5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
5KAFU 3A0BU 5B66U 4IL6U 4UB6U 4UB8U 4PJ0U 3KZIU 5TISU 5GTHU 3WU2U 5KAIU 5H2FU 2AXTU 1S5LU 5B5EU 5GTIU 5E79U 3A0HU 2DUYA
chains in the Genus database with same CATH superfamily
3ZDAA 7ICMA 4M0AA 2PKEA 2ASLA 2W7PA 2KFNA 4C80A 9ICTA 5ALFA 4FBUA 2HOIA 5J2AA 3TFSA 8ICJA 4P4PA 4MF2A 1X6IA 4DSIA 1Z1BA 3LWLA 1S9FA 3PSPA 3WK4A 1NZBA 2N1RA 3VC8A 1ZQVA 3N7RC 3PSTA 4ELVA 1X9MA 4IQWA 4BXOB 1ZYQA 1YZ6A 3ZDEA 1ZQNA 3C2MA 3ISCA 3HILA 2W04A 2LMRA 5KG7A 4J9QA 1ZQDA 4ECVA 1TK8A 5KT3A 5KG3A 1DGSA 1AQ6A 1D8BA 5EE1A 2PMZF 3V7LA 4XUSA 1X40A 4Q45A 4FS2A 1ZD2P 1ZQEA 1ZQWA 5J8YA 5DGAA 2GWSA 2Q4TA 5HP4A 4QZBA 3SEIA 3QUQA 1S0NA 2F8LA 9ICHA 5KFTA 2JXJA 3WKDA 3HT3A 3PV8A 1NJYA 3I1YA 5TZVA 2KG5A 2KSOA 3RH4A 1SIJA 2K4EA 1ZETA 1Q3UA 5J0XA 3V6HA 1T3NA 1TK0A 5KFNA 4MFAA 2DPJA 4RQNA 5D49A 2HOQA 2PI5A 3PY8A 4ED2A 3MC1A 3QXGA 1SKSA 1SB3C 2RHFA 3WKCA 2W8LA 1U48A 5CJ7A 4P0QA 2XC9A 4EBCA 2XI9A 7ICKA 1KRPA 5L9XA 5KFUA 3R9KA 4RQ3A 2K8AA 2DGZA 4F2RA 2AXTU 1HEKA 5DB7A 9ICSA 3IDWA 4QZ8A 4BWMA 1BNOA 1ZQHA 4DQPA 5DBBA 2IA6A 3BDPA 2HBLA 3ZI4A 4J9RA 4C4RA 4KLEA 7ICGA 3FDSA 2K60A 2VANA 2BR0A 3MDAA 3JPSA 5J2IA 4ECSA 2BQRA 4FZNA 4JMUA 3QX7A 3TANA 1ZQQA 3M8SA 5CR0A 3SR6A 3M9NB 4JK1A 3S6JA 1J2NA 5DB9A 2L5YA 2B6GA 2R8KA 8ICAA 4KX3A 4NLGA 3QNMA 5AM4A 8ICYA 2OXOA 1NK4A 8ICEA 4R63A 2KVCA 4HYKA 1B0XA 3GU3A 4OO1J 5HMLA 2HCFA 4NM2A 2R8JA 2YB1A 4DL6A 3D2SA 3TAPA 5J0UA 5HR6A 4KTQA 1M6YA 7ICIA 1OXJA 2KOBA 4RQ4A 4UB2A 5KFBA 1DK3A 3T79A 1CI4A 1PK1A 2GOLA 3BS5B 5H2FU 4C0ZA 5DGBA 2W7OA 1RQNA 1ZQ1C 3PNCA 1B43A 4EEKA 3BQ7A 3N7SC 2ZIVB 3HKZF 4CRXA 4UAUA 3UXOA 4C8MA 3F5EA 4Q8EA 4XA5A 2CN1A 4QWDA 2K89A 3WK8A 1P7DA 2FJ6A 2LBOA 4O5EA 1FFVA 2F3NA 2FLPA 4KX5A 1IXRA 5AM1A 1PVRA 3RH6A 4GLXA 3ZD8A 4RQ2A 4QZCA 1DRGA 1DGJA 1NK5A 1RYUA 4UW9A 4C8OA 2ZJAA 2K4HA 2W9BB 1C20A 4EEYA 2YMLA 4OD0A 1NK0A 9ICFA 2XVTA 4RUCA 3WKBA 5AIBA 4BWJA 2WF6A 5EOZA 3L3FX 1NKEA 4NV0A 2FPLA 4BX9C 1N5WA 1U9LA 4Y2JA 5HR7A 1FO4A 2ZXHA 2G5HB 1BPEA 4F2SA 2I5HA 3UXPA 1KW4A 4ECZA 2QB0B 1TK5A 5AIAA 4UB6U 3KKAA 5KFRA 1QCKA 2HHUA 5AKZA 3LYSA 1T4GA 4Y2RA 3C28A 2WB1F 4F4XA 2V4RA 5AKIA 3E2EA 2QKQA 4KLHA 1WG8A 2DKXA 5CP2A 4KMUA 4M9LA 4B9NA 2NRWA 4RPXA 3TKAA 1ZRMA 1K1SA 4UAWA 5J2BA 4O3SA 3I76A 3CW2C 5AK5A 7ICEA 1KDHA 3NGDA 4EENA 4AYBF 1JMSA 4Y2XA 1NI3A 9ICIA 5DBAA 2KIWA 3QZ8A 4B9UA 4FZMA 5ALWA 3DEEA 2K4IA 5ALVA 3IP4B 1FFUA 9ICVA 3BQ0A 7ICJA 4BDPA 1ED1A 3PX6A 1JXLA 1S8OA 1HIWA 3H7IA 5DDYA 5J2HA 5KFOA 4EZ6A 3H8JA 4TUPA 1ZQKA 1TV9A 2NYVA 4NL9A 3VCBA 2KK0A 4RU9A 1ZQTA 1CRXA 3A0BU 1XWLA 2DKZA 5J29A 4Y2SA 3QUBA 3JPQA 1XSPA 8ICLA 4QZEA 2KFZA 4Y2TA 2O6KA 3SV4A 3OSPA 3PO5A 2W43A 3WK5A 3BQTA 2G5IB 4CDGA 4F91B 4K4HA 4G3IA 2VJ4A 4UBBA 3IG5A 1D9DA 2G0AA 5ALOA 5AI5A 4DEZA 4Y2PA 5J8YC 5KT2A 5KFJA 2ATLA 3AUOA 4NM1A 1LV5A 2VIXA 3G6VA 7ICVA 4IRKA 4IR9A 5ALRA 1KL9A 1QQ6A 2W9CB 3PR4A 4CF5A 2MSNA 4GFJA 4MFCA 4IS7A 1N5XA 5KG2A 4DF4A 1UHUA 4KN7A 4TUSA 4Y2VA 5IIMA 4DOAA 2E1EA 1F44A 4OJ6A 1S77D 2HMXA 4UAVA 4Z6CA 1JN3A 1ZQGA 9ICLA 4Y2YA 4DFJA 3PW5A 4I2CA 2ZIUA 3M1YA 1U4BA 5AI4A 3BS7A 1ZOLA 5DG9A 1QH9A 1X2IA 4PZOA 5GTHU 1OW5A 4YCXA 4J9LA 4DL4A 2MU2A 1JALA 2LYHA 3K1RB 3NVYA 2HI0A 2RP5A 3N28A 2ZIXB 2JHDA 5KFZA 2XGQA 3RJJA 2WFAA 9ICNA 2H3QA 3C1ZA 4U7CA 3C5GA 2VA3A 4RQ0A 4UAZA 2BPCA 2HDOA 3MFIA 3C29A 3AQEA 4J9KA 2C28A 3EPIA 1UT5A 2VA2A 2HW3A 3C5FA 2JRZA 4FE3A 1UA0A 4NLBA 5KFHA 2F1HA 5KT5A 4RQ5A 8ICXA 1Z4OA 3GFKB 3PMNA 2MRLA 2FI1A 1J97A 4QJFB 4M9HA 3TADA 7ICSA 9ICMA 1ZQCA 4ED3A 3G6XA 4A8EA 3E0FA 5J2KA 4ELUA 1TVAA 2WB1C 4KLIA 8ICWA 4Y2UA 3JPPA 1WCNA 1L3VA 4ED6A 3NRWA 4NLNA 4KMOB 4I2EA 4KLTA 4R8UB 4F3OA 2F2AB 4I2AA 5ALYA 4TQRA 