECR A;  3RR7 A;  5DBC A;  3RB0 A;  1JMS A;  5CWR A;  3EW9 A;  5DB6 A;  2F44 A;  3RJE A;  2YML A;  1YT3 A;  1N62 A;  1JRO A;  4DL2 A;  2XY7 A;  4CF3 A;  4F4W A;  1KKX A;  3N97 B;  2AQ4 A;  4O3S A;  2WB1 F;  3T3F A;  2QKQ A;  3RB3 A;  3SAF A;  5KFO A;  4F4Y A;  3KD3 A;  5DQH A;  2LI6 A;  1KBU A;  3IHQ B;  1S76 D;  3ISC A;  4CCH A;  5H2F U;  5ALE A;  4Z6C A;  2JHD A;  2G5H B;  4RPY A;  1DGJ A;  1SKR A;  5AKY A;  1N61 A;  3PV8 A;  1NK7 A;  5AKJ A;  1ZJN A;  4NLK A;  5ALL A;  2JZB B;  3WK7 A;  1VDV A;  1KW4 A;  2BCS A;  2NO4 A;  1FO4 A;  4F5Q A;  2ZJA A;  4J9P A;  3RR8 A;  2XC9 A;  3ORY A;  2LYB A;  1XSP A;  5CJ7 A;  1FIQ A;  2FE9 A;  2DL0 A;  5TZV A;  2IHM A;  3HW8 A;  8ICQ A;  2FI1 A;  5ALF A;  5J8Y C;  4AYB C;  4Y2J A;  2R8J A;  2JR5 A;  2I9G A;  3QU7 A;  5KFM A;  1ZQU A;  4F91 B;  2FMP A;  3QNM A;  2MRL A;  3IM1 A;  2KV2 A;  4NM1 A;  2FDR A;  1ZQV A;  5J8Y A;  9ICK A;  1T3Q A;  4MEX A;  3H40 A;  5EE0 A;  2ALZ A;  4USA A;  1B4F A;  5KFK A;  5AM0 A;  1TFR A;  1ZQJ A;  4QZG A;  1ZQD A;  3AL0 B;  3PX6 A;  2EAM A;  2KKP A;  5KFU A;  5AK4 A;  3IDW A;  2YY6 A;  5KFG A;  7ICI A;  1SL2 A;  3B0Y A;  2Q4T A;  4YVZ A;  1WG8 A;  1X6J A;  2PKE A;  4ED0 A;  1FFV A;  3UMC A;  3K1R B;  2HBJ A;  4FS1 A;  1LKY A;  2EZY A;  4ELU A;  5F3X B;  1XO0 A;  4UB6 U;  2KFZ A;  3WK6 A;  1NKC A;  3DV9 A;  3RJF A;  4FS2 A;  2LM1 A;  2P66 A;  3ZI4 A;  3JPO A;  1NZP A;  5A0L A;  5JU5 A;  1L3V A;  3SMV A;  1XC9 A;  4DS5 A;  3SZ2 A;  4PHA A;  9ICN A;  5AKK A;  1YZ6 A;  3PW4 A;  5T14 A;  2XVT A;  4DSE A;  1ZQX A;  3K4G A;  2JH7 A;  4GIB A;  5L9X A;  2HVH A;  1BPZ A;  1RG6 A;  2W9B A;  4C8M A;  1EXN A;  5KFZ A;  4U7C A;  8ICP A;  2DKX A;  2BQR A;  3GII A;  3T79 A;  2LYA A;  4IS7 A;  3E58 A;  2CPR A;  2JGA A;  2KEY A;  5E79 U;  3KHG A;  3F5E A;  1F44 A;  4UBB A;  4DS4 A;  3GIJ A;  1Y88 A;  1HJP A;  4QZA A;  1QH9 A;  5DLG A;  2ISO A;  4M9J A;  4M9G A;  1SL0 A;  1COK A;  2OHF A;  3AM9 A;  2L5Y A;  5KL8 B;  3LVV A;  