5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
3A0BU 5GTHU 3WU2U 2AXTU 5B5EU 3A0HU 3KZIU 5TISU 5H2FU 1S5LU 5E79U 4IL6U 4PJ0U 5B66U 4UB8U 4UB6U 5GTIU 2DUYA 5KAIU 5KAFU
chains in the Genus database with same CATH superfamily
1BGXT 3FYHA 4O3SA 1JXLA 2K8CB 3CYMA 4CCHA 4QW9A 3PW0A 3E0FA 3BQ2A 2HOFA 1SWWA 2WF6A 2WF9A 4CE6A 1RDFA 2YQEA 4M0AA 4RQ4A 4JV0A 3RAXA 3HKZF 2JH1A 2LYBA 1KRPA 5J0YA 2P66A 3ISDA 1MQ3A 3BS7A 3WK9A 5HNKA 4NY8A 9ICEA 1SIJA 1ZQZA 3MABA 1VLBA 5T14A 4LJXA 1JXEA 4Z6EA 2V4QA 4IRDA 1WG8A 4DL4A 7ICUA 4OJLA 2JHDA 4DSFA 4DQQA 1ZQSA 4O5EA 3RB3A 3UMGA 3QX7A 5DG7A 7ICKA 3PW4A 3HX0A 5J29A 5KG0A 5KFNA 2D8CA 3H0MB 4ED2A 2KVSA 4ECZA 4F4XA 4WJ3B 4UAZA 2HBMA 2HW3A 2PFQA 2UVWA 1NK9A 2F76X 4DOBA 2CN1A 2VANA 1Y88A 2LKYA 5L1LA 4RQ0A 4YXMA 2ZXHA 3AEVA 4QWBA 5H2FU 5DG8A 2DBYA 3PZPA 5AIAA 2AQ4A 1K1QA 1COKA 4EEYA 4US8A 4QZHA 7ICJA 2ZIUB 2ISPA 2FMSA 4MEYA 5KAFU 1ZQAA 4O3PA 2RDIA 4M04A 8ICVA 4EX7A 2XIDA 3M9NB 7ICMA 4USAA 4C4SA 1KLNA 1T3NA 9ICWA 5DQGA 7ICSA 4NLNA 4GXJA 2G5HB 1NI3A 3RJIA 5KFIA 5KFMA 2BCRA 2BHNA 3H8MA 4OJ6A 4F5NA 4YR0A 1ZQTA 2AXTU 3MDAA 4UBBA 3GIJA 3RJHA 4F5QA 4UAVA 5ALEA 3D2SA 3ONNA 4I29A 3UQ0A 1S8OA 3ETLA 2K4EA 9ICPA 9ICNA 4Q8FA 2ZTDA 3ZDAA 1KFTA 2HHXA 4C4TA 5DGBA 1D8BA 1NJZA 4I2IA 1XWLA 1ZQUA 5KT7A 2C28A 2QARB 2G09A 4C7YA 3D6JA 2AGOA 4NLZA 1NK5A 4ED3A 4NLBA 1ZD4A 2E5SA 3C5FA 4DL5A 1F0MA 2DWQA 5AKXA 4MF8A 5L1MA 1YZ7A 2HHQA 1ZQXA 2N1RA 3TACB 5JRTA 4UQGA 3MDCA 1CI4A 4QZGA 2KFZA 1S0NA 2XGPA 2A19A 2IOFA 1L5UA 3PR5B 2Y9UA 2BCUA 1SV0C 3ALRA 3SZ2A 4RQ3A 1VJ5A 2YTUA 3UXPA 1SKSA 1KW4A 3V72A 3QNMA 1X6IA 2RHFA 1ZQHA 4QWAA 4M47A 2KIVA 1ZJMA 4X5VA 1KKXA 4KLQA 3OHAA 1RM6C 3H7IA 4P2HA 2YY6A 1D8YA 7ICOA 4ICAA 2BGWA 1V38A 2C22A 1S10A 1FIQA 2F1JA 2FLNA 1S5LU 2E1EA 4FBUA 5KT6A 5KFJA 3B0XA 3QUQA 4UB5A 2EQYA 3U26A 3ZDCA 4TURA 4PZNA 5DBBA 4IQWA 4ECSA 1NJWA 5IINA 1JUDA 4Q43A 2B6GA 2F1IA 5AM3A 3PX4A 4YD1A 4QZEA 3QU2A 3H8JA 2OWOA 2JEGA 4K4IA 1S0OA 4KLGA 3MFIA 5L1IA 2FMQA 3D2QA 5AKKA 1TVAA 1NOMA 5EE0A 1Z1VA 1QQ6A 3OTQA 3NVVA 4DEZA 3ZD9A 2C2EA 1T3QA 3WKBA 8ICQA 4EX6A 2BCSA 3PSFA 3M8SA 2RP5A 4F91B 1JI7A 1JN3A 4YN4A 2MAXA 2HVHA 2PMZF 5J2AA 5B66U 1D9FA 5IILA 3MC1A 2NV3A 4UB6U 3PW5A 2FPMA 4NL9C 4PL1A 4EENA 1O03A 2BKEA 3TADC 1UPHA 5AM5A 5JTIA 5ALUA 5ALPA 1RYUA 3BQ7A 3FAHA 4CGZA 4RNNA 1ZQVA 2WB1C 2YB4A 4QZDA 3F53A 4Z6DA 3PR4A 3UQ2A 3WKAA 3TFSA 2DFLA 1NJYA 2VA8A 1Z3EB 8ICBA 2DKXA 4UASA 4B9LA 1B22A 3BS5B 7ICQA 3FC4A 2NO5A 4PZOA 8ICWA 1XO1A 4K4GA 4G9BA 2AHOB 4RQ5A 3TKAA 4J9LA 3M9MB 2XVTA 3Q8PB 4DF8A 1F5SA 1JALA 2W43A 4BUGA 1HIWA 3LVWA 1ECWA 4F5RA 1UA0A 2Y9TA 5J0TA 4DSJA 1ZQBA 1QSYA 2MUTB 3SR6A 4KN4A 2E1FA 3PSPA 3WK6A 5C0YA 4DLEA 1Q46A 1XO0A 4I2DA 1SL2A 1ED1A 3F2CA 4YR2A 1UQVA 1UT5A 1PVRA 3BDPA 2DPIA 2MRLA 4IL6U 2LM4A 3OHBA 3N97B 2ASDA 4DSIA 4DL2A 5ALYA 1BNOA 5KFGA 3H40A 2F8LA 4UAWA 3RRHA 3T3FA 3NVYA 1L3VA 3GV7B 2RQ5A 4PJ0U 3ZD8A 4P0QA 1U9LA 2Q0ZX 1L3TA 1N61A 5DQHA 9ICBA 1NK8A 3F5EA 2DUYA 5F9NA 5ALKA 5J2BA 3CW2C 5F3XB 2L5YA 5HHIA 3SYZA 5AICA 1TK5A 4UAUA 4A8EA 4UAYA 5AKHA 1S76D 2BCQA 2ZXIA 4I2EA 2ZJ5A 4B9VA 2KMDA 4YMOA 3T79A 2G5IB 5DB6A 4YQWA 4R63A 1RXWA 4J9QA 3RJKA 2QKQA 3DV9A 2R8IA 3FDSA 3LDAA 1TE2A 3RF9A 2VA3A 4RUAA 7ICHA 3K1RB 2XO7A 5AI8A 3ZDBA 3OPXA 5DDYA 3M8RA 3KFUF 2K89A 2ES6A 5DG9A 4EELA 3NGDA 2K60A 5KFEA 8ICFA 1URJA 5ALHA 1Z00B 2HHSA 5JUMA 4KLJA 3PX0A 2IA6A 2BQUA 3UXOA 2E3TA 1JIHA 3Q8RB 2R8KA 1J97A 2PI4A 5AI5A 4MF2A 3RH5A 4NXZA 4TUPA 5KTQA 5D46A 3KHLA 3GIIA 4F4YA 2IOHA 1KL9A 4Z6CA 4NWIA 2DQNB 2RRDA 2J6SA 5D49A 5CHGA 5BPCA 2UVVA 1ZRNA 4R65A 5AM4A 2ZUCA 2OCEA 3TARA 3IRUA 2KEYA 1C20A 1WCLA 4M6WB 4BWMA 1QQ5A 5DQIA 4CNQA 1L8OA 4DO9A 2W9BB 9ICOA 1DGJA 