5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
2DUYA 4PJ0U 4UB8U 5H2FU 3WU2U 5B66U 5KAFU 5E79U 2AXTU 1S5LU 3KZIU 5KAIU 3A0BU 4UB6U 3A0HU 5TISU 5GTHU 5GTIU 5B5EU 4IL6U
chains in the Genus database with same CATH superfamily
2JZBB 4RT2A 2G0AA 4M6WA 1BNOA 5CR0A 3OSNA 2AU0A 4BWJA 1NZBA 5K4LA 1SWWA 1SV0C 5ALXA 5J2AA 5KT5A 1F5SA 3A0BU 1SXEA 5AI0A 2N1RA 1KSPA 2G5HB 5AM0A 5J2KA 5ALQA 4DL6A 1QSLA 5DLFA 4QW8A 2XVTA 4I2GA 4ECTA 2D6FC 4Q8EA 2H3VA 2F8KA 4I2JA 4ED3A 4NWIA 2J6SA 2RRDA 3MDAA 3WK5A 3MR2A 8ICMA 1HEKA 4NJ8A 7ICTA 3WK8A 4A8EA 5KFDA 8ICVA 1ECWA 5ALIA 4Y2TA 5J0PA 4M6WB 5KG0A 4RNNA 2HBMA 4NXZA 1TK5A 4KLIA 4O3OA 4ELUA 2O6KA 5D49A 3PX6A 2E3TA 4EYHB 4DL5A 7ICVA 1JALA 3TAQA 3RTVA 3QNMA 2DKXA 4RQ5A 5AK6A 3NS1A 1XO1A 5J0QA 4QW9A 1A76A 3SYZA 4I2BA 8ICWA 2K8AA 3RBEA 4NLZA 3SZ2A 2KJ8A 2EANA 4JUZA 3I1YA 2V4RA 3WU2U 2H5XA 8ICSA 4C4SA 2B21A 1ZQJA 2LYAA 4EZ9A 5KFLA 2OCEA 1L7OA 3LVWA 1LKYB 3KZXA 1BPYA 3BS7A 4YQWA 1ZQNA 3JPTA 2JEGA 4QWEA 1BPBA 4PHAA 3QU7A 3WK6A 2B6GA 2F1IA 1TE2A 2HOQA 3FC4A 1ZXIA 5DB9A 4K4GA 4KLQA 5F9LA 1L3TA 4RQ7A 3Q8RB 2QLTA 1K1QA 3L5KA 5J0RA 5J8YC 1BPXA 2E8OA 1B22A 3S6JA 4DSLA 1QLNA 1TVAA 1ZRMA 3SAHA 2MU2A 2DL0A 3CRXA 3HW8A 2JMGA 2ZTEA 1X6JA 3RFAA 5F9NA 1QSYA 5EWGA 2KJ5A 2JXJA 2ZIXB 2BCUA 4QZEA 3TQ1A 4UAYA 5J8YA 4ED8A 4DS5A 3PW4A 4KLUA 2MA1A 3TARA 2A1JA 4IR1A 4C8MA 5AKXA 2C2DA 1OXJA 2WF6A 5KT4A 2AQ4A 1RPLA 1BGXT 4QZDA 4RU9A 4ED1A 5T14A 4PHPA 1NJWA 4EBCA 1S77D 4F4ZA 4PGYA 1X40A 1WWVA 3MBYA 2NRTA 5HNKA 2JR5A 3EPGA 4Y2XA 5JU5A 5DB6A 4O5CA 2NRWA 1U48A 3RH5A 4UAZA 2WFAA 2G07A 3PW5A 3BQ2A 1T4GA 2FMPA 2EQYA 2HMXA 1YZ6A 3RB0A 1WG8A 1L7NA 2QKQA 5KFNA 3PW0A 4AYBC 1S10A 2IMWP 2LMRA 4YR3A 2F1HA 4DCCA 4P4PA 2BCQA 2K60A 3QXGA 3NTUA 4K4HA 3ONNA 