3TARA 4BXOA 2W11A 5AKGA 1RXVA 1XSNA 3RTVA 3CP8A 1VDVA 4F4KA 5EE0A 4I2GA 1KN5A 3BZKA 3N4MB 3QZ7A 1RYSA 4IL6U 3NASA 2IMWP 2D8CA 2Y0SC 3PX0A 1X42A 1PVPA 1LKYA 4JWMA 2JMGA 1RDFA 4F50A 5KFPA 3RAQA 3PW4A 5DKWA 2DQNB 2KZZA 3LWMA 3AU6A 3SI8A 1S10A 4O3MA 4Z6DA 4C4TA 4J9MA 2YX8A 5T14A 2JEIA 4NJ8A 1VLBA 3OGUA 2A19A 1SXDA 5CB1A 4UB5A 3RB3A 1UPHA 3DDHA 3L5KA 8ICZA 3D2QA 2EAPA 3SAGA 3KZXA 8ICHA 3QYPA 4NWIA 2WHEA 3I28A 3L4PA 1KFTA 3ORYA 5ALNA 3B0YA 2W9MA 3RB4A 3AL0B 2KZMA 1N63A 3O0FA 1OUQA 1RXWA 3B9JA 2F1IA 2QARB 5AKYA 1JRPA 1NZPA 5J2FA 3ZDCA 2EAOA 3MBYA 2E5SA 5J0YA 3ZDDA 2JGAA 4UAYA 1NK7A 1Q3VA 4P4MA 5DG8A 2ISPA 4P0PB 1NK9A 3T5HA 3G6YA 4DS5A 9ICGA 5BOLA 4PHPA 1UA1A 3TFRA 4KLFA 5TISU 4PGXA 1NK8A 3RRGA 4YMOA 1WWUA 4F72A 2JV3A 2ALZA 1S97A 1JI7A 2W55A 2IHNA 8ICIA 2B0CA 2HBJA 5JU5A 4PHEA 2PFPA 4MF8A 2DBYA 4QZAA 3SV3A 5G5HA 4US8A 2KNJA 3PZPA 4IC9A 3GIJA 3WKAA 2KN7A 3QUCA 1TE2A 3EUB2 8ICVA 2AQ0A 1RZTA 2KIVA 4USAA 2J6UA 2PFNA 2R18A 4DLEA 5KFEA 2K8CB 1PUZA 3KHHA 3T5JA 5JUMA 4ZOHC 1DK2A 3AN1A 3GV7B 4DL2A 5KAIU 4JWNA 1COKA 4KLDA 9ICEA 1NJZA 1XU4A 5ALUA 5KG0A 4TUQA 4ECTA 4TQSA 3HP6A 1N62A 3NVVA 3AMZA 3NVWA 1Z19A 3K1ZA 2ZUBA 5CRXA 2NRVA 9ICKA 5DG7A 3KFUF 5ALQA 4I27A 2VJ5A 3PSIA 1ZQUA 4JUZA 1L6NA 2QB1A 3QE9Y 3IN5A 3OJSA 1X9WA 2FLNA 4F5QA 5D4BA 4DFKA 2AHOB 1RQLA 2KSOB 1PK3A 1IG6A 2B21A 2AH5A 2JZBA 4E0DA 1L7NA 2HBMA 1KFSA 7ICHA 4QWAA 9ICJA 3UQ2A 3H8MA 5AICA 1QLNA 7ICLA 2F44A 4DSEA 2ASDA 1WCLA 3JPNA 4EYHB 5KFAA 3RF9A 4P0QB 3D2NA 2MUTA 2KJ8A 4LVSA 4C8LA 4DSKA 2QB0A 5IIKA 8ICGA 2OCEA 1L8LA 3F2DA 2HHSA 3SENA 3B0XA 2EANA 2KD1A 1L3TA 2LYBA 1L7MA 5KFSA 3NRZA 4DFDA 4DSLA 4Y2QA 4GC7A 3LVVA 2NO5A 7ICUA 2QLTA 3SYZA 3M6KA 1S5LU 2GH1A 2HHWA 4LZGA 5AKLA 1FIQA 2ISOA 5ALPA 1MN8A 2V9WA 9ICXA 3C21A 3SZ2A 4Z6FA 2V4QA 2BQ3A 5EWGA 3D6JA 1L8OA 4IQTA 4AP9A 3EZ5A 2W3SA 7ICPA 2Y1IA 4NLCA 4F5PA 4YMNA 3HJEA 5ALDA 4O3OA 1V38A 4ECQA 2DUYA 3TI0A 2XY5A 2BQUA 1BGXT 4DF8A 3HX0A 2KHQA 3RB0A 5G5GA 2C2DA 4ED1A 1A77A 5KFYA 1UCVA 2ZIWA 3UM9A 1QSSA 4F93B 1ZQOA 4IQVA 3T5LA 1ECWA 3OJUA 4M2YA 1PK1B 1S76D 1JXEA 4M9JA 2NRZA 4J9NA 4G9BA 5JTIA 1F5SA 3KBBA 3GDXA 4F4ZA 4Q44A 4HAIA 1DOQA 3CYMA 3MDCA 5EE3A 3QU4A 5IIIA 4YMMA 2EZYA 5KG5A 1AROP 5B5EU 4QWCA 5DLGA 1BPDA 3FAHA 1KFDA 1Z00A 1ZQBA 8ICMA 2HHXA 3SMVA 4B9MA 3KHGA 7ICTA 5F9NA 5AI9A 5L1LA 5KFKA 3V7KA 2FMSA 3RR7A 3WU2U 4US9A 2Y0SF 4QNLA 2W9CA 1MA7A 4RNNA 1K5OA 1N56A 1TAQA 4YD1A 1O03A 2J6TA 2BKEA 4PH5A 1SXEA 4IRDA 3K75D 4MEYA 5AI8A 3SAHA 3TQ1A 5L1KA 5AM2A 2HBKA 2UVRA 1B22A 1TAMA 1ZQSA 1F0MA 3UQ0A 4ELTA 4I2FA 2LM4A 4UQGA 1JX4A 3QU2A 5KT7A 5JRTA 4KITB 2ZUDA 1IIPA 2WF8A 5KTQA 4FFDA 2ZTCA 5KFCA 4KLLA 4RNOA 5BOMA 5B66U 1ZD5A 1V9PA 2GO7A 3FYHA 4F4WA 2ZIXA 8ICFA 1J2MA 2F77X 1UT8A 3RBDA 2WAQF 1TFRA 2IOHA 3EPGA 2OWOA 5ALKA 3F2CA 4FS1A 3RFAA 4YXMA 4M47A 1S0OA 2XO7A 4IRCA 2M9NA 3RJIA 1XSLA 7ICFA 3PO4A 4K4GA 2HHVA 4QZIA 9ICAA 3KD3A 1JROA 1T7PA 1D8LA 5A0LA 2W3RA 3Q8KA 5IILA 2BDPA 5AKEA 4I2JA 1TAUA 2RLTA 2A1JA 5AHXA 5C0YA 2CRXA 3CNHA 3KOOA 5FP0A 4ICAA 4LJXA 4DL5A 2DPIA 3RJKA 3ZDBA 7ICQA 3FM9A 4YQWA 2ASJA 3M7DA 1SL1A 2EH9A 1CUKA 2NRTA 2H3IA 2DF4B 2G06A 1LB2B 1BPBA 1KLNA 5KFXA 1RG6A 4KLMA 4R8UA 4PZNA 2F76X 3M9MB 3PR5B 1NNLA 4GIBA 3ETLA 3UMCA 4M6WA 3OTQA 3WK7A 1ZQMA 3RJGA 2ZTEA 1ZQRA 4EELA 3GQCA 1DXSA 3SD7A 4RQ1A 3RB6A 1ZQIA 3QU7A 2WTFA 4TURA 2AU0A 1ZQFA 8ICUA 4RPZA 1MSWD 4FO6A 1WUDA 4DCCA 1IM4A 4YR3A 5KFQA 4P2HA 1HUZA 8ICSA 5ALMA 1ZD3A 2YQEA 2PFOA 2EZZA 1V97A 4RPYA 2ZTDA 4O3RA 2C2RA 4DOBA 2FPMA 4RQ6A 3PW2A 5KG1A 4J9OA 4QIWC 1BNPA 4PHAA 4KLOA 3CRXA 3V6JA 1KTQA 4BUGA 4UB1A 4KLSA 3PMLA 2ODGA 2E8PA 4RQ8A 4QWBA 4M04A 2E8MA 1MQ2A 5KG6A 3MGIA 2BCVA 2FLLA 3N97B 2OYYA 2QARA 