4Y2UA 2KKPA 3KHGA 2VJ4A 4R8UA 7ICEA 1ZYQA 4MFAA 2QB0B 2HOIA 9ICFA 3SV4A 8ICLA 1QCKA 4JK1A 5BOMA 3OSPA 1VDVA 5ALGA 4Y2QA 3OGUA 3QYPA 3N4MB 1B0XA 1HEKA 5F9LA 3PW7A 4QWCA 2IHNA 2Y0SC 4J9SA 7ICGA 1FFVA 1SZHA 3CNHA 4XRHA 4M9HA 4GC7A 2D6FC 4PHPA 2RDJA 1L6NA 4EYHB 1WCNA 4ECWA 9ICCA 2FPLA 3ZI4A 3NS1A 5KFPA 5KAIU 3LWLA 3A0BU 1DK3A 3T5JA 2WB1F 1ZQWA 4EBCA 5CA7A 2Y1JA 5J2GA 1LB2B 3B0YA 3BJYA 4CDGA 4ECTA 2YN4A 3QUTA 2YMLA 2BQRA 4C8NA 2ATLA 1PK1B 2ZIXA 5DLFA 5KFAA 1N60A 2Z7JA 4RPXA 2XY6A 3TFRA 4M9LA 3WK8A 3MGIA 5G5HA 5CP2A 4RQ8A 1T4GA 1UA1A 1T7PA 4IQTA 2VA2A 2KICA 4ECXA 2EAMA 1L3SA 1Q3VA 3HILA 3RJGA 1ZQLA 3JPSA 1OUQA 2CRXA 1QQ7A 1X9WA 4RQ2A 2EZYA 5KFHA 1N63A 5DKWA 4M2YA 2IOFK 1L7PA 5AI0A 3RJFA 2F44A 4I2HA 2FLLA 4DFDA 5KG3A 1KSPA 2OHFA 9ICLA 7ICLA 1SL1A 1PK3A 2KG5A 1SV0A 1J2NA 5J0RA 2AGPA 2FI1A 5AKJA 4ELTA 2E8OA 3A0HU 4I27A 1SGGA 2NRWA 2AJQA 2JR5A 2WAQC 1U48A 4IR1A 2JH7A 1K5OA 4P0PA 4O3QA 2HSZA 1CUKA 3THVA 3RRGA 5KT4A 1TFRA 2NRVA 5AKEA 1BPZA 4F50A 2F77X 4QZIA 2IBKA 5KNIA 4E0DA 4CF5A 1XU4A 5AK5A 4DOAA 5AI9A 5ALTA 3T5HA 1L7MA 9ICTA 5C5JA 2GOLA 5J2JA 1JROA 3NVWA 1V85A 4IRCA 1CEZA 1ZD5A 4KMOB 9ICSA 3JPQA 5ALRA 8ICZA 3EPGA 3N7PD 5AKZA 3NTUA 3MR3A 1FFUA 5KFYA 9ICRA 4PH5A 4ECYA 2KSOA 2KP7A 3QU7A 4KLUA 1TKDA 2YMQA 3QU4A 5J2IA 4DOCA 4GIBA 1A6SA 5KFWA 4NV0A 2H3ZA 4EBEA 5KG2A 5EOZA 8ICJA 4NM2A 3DDHA 1DXSA 3JPTA 4I2CA 4C7ZA 3KZIU 5AKIA 8ICAA 2ISOA 4KITB 4LZGA 4KMUA 4OJ5A 4DSEA 4NL9A 1RXVA 3QU5A 4G3IA 1Z1BA 3TADA 1IV8A 1Z19A 2WF5A 4J9MA 3NASA 4DQRA 4UW9A 3EZ5A 3UMCA 3FM9A 2R18A 2W11A 5KFZA 4YFKA 1ZQCA 3KBBA 4O5KA 2W54A 4DF4A 9ICIA 2EANA 2HBKA 2OM6A 1C7YA 3DEEA 2A3VA 4IS7A 1SKRA 5IIJA 3RBEA 1CRXA 3V6HA 2JEJA 3HPOA 2W7PA 4I2GA 3SAFA 5KFBA 9ICQA 4KTQA 4DS5A 4JV1A 1PVPA 3R9KA 1TAQA 5KFVA 2V9WA 5ALDA 3MR2A 5ALSA 2KD1A 4EZ9A 2ZIVA 3PMNA 3PVXA 3RJJA 5KG6A 1MSWD 3RB6A 1ZQNA 3MBYA 3GDXA 1NZPA 3PX6A 2GWSA 3V7JA 8ICXA 2Y0SF 4AP9A 5J8YC 4DFJA 4Y2RA 2H3QA 3Q8SB 3G6XA 4RQ7A 3RB0A 1N48A 3LYSA 4UATA 3JPNA 4UB1A 2ASJA 1ZD3A 4O3OA 3GIMA 2F2AB 2B21A 4P4OA 5TISU 4KLTA 2PXIA 3RH6A 3N28A 2VKQA 1L7NA 2K4IA 8ICKA 2BCVA 4PL2A 1U47A 2XICA 4QZBA 3BQ1A 3LK9A 3GILA 4EYIB 5IIIA 4HYKA 3KKAC 4Y2SA 2QB1A 3IHQB 2CXYA 4OJPA 3AMZA 2W9CA 1AQ6A 2ZJAA 4NJ8A 1DOQA 1SWVA 3NRWA 2AQ0A 1O08A 2XI9A 2H5XA 4RU9A 2AGQA 1B43A 2WTFA 1NKCA 4JWMA 4TUSA 1X2IA 1NK4A 1IG6A 2H3IA 2C2DA 2BR0A 2WF8A 2FMPA 2EZXA 1TAMA 2G06A 4QZAA 3M6KA 2K8BB 2JXJA 2Q4TA 4PGXA 4J9NA 5ALQA 2JZBA 5EWGA 4K4HA 5KFKA 5AK3A 2KNJA 2GLEA 3PO5A 2F8KA 1S97A 3LVVA 1NKEA 3KZXA 5FP0A 1LVHA 1NJXA 3C21A 2XGQA 4RQMA 3C2LA 5DB9A 4Y2VA 4KN7A 2Y1IA 7ICRA 5IIOA 4BX9C 2G07A 5DB8A 2WAQF 1WYGA 5TZVA 3GIKA 2AU0A 9ICAA 3QEBZ 3MGHA 5KFFA 3PO4A 4RQNA 3AQEA 2KZMA 4DS4A 1X9MA 2KOBA 5AKLA 3O0FA 2KFNA 2W7OA 4FS1A 4KLMA 3M7DA 1N5XA 5E79U 3EPIA 2YMMA 3EUB2 2A1JA 4O9MA 3M9OB 1N56A 1KEJA 2NRXA 2YX8A 4DQSA 1D8LA 2HHWA 3AN1A 4ECQA 4TQSA 3BQ0A 3WK4A 2HHTA 2DF4B 3MR6A 4ED1A 5GTHU 4DFPA 1QTMA 3VC8A 4F4WA 4F4ZA 3Q8QB 2W3RA 1UHUA 1OXJA 1SKWA 3WKCA 4BDPA 3NUQA 2QLTA 4F3OA 3QU9A 2XCPA 7ICTA 1S77D 4FZNA 1LKYA 5HMLA 9ICMA 2DL0A 2RLTA 5AM0A 5KG7A 2B0CA 4ED0A 2JGAA 4YMMA 2HCFA 2NRZA 2UVUA 1SXDA 4LVSA 2ALZA 2I6XA 4ED8A 1RYSA 4KX3A 2ZUDA 5CEHA 3F2DA 5KFOA 2DGZA 4GXIA 1ZQEA 4LZDA 4O3NA 2GO7A 5BOLA 3L4PA 3HWTA 3HJEA 2KE7A 5J0PA 2W9AA 1UCVA 3GU3A 2XCAA 3RH4A 8ICEA 2EDUA 2KJ5A 2F3NA 4I2AA 5CR0A 1BPEA 1ZQMA 4AYBC 2LBOA 1ZQ1C 2IMWP 2K8AA 1SZPA 2KZ3A 3ED5A 2W8KA 1ZQKA 4GXKA 4Q8EA 2KV2A 4QW8A 3IV6A 4J9KA 2BDPA 4BXOA 1IIPA 5KFRA 3H8WA 4FFDA 1FO4A 3N7RC 3Q8KA 1TV9A 5AIBA 2VJ5A 1X9SA 3ICXA 3V7LA 5L9XA 2FPKA 3BQTA 5J0OA 5KL8B 1F44A 4ZH4A 4ED7A 3M1YA 5AI6A 3QUCA 2JEFA 2W04A 4P0QB 2R8GA 