3RJJA 4GFJA 1CRXA 1COOA 2BPFA 7ICLA 1X9WA 4UAWA 2C2RA 2F8LA 2KMDA 4YP3A 4JWMA 4LZDA 3HP6A 3UMCA 2FPKA 5J0TA 1SKRA 2KV2A 9ICQA 2EZYA 1L7PA 4I2FA 3UMGA 4G9BA 2K4IA 1KRPA 2E5SA 2KP7A 1J97A 1SL2A 3K1RB 1B0XA 3KD3A 1N56A 1ZQTA 4I2AA 4GC7A 2W9CB 5AKIA 2G08A 2W9CA 4KLDA 2WF9A 4YXMA 5IIOA 2LPEA 1ZETA 4DEZA 2WB1F 3M7DA 2W9AA 4QIWF 3E0FA 1QTMA 4PJ0U 5AKKA 4QZBA 2IA6A 1UA1A 1ZQFA 2J6TA 2HSZA 2R8JA 1UT5A 2XCAA 1SKWA 2NO5A 3KHHA 3V7LA 2BHNA 3CYMA 2XY5A 5L1MA 5L1KA 4KLLA 8ICLA 3PO5A 3TANA 2ZIXA 4KMOB 4UARA 5ALYA 4DLGA 9ICRA 3GZFA 3PR4A 2BDUA 9ICSA 4OJ5A 4ECUA 1UPHA 4ZOHC 2UVRA 2AXTU 2DBYA 1XSPA 1ZQQA 4ECQA 5ALSA 5FP0A 5ALWA 2H3ZA 2BCSA 3H0MB 2H3QA 2K8BB 3V6KA 2P6RA 3V7KA 4B9SA 5KFCA 4BWMA 2W03A 3RF9A 3OSPA 2DFLA 1XSLA 3TAPA 5DGAA 3M9OB 2JEJA 4FBTA 2ISPA 2P66A 9ICUA 3BQ7A 4BGDA 1TAUA 4IQVA 1Q3UA 1EXNA 5D4BA 3NVWA 2H3FA 2VANA 3VCBA 3TKAA 2C2EA 4FZNA 7ICJA 1PVPA 3B0XA 2CXYA 1IIPA 3C5GA 4J9SA 3OTQA 4J03A 3H4BA 5KL8B 1WCNA 1SL1A 3AMZA 1T3QA 2KIWA 4DFKA 5ALVA 5KFRA 5ALOA 4CF3A 3RJGA 5HMLA 3NGDA 3JPQA 1NJZA 4KLOA 2CN1A 4RUCA 4CGZA 3NRZA 1TAQA 3PVXA 2FPMA 3EUB2 3M9MB 5ALNA 5KFMA 2Y0SF 4GXIA 4FZLA 9ICTA 4KLEA 4ED2A 5G5HA 3LWMA 2FMSA 1PK1A 9ICKA 2W54A 2NRXA 1JUDA 2OXOA 3AU6A 2DKZA 3RJHA 2OYYA 4G3IA 3L3FX 4XUSA 2PI5A 1T8EA 4M9JA 7ICEA 3NVZA 5AK3A 1SWVA 4YR0A 4R63A 8ICNA 4F5PA 1N62A 3C2LA 2R18A 3MR6A 5EWFA 1KLNA 3WKBA 4LZGA 3ZD8A 4F2RA 9ICHA 2HHXA 1Z00B 1TK0A 2W3RA 4YD1A 8ICQA 4TUSA 1ZD5A 2PFOA 4DOCA 4NM1A 2P35A 2DUYA 3M6KA 1PVRA 3F5AA 7ICPA 3IN5A 4BDPA 3WK4A 1UCVA 3RB4A 5AM5A 2BQUA 7ICRA 4F5NA 2QB0A 3H4DA 2K4EA 2EDUA 4FE3A 2UVWA 1L3UA 5EE0A 1A6SA 3V6JA 4IRDA 4AP9A 4DO9A 1KQQA 4Y2QA 1TK8A 4DSEA 5J0SA 2ZTDA 4F71A 3C1ZA 1M6YA 4PHDA 1N61A 5CHGA 3MR5A 3EWAA 3H0LB 4EBEA 