4R64A 1ZQJA 1PZNA 3AM9A 3F5AA 4EX6A 2JEFA 2E3TA 3Q8LA 2I1QA 2ZG6A 4DSJA 3NUQA 2LM1A 5EWEA 2KZ3A 1KKXA 2KVSA 5J0RA 4J9SA 1YZ7A 4FBTA 3K4GA 2IOFK 2ZUCA 4ECUA 2BPFA 2KEYA 2NRXA 2JR5A 8ICPA 4JV2A 4B9VA 3NTUA 4QZGA 3RAXA 9ICQA 2KJ5A 4RUAA 1VJ5A 2G07A 5KT4A 1YT3A 3MR2A 2R8GA 4CF4A 3LVWA 3UMGA 1A6SA 1GO3F 4IQUA 1L3SA 2FMQA 1B4FA 3QU9A 1JUDA 1MQ3A 2FE9A 1Z3EB 2P35A 3H0MB 5J0SA 1NKBA 2C22A 2RRDA 2HVIA 8ICOA 1SKRA 2JH1A 2I6XA 2EAMA 2R8IA 2J6SA 3GZFA 4RNMA 3UMBA 2HOFA 4QZHA 1NJWA 2WAQC 4UARA 2ESEA 4KLUA 4I2BA 3ALRA 2KKPA 3KKAC 2D3DA 3LDAA 4RT3A 5AM0A 1L7PA 3ICXA 4R66A 2Q0ZX 3FC4A 2AGPA 2Y9UA 3C2KA 4FZLA 2P6RA 7ICNA 2AGQA 4OJ5A 4GXIA 2DWQA 5EWFA 1ZQPA 8ICTA 1ZJMA 5F9LA 3PX4A 3KHLA 2OH2A 5KNIA 2F1JA 1QQ7A 3LK9A 4F5NA 1T94A 1KSPA 5BPCA 3QEAZ 4OJPA 1QSLA 1LKYB 3AQFA 8ICQA 1ZQAA 4JV1A 1U49A 4B9TA 4QWEA 3UXNA 3Q8SB 4UB4A 2PI4A 3AU2A 4EZ9A 4OJLA 2BCSA 3MR6A 2BPGA 1COOA 3Q8PB 1SZPA 2H3FA 3C2LA 2KE7A 4I2HA 1SV4A 1Z1VA 4O0IA 3ZD9A 1FEZA 5ALEA 1BPYA 1D8YA 3RR8A 5KFLA 1KBUA 4B6JA 5ALZA 2LYAA 3UPQA 3N7PD 4R65A 2CXYA 1SV0A 2FPKA 5DB8A 5J2CA 1XO1A 4NL9C 3EW9A 4B9SA 2MAXA 1X6JA 5ALLA 3C23A 2WF5A 4NY8A 4KLGA 3GV5B 4ZH4A 4C4SA 5DQHA 2EQYA 2WF7A 4NXZA 4I29A 2E8OA 3BS5A 4YFKA 4ED7A 3PSFA 4YVZA 1NK6A 9ICOA 5ALSA 1NOMA 3WKEA 4UB8U 2ZIVA 1ZQZA 2AJQA 1NJXA 7ICOA 4QZ9A 2HVHA 4F8RA 4Q8FA 5KT6A 3V7JA 4DS4A 4DWIA 4Q43A 3V6KA 3RJHA 4UATA 1N48A 3PVXA 3T5KA 2FDRA 5DBCA 4I28A 5AKKA 2FMPA 4PHDA 2K4PA 4DQRA 3E58A 3HW8A 4PL2A 3KHRA 4GXJA 2W9BA 4OCZA 1PVQA 4QW8A 2ZJ5A 3MGVA 3IRUA 1XS9D 1XO0A 1UQVA 5ALTA 2F8KA 5DLFA 8ICBA 4ECYA 3Q8RB 3BQ1A 5KFGA 2R8HA 1ZJNA 4RZRA 2BDUA 4YR2A 3OPXA 1KQQA 3ETRA 5KFWA 7ICRA 3J81j 4F5OA 4XQ8A 4O3PA 4IR1A 3HRDD 2YMPA 2NO4A 2KKVA 2P6UA 4YXJA 1XC9A 3DV9A 4DQQA 3ISBA 2G08A 5J2GA 4B9LA 1EXNA 4F4YA 4P4OA 1Q46A 5HMMA 3NS1A 5KG4A 1D9FA 3BJYA 2IOFA 4Z6EA 1BVSA 1SWVA 4U6PA 5AKXA 2XCAA 3H4BA 3WK6A 3QU5A 9ICPA 2DL0A 3AEVA 5DQGA 3MR3A 2YMMA 4WJ3B 5AKHA 3JPTA 5CWRA 4MHVA 1Y88A 3PW7A 3EWAA 2XICA 5KFMA 4O5CA 3QEBZ 2ES6A 3M8RA 2HHTA 3SAFA 3TADC 2YN4A 4DQSA 4X5VA 2Y1JA 5AI0A 2JZBB 2EDUA 1SL2A 5CHGA 1SKWA 4PL1A 4QW9A 1SGGA 4DFMA 3H0LB 3GIKA 2H3VA 1L5UA 2DFLA 2HSZA 1RPLA 5F3XB 4O3NA 2PMZC 1SZHA 2MA1A 1O08A 3GIMA 2XCPA 2MUTB 1S0MA 2LPEA 4MFFA 4QIWF 4KLJA 3THVA 1QQ5A 3ISDA 2JH7A 2BHNA 4O5KA 2ZJ8A 4DOCA 4UASA 1L3UA 1Z4NA 4YN4A 3IHQB 2KJ9A 2W54A 1BPXA 3C1YA 2HHQA 5AI6A 1JIHA 4J9PA 5HHHA 3TAQA 2VA8A 3H0RB 5AM5A 3TACB 5CA7A 3A0HU 2XY7A 4YG2A 2LHTA 3RJEA 4ECWA 2W03A 3H8WA 3BQ2A 5DDMA 2M0NA 4PJ0U 4RQMA 1URJA 2PXIA 4F71A 4CGZA 3F2BA 4DFPA 4ECRA 1ZQXA 2C2EA 2P66A 5AM3A 5KFFA 9ICBA 5KL1B 5E79U 5KFVA 4EBDA 2JEGA 5J0OA 1C7YA 5DB6A 4PPXA 5KL8B 2BCQA 2UVUA 5D46A 3F53A 3T3FA 4XRHA 1N61A 2AQ4A 1K1QA 8ICKA 2W8KA 1ZXIA 4CCHA 4LZDA 3MFHA 2BGWA 2ZIWB 5C5JA 1U47A 9ICUA 2AGOA 4ECXA 2RDJA 2E1FA 1CEZA 3RJFA 5HNKA 2ZXIA 3OHAA 3H4DA 1IV8A 5ALIA 3QUTA 2XGPA 1ZRNA 3WK9A 3MR5A 2KV2A 4EX7A 1QSYA 4F5RA 1N2XA 2KMDA 5ALHA 3PW0A 3M6ZA 3IG8A 3HWTA 2BCRA 3KZIU 5J0QA 4C8NA 3Q8MA 4C8KA 1Z00B 5KFDA 1S0VA 4RQ7A 3H8SA 1TKDA 2NV3A 4PGYA 4YP3A 3OHBA 5J2JA 3GILA 4GC6A 3KTQA 4YR0A 5KAFU 5L1IA 4BJQA 4CE6A 4EYIB 5J2DA 4ED0A 5AK6A 3RBEA 3H40A 2G09A 4I2DA 3JPRA 4RT2A 3ONNA 1ZQYA 3BZCA 1A76A 2D6FC 2JEJA 3JPOA 2GLEA 3HKZC 1SV0C 3OSNA 4DL3A 4K4IA 1ZQLA 5J0PA 4ACOA 1SL0A 4UB3A 3HPOA 2XY6A 1RM6C 2H3ZA 2OEHA 5IINA 4DQIA 1BPZA 2UVVA 1N60A 3SQIA 5ALGA 2I9GA 1XNSA 4UBCA 5AK4A 4BGDA 3IM1A 1RYRA 3ED5A 5EE9A 3NVZA 4MEXA 2K8BB 5J2EA 3MGHA 3GIIA 4GXKA 4CNQA 3GV8B 2KTQA 4PGQA 2YMQA 5CEHA 4KN4A 2E8NA 5KFIA 4M9NA 5J0WA 2EZXA 2KICA 1LVHA 4O3QA 1X9XA 1HUOA 4KLQA 4JV0A 2WF9A 5AK3A 2LI6A 9ICCA 2Y9TA 1T8EA 4NLKA 2OHFA 3V72A 4I2IA 