3AUOA 2KJ8A 1NZBA 4UB8U 1BPXA 8ICIA 3IP4B 3RBDA 4CF4A 8ICCA 5AK6A 4F71A 5ALVA 4DL3A 2ZIUA 4UARA 1U45A 4KLLA 3RFAA 4XUSA 4Z6FA 1Q8KA 5AM2A 4Y2JA 3SI8A 4B9SA 5J0XA 3H4DA 4M9GA 3L5KA 4JV2A 1RZTA 1KFDA 2HBJA 2MSNA 4ECUA 1ZQIA 2EH9A 1QH9A 3IM1A 2BPCA 4RNMA 3C2MA 1FEZA 5J2KA 4JMUA 4RQ1A 1D9DA 5J2FA 3ISCA 1IM4A 2I5HA 1S9FA 4KX5A 1DRGA 5J2HA 3H0RB 2D3DA 3IDWA 3C28A 1T8EA 2KKVA 2OYYA 4JB3A 2FE9A 3J81j 2E8MA 2DKZA 2QARA 3K4GA 3NVZA 2LPEA 4QZ9A 3TI0A 3E58A 5DLGA 1KQQA 1SL0A 3Q8MA 2PI5A 1N5WA 3C5GA 1ZQFA 5IIKA 1NK7A 4XQ8A 8ICPA 3G6VA 3BZKA 1MN8A 3QZ7A 2OEHA 1WWVA 5J0SA 4KLIA 5DGAA 3PSIA 1ZQPA 4J9RA 2ZUBA 1N62A 1EXNA 4J9PA 3RR7A 3E2EA 2ODGA 4KLFA 3I1YA 5HP4A 4BXOB 3QZ8A 1YZ6A 4PPXA 3C1YA 3CP8A 2PKEA 3ISBA 3Q8LA 3KHRA 1KDHA 2C2RA 3RJEA 3N7SC 4F5PA 4F5OA 5IIMA 4IQVA 3SAHA 2XC9A 3JPRA 4MEXA 2KVCA 1K1SA 2OXOA 5HR7A 4KLDA 5G5GA 2JV3A 4KLEA 2LM1A 2NYVA 4BJQA 4GLXA 2E8PA 1QSLA 2HVIA 2WFAA 4R8UB 3UXNA 3TAQA 8ICMA 2NO4A 5KFDA 3V6JA 5KFUA 4IR9A 1ZXIA 1GO3F 1ZJNA 1BPBA 1ZOLA 2FJ6A 5AM1A 2VIXA 4QZFA 2ESEA 7ICPA 4EEKA 4B6JA 3ZDEA 4F2SA 1L8LA 4DLGA 3IG5A 2O6KA 3MFHA 4CRXA 2HBLA 5JU5A 4YCXA 5EE1A 8ICTA 3PSTA 1BNPA 4NM1A 4DL7A 3PV8A 3WKDA 3S6JA 4TQRA 4DQIA 4ACOA 1JRPA 5ALIA 1NKBA 2WF7A 3PY8A 2ZG6A 5EE3A 3MR5A 2XY5A 2ZTEA 4QIWC 1DK2A 4F92B 5DBAA 4YD2A 4F4KA 5D4BA 4F72A 4QZ8A 1KBUA 2ZIXB 4MFCA 4O5CA 2M0NA 1V97A 1X42A 3CRXA 3T5KA 2K4HA 1NK0A 1S0MA 4C8OA 1QLNA 2JRZA 3NRZA 4Y2PA 2XY7A 4GFJA 1TAUA 4MHVA 5J2CA 5J8YA 4FS2A 4NLCA 4ELVA 5J0UA 5GTIU 4P4PA 2W3SA 4ZOHC 5ALZA 4B9UA 1XSNA 3SD7A 3SAGA 3PMLA 4KLOA 2ASLA 1Q3UA 4ED6A 2HI0A 4Y2XA 5ALJA 1PVQA 2PFPA 1HUOA 2UVRA 4YMNA 3I28A 2KIWA 3WK5A 1ZQGA 4Y2YA 2KN7A 2P35A 3BS5A 4AYBF 4IRKA 2W55A 1MC8A 4C4RA 2W8LA 4ELUA 2MA1A 8ICYA 4O3RA 5KT3A 4QWEA 1PZNA 3KKAA 5KFXA 4OJOA 3EWAA 3SQIA 1BVSA 4OCZA 3WU2U 4XA5A 8ICUA 4P0PB 3C23A 4Y2TA 1LV5A 5KG5A 2P6UA 3WK7A 7ICVA 4Q45A 5EE9A 2MUTA 5AHXA 2NRTA 4NLKA 2LI6A 1JX4A 2LYAA 8ICOA 1XC9A 3PNCA 1XNSA 2EZZA 5ALNA 1RYRA 2OH2A 1MQ2A 5L1KA 5HHHA 2HDOA 1L7OA 1RPLA 2G08A 2MU2A 3ORYA 3F2BA 3RAQA 1JMSA 3F5AA 2IHMA 2R8JA 2J6TA 3C2KA 1H38A 5DBCA 3G6YA 2DPJA 1HJPA 1P7DA 4FBTA 1ZD2P 1MA7A 3ZDDA 1X66A 7ICFA 2KSOB 2KK0A 5J2EA 2PFNA 2FDRA 4Q44A 3KHHA 2P6RA 4I28A 3GFKB 3RB4A 2HHVA 4NLGA 3C29A 1X9XA 3M6ZA 4UB3A 4IQUA 5J0QA 1QSSA 3B9JA 1ZQQA 5HMMA 4F2RA 4PGYA 5DB7A 2ZIWA 5KFQA 2K4PA 3L3FX 1L3UA 3MGVA 3AL0B 1HUZA 7ICIA 3KTQA 5DDMA 2BPGA 3HKZC 7ICNA 1WWUA 4JUZA 5J0WA 2V4RA 3K1ZA 4KLSA 4M9JA 5EWEA 9ICKA 4C80A 4YR3A 3HP6A 4I2BA 1S0VA 5KFTA 2I9GA 3QE9Y 5KT5A 3QXGA 2AH5A 3HT3A 3OSNA 1T94A 1SXEA 5KG4A 3RTVA 4O3MA 1V9PA 2W9MA 9ICUA 3KOOA 3GV5B 2GH1A 1N2XA 1J2MA 4B9TA 4YP3A 3UMBA 3TANA 3WKEA 4DSKA 1A77A 5CJ7A 3QUBA 4I2JA 1UT8A 1Z00A 2BQ3A 4BWJA 1XSLA 2JMGA 1TK8A 1Z4OA 4BGDA 3IG8A 4U6PA 4QNLA 4CF3A 3AU6A 3C1ZA 2FLPA 5J2DA 2KHVA 4QJFB 4DSLA 5A0LA 1TK0A 4US9A 1X6JA 4UB2A 4OO1J 5EWFA 4DFKA 5ALWA 3SMVA 4QZCA 4F8RA 4FO6A 3IN5A 5KT2A 1X40A 2ZIVB 3GQCA 1ZQYA 5AKYA 4B9NA 1ZETA 1NNLA 3TQ1A 1SV4A 1YT3A 4EZ6A 4J9OA 4YXJA 3H0LB 4RPZA 4UBCA 8ICNA 1B4FA 4ECVA 4KLHA 4PGQA 1DGSA 3HW8A 4R66A 2H3VA 5L1JA 2YMPA 4MFFA 2HMXA 3HRDD 4RPYA 4DFMA 9ICVA 8ICRA 4ECRA 4M6WA 4F93B 3JPOA 3T5LA 4FZMA 5KG1A 3AQFA 4TUQA 4C8MA 1RQNA 4HAIA 5KL1B 5CB1A 2W9BA 3AM9A 4I2FA 8ICHA 1IXRA 4RZRA 1ZQDA 2HHUA 4UB4A 3GZFA 4DQPA 2QB0A 3RR8A 3H8SA 2H3FA 2ZIWB 3D2NA 1A76A 4QIWF 2G0AA 1NK6A 3KD3A 3SEIA 5KFCA 2KZZA 2W9CB 4IC9A 1A0PA 2KJ9A 3V7KA 1KTQA 2BZFA 5AKGA 4B9MA 5KFSA 2HOQA 2J6UA 4FZLA 3SENA 3H4BA 4QWDA 4C8LA 9ICJA 3UPQA 1WUDA 1M6YA 1SB3C 3ETRA 5K4LA 2PFOA 4DCCA 4YG2A 4RUCA 4O0IA 3AU2A 4R64A 1ZQRA 9ICGA 3TAPA 2KTQA 4J03A 2CPRA 3GV8B 2JZBB 3I76A 3OJSA 1XS9D 