5ALZA 5B66U 5KFBA 4DL7A 4EEYA 5KT7A 2OM6A 3QZ8A 3MGHA 2VIXA 3H8JA 3U26A 1SXDA 3K4GA 2C28A 4C4RA 1DXSA 3ISCA 3NRWA 1BNPA 7ICMA 4KN4A 5DB8A 1RG6A 2F1JA 4BXOB 1URJA 4M0AA 9ICAA 3PW7A 4KLJA 2QARA 7ICHA 5DB7A 5AICA 3UQ2A 2LBOA 3DDHA 4NV0A 4KMUA 4DFDA 4ECXA 1BVSA 5J2BA 4F5QA 4J9PA 1KDHA 3NASA 5BOMA 2RHFA 5KFOA 4RQ2A 2NV3A 2KVSA 8ICFA 5DBBA 2D3DA 2XCPA 2EZZA 2KG5A 3T5KA 2HW3A 4RQNA 2K8CB 4GLXA 8ICZA 5CJ7A 2ZTCA 4QZHA 5DDYA 1D9DA 4BXOA 1B43A 3N4MB 3H8WA 2A1AA 4US8A 5JUMA 2LYHA 3Q8PB 3M9NB 4OCZA 3KTQA 7ICSA 1KEJA 2RDJA 4OO1J 3UXNA 5G5GA 1HIWA 1DK2A 9ICCA 5DGBA 2ZIUA 4XRHA 1NK5A 4DL3A 1SIJA 5J0XA 3PW2A 4F4XA 9ICOA 1U45A 2PFQA 5ALDA 3OHAA 1ZQHA 2BPGA 4QWCA 1QCKA 5KFEA 1PK3A 4F93B 2NRVA 2W8LA 3BZKA 2GWSA 4NL9C 3ORYA 5J2HA 1U49A 4GC6A 4DQPA 1S0VA 2KNJA 2KVCA 1ZQCA 3SAFA 5IILA 4M04A 3QU5A 1D8YA 4O3SA 3WKAA 1NKBA 2LHTA 2WHEA 2FMQA 4F4KA 3RR7A 4Q43A 4KTQA 8ICOA 2PXIA 5DBCA 2WF7A 1JX4A 2KKVA 3UMBA 4KLSA 1ZQWA 2EH9A 5KG3A 1T3NA 1T7PA 4DQRA 4UAVA 9ICPA 2RQ5A 3AM9A 3QU2A 2Y9TA 7ICOA 2HOIA 4YG2A 5HR6A 1SKSA 5EE3A 4I2IA 2K89A 2YTUA 3C1YA 5IIIA 1VJ5A 1BPEA 5J0OA 1D8LA 3GQCA 1V97A 1RQLA 3SMVA 1HUZA 3T79A 5ALMA 4OD0A 3IM1A 4YD2A 2FLPA 1ZQ1C 1IV8A 5KG7A 2JV3A 5AIBA 2Y9UA 3IDWA 1DOQA 5KFPA 4ECRA 4IL6U 5BOLA 9ICEA 2HHUA 2HBLA 4RUAA 3N7PD 5ALPA 3AL0B 1LKYA 2KN7A 5DG8A 2A1JB 4K4IA 9ICNA 4QZCA 4J9KA 4DWIA 4QZGA 4M9GA 3AQFA 2EAMA 1IM4A 4YMNA 2R8GA 3NVYA 3LK9A 4YVZA 3H8MA 8ICGA 4DSJA 9ICLA 1X66A 1MQ3A 5L1JA 3AU2A 5J2JA 2Q0ZX 5AM4A 1D8BA 5KFSA 4DS4A 1MC8A 3I76A 4RQ4A 4MHVA 4KX5A 4CF5A 5L1IA 2A3VA 1VDVA 2I1QA 1KFDA 3PSFA 4F92B 2FLLA 3D2QA 3QYPA 2KIVA 2H3IA 3PO4A 4MFAA 3MFHA 1N2XA 8ICBA 5HR7A 1COKA 5J0UA 4QZIA 2ESEA 2GLEA 3QUBA 9ICBA 1XU4A 5KAIU 5J2CA 5KT3A 2XY6A 3GIJA 