4EBEA 1V85A 1WYGA 3Q8QB 4ED8A 2YB4A 5IIJA 2RDIA 5HHIA 2A1JB 3RRHA 4NLZA 5IIOA 2IHMA 2KP7A 1X9SA 3M9OB 3RH5A 1L7OA 5L1MA 4DSFA 2ZIUB 3IV6A 5J0TA 3MABA 2BCUA 4DO9A 2KHVA 4YD2A 1X66A 2LKYA 2VKQA 1ZD4A 5DQIA 1HJPA 4P0PA 1KEJA 1NKCA 3EYZA 1H38A 8ICNA 2OM6A 1Q8KA 2A3VA 4M6WB 4AYBC 2IBKA 5AKJA 4DL7A 2PFQA 2BZFA 4C7ZA 2Z7JA 5L1JA 9ICWA 4M9GA 5K4LA 2XIDA 4QZFA 5ALXA 4F92B 2RQ5A 4QZDA 4JB3A 1SWWA 5ALJA 1U45A 2W9AA 8ICRA 4O9MA 4J03A 2YY6A 1MC8A 2H5XA 1T3QA 1QTMA 2UVWA 1A0PA 2CPRA 1WWVA 4C7YA 4CF3A 4OJOA 5GTIU 4DLGA 3U26A 9ICRA 8ICCA 2A1AA 2YTUA
chains in the Genus database with same CATH topology
5KAFU 3A0BU 5B66U 4IL6U 4UB6U 4UB8U 4PJ0U 3KZIU 5TISU 5GTHU 3WU2U 5KAIU 5H2FU 2AXTU 1S5LU 5B5EU 5GTIU 5E79U 3A0HU 2DUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF U;  3A0B U;  5B66 U;  4IL6 U;  4UB6 U;  4UB8 U;  4PJ0 U;  3KZI U;  5TIS U;  5GTH U;  3WU2 U;  5KAI U;  5H2F U;  2AXT U;  1S5L U;  5B5E U;  5GTI U;  5E79 U;  3A0H U;  2DUY A; 
#chains in the Genus database with same CATH topology
 3ZDA A;  7ICM A;  4M0A A;  2PKE A;  2ASL A;  2W7P A;  2KFN A;  4C80 A;  9ICT A;  5ALF A;  4FBU A;  2HOI A;  5J2A A;  3TFS A;  8ICJ A;  4P4P A;  4MF2 A;  1X6I A;  4DSI A;  1Z1B A;  3LWL A;  1S9F A;  3PSP A;  3WK4 A;  1NZB A;  2N1R A;  3VC8 A;  1ZQV A;  3N7R C;  3PST A;  4ELV A;  1X9M A;  4IQW A;  4BXO B;  1ZYQ A;  1YZ6 A;  3ZDE A;  1ZQN A;  3C2M A;  3ISC A;  3HIL A;  2W04 A;  2LMR A;  5KG7 A;  4J9Q A;  1ZQD A;  4ECV A;  1TK8 A;  5KT3 A;  5KG3 A;  1DGS A;  1AQ6 A;  1D8B A;  5EE1 A;  2PMZ F;  3V7L A;  4XUS A;  1X40 A;  4Q45 A;  4FS2 A;  1ZD2 P;  1ZQE A;  1ZQW A;  5J8Y A;  5DGA A;  2GWS A;  2Q4T A;  5HP4 A;  4QZB A;  3SEI A;  3QUQ A;  1S0N A;  2F8L A;  9ICH A;  5KFT A;  2JXJ A;  3WKD A;  3HT3 A;  3PV8 A;  1NJY A;  3I1Y A;  5TZV A;  2KG5 A;  2KSO A;  3RH4 A;  1SIJ A;  2K4E A;  1ZET A;  1Q3U A;  5J0X A;  3V6H A;  1T3N A;  1TK0 A;  5KFN A;  4MFA A;  2DPJ A;  4RQN A;  5D49 A;  2HOQ A;  2PI5 A;  3PY8 A;  4ED2 A;  3MC1 A;  3QXG A;  1SKS A;  1SB3 C;  2RHF A;  3WKC A;  2W8L A;  1U48 A;  5CJ7 A;  4P0Q A;  2XC9 A;  4EBC A;  2XI9 A;  7ICK A;  1KRP A;  5L9X A;  5KFU A;  3R9K A;  4RQ3 A;  2K8A A;  2DGZ A;  4F2R A;  2AXT U;  1HEK A;  5DB7 A;  9ICS A;  3IDW A;  4QZ8 A;  4BWM A;  1BNO A;  1ZQH A;  4DQP A;  5DBB A;  2IA6 A;  3BDP A;  2HBL A;  3ZI4 A;  4J9R A;  4C4R A;  4KLE A;  7ICG A;  3FDS A;  2K60 A;  2VAN A;  2BR0 A;  3MDA A;  3JPS A;  5J2I A;  4ECS A;  2BQR A;  4FZN A;  4JMU A;  3QX7 A;  3TAN A;  1ZQQ A;  3M8S A;  5CR0 A;  3SR6 A;  3M9N B;  4JK1 A;  3S6J A;  1J2N A;  5DB9 A;  2L5Y A;  2B6G A;  2R8K A;  8ICA A;  4KX3 A;  4NLG A;  3QNM A;  5AM4 A;  8ICY A;  2OXO A;  1NK4 A;  8ICE A;  4R63 A;  2KVC A;  4HYK A;  1B0X A;  3GU3 A;  4OO1 J;  5HML A;  2HCF A;  4NM2 A;  2R8J A;  2YB1 A;  4DL6 A;  3D2S A;  3TAP A;  5J0U A;  5HR6 A;  4KTQ A;  1M6Y A;  7ICI A;  1OXJ A;  2KOB A;  4RQ4 A;  4UB2 A;  5KFB A;  1DK3 A;  3T79 A;  1CI4 A;  1PK1 A;  2GOL A;  3BS5 B;  5H2F U;  4C0Z A;  5DGB A;  2W7O A;  1RQN A;  1ZQ1 C;  3PNC A;  1B43 A;  4EEK A;  3BQ7 A;  3N7S C;  2ZIV B;  3HKZ F;  4CRX A;  4UAU A;  3UXO A;  4C8M A;  3F5E A;  4Q8E A;  4XA5 A;  2CN1 A;  4QWD A;  2K89 A;  3WK8 A;  1P7D A;  2FJ6 A;  2LBO A;  4O5E A;  1FFV A;  2F3N A;  2FLP A;  4KX5 A;  1IXR A;  5AM1 A;  1PVR A;  3RH6 A;  4GLX A;  3ZD8 A;  4RQ2 A;  4QZC A;  1DRG A;  1DGJ A;  1NK5 A;  1RYU A;  4UW9 A;  4C8O A;  2ZJA A;  2K4H A;  2W9B B;  1C20 A;  4EEY A;  2YML A;  4OD0 A;  1NK0 A;  9ICF A;  2XVT A;  4RUC A;  3WKB A;  5AIB A;  4BWJ A;  2WF6 A;  5EOZ A;  3L3F X;  1NKE A;  4NV0 A;  2FPL A;  4BX9 C;  1N5W A;  1U9L A;  4Y2J A;  