3UM9A 1BPDA 2ZTCA 1PK1A 2BPFA 2LYHA 4RT2A 5CRXA 5AI4A 5B5EU 4DWIA 1U4BA 1COOA 2EAOA 9ICHA 3PW2A 4C0ZA 4P4MA 1ZRMA 2EAPA 1ZQJA 4RNOA 1AROP 4OD0A 2LHTA 5AK4A 3SV3A 4DL6A 1KFSA 1PUZA 4FE3A 4PHDA 4RQ6A 2WHEA 2W03A 4C8KA 4PHEA 1RQLA 1Z4NA 2A1JB 2LMRA 5ALLA 1U49A 4PHAA 5CWRA 4JWNA 5HR6A 8ICSA 2F1HA 3BZCA 9ICXA 5ALFA 4U7CA 2BDUA 8ICGA 1ZQOA 3K75D 3JPPA 3VCBA 2M9NA 2JEIA 1KN5A 3EYZA 2YB1A 4GC6A 4EBDA 1OW5A 2A1AA 2KHQA 4RT3A 2R8HA 3QEAZ 2ZJ8A 2I1QA 1BPYA 1RG6A 5ALXA 1LKYB 1XSPA 3V6KA 5ALOA 5KFLA 3OJUA 4YVZA 3LWMA 2E8NA 3EW9A 5ALMA 2PMZC 4M9NA
chains in the Genus database with same CATH topology
3A0BU 5GTHU 3WU2U 2AXTU 5B5EU 3A0HU 3KZIU 5TISU 5H2FU 1S5LU 5E79U 4IL6U 4PJ0U 5B66U 4UB8U 4UB6U 5GTIU 2DUYA 5KAIU 5KAFU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B U;  5GTH U;  3WU2 U;  2AXT U;  5B5E U;  3A0H U;  3KZI U;  5TIS U;  5H2F U;  1S5L U;  5E79 U;  4IL6 U;  4PJ0 U;  5B66 U;  4UB8 U;  4UB6 U;  5GTI U;  2DUY A;  5KAI U;  5KAF U; 
#chains in the Genus database with same CATH topology
 1BGX T;  3FYH A;  4O3S A;  1JXL A;  2K8C B;  3CYM A;  4CCH A;  4QW9 A;  3PW0 A;  3E0F A;  3BQ2 A;  2HOF A;  1SWW A;  2WF6 A;  2WF9 A;  4CE6 A;  1RDF A;  2YQE A;  4M0A A;  4RQ4 A;  4JV0 A;  3RAX A;  3HKZ F;  2JH1 A;  2LYB A;  1KRP A;  5J0Y A;  2P66 A;  3ISD A;  1MQ3 A;  3BS7 A;  3WK9 A;  5HNK A;  4NY8 A;  9ICE A;  1SIJ A;  1ZQZ A;  3MAB A;  1VLB A;  5T14 A;  4LJX A;  1JXE A;  4Z6E A;  2V4Q A;  4IRD A;  1WG8 A;  4DL4 A;  7ICU A;  4OJL A;  2JHD A;  4DSF A;  4DQQ A;  1ZQS A;  4O5E A;  3RB3 A;  3UMG A;  3QX7 A;  5DG7 A;  7ICK A;  3PW4 A;  3HX0 A;  5J29 A;  5KG0 A;  5KFN A;  2D8C A;  3H0M B;  4ED2 A;  2KVS A;  4ECZ A;  4F4X A;  4WJ3 B;  4UAZ A;  2HBM A;  2HW3 A;  2PFQ A;  2UVW A;  1NK9 A;  2F76 X;  4DOB A;  2CN1 A;  2VAN A;  1Y88 A;  2LKY A;  5L1L A;  4RQ0 A;  4YXM A;  2ZXH A;  3AEV A;  4QWB A;  5H2F U;  5DG8 A;  2DBY A;  3PZP A;  5AIA A;  2AQ4 A;  1K1Q A;  1COK A;  4EEY A;  4US8 A;  4QZH A;  7ICJ A;  2ZIU B;  2ISP A;  2FMS A;  4MEY A;  5KAF U;  1ZQA A;  4O3P A;  2RDI A;  4M04 A;  8ICV A;  4EX7 A;  2XID A;  3M9N B;  7ICM A;  4USA A;  4C4S A;  1KLN A;  1T3N A;  9ICW A;  5DQG A;  7ICS A;  4NLN A;  4GXJ A;  2G5H B;  1NI3 A;  3RJI A;  5KFI A;  5KFM A;  2BCR A;  2BHN A;  3H8M A;  4OJ6 A;  4F5N A;  4YR0 A;  1ZQT A;  2AXT U;  3MDA A;  4UBB A;  3GIJ A;  3RJH A;  4F5Q A;  4UAV A;  5ALE A;  3D2S A;  3ONN A;  4I29 A;  3UQ0 A;  1S8O A;  3ETL A;  2K4E A;  9ICP A;  9ICN A;  4Q8F A;  2ZTD A;  3ZDA A;  1KFT A;  2HHX A;  4C4T A;  5DGB A;  1D8B A;  1NJZ A;  4I2I A;  1XWL A;  1ZQU A;  5KT7 A;  2C28 A;  2QAR B;  2G09 A;  4C7Y A;  3D6J A;  2AGO A;  4NLZ A;  1NK5 A;  4ED3 A;  4NLB A;  1ZD4 A;  2E5S A;  3C5F A;  4DL5 A;  1F0M A;  2DWQ A;  5AKX A;  4MF8 A;  5L1M A;  1YZ7 A;  2HHQ A;  1ZQX A;  2N1R A;  3TAC B;  5JRT A;  4UQG A;  3MDC A;  1CI4 A;  4QZG A;  2KFZ A;  1S0N A;  2XGP A;  2A19 A;  2IOF A;  1L5U A;  3PR5 B;  2Y9U A;  2BCU A;  1SV0 C;  3ALR A;  3SZ2 A;  4RQ3 A;  1VJ5 A;  2YTU A;  3UXP A;  1SKS A;  1KW4 A;  3V72 A;  3QNM A;  1X6I A;  2RHF A;  1ZQH A;  4QWA A;  4M47 A;  2KIV A;  1ZJM A;  4X5V A;  1KKX A;  4KLQ A;  3OHA A;  1RM6 C;  3H7I A;  4P2H A;  2YY6 A;  1D8Y A;  7ICO A;  4ICA A;  2BGW A;  1V38 A;  2C22 A;  1S10 A;  1FIQ A;  2F1J A;  2FLN A;  1S5L U;  2E1E A;  4FBU A;  5KT6 A;  5KFJ A;  3B0X A;  3QUQ A;  4UB5 A;  2EQY A;  3U26 A;  3ZDC A;  4TUR A;  4PZN A;  5DBB A;  4IQW A;  4ECS A;  1NJW A;  5IIN A;  1JUD A;  4Q43 A;  2B6G A;  2F1I A;  5AM3 A;  3PX4 A;  4YD1 A;  4QZE A;  3QU2 A;  3H8J A;  2OWO A;  2JEG A;  4K4I A;  1S0O A;  4KLG A;  3MFI A;  5L1I A;  2FMQ A;  3D2Q A;  