5DG7A 4EENA 4NY8A 1ZD3A 4Y2SA 3AUOA 5HMMA 3C29A 5EE9A 2BQRA 1S0NA 1KFSA 4R64A 2WAQF 3KBBA 2OHFA 1X6IA 3PV8A 5KG2A 2NRZA 4LJXA 4P4MA 4XQ8A 2K4HA 4OJ6A 3BQ0A 2F76X 5L9XA 4F8RA 2W43A 5IIMA 1RXVA 2XGPA 2XI9A 3EW9A 4B6JA 1Z00A 4PL1A 4GXKA 4J9RA 1NJYA 1RM6C 3IP4B 2ASLA 2ISOA 2HHWA 1ZQPA 1NK7A 2UVUA 3ETRA 5D46A 4O3PA 3H40A 2ZIWA 2ZUDA 2E8NA 1V9PA 2HHSA 4NLBA 3JPPA 5ALEA 3H7IA 4RPYA 2ZUCA 3Q8MA 4RPXA 1T94A 4Q45A 5AHXA 1A0PA 5E79U 3HILA 5KFVA 1A77A 1ZQVA 9ICXA 2FE9A 3MDCA 4F91B 5J29A 1KN5A 1TAMA 2FLNA 4IQWA 1OW5A 2YX8A 5DKWA 4TQSA 1SL0A 4P4OA 4Z6EA 2AQ0A 1NK6A 5AM3A 2KZZA 4KLHA 1NOMA 2ODGA 1ZOLA 4KX3A 2ZJ8A 4RNMA 2W3SA 3E58A 4IRCA 1Z1BA 4ED6A 4O5KA 1PZNA 3KKAC 4ECSA 3V6HA 3PZPA 5DQIA 2DGZA 1O03A 5L1LA 5ALKA 2KKPA 1AROP 1CUKA 4FS1A 4PHEA 2RP5A 1KBUA 2ASJA 1BPDA 2HCFA 3N28A 1FO4A 1AQ6A 3PX4A 4JV0A 3GV8B 2WAQC 5DDMA 2E8PA 4UB6U 5AKGA 3PR5B 7ICUA 4ED0A 2GH1A 2KTQA 4F72A 5AKZA 1KL9A 4XA5A 5HHHA 4USAA 4C7ZA 2G09A 2GOLA 1FFUA 5ALGA 4F5RA 4FO6A 4C80A 4DOAA 1CEZA 2HVIA 9ICGA 2IHNA 4TUPA 3SEIA 4RQ3A 2G06A 3AN1A 5KAFU 1N60A 4F2SA 2EAPA 1H38A 4U6PA 5HP4A 5KFZA 1C20A 8ICCA 4DLEA 2OWOA 2BDPA 5KFJA 4NLNA 5KFFA 3GU3A 5AKYA 5KFXA 1Z19A 5AK4A 4WJ3B 4M9NA 4Y2YA 4Q8FA 3HX0A 1ZQLA 4UB2A 4QWDA 3G6XA 1L6NA 3K1ZA 3C23A 4QZAA 2QB0B 2UVVA 1XSNA 3FM9A 4FZMA 2IOHA 2KHVA 7ICIA 1Z4OA 5DQHA 2DPJA 1TFRA 3SENA 4UASA 4I29A 1RDFA 1QQ7A 5KFHA 2YQEA 3MC1A 4MF8A 2KD1A 3ZDCA 5KTQA 2LM4A 3HPOA 1P7DA 2IHMA 2F44A 5DG9A 5H2FU 3LWLA 3LVVA 3MR3A 1QH9A 1F0MA 2V9WA 5DBAA 3C5FA 2DPIA 4P0PB 2J6UA 1S76D 2PI4A 2W55A 4UB3A 4DOBA 3K75D 4GIBA 2IBKA 3RR8A 3PMLA 5KFWA 2YB4A 4J9OA 1WYGA 2F2AB 1ZQXA 3THVA 4IS7A 2AHOB 3ZI4A 2AGOA 4JWNA 3EYZA 2W9MA 3UQ0A 4BUGA 2KZ3A 3IG5A 3M6ZA 1VLBA 1ZJMA 7ICNA 2QB1A 3RAQA 