1L3S A;  2OCE A;  4PHD A;  1MSW D;  2ASD A;  4PJ0 U;  2W8L A;  2YN4 A;  5ALY A;  2F76 X;  2AGP A;  4DQS A;  5EWF A;  4M2Y A;  4I29 A;  2E1F A;  5AIC A;  3UPQ A;  3ETL A;  3M9N B;  4CF4 A;  4KLH A;  3M8S A;  1TKD A;  4I27 A;  2KE7 A;  2FPM A;  2FMQ A;  3N7R C;  3EYZ A;  4ECT A;  3QE9 Y;  4EEK A;  1ZQS A;  4I28 A;  2BCR A;  4BJQ A;  4JV1 A;  7ICS A;  2V4R A;  1ZQA A;  1JI7 A;  2AGQ A;  4IL6 U;  3M1Y A;  5HNK A;  8ICL A;  2R8H A;  2CXY A;  4QZB A;  3A0H U;  4KLU A;  5JRT A;  3WKC A;  3KBB A;  5ALT A;  3MR3 A;  3HJE A;  1S9F A;  4FZN A;  2HDO A;  3ISD A;  3QEB Z;  2ZUC A;  4KLQ A;  2K4E A;  3WKB A;  1O03 A;  4MEY A;  7ICH A;  2KG5 A;  4UB3 A;  2F8L A;  4OO1 J;  3PO5 A;  5KG6 A;  2MUT B;  2BCQ A;  4IQW A;  3T5K A;  4RQ2 A;  1PZN A;  2ZIW A;  4QZE A;  4QWE A;  2Y9U A;  3FYH A;  2KVC A;  5J29 A;  3OHA A;  2IA6 A;  4FO6 A;  4F50 A;  4QJF B;  3OGU A;  3C23 A;  4I2D A;  5KG3 A;  1N5W A;  2XY5 A;  8ICE A;  4RQ8 A;  2BPF A;  9ICW A;  3S6J A;  9ICB A;  4R66 A;  1RYU A;  4M0A A;  7ICP A;  3KKA C;  2XIC A;  1X9W A;  2KP7 A;  2B6G A;  1N56 A;  1ZQQ A;  3Q8L A;  3NRZ A;  4IRK A;  2K60 A;  5J0S A;  2BHN A;  2ZTD A;  2FLN A;  2RHF A;  5ALX A;  2Y9T A;  4BUG A;  2G06 A;  5BOL A;  3I1Y A;  1U47 A;  1KFT A;  4M9N A;  1L8L A;  5EE3 A;  3C28 A;  4YR3 A;  3V7K A;  1NZB A;  4KMO B;  3V6H A;  5J0U A;  2KJ5 A;  4DLG A;  2MSN A;  4DL6 A;  4QZC A;  4P2H A;  3H8M A;  1KL9 A;  4BWJ A;  2E8O A;  4C8L A;  3QU9 A;  4O3P A;  4KN4 A;  4M47 A;  5KFX A;  9ICM A;  4DSI A;  5TIS U;  5J0W A;  1ED1 A;  2FLP A;  2EZX A;  4YG2 A;  4RUA A;  3PST A;  2P6U A;  1RYR A;  7ICV A;  4F3O A;  1F5S A;  5DG8 A;  1AQ6 A;  4RQ1 A;  5L1I A;  9ICU A;  2OYY A;  3F2B A;  4KLL A;  4OJO A;  4UB4 A;  2G07 A;  2KTQ A;  2PMZ F;  4O3O A;  4K4G A;  4NXZ A;  2OH2 A;  2XI9 A;  3TFR A;  1TK8 A;  4PZO A;  4UB1 A;  3RBD A;  3QUC A;  3THV A;  5J0Q A;  3IV6 A;  5KFS A;  1L7M A;  3SAH A;  2F1J A;  3MFH A;  1RXV A;  3WK4 A;  4Y2Y A;  5EE1 A;  2G08 A;  3NRW