5AKK A;  1TVA A;  1NOM A;  5EE0 A;  1Z1V A;  1QQ6 A;  3OTQ A;  3NVV A;  4DEZ A;  3ZD9 A;  2C2E A;  1T3Q A;  3WKB A;  8ICQ A;  4EX6 A;  2BCS A;  3PSF A;  3M8S A;  2RP5 A;  4F91 B;  1JI7 A;  1JN3 A;  4YN4 A;  2MAX A;  2HVH A;  2PMZ F;  5J2A A;  5B66 U;  1D9F A;  5IIL A;  3MC1 A;  2NV3 A;  4UB6 U;  3PW5 A;  2FPM A;  4NL9 C;  4PL1 A;  4EEN A;  1O03 A;  2BKE A;  3TAD C;  1UPH A;  5AM5 A;  5JTI A;  5ALU A;  5ALP A;  1RYU A;  3BQ7 A;  3FAH A;  4CGZ A;  4RNN A;  1ZQV A;  2WB1 C;  2YB4 A;  4QZD A;  3F53 A;  4Z6D A;  3PR4 A;  3UQ2 A;  3WKA A;  3TFS A;  2DFL A;  1NJY A;  2VA8 A;  1Z3E B;  8ICB A;  2DKX A;  4UAS A;  4B9L A;  1B22 A;  3BS5 B;  7ICQ A;  3FC4 A;  2NO5 A;  4PZO A;  8ICW A;  1XO1 A;  4K4G A;  4G9B A;  2AHO B;  4RQ5 A;  3TKA A;  4J9L A;  3M9M B;  2XVT A;  3Q8P B;  4DF8 A;  1F5S A;  1JAL A;  2W43 A;  4BUG A;  1HIW A;  3LVW A;  1ECW A;  4F5R A;  1UA0 A;  2Y9T A;  5J0T A;  4DSJ A;  1ZQB A;  1QSY A;  2MUT B;  3SR6 A;  4KN4 A;  2E1F A;  3PSP A;  3WK6 A;  5C0Y A;  4DLE A;  1Q46 A;  1XO0 A;  4I2D A;  1SL2 A;  1ED1 A;  3F2C A;  4YR2 A;  1UQV A;  1UT5 A;  1PVR A;  3BDP A;  2DPI A;  2MRL A;  4IL6 U;  2LM4 A;  3OHB A;  3N97 B;  2ASD A;  4DSI A;  4DL2 A;  5ALY A;  1BNO A;  5KFG A;  3H40 A;  2F8L A;  4UAW A;  3RRH A;  3T3F A;  3NVY A;  1L3V A;  3GV7 B;  2RQ5 A;  4PJ0 U;  3ZD8 A;  4P0Q A;  1U9L A;  2Q0Z X;  1L3T A;  1N61 A;  5DQH A;  9ICB A;  1NK8 A;  3F5E A;  2DUY A;  5F9N A;  5ALK A;  5J2B A;  3CW2 C;  5F3X B;  2L5Y A;  5HHI A;  3SYZ A;  5AIC A;  1TK5 A;  4UAU A;  4A8E A;  4UAY A;  5AKH A;  1S76 D;  2BCQ A;  2ZXI A;  4I2E A;  2ZJ5 A;  4B9V A;  2KMD A;  4YMO A;  3T79 A;  2G5I B;  5DB6 A;  4YQW A;  4R63 A;  1RXW A;  4J9Q A;  3RJK A;  2QKQ A;  3DV9 A;  2R8I A;  3FDS A;  3LDA A;  1TE2 A;  3RF9 A;  2VA3 A;  4RUA A;  7ICH A;  3K1R B;  2XO7 A;  5AI8 A;  3ZDB A;  3OPX A;  5DDY A;  3M8R A;  3KFU F;  2K89 A;  2ES6 A;  5DG9 A;  4EEL A;  3NGD A;  2K60 A;  5KFE A;  8ICF A;  1URJ A;  5ALH A;  1Z00 B;  2HHS A;  5JUM A;  4KLJ A;  3PX0 A;  2IA6 A;  2BQU A;  3UXO A;  2E3T A;  1JIH A;  3Q8R B;  2R8K A;  1J97 A;  2PI4 A;  5AI5 A;  4MF2 A;  3RH5 A;  4NXZ A;  4TUP A;  5KTQ A;  5D46 A;  3KHL A;  3GII A;  4F4Y A;  2IOH A;  1KL9 A;  4Z6C A;  4NWI A;  2DQN B;  2RRD A;  2J6S A;  5D49 A;  5CHG A;  5BPC A;  2UVV A;  1ZRN A;  4R65 A;  5AM4 A;  2ZUC A;  2OCE A;  3TAR A;  3IRU A;  2KEY A;  1C20 A;  1WCL A;  4M6W B;  4BWM A;  1QQ5 A;  5DQI A;  4CNQ A;  1L8O A;  4DO9 A;  2W9B B;  9ICO A;  1DGJ A;  4Y2U A;  2KKP A;  3KHG A;  2VJ4 A;  4R8U A;  7ICE A;  1ZYQ A;  4MFA A;  2QB0 B;  2HOI A;  9ICF A;  3SV4 A;  8ICL A;  1QCK A;  4JK1 A;  5BOM A;  3OSP A;  1VDV A;  5ALG A;  4Y2Q A;  3OGU A;  3QYP A;  3N4M B;  1B0X A;  1HEK A;  5F9L A;  3PW7 A;  4QWC A;  2IHN A;  2Y0S C;  4J9S A;  7ICG A;  1FFV A;  1SZH A;  3CNH A;  4XRH A;  4M9H A;  4GC7 A;  2D6F C;  4PHP A;  2RDJ A;  1L6N A;  4EYH B;  1WCN A;  4ECW A;  9ICC A;  2FPL A;  3ZI4 A;  3NS1 A;  5KFP A;  5KAI U;  3LWL A;  3A0B U;  1DK3 A;  3T5J A;  2WB1 F;  1ZQW A;  4EBC A;  5CA7 A;  2Y1J A;  5J2G A;  1LB2 B;  3B0Y A;  3BJY A;  4CDG A;  4ECT A;  2YN4 A;  3QUT A;  2YML A;  2BQR A;  4C8N A;  2ATL A;  1PK1 B;  2ZIX A;  5DLF A;  5KFA A;  1N60 A;  2Z7J A;  4RPX A;  2XY6 A;  3TFR A;  4M9L A;  3WK8 A;  3MGI A;  5G5H A;  5CP2 A;  4RQ8 A;  1T4G A;  1UA1 A;  1T7P A;  4IQT A;  2VA2 A;  2KIC A;  4ECX A;  2EAM A;  1L3S A;  1Q3V A;  3HIL A;  3RJG A;  1ZQL A;  3JPS A;  1OUQ A;  2CRX A;  1QQ7 A;  1X9W A;  4RQ2 A;  2EZY A;  5KFH A;  1N63 A;  5DKW A;  4M2Y A;  2IOF K;  1L7P A;  5AI0 A;  3RJF A;  2F44 A;  4I2H A;  2FLL A;  4DFD A;  5KG3 A;  1KSP A;  2OHF