5HR7 A;  1FO4 A;  2ZXH A;  2G5H B;  1BPE A;  4F2S A;  2I5H A;  3UXP A;  1KW4 A;  4ECZ A;  2QB0 B;  1TK5 A;  5AIA A;  4UB6 U;  3KKA A;  5KFR A;  1QCK A;  2HHU A;  5AKZ A;  3LYS A;  1T4G A;  4Y2R A;  3C28 A;  2WB1 F;  4F4X A;  2V4R A;  5AKI A;  3E2E A;  2QKQ A;  4KLH A;  1WG8 A;  2DKX A;  5CP2 A;  4KMU A;  4M9L A;  4B9N A;  2NRW A;  4RPX A;  3TKA A;  1ZRM A;  1K1S A;  4UAW A;  5J2B A;  4O3S A;  3I76 A;  3CW2 C;  5AK5 A;  7ICE A;  1KDH A;  3NGD A;  4EEN A;  4AYB F;  1JMS A;  4Y2X A;  1NI3 A;  9ICI A;  5DBA A;  2KIW A;  3QZ8 A;  4B9U A;  4FZM A;  5ALW A;  3DEE A;  2K4I A;  5ALV A;  3IP4 B;  1FFU A;  9ICV A;  3BQ0 A;  7ICJ A;  4BDP A;  1ED1 A;  3PX6 A;  1JXL A;  1S8O A;  1HIW A;  3H7I A;  5DDY A;  5J2H A;  5KFO A;  4EZ6 A;  3H8J A;  4TUP A;  1ZQK A;  1TV9 A;  2NYV A;  4NL9 A;  3VCB A;  2KK0 A;  4RU9 A;  1ZQT A;  1CRX A;  3A0B U;  1XWL A;  2DKZ A;  5J29 A;  4Y2S A;  3QUB A;  3JPQ A;  1XSP A;  8ICL A;  4QZE A;  2KFZ A;  4Y2T A;  2O6K A;  3SV4 A;  3OSP A;  3PO5 A;  2W43 A;  3WK5 A;  3BQT A;  2G5I B;  4CDG A;  4F91 B;  4K4H A;  4G3I A;  2VJ4 A;  4UBB A;  3IG5 A;  1D9D A;  2G0A A;  5ALO A;  5AI5 A;  4DEZ A;  4Y2P A;  5J8Y C;  5KT2 A;  5KFJ A;  2ATL A;  3AUO A;  4NM1 A;  1LV5 A;  2VIX A;  3G6V A;  7ICV A;  4IRK A;  4IR9 A;  5ALR A;  1KL9 A;  1QQ6 A;  2W9C B;  3PR4 A;  4CF5 A;  2MSN A;  4GFJ A;  4MFC A;  4IS7 A;  1N5X A;  5KG2 A;  4DF4 A;  1UHU A;  4KN7 A;  4TUS A;  4Y2V A;  5IIM A;  4DOA A;  2E1E A;  1F44 A;  4OJ6 A;  1S77 D;  2HMX A;  4UAV A;  4Z6C A;  1JN3 A;  1ZQG A;  9ICL A;  4Y2Y A;  4DFJ A;  3PW5 A;  4I2C A;  2ZIU A;  3M1Y A;  1U4B A;  5AI4 A;  3BS7 A;  1ZOL A;  5DG9 A;  1QH9 A;  1X2I A;  4PZO A;  5GTH U;  1OW5 A;  4YCX A;  4J9L A;  4DL4 A;  2MU2 A;  1JAL A;  2LYH A;  3K1R B;  3NVY A;  2HI0 A;  2RP5 A;  3N28 A;  2ZIX B;  2JHD A;  5KFZ A;  2XGQ A;  3RJJ A;  2WFA A;  9ICN A;  2H3Q A;  3C1Z A;  4U7C A;  3C5G A;  2VA3 A;  4RQ0 A;  4UAZ A;  2BPC A;  2HDO A;  3MFI A;  3C29 A;  3AQE A;  4J9K A;  2C28 A;  3EPI A;  1UT5 A;  2VA2 A;  2HW3 A;  3C5F A;  2JRZ A;  4FE3 A;  1UA0 A;  4NLB A;  5KFH A;  2F1H A;  5KT5 A;  4RQ5 A;  8ICX A;  1Z4O A;  3GFK B;  3PMN A;  2MRL A;  2FI1 A;  1J97 A;  4QJF B;  4M9H A;  3TAD A;  7ICS A;  9ICM A;  1ZQC A;  4ED3 A;  3G6X A;  4A8E A;  3E0F A;  5J2K A;  4ELU A;  1TVA A;  2WB1 C;  4KLI A;  8ICW A;  4Y2U A;  3JPP A;  1WCN A;  1L3V A;  4ED6 A;  3NRW A;  4NLN A;  4KMO B;  4I2E A;  4KLT A;  4R8U B;  4F3O A;  2F2A B;  4I2A A;  5ALY A;  4TQR A;  3TAR A;  4BXO A;  2W11 A;  5AKG A;  1RXV A;  1XSN A;  3RTV A;  3CP8 A;  1VDV A;  4F4K A;  5EE0 A;  4I2G A;  1KN5 A;  3BZK A;  3N4M B;  3QZ7 A;  1RYS A;  4IL6 U;  3NAS A;  2IMW P;  2D8C A;  2Y0S C;  3PX0 A;  1X42 A;  1PVP A;  1LKY A;  4JWM A;  2JMG A;  1RDF A;  4F50 A;  5KFP A;  3RAQ A;  3PW4 A;  5DKW A;  2DQN B;  2KZZ A;  3LWM A;  3AU6 A;  3SI8 A;  1S10 A;  4O3M A;  4Z6D A;  4C4T A;  4J9M A;  2YX8 A;  5T14 A;  2JEI A;  4NJ8 A;  1VLB A;  3OGU A;  2A19 A;  1SXD A;  5CB1 A;  4UB5 A;  3RB3 A;  1UPH A;  3DDH A;  3L5K A;  8ICZ A;  3D2Q A;  2EAP A;  3SAG A;  3KZX A;  8ICH A;  3QYP A;  4NWI A;  2WHE A;  3I28 A;  3L4P A;  1KFT A;  3ORY A;  5ALN A;  3B0Y A;  2W9M A;  3RB4 A;  3AL0 B;  2KZM A;  1N63 A;  3O0F A;  1OUQ A;  1RXW A;  3B9J A;  2F1I A;  2QAR B;  5AKY A;  1JRP A;  1NZP A;  5J2F A;  3ZDC A;  2EAO A;  3MBY A;  2E5S A;  5J0Y A;  3ZDD A;  2JGA A;  4UAY A;  1NK7 A;  1Q3V A;  4P4M A;  5DG8 A;  2ISP A;  4P0P B;  1NK9 A;  3T5H A;  3G6Y A;  4DS5 A;  9ICG A;  5BOL A;  4PHP A;  1UA1 A;  3TFR A;  4KLF A;  5TIS U;  4PGX A;  1NK8 A;  3RRG A;  4YMO A;  1WWU A;  4F72 A;  2JV3 A;  2ALZ A;  1S97 