A;  2Z7J A;  5AKX A;  2EAO A;  2DPJ A;  4DOC A;  1KTQ A;  2H3Z A;  5DB9 A;  4P0P B;  2KVS A;  2BKE A;  4JMU A;  2C2R A;  2A3V A;  1U9L A;  2BQU A;  2W7O A;  3D6J A;  2ZJ5 A;  8ICI A;  5EOZ A;  4IR9 A;  3FC4 A;  3ONN A;  1ZD2 P;  1BPB A;  2F1H A;  4KLJ A;  3QZ8 A;  4FZM A;  2PI5 A;  2M9N A;  2F1I A;  5ALR A;  5KNI A;  1ZQT A;  5AI9 A;  4QZ8 A;  2WHE A;  3MBY A;  3Q8P B;  4KLT A;  3GIK A;  4OJ5 A;  5J2J A;  3CYM A;  5DLF A;  3QZ7 A;  4DFM A;  1HUO A;  2QB0 B;  3RJH A;  1NI3 A;  7ICM A;  1D8L A;  2ZIU B;  1L3T A;  4IC9 A;  3WKD A;  4BDP A;  3ETR A;  1B22 A;  2XGP A;  2K4I A;  3RH5 A;  4RNN A;  3OJS A;  1SKW A;  1H38 A;  3BQT A;  4QZI A;  2J6U A;  1UT8 A;  1ZQO A;  5KFJ A;  4XRH A;  3IN5 A;  4IQU A;  5DKW A;  3TAR A;  1JXE A;  5IIJ A;  2QAR A;  5AM2 A;  4LVS A;  2BQ3 A;  3E2E A;  4C8O A;  4F5N A;  5J0X A;  5HMM A;  3PSF A;  5KFR A;  4UQG A;  2YTU A;  5KFY A;  1DK3 A;  4DL4 A;  3LDA A;  2BDU A;  2KSO A;  1KFD A;  4EYI B;  4UW9 A;  7ICF A;  2XGQ A;  3PO4 A;  3F2D A;  4PHP A;  4QW9 A;  1S97 A;  3AU6 A;  2ZTC A;  2V4Q A;  4TUR A;  3EPI A;  1ZQH A;  1S10 A;  4CGZ A;  4Y2V A;  3T5J A;  1ZQL A;  9ICS A;  3JPN A;  1SZP A;  4P4M A;  2KMD A;  2YB1 A;  4NLB A;  9ICR A;  4F4K A;  4ED7 A;  2AGO A;  1WYG A;  4AP9 A;  8ICN A;  3PW7 A;  2QB1 A;  8ICG A;  1U49 A;  1ZQG A;  4A8E A;  4FBT A;  2KSO B;  3SI8 A;  3QXG A;  2C2D A;  3CW2 C;  2R8I A;  4J9S A;  1QQ5 A;  1RQN A;  4ZH4 A;  1BGX T;  4JUZ A;  3CRX A;  2ATL A;  3WK5 A;  2KIW A;  2QLT A;  4Q43 A;  3TKA A;  3RB6 A;  2V9W A;  2W43 A;  9ICQ A;  1A0P A;  1QCK A;  8ICB A;  1PUZ A;  7ICN A;  2JH1 A;  4O5K A;  4ECW A;  4LJX A;  2UVU A;  5ALQ A;  4TUS A;  2AXT U;  2GOL A;  2HOQ A;  4QZ9 A;  3TFS A;  4DQI A;  4KN7 A;  1SV4 A;  1Q3U A;  2NRV A;  2RDI A;  1BPE A;  5CHG A;  4JV2 A;  4KLF A;  4KLI A;  2EH9 A;  4O3M A;  3V7L A;  4C8K A;  1X9S A;  3TAD A;  2KHQ A;  4RQ0 A;  2JEI A;  3M6Z A;  4J9M A;  3F5A A;  1UCV A;  3Q8M A;  1X2I A;  4B9S A;  3GQC A;  1LKY