A;  9ICL A;  7ICL A;  1SL1 A;  1PK3 A;  2KG5 A;  1SV0 A;  1J2N A;  5J0R A;  2AGP A;  2FI1 A;  5AKJ A;  4ELT A;  2E8O A;  3A0H U;  4I27 A;  1SGG A;  2NRW A;  2AJQ A;  2JR5 A;  2WAQ C;  1U48 A;  4IR1 A;  2JH7 A;  1K5O A;  4P0P A;  4O3Q A;  2HSZ A;  1CUK A;  3THV A;  3RRG A;  5KT4 A;  1TFR A;  2NRV A;  5AKE A;  1BPZ A;  4F50 A;  2F77 X;  4QZI A;  2IBK A;  5KNI A;  4E0D A;  4CF5 A;  1XU4 A;  5AK5 A;  4DOA A;  5AI9 A;  5ALT A;  3T5H A;  1L7M A;  9ICT A;  5C5J A;  2GOL A;  5J2J A;  1JRO A;  3NVW A;  1V85 A;  4IRC A;  1CEZ A;  1ZD5 A;  4KMO B;  9ICS A;  3JPQ A;  5ALR A;  8ICZ A;  3EPG A;  3N7P D;  5AKZ A;  3NTU A;  3MR3 A;  1FFU A;  5KFY A;  9ICR A;  4PH5 A;  4ECY A;  2KSO A;  2KP7 A;  3QU7 A;  4KLU A;  1TKD A;  2YMQ A;  3QU4 A;  5J2I A;  4DOC A;  4GIB A;  1A6S A;  5KFW A;  4NV0 A;  2H3Z A;  4EBE A;  5KG2 A;  5EOZ A;  8ICJ A;  4NM2 A;  3DDH A;  1DXS A;  3JPT A;  4I2C A;  4C7Z A;  3KZI U;  5AKI A;  8ICA A;  2ISO A;  4KIT B;  4LZG A;  4KMU A;  4OJ5 A;  4DSE A;  4NL9 A;  1RXV A;  3QU5 A;  4G3I A;  1Z1B A;  3TAD A;  1IV8 A;  1Z19 A;  2WF5 A;  4J9M A;  3NAS A;  4DQR A;  4UW9 A;  3EZ5 A;  3UMC A;  3FM9 A;  2R18 A;  2W11 A;  5KFZ A;  4YFK A;  1ZQC A;  3KBB A;  4O5K A;  2W54 A;  4DF4 A;  9ICI A;  2EAN A;  2HBK A;  2OM6 A;  1C7Y A;  3DEE A;  2A3V A;  4IS7 A;  1SKR A;  5IIJ A;  3RBE A;  1CRX A;  3V6H A;  2JEJ A;  3HPO A;  2W7P A;  4I2G A;  3SAF A;  5KFB A;  9ICQ A;  4KTQ A;  4DS5 A;  4JV1 A;  1PVP A;  3R9K A;  1TAQ A;  5KFV A;  2V9W A;  5ALD A;  3MR2 A;  5ALS A;  2KD1 A;  4EZ9 A;  2ZIV A;  3PMN A;  3PVX A;  3RJJ A;  5KG6 A;  1MSW D;  3RB6 A;  1ZQN A;  3MBY A;  3GDX A;  1NZP A;  3PX6 A;  2GWS A;  3V7J A;  8ICX A;  2Y0S F;  4AP9 A;  5J8Y C;  4DFJ A;  4Y2R A;  2H3Q A;  3Q8S B;  3G6X A;  4RQ7 A;  3RB0 A;  1N48 A;  3LYS A;  4UAT A;  3JPN A;  4UB1 A;  2ASJ A;  1ZD3 A;  4O3O A;  3GIM A;  2F2A B;  2B21 A;  4P4O A;  5TIS U;  4KLT A;  2PXI A;  3RH6 A;  3N28 A;  2VKQ A;  1L7N A;  2K4I A;  8ICK A;  2BCV A;  4PL2 A;  1U47 A;  2XIC A;  4QZB A;  3BQ1 A;  3LK9 A;  3GIL A;  4EYI B;  5III A;  4HYK A;  3KKA C;  4Y2S A;  2QB1 A;  3IHQ B;  2CXY A;  4OJP A;  3AMZ A;  2W9C A;  1AQ6 A;  2ZJA A;  4NJ8 A;  1DOQ A;  1SWV A;  3NRW A;  2AQ0 A;  1O08 A;  2XI9 A;  2H5X A;  4RU9 A;  2AGQ A;  1B43 A;  2WTF A;  1NKC A;  4JWM A;  4TUS A;  1X2I A;  1NK4 A;  1IG6 A;  2H3I A;  2C2D A;  2BR0 A;  2WF8 A;  2FMP A;  2EZX A;  1TAM A;  2G06 A;  4QZA A;  3M6K A;  2K8B B;  2JXJ A;  2Q4T A;  4PGX A;  4J9N A;  5ALQ A;  2JZB A;  5EWG A;  4K4H A;  5KFK A;  5AK3 A;  2KNJ A;  2GLE A;  3PO5 A;  2F8K A;  1S97 A;  3LVV A;  1NKE A;  3KZX A;  5FP0 A;  1LVH A;  1NJX A;  3C21 A;  2XGQ A;  4RQM A;  3C2L A;  5DB9 A;  4Y2V A;  4KN7 A;  2Y1I A;  7ICR A;  5IIO A;  4BX9 C;  2G07 A;  5DB8 A;  2WAQ F;  1WYG A;  5TZV A;  3GIK A;  2AU0 A;  9ICA A;  3QEB Z;  3MGH A;  5KFF A;  3PO4 A;  4RQN A;  3AQE A;  2KZM A;  4DS4 A;  1X9M A;  2KOB A;  5AKL A;  3O0F A;  2KFN A;  2W7O A;  4FS1 A;  4KLM A;  3M7D A;  1N5X A;  5E79 U;  3EPI A;  2YMM A;  3EUB 2;  2A1J A;  4O9M A;  3M9O B;  1N56 A;  1KEJ A;  2NRX A;  2YX8 A;  4DQS A;  1D8L A;  2HHW A;  3AN1 A;  4ECQ A;  4TQS A;  3BQ0 A;  3WK4 A;  2HHT A;  2DF4 B;  3MR6 A;  4ED1 A;  5GTH U;  4DFP A;  1QTM A;  3VC8 A;  4F4W A;  4F4Z A;  3Q8Q B;  2W3R A;  1UHU A;  1OXJ A;  1SKW A;  3WKC A;  4BDP A;  3NUQ A;  2QLT A;  4F3O A;  3QU9 A;  2XCP A;  7ICT A;  1S77 D;  4FZN A;  1LKY A;  5HML A;  9ICM A;  2DL0 A;  2RLT A;  5AM0 A;  5KG7 A;  2B0C A;  4ED0 A;  2JGA A;  4YMM A;  2HCF A;  2NRZ A;  2UVU A;  1SXD A;  4LVS A;  2ALZ A;  2I6X A;  4ED8 A;  1RYS A;  4KX3 A;  2ZUD A;  5CEH A;  3F2D A;  