A;  1JI7 A;  2W55 A;  2IHN A;  8ICI A;  2B0C A;  2HBJ A;  5JU5 A;  4PHE A;  2PFP A;  4MF8 A;  2DBY A;  4QZA A;  3SV3 A;  5G5H A;  4US8 A;  2KNJ A;  3PZP A;  4IC9 A;  3GIJ A;  3WKA A;  2KN7 A;  3QUC A;  1TE2 A;  3EUB 2;  8ICV A;  2AQ0 A;  1RZT A;  2KIV A;  4USA A;  2J6U A;  2PFN A;  2R18 A;  4DLE A;  5KFE A;  2K8C B;  1PUZ A;  3KHH A;  3T5J A;  5JUM A;  4ZOH C;  1DK2 A;  3AN1 A;  3GV7 B;  4DL2 A;  5KAI U;  4JWN A;  1COK A;  4KLD A;  9ICE A;  1NJZ A;  1XU4 A;  5ALU A;  5KG0 A;  4TUQ A;  4ECT A;  4TQS A;  3HP6 A;  1N62 A;  3NVV A;  3AMZ A;  3NVW A;  1Z19 A;  3K1Z A;  2ZUB A;  5CRX A;  2NRV A;  9ICK A;  5DG7 A;  3KFU F;  5ALQ A;  4I27 A;  2VJ5 A;  3PSI A;  1ZQU A;  4JUZ A;  1L6N A;  2QB1 A;  3QE9 Y;  3IN5 A;  3OJS A;  1X9W A;  2FLN A;  4F5Q A;  5D4B A;  4DFK A;  2AHO B;  1RQL A;  2KSO B;  1PK3 A;  1IG6 A;  2B21 A;  2AH5 A;  2JZB A;  4E0D A;  1L7N A;  2HBM A;  1KFS A;  7ICH A;  4QWA A;  9ICJ A;  3UQ2 A;  3H8M A;  5AIC A;  1QLN A;  7ICL A;  2F44 A;  4DSE A;  2ASD A;  1WCL A;  3JPN A;  4EYH B;  5KFA A;  3RF9 A;  4P0Q B;  3D2N A;  2MUT A;  2KJ8 A;  4LVS A;  4C8L A;  4DSK A;  2QB0 A;  5IIK A;  8ICG A;  2OCE A;  1L8L A;  3F2D A;  2HHS A;  3SEN A;  3B0X A;  2EAN A;  2KD1 A;  1L3T A;  2LYB A;  1L7M A;  5KFS A;  3NRZ A;  4DFD A;  4DSL A;  4Y2Q A;  4GC7 A;  3LVV A;  2NO5 A;  7ICU A;  2QLT A;  3SYZ A;  3M6K A;  1S5L U;  2GH1 A;  2HHW A;  4LZG A;  5AKL A;  1FIQ A;  2ISO A;  5ALP A;  1MN8 A;  2V9W A;  9ICX A;  3C21 A;  3SZ2 A;  4Z6F A;  2V4Q A;  2BQ3 A;  5EWG A;  3D6J A;  1L8O A;  4IQT A;  4AP9 A;  3EZ5 A;  2W3S A;  7ICP A;  2Y1I A;  4NLC A;  4F5P A;  4YMN A;  3HJE A;  5ALD A;  4O3O A;  1V38 A;  4ECQ A;  2DUY A;  3TI0 A;  2XY5 A;  2BQU A;  1BGX T;  4DF8 A;  3HX0 A;  2KHQ A;  3RB0 A;  5G5G A;  2C2D A;  4ED1 A;  1A77 A;  5KFY A;  1UCV A;  2ZIW A;  3UM9 A;  1QSS A;  4F93 B;  1ZQO A;  4IQV A;  3T5L A;  1ECW A;  3OJU A;  4M2Y A;  1PK1 B;  1S76 D;  1JXE A;  4M9J A;  2NRZ A;  4J9N A;  4G9B A;  5JTI A;  1F5S A;  3KBB A;  3GDX A;  4F4Z A;  4Q44 A;  4HAI A;  1DOQ A;  3CYM A;  3MDC A;  5EE3 A;  3QU4 A;  5III A;  4YMM A;  2EZY A;  5KG5 A;  1ARO P;  5B5E U;  4QWC A;  5DLG A;  1BPD A;  3FAH A;  1KFD A;  1Z00 A;  1ZQB A;  8ICM A;  2HHX A;  3SMV A;  4B9M A;  3KHG A;  7ICT A;  5F9N A;  5AI9 A;  5L1L A;  5KFK A;  3V7K A;  2FMS A;  3RR7 A;  3WU2 U;  4US9 A;  2Y0S F;  4QNL A;  2W9C A;  1MA7 A;  4RNN A;  1K5O A;  1N56 A;  1TAQ A;  4YD1 A;  1O03 A;  2J6T A;  2BKE A;  4PH5 A;  1SXE A;  4IRD A;  3K75 D;  4MEY A;  5AI8 A;  3SAH A;  3TQ1 A;  5L1K A;  5AM2 A;  2HBK A;  2UVR A;  1B22 A;  1TAM A;  1ZQS A;  1F0M A;  3UQ0 A;  4ELT A;  4I2F A;  2LM4 A;  4UQG A;  1JX4 A;  3QU2 A;  5KT7 A;  5JRT A;  4KIT B;  2ZUD A;  1IIP A;  2WF8 A;  5KTQ A;  4FFD A;  2ZTC A;  5KFC A;  4KLL A;  4RNO A;  5BOM A;  5B66 U;  1ZD5 A;  1V9P A;  2GO7 A;  3FYH A;  4F4W A;  2ZIX A;  8ICF A;  1J2M A;  2F77 X;  1UT8 A;  3RBD A;  2WAQ F;  1TFR A;  2IOH A;  3EPG A;  2OWO A;  5ALK A;  3F2C A;  4FS1 A;  3RFA A;  4YXM A;  4M47 A;  1S0O A;  2XO7 A;  4IRC A;  2M9N A;  3RJI A;  1XSL A;  7ICF A;  3PO4 A;  4K4G A;  2HHV A;  4QZI A;  9ICA A;  3KD3 A;  1JRO A;  1T7P A;  1D8L A;  5A0L A;  2W3R A;  3Q8K A;  5IIL A;  2BDP A;  5AKE A;  4I2J A;  1TAU A;  2RLT A;  2A1J A;  5AHX A;  5C0Y A;  2CRX A;  3CNH A;  3KOO A;  5FP0 A;  4ICA A;  4LJX A;  4DL5 A;  2DPI A;  3RJK A;  3ZDB A;  7ICQ A;  3FM9 A;  4YQW A;  2ASJ A;  3M7D A;  1SL1 A;  2EH9 A;  1CUK A;  2NRT A;  2H3I A;  2DF4 B;  2G06 A;  1LB2 B;  1BPB A;  1KLN A;  5KFX A;  1RG6 A;  4KLM A;  4R8U A;  4PZN A;  2F76 X;  3M9M B;  3PR5 B;  1NNL A;  4GIB A;  3ETL A;  3UMC