4ZH4A 4OJOA 2KSOB 5KFTA 2IOFA 3TADA 2PMZF 2MUTB 2YMQA 4RZRA 3RJFA 4JMUA 4Y2PA 3DV9A 4ACOA 4UB1A 3H0RB 2Y1IA 5KT2A 9ICIA 1XO0A 4Y2UA 3RBDA 3JPSA 3KKAA 4QZ9A 4Q44A 4UB8U 2ZIVB 3GIMA 2MRLA 2GO7A 5KFQA 3T5JA 4ECZA 5C0YA 4YR2A 5AK5A 5AM1A 3WK9A 2HBJA 1SV4A 4YMOA 4KLFA 1V38A 2BPCA 2JRZA 3CW2C 3JPRA 4RQ0A 4C8OA 3A0HU 5EWEA 1B4FA 2E1FA 3WKEA 1MQ2A 2OEHA 2XC9A 2KZMA 1RYUA 2KSOA 1ZYQA 1Q46A 4UB4A 1U4BA 3ZD9A 3UPQA 3GFKB 3SI8A 3RB3A 3RB6A 2ZXHA 3HKZC 2YB1A 4ECWA 4HYKA 2ZIUB 4PZNA 1NKEA 2RDIA 2E8MA 4O5EA 3BDPA 2LM1A 1XNSA 4TUQA 1FEZA 5AI8A 3SQIA 3CNHA 4F5OA 4DFMA 2Q4TA 4R8UA 5GTIU 2YN4A 2JHDA 2BGWA 3TFSA 4P0PA 2DWQA 5B5EU 3RH4A 1ZQDA 4QJFB 2B0CA 1QQ5A 2R8IA 3IG8A 2CRXA 5KG1A 3BQTA 3RJIA 3IV6A 3FAHA 5J2FA 4DL4A 1SGGA 5ALJA 4ELVA 3ZDDA 4J9MA 3IRUA 3L4PA 1JIHA 3N7SC 3KHGA 4PPXA 9ICJA 5KNIA 4F50A 3KZIU 4O3MA 4B9VA 1ZQYA 2YMMA 3CP8A 3SR6A 4PZOA 4UBCA 3R9KA 1X9SA 3TFRA 1ZQOA 3OHBA 2XIDA 1MA7A 5TZVA 4Z6CA 1JN3A 1J2MA 1Q3VA 1L3VA 1N5XA 4QWAA 3ICXA 5KFUA 2VA2A 4RNOA 5J0WA 4UB5A 4KLGA 4NLGA 2DF4B 8ICXA 3ALRA 3QU9A 2VJ5A 5AKJA 1UA0A 5J2IA 2Y0SC 4B9MA 3D2SA 2D8CA 4F4YA 4LVSA 4I2DA 4O3NA 4EYIB 3Q8LA 1X9XA 2W7OA 2JH1A 3MGIA 2WTFA 1PK1B 9ICFA 3PX0A 2ES6A 3T5LA 1NJXA 1IXRA 3Q8KA 1Q8KA 3LDAA 3HKZF 4R66A 3PSIA 1WCLA 4ECYA 4MEYA 4O9MA 1Y88A 4PH5A 1ZRNA 4Z6FA 2VKQA 5CA7A 1ZQAA 1NK4A 4M2YA 4RQ1A 3QZ7A 5DLGA 3TADC 4IRKA 2XY7A 3HRDD 7ICKA 3GDXA 2AH5A 3ZDBA 5AIAA 4PGQA 1DGJA 1SB3C 2WB1C 3J81j 1NK9A 5KL1B 4KITB 2JEFA 1RQNA 1CI4A 3MABA 1ZQKA 2KOBA 1L8LA 2IOFK 2ALZA 4US9A 4ICAA 2W9BA 1SZHA 2W9BB 4Y2JA 3QUQA 3C2MA 3GILA 2DQNB 1NK0A 1LV5A 3NVVA 1QSSA 1JXLA 4FBUA 2ZIVA 4X5VA 1JMSA 2KHQA 4KN7A 3D6JA 3UM9A 4CNQA 1JROA 4OJPA 4P2HA 1V85A 4M47A 2W04A 5KFIA 1GO3F 1LVHA 1N63A 2FDRA 