5KFO A;  2DGZ A;  4GXI A;  1ZQE A;  4LZD A;  4O3N A;  2GO7 A;  5BOL A;  3L4P A;  3HWT A;  3HJE A;  2KE7 A;  5J0P A;  2W9A A;  1UCV A;  3GU3 A;  2XCA A;  3RH4 A;  8ICE A;  2EDU A;  2KJ5 A;  2F3N A;  4I2A A;  5CR0 A;  1BPE A;  1ZQM A;  4AYB C;  2LBO A;  1ZQ1 C;  2IMW P;  2K8A A;  1SZP A;  2KZ3 A;  3ED5 A;  2W8K A;  1ZQK A;  4GXK A;  4Q8E A;  2KV2 A;  4QW8 A;  3IV6 A;  4J9K A;  2BDP A;  4BXO A;  1IIP A;  5KFR A;  3H8W A;  4FFD A;  1FO4 A;  3N7R C;  3Q8K A;  1TV9 A;  5AIB A;  2VJ5 A;  1X9S A;  3ICX A;  3V7L A;  5L9X A;  2FPK A;  3BQT A;  5J0O A;  5KL8 B;  1F44 A;  4ZH4 A;  4ED7 A;  3M1Y A;  5AI6 A;  3QUC A;  2JEF A;  2W04 A;  4P0Q B;  2R8G A;  3AUO A;  2KJ8 A;  1NZB A;  4UB8 U;  1BPX A;  8ICI A;  3IP4 B;  3RBD A;  4CF4 A;  8ICC A;  5AK6 A;  4F71 A;  5ALV A;  4DL3 A;  2ZIU A;  4UAR A;  1U45 A;  4KLL A;  3RFA A;  4XUS A;  4Z6F A;  1Q8K A;  5AM2 A;  4Y2J A;  3SI8 A;  4B9S A;  5J0X A;  3H4D A;  4M9G A;  3L5K A;  4JV2 A;  1RZT A;  1KFD A;  2HBJ A;  2MSN A;  4ECU A;  1ZQI A;  2EH9 A;  1QH9 A;  3IM1 A;  2BPC A;  4RNM A;  3C2M A;  1FEZ A;  5J2K A;  4JMU A;  4RQ1 A;  1D9D A;  5J2F A;  3ISC A;  1IM4 A;  2I5H A;  1S9F A;  4KX5 A;  1DRG A;  5J2H A;  3H0R B;  2D3D A;  3IDW A;  3C28 A;  1T8E A;  2KKV A;  2OYY A;  4JB3 A;  2FE9 A;  3J81 j;  2E8M A;  2DKZ A;  2QAR A;  3K4G A;  3NVZ A;  2LPE A;  4QZ9 A;  3TI0 A;  3E58 A;  5DLG A;  1KQQ A;  1SL0 A;  3Q8M A;  2PI5 A;  1N5W A;  3C5G A;  1ZQF A;  5IIK A;  1NK7 A;  4XQ8 A;  8ICP A;  3G6V A;  3BZK A;  1MN8 A;  3QZ7 A;  2OEH A;  1WWV A;  5J0S A;  4KLI A;  5DGA A;  3PSI A;  1ZQP A;  4J9R A;  2ZUB A;  1N62 A;  1EXN A;  4J9P A;  3RR7 A;  3E2E A;  2ODG A;  4KLF A;  3I1Y A;  5HP4 A;  4BXO B;  3QZ8 A;  1YZ6 A;  4PPX A;  3C1Y A;  3CP8 A;  2PKE A;  3ISB A;  3Q8L A;  3KHR A;  1KDH A;  2C2R A;  3RJE A;  3N7S C;  4F5P A;  4F5O A;  5IIM A;  4IQV A;  3SAH A;  2XC9 A;  3JPR A;  4MEX A;  2KVC A;  1K1S A;  2OXO A;  5HR7 A;  4KLD A;  5G5G A;  2JV3 A;  4KLE A;  2LM1 A;  2NYV A;  4BJQ A;  4GLX A;  2E8P A;  1QSL A;  2HVI A;  2WFA A;  4R8U B;  3UXN A;  3TAQ A;  8ICM A;  2NO4 A;  5KFD A;  3V6J A;  5KFU A;  4IR9 A;  1ZXI A;  1GO3 F;  1ZJN A;  1BPB A;  1ZOL A;  2FJ6 A;  5AM1 A;  2VIX A;  4QZF A;  2ESE A;  7ICP A;  4EEK A;  4B6J A;  3ZDE A;  4F2S A;  1L8L A;  4DLG A;  3IG5 A;  2O6K A;  3MFH A;  4CRX A;  2HBL A;  5JU5 A;  4YCX A;  5EE1 A;  8ICT A;  3PST A;  1BNP A;  4NM1 A;  4DL7 A;  3PV8 A;  3WKD A;  3S6J A;  4TQR A;  4DQI A;  4ACO A;  1JRP A;  5ALI A;  1NKB A;  2WF7 A;  3PY8 A;  2ZG6 A;  5EE3 A;  3MR5 A;  2XY5 A;  2ZTE A;  4QIW C;  1DK2 A;  4F92 B;  5DBA A;  4YD2 A;  4F4K A;  5D4B A;  4F72 A;  4QZ8 A;  1KBU A;  2ZIX B;  4MFC A;  4O5C A;  2M0N A;  1V97 A;  1X42 A;  3CRX A;  3T5K A;  2K4H A;  1NK0 A;  1S0M A;  4C8O A;  1QLN A;  2JRZ A;  3NRZ A;  4Y2P A;  2XY7 A;  4GFJ A;  1TAU A;  4MHV A;  5J2C A;  5J8Y A;  4FS2 A;  4NLC A;  4ELV A;  5J0U A;  5GTI U;  4P4P A;  2W3S A;  4ZOH C;  5ALZ A;  4B9U A;  1XSN A;  3SD7 A;  3SAG A;  3PML A;  4KLO A;  2ASL A;  1Q3U A;  4ED6 A;  2HI0 A;  4Y2X A;  5ALJ A;  1PVQ A;  2PFP A;  1HUO A;  2UVR A;  4YMN A;  3I28 A;  2KIW A;  3WK5 A;  1ZQG A;  4Y2Y A;  2KN7 A;  2P35 A;  3BS5 A;  4AYB F;  4IRK A;  2W55 A;  1MC8 A;  4C4R A;  2W8L A;  4ELU A;  2MA1 A;  8ICY A;  4O3R A;  5KT3 A;  4QWE A;  1PZN A;  3KKA A;  5KFX A;  4OJO A;  3EWA A;  3SQI A;  1BVS A;  4OCZ A;  3WU2 U;  4XA5 A;  8ICU A;  4P0P B;  3C23 A;  4Y2T A;  1LV5 A;  5KG5 A;  2P6U A;  3WK7 A;  7ICV A;  4Q45 A;  5EE9 A;  2MUT A;  5AHX A;  2NRT A;  4NLK A;  2LI6 A;  1JX4 A;  2LYA A;  8ICO A;  1XC9 A;  3PNC A;  1XNS A;  2EZZ A;  5ALN A;  1RYR A;  2OH2 