A;  4M6W A;  3OTQ A;  3WK7 A;  1ZQM A;  3RJG A;  2ZTE A;  1ZQR A;  4EEL A;  3GQC A;  1DXS A;  3SD7 A;  4RQ1 A;  3RB6 A;  1ZQI A;  3QU7 A;  2WTF A;  4TUR A;  2AU0 A;  1ZQF A;  8ICU A;  4RPZ A;  1MSW D;  4FO6 A;  1WUD A;  4DCC A;  1IM4 A;  4YR3 A;  5KFQ A;  4P2H A;  1HUZ A;  8ICS A;  5ALM A;  1ZD3 A;  2YQE A;  2PFO A;  2EZZ A;  1V97 A;  4RPY A;  2ZTD A;  4O3R A;  2C2R A;  4DOB A;  2FPM A;  4RQ6 A;  3PW2 A;  5KG1 A;  4J9O A;  4QIW C;  1BNP A;  4PHA A;  4KLO A;  3CRX A;  3V6J A;  1KTQ A;  4BUG A;  4UB1 A;  4KLS A;  3PML A;  2ODG A;  2E8P A;  4RQ8 A;  4QWB A;  4M04 A;  2E8M A;  1MQ2 A;  5KG6 A;  3MGI A;  2BCV A;  2FLL A;  3N97 B;  2OYY A;  2QAR A;  4R64 A;  1ZQJ A;  1PZN A;  3AM9 A;  3F5A A;  4EX6 A;  2JEF A;  2E3T A;  3Q8L A;  2I1Q A;  2ZG6 A;  4DSJ A;  3NUQ A;  2LM1 A;  5EWE A;  2KZ3 A;  1KKX A;  2KVS A;  5J0R A;  4J9S A;  1YZ7 A;  4FBT A;  3K4G A;  2IOF K;  2ZUC A;  4ECU A;  2BPF A;  2KEY A;  2NRX A;  2JR5 A;  8ICP A;  4JV2 A;  4B9V A;  3NTU A;  4QZG A;  3RAX A;  9ICQ A;  2KJ5 A;  4RUA A;  1VJ5 A;  2G07 A;  5KT4 A;  1YT3 A;  3MR2 A;  2R8G A;  4CF4 A;  3LVW A;  3UMG A;  1A6S A;  1GO3 F;  4IQU A;  1L3S A;  2FMQ A;  1B4F A;  3QU9 A;  1JUD A;  1MQ3 A;  2FE9 A;  1Z3E B;  2P35 A;  3H0M B;  5J0S A;  1NKB A;  2C22 A;  2RRD A;  2HVI A;  8ICO A;  1SKR A;  2JH1 A;  2I6X A;  2EAM A;  2R8I A;  2J6S A;  3GZF A;  4RNM A;  3UMB A;  2HOF A;  4QZH A;  1NJW A;  2WAQ C;  4UAR A;  2ESE A;  4KLU A;  4I2B A;  3ALR A;  2KKP A;  3KKA C;  2D3D A;  3LDA A;  4RT3 A;  5AM0 A;  1L7P A;  3ICX A;  4R66 A;  2Q0Z X;  3FC4 A;  2AGP A;  2Y9U A;  3C2K A;  4FZL A;  2P6R A;  7ICN A;  2AGQ A;  4OJ5 A;  4GXI A;  2DWQ A;  5EWF A;  1ZQP A;  8ICT A;  1ZJM A;  5F9L A;  3PX4 A;  3KHL A;  2OH2 A;  5KNI A;  2F1J A;  1QQ7 A;  3LK9 A;  4F5N A;  1T94 A;  1KSP A;  5BPC A;  3QEA Z;  4OJP A;  1QSL A;  1LKY B;  3AQF A;  8ICQ A;  1ZQA A;  4JV1 A;  1U49 A;  4B9T A;  4QWE A;  3UXN A;  3Q8S B;  4UB4 A;  2PI4 A;  3AU2 A;  4EZ9 A;  4OJL A;  2BCS A;  3MR6 A;  2BPG A;  1COO A;  3Q8P B;  1SZP A;  2H3F A;  3C2L A;  2KE7 A;  4I2H A;  1SV4 A;  1Z1V A;  4O0I A;  3ZD9 A;  1FEZ A;  5ALE A;  1BPY A;  1D8Y A;  3RR8 A;  5KFL A;  1KBU A;  4B6J A;  5ALZ A;  2LYA A;  3UPQ A;  3N7P D;  4R65 A;  2CXY A;  1SV0 A;  2FPK A;  5DB8 A;  5J2C A;  1XO1 A;  4NL9 C;  3EW9 A;  4B9S A;  2MAX A;  1X6J A;  5ALL A;  3C23 A;  2WF5 A;  4NY8 A;  4KLG A;  3GV5 B;  4ZH4 A;  4C4S A;  5DQH A;  2EQY A;  2WF7 A;  4NXZ A;  4I29 A;  2E8O A;  3BS5 A;  4YFK A;  4ED7 A;  3PSF A;  4YVZ A;  1NK6 A;  9ICO A;  5ALS A;  1NOM A;  3WKE A;  4UB8 U;  2ZIV A;  1ZQZ A;  2AJQ A;  1NJX A;  7ICO A;  4QZ9 A;  2HVH A;  4F8R A;  4Q8F A;  5KT6 A;  3V7J A;  4DS4 A;  4DWI A;  4Q43 A;  3V6K A;  3RJH A;  4UAT A;  1N48 A;  3PVX A;  3T5K A;  2FDR A;  5DBC A;  4I28 A;  5AKK A;  2FMP A;  4PHD A;  2K4P A;  4DQR A;  3E58 A;  3HW8 A;  4PL2 A;  3KHR A;  4GXJ A;  2W9B A;  4OCZ A;  1PVQ A;  4QW8 A;  2ZJ5 A;  3MGV A;  3IRU A;  1XS9 D;  1XO0 A;  1UQV A;  5ALT A;  2F8K A;  5DLF A;  8ICB A;  4ECY A;  3Q8R B;  3BQ1 A;  5KFG A;  2R8H A;  1ZJN A;  4RZR A;  2BDU A;  4YR2 A;  3OPX A;  1KQQ A;  3ETR A;  5KFW A;  7ICR A;  3J81 j;  4F5O A;  4XQ8 A;  4O3P A;  4IR1 A;  3HRD D;  2YMP A;  2NO4 A;  2KKV A;  2P6U A;  4YXJ A;  1XC9 A;  3DV9 A;  4DQQ A;  3ISB A;  2G08 A;  5J2G A;  4B9L A;  1EXN A;  4F4Y A;  4P4O A;  1Q46 A;  5HMM A;  3NS1 A;  5KG4 A;  1D9F A;  3BJY A;  2IOF A;  4Z6E A;  1BVS A;  1SWV A;  4U6P A;  5AKX A;  2XCA A;  3H4B A;  3WK6 A;  3QU5 A;  9ICP A;  2DL0 A;  3AEV A;  5DQG A;  3MR3 A;  2YMM A;  4WJ3 B;  5AKH A;  3JPT A;  5CWR A;  4MHV A;  1Y88 A;  3PW7 A;  3EWA A;  