B;  1N63 A;  1T3N A;  3GIL A;  3V6J A;  3NTU A;  3QX7 A;  4Q8F A;  3L3F X;  3EZ5 A;  4ED8 A;  3PSI A;  3V72 A;  1NJY A;  2E5S A;  5KT7 A;  3J81 j;  5AKI A;  3CP8 A;  2GO7 A;  5KT5 A;  3MC1 A;  4C4T A;  5KFI A;  1M6Y A;  5ALS A;  1KQQ A;  5IIL A;  1DXS A;  1Q8K A;  1T8E A;  4C0Z A;  1N60 A;  4C7Y A;  5AK6 A;  5L1L A;  5ALK A;  1Z00 A;  2YMP A;  4NLZ A;  4ECX A;  5C0Y A;  4XA5 A;  4EX6 A;  2HW3 A;  3OSP A;  2EAN A;  3UMB A;  3GFK B;  2WF6 A;  4ECS A;  5L1K A;  1RPL A;  3ZDA A;  3Q8R B;  1PVQ A;  5KG2 A;  1HIW A;  4NL9 C;  2ES6 A;  3M6K A;  5AK3 A;  5ALJ A;  2NYV A;  3QUT A;  4CDG A;  4PGY A;  3L5K A;  3OTQ A;  2DGZ A;  4PGQ A;  3KOO A;  3NS1 A;  5J2D A;  5FP0 A;  3R9K A;  4GXI A;  1A77 A;  1NK0 A;  5DBB A;  1D9D A;  4NV0 A;  1QQ7 A;  1JRP A;  1URJ A;  2A1J B;  3PVX A;  2KZ3 A;  4IRC A;  2YB4 A;  4M04 A;  3D2S A;  2C2E A;  3WK8 A;  5KFE A;  3V7J A;  1D9F A;  2MA1 A;  5AKE A;  4EX7 A;  5DGB A;  2GWS A;  2DKZ A;  4QZH A;  9ICP A;  2NO5 A;  3HRD D;  2VIX A;  3UXN A;  2ZXH A;  5KFT A;  1BVS A;  2GH1 A;  2KK0 A;  5KG1 A;  2NRZ A;  1LB2 B;  2WAQ C;  3LVW A;  1S0O A;  4US8 A;  1BPX A;  4K4I A;  3F2C A;  3RJJ A;  3M7D A;  5CRX A;  3SAG A;  9ICO A;  2E3T A;  4YP3 A;  5DG9 A;  5DQG A;  1ZXI A;  3BJY A;  4O5C A;  1SKS A;  3Q8S B;  1ZQP A;  4YXJ A;  1NK4 A;  8ICS A;  2ZIW B;  2B0C A;  1GO3 F;  1X42 A;  5ALN A;  5KFC A;  3UXP A;  2R18 A;  2W7P A;  5J2G A;  1PVP A;  2PXI A;  2VAN A;  1NK9 A;  3GV8 B;  3QEA Z;  4KMU A;  4C4R A;  3BS5 B;  1RXW A;  5J2I A;  3M9O B;  2E1E A;  5DDM A;  8ICW A;  4RU9 A;  3LWM A;  3FDS A;  3SYZ A;  1S0M A;  1JIH A;  3HWT A;  4GFJ A;  4Z6F A;  1ZJM A;  3EWA A;  4F71 A;  4UAV A;  2ZTE A; 
#chains in the Genus database with same CATH homology
 4IL6 U;  3A0H U;  5H2F U;  5KAF U;  5TIS U;  5KAI U;  5B66 U;  4UB8 U;  5B5E U;  4UB6 U;  3WU2 U;  5GTH U;  2DUY A;  1S5L U;  4PJ0 U;  5GTI U;  5E79 U;  3A0B U;  2AXT U;  3KZI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...