A;  1MQ2 A;  5L1K A;  5HHH A;  2HDO A;  1L7O A;  1RPL A;  2G08 A;  2MU2 A;  3ORY A;  3F2B A;  3RAQ A;  1JMS A;  3F5A A;  2IHM A;  2R8J A;  2J6T A;  3C2K A;  1H38 A;  5DBC A;  3G6Y A;  2DPJ A;  1HJP A;  1P7D A;  4FBT A;  1ZD2 P;  1MA7 A;  3ZDD A;  1X66 A;  7ICF A;  2KSO B;  2KK0 A;  5J2E A;  2PFN A;  2FDR A;  4Q44 A;  3KHH A;  2P6R A;  4I28 A;  3GFK B;  3RB4 A;  2HHV A;  4NLG A;  3C29 A;  1X9X A;  3M6Z A;  4UB3 A;  4IQU A;  5J0Q A;  1QSS A;  3B9J A;  1ZQQ A;  5HMM A;  4F2R A;  4PGY A;  5DB7 A;  2ZIW A;  5KFQ A;  2K4P A;  3L3F X;  1L3U A;  3MGV A;  3AL0 B;  1HUZ A;  7ICI A;  3KTQ A;  5DDM A;  2BPG A;  3HKZ C;  7ICN A;  1WWU A;  4JUZ A;  5J0W A;  2V4R A;  3K1Z A;  4KLS A;  4M9J A;  5EWE A;  9ICK A;  4C80 A;  4YR3 A;  3HP6 A;  4I2B A;  1S0V A;  5KFT A;  2I9G A;  3QE9 Y;  5KT5 A;  3QXG A;  2AH5 A;  3HT3 A;  3OSN A;  1T94 A;  1SXE A;  5KG4 A;  3RTV A;  4O3M A;  1V9P A;  2W9M A;  9ICU A;  3KOO A;  3GV5 B;  2GH1 A;  1N2X A;  1J2M A;  4B9T A;  4YP3 A;  3UMB A;  3TAN A;  3WKE A;  4DSK A;  1A77 A;  5CJ7 A;  3QUB A;  4I2J A;  1UT8 A;  1Z00 A;  2BQ3 A;  4BWJ A;  1XSL A;  2JMG A;  1TK8 A;  1Z4O A;  4BGD A;  3IG8 A;  4U6P A;  4QNL A;  4CF3 A;  3AU6 A;  3C1Z A;  2FLP A;  5J2D A;  2KHV A;  4QJF B;  4DSL A;  5A0L A;  1TK0 A;  4US9 A;  1X6J A;  4UB2 A;  4OO1 J;  5EWF A;  4DFK A;  5ALW A;  3SMV A;  4QZC A;  4F8R A;  4FO6 A;  3IN5 A;  5KT2 A;  1X40 A;  2ZIV B;  3GQC A;  1ZQY A;  5AKY A;  4B9N A;  1ZET A;  1NNL A;  3TQ1 A;  1SV4 A;  1YT3 A;  4EZ6 A;  4J9O A;  4YXJ A;  3H0L B;  4RPZ A;  4UBC A;  8ICN A;  1B4F A;  4ECV A;  4KLH A;  4PGQ A;  1DGS A;  3HW8 A;  4R66 A;  2H3V A;  5L1J A;  2YMP A;  4MFF A;  2HMX A;  3HRD D;  4RPY A;  4DFM A;  9ICV A;  8ICR A;  4ECR A;  4M6W A;  4F93 B;  3JPO A;  3T5L A;  4FZM A;  5KG1 A;  3AQF A;  4TUQ A;  4C8M A;  1RQN A;  4HAI A;  5KL1 B;  5CB1 A;  2W9B A;  3AM9 A;  4I2F A;  8ICH A;  1IXR A;  4RZR A;  1ZQD A;  2HHU A;  4UB4 A;  3GZF A;  4DQP A;  2QB0 A;  3RR8 A;  3H8S A;  2H3F A;  2ZIW B;  3D2N A;  1A76 A;  4QIW F;  2G0A A;  1NK6 A;  3KD3 A;  3SEI A;  5KFC A;  2KZZ A;  2W9C B;  4IC9 A;  1A0P A;  2KJ9 A;  3V7K A;  1KTQ A;  2BZF A;  5AKG A;  4B9M A;  5KFS A;  2HOQ A;  2J6U A;  4FZL A;  3SEN A;  3H4B A;  4QWD A;  4C8L A;  9ICJ A;  3UPQ A;  1WUD A;  1M6Y A;  1SB3 C;  3ETR A;  5K4L A;  2PFO A;  4DCC A;  4YG2 A;  4RUC A;  4O0I A;  3AU2 A;  4R64 A;  1ZQR A;  9ICG A;  3TAP A;  2KTQ A;  4J03 A;  2CPR A;  3GV8 B;  2JZB B;  3I76 A;  3OJS A;  1XS9 D;  3UM9 A;  1BPD A;  2ZTC A;  1PK1 A;  2BPF A;  2LYH A;  4RT2 A;  5CRX A;  5AI4 A;  5B5E U;  4DWI A;  1U4B A;  1COO A;  2EAO A;  9ICH A;  3PW2 A;  4C0Z A;  4P4M A;  1ZRM A;  2EAP A;  1ZQJ A;  4RNO A;  1ARO P;  4OD0 A;  2LHT A;  5AK4 A;  3SV3 A;  4DL6 A;  1KFS A;  1PUZ A;  4FE3 A;  4PHD A;  4RQ6 A;  2WHE A;  2W03 A;  4C8K A;  4PHE A;  1RQL A;  1Z4N A;  2A1J B;  2LMR A;  5ALL A;  1U49 A;  4PHA A;  5CWR A;  4JWN A;  5HR6 A;  8ICS A;  2F1H A;  3BZC A;  9ICX A;  5ALF A;  4U7C A;  2BDU A;  8ICG A;  1ZQO A;  3K75 D;  3JPP A;  3VCB A;  2M9N A;  2JEI A;  1KN5 A;  3EYZ A;  2YB1 A;  4GC6 A;  4EBD A;  1OW5 A;  2A1A A;  2KHQ A;  4RT3 A;  2R8H A;  3QEA Z;  2ZJ8 A;  2I1Q A;  1BPY A;  1RG6 A;  5ALX A;  1LKY B;  1XSP A;  3V6K A;  5ALO A;  5KFL A;  3OJU A;  4YVZ A;  3LWM A;  2E8N A;  3EW9 A;  5ALM A;  2PMZ C;  4M9N A; 
#chains in the Genus database with same CATH homology
 3A0B U;  5GTH U;  3WU2 U;  2AXT U;  5B5E U;  3A0H U;  3KZI U;  5TIS U;  5H2F U;  1S5L U;  5E79 U;  4IL6 U;  4PJ0 U;  5B66 U;  4UB8 U;  4UB6 U;  5GTI U;  2DUY A;  5KAI U;  5KAF U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...