2XIC A;  5KFM A;  4O5C A;  3QEB Z;  2ES6 A;  3M8R A;  2HHT A;  3SAF A;  3TAD C;  2YN4 A;  4DQS A;  4X5V A;  2Y1J A;  5AI0 A;  2JZB B;  2EDU A;  1SL2 A;  5CHG A;  1SKW A;  4PL1 A;  4QW9 A;  1SGG A;  4DFM A;  3H0L B;  3GIK A;  2H3V A;  1L5U A;  2DFL A;  2HSZ A;  1RPL A;  5F3X B;  4O3N A;  2PMZ C;  1SZH A;  2MA1 A;  1O08 A;  3GIM A;  2XCP A;  2MUT B;  1S0M A;  2LPE A;  4MFF A;  4QIW F;  4KLJ A;  3THV A;  1QQ5 A;  3ISD A;  2JH7 A;  2BHN A;  4O5K A;  2ZJ8 A;  4DOC A;  4UAS A;  1L3U A;  1Z4N A;  4YN4 A;  3IHQ B;  2KJ9 A;  2W54 A;  1BPX A;  3C1Y A;  2HHQ A;  5AI6 A;  1JIH A;  4J9P A;  5HHH A;  3TAQ A;  2VA8 A;  3H0R B;  5AM5 A;  3TAC B;  5CA7 A;  3A0H U;  2XY7 A;  4YG2 A;  2LHT A;  3RJE A;  4ECW A;  2W03 A;  3H8W A;  3BQ2 A;  5DDM A;  2M0N A;  4PJ0 U;  4RQM A;  1URJ A;  2PXI A;  4F71 A;  4CGZ A;  3F2B A;  4DFP A;  4ECR A;  1ZQX A;  2C2E A;  2P66 A;  5AM3 A;  5KFF A;  9ICB A;  5KL1 B;  5E79 U;  5KFV A;  4EBD A;  2JEG A;  5J0O A;  1C7Y A;  5DB6 A;  4PPX A;  5KL8 B;  2BCQ A;  2UVU A;  5D46 A;  3F53 A;  3T3F A;  4XRH A;  1N61 A;  2AQ4 A;  1K1Q A;  8ICK A;  2W8K A;  1ZXI A;  4CCH A;  4LZD A;  3MFH A;  2BGW A;  2ZIW B;  5C5J A;  1U47 A;  9ICU A;  2AGO A;  4ECX A;  2RDJ A;  2E1F A;  1CEZ A;  3RJF A;  5HNK A;  2ZXI A;  3OHA A;  3H4D A;  1IV8 A;  5ALI A;  3QUT A;  2XGP A;  1ZRN A;  3WK9 A;  3MR5 A;  2KV2 A;  4EX7 A;  1QSY A;  4F5R A;  1N2X A;  2KMD A;  5ALH A;  3PW0 A;  3M6Z A;  3IG8 A;  3HWT A;  2BCR A;  3KZI U;  5J0Q A;  4C8N A;  3Q8M A;  4C8K A;  1Z00 B;  5KFD A;  1S0V A;  4RQ7 A;  3H8S A;  1TKD A;  2NV3 A;  4PGY A;  4YP3 A;  3OHB A;  5J2J A;  3GIL A;  4GC6 A;  3KTQ A;  4YR0 A;  5KAF U;  5L1I A;  4BJQ A;  4CE6 A;  4EYI B;  5J2D A;  4ED0 A;  5AK6 A;  3RBE A;  3H40 A;  2G09 A;  4I2D A;  3JPR A;  4RT2 A;  3ONN A;  1ZQY A;  3BZC A;  1A76 A;  2D6F C;  2JEJ A;  3JPO A;  2GLE A;  3HKZ C;  1SV0 C;  3OSN A;  4DL3 A;  4K4I A;  1ZQL A;  5J0P A;  4ACO A;  1SL0 A;  4UB3 A;  3HPO A;  2XY6 A;  1RM6 C;  2H3Z A;  2OEH A;  5IIN A;  4DQI A;  1BPZ A;  2UVV A;  1N60 A;  3SQI A;  5ALG A;  2I9G A;  1XNS A;  4UBC A;  5AK4 A;  4BGD A;  3IM1 A;  1RYR A;  3ED5 A;  5EE9 A;  3NVZ A;  4MEX A;  2K8B B;  5J2E A;  3MGH A;  3GII A;  4GXK A;  4CNQ A;  3GV8 B;  2KTQ A;  4PGQ A;  2YMQ A;  5CEH A;  4KN4 A;  2E8N A;  5KFI A;  4M9N A;  5J0W A;  2EZX A;  2KIC A;  1LVH A;  4O3Q A;  1X9X A;  1HUO A;  4KLQ A;  4JV0 A;  2WF9 A;  5AK3 A;  2LI6 A;  9ICC A;  2Y9T A;  1T8E A;  4NLK A;  2OHF A;  3V72 A;  4I2I A;  4EBE A;  1V85 A;  1WYG A;  3Q8Q B;  4ED8 A;  2YB4 A;  5IIJ A;  2RDI A;  5HHI A;  2A1J B;  3RRH A;  4NLZ A;  5IIO A;  2IHM A;  2KP7 A;  1X9S A;  3M9O B;  3RH5 A;  1L7O A;  5L1M A;  4DSF A;  2ZIU B;  3IV6 A;  5J0T A;  3MAB A;  2BCU A;  4DO9 A;  2KHV A;  4YD2 A;  1X66 A;  2LKY A;  2VKQ A;  1ZD4 A;  5DQI A;  1HJP A;  4P0P A;  1KEJ A;  1NKC A;  3EYZ A;  1H38 A;  8ICN A;  2OM6 A;  1Q8K A;  2A3V A;  4M6W B;  4AYB C;  2IBK A;  5AKJ A;  4DL7 A;  2PFQ A;  2BZF A;  4C7Z A;  2Z7J A;  5L1J A;  9ICW A;  4M9G A;  5K4L A;  2XID A;  4QZF A;  5ALX A;  4F92 B;  2RQ5 A;  4QZD A;  4JB3 A;  1SWW A;  5ALJ A;  1U45 A;  2W9A A;  8ICR A;  4O9M A;  4J03 A;  2YY6 A;  1MC8 A;  2H5X A;  1T3Q A;  1QTM A;  2UVW A;  1A0P A;  2CPR A;  1WWV A;  4C7Y A;  4CF3 A;  4OJO A;  5GTI U;  4DLG A;  3U26 A;  9ICR A;  8ICC A;  2A1A A;  2YTU A; 
#chains in the Genus database with same CATH homology
 5KAF U;  3A0B U;  5B66 U;  4IL6 U;  4UB6 U;  4UB8 U;  4PJ0 U;  3KZI U;  5TIS U;  5GTH U;  3WU2 U;  5KAI U;  5H2F U;  2AXT U;  1S5L U;  5B5E U;  5GTI U;  5E79 U;  3A0H U;  2DUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...