1ZJNA 4NL9A 3AEVA 3KFUF 4UBBA 1PUZA 2KK0A 4PGXA 5KT6A 5J2GA 2ZIWB 1ZQBA 2KEYA 3GV7B 3PY8A 1D9FA 2HHVA 2JZBA 1OUQA 4F4WA 4C4TA 1IG6A 2I9GA 4IQUA 1NNLA 2K4PA 1ZD4A 2EAOA 2LI6A 4C0ZA 4FFDA 1N48A 5AI9A 2KE7A 2G5IB 2HOFA 5J0YA 2PMZC 3QEAZ 5J2EA 5KFKA 4B9LA 3QUCA 2HI0A 3WKCA 3M8SA 4NLKA 3BQ1A 4BX9C 2OH2A 2HBKA 3AQEA 3KHLA 1FIQA 4HAIA 1YZ7A 5EE1A 3F2DA 9ICMA 2MUTA 4YXJA 4UW9A 4DQSA 2ZXIA 7ICFA 4DL2A 2A19A 3TACB 4RQ8A 3ED5A 1Z3EB 2WF5A 3PNCA 2ZG6A 8ICYA 4C8LA 8ICIA 2KJ9A 4KLMA 5AKLA 1ZQMA 2PFPA 1S9FA 4J9QA 4YMMA 3QU4A 2BR0A 3F5EA 1YT3A 1NKCA 2M0NA 3B0YA 4DFJA 2ZJAA 3RAXA 3RJKA 3SV4A 3DEEA 4I2HA 4YFKA 4RQ6A 3I28A 4YN4A 2F77X 2HHQA 7ICQA 1S0OA 1TV9A 8ICPA 1L7MA 1NI3A 2W11A 1ZD2P 1S97A 4C8NA 1KTQA 3G6YA 4YCXA 4FS2A 5KFGA 1KKXA 4DQQA 1PVQA 8ICRA 2YMPA 2MSNA 3QEBZ 5J2DA 1BPZA 4ECVA 2JH7A 3PSTA 4MF2A 2I5HA 3QUTA 2ZUBA 5A0LA 4I2EA 3HWTA 4J9NA 2ZJ5A 5AKHA 3V72A 2ASDA 3WKDA 2V4QA 2AGQA 2BZFA 3ETLA 5ALTA 2XICA 1ED1A 2PKEA 4TQRA 2YMLA 3WK7A 2BQ3A 3UXPA 4P0QA 4E0DA 2E1EA 2FJ6A 1SZPA 5ALUA 1O08A 3O0FA 2RLTA 2L5YA 1QQ6A 4KLTA 4DSIA 5DQGA 1MSWD 1X2IA 5ALFA 4CCHA 1TKDA 4QNLA 3E2EA 3JPOA 2PFNA 3LYSA 4PL2A 3D2NA 5KG6A 4R8UB 4EX7A 9ICWA 5BPCA 2C22A 2EZXA 9ICVA 5JRTA 1ZQZA 2P6UA 5IIKA 5TISU 3TI0A 5C5JA 3T5HA 3T3FA 1J2NA 3F2CA 4JV1A 3OJSA 2LKYA 2JEIA 4F3OA 5AM2A 5IINA 2FI1A 3SD7A 4O3QA 8ICKA 2BCVA 3BS5A 8ICJA 4IC9A 3OJUA 3GV5B 1RYSA 4QWBA 3ZDAA 4GXJA 3KHRA 1F44A 4NLCA 4DFPA 2LYBA 1UQVA 1ZQEA 4I27A 5EOZA 8ICEA 5AI6A 2F3NA 8ICUA 3Q8SB 1RXWA 2ATLA 4DSFA 5ALRA 8ICAA 2YY6A 3RJEA 4M9HA 2HDOA 2FPLA 2XO7A 1RZTA 5ALLA 2NO4A 4U7CA 4NM2A 3M8RA 1NZPA 3MGVA 3BJYA 1RYRA 5KG5A 3GIIA 5JTIA 1X42A 2VJ4A 4UAUA 4UATA 4B9TA 4UQGA 3NUQA 2R8HA 4IQTA 4EZ6A 3EPIA 4DQIA 1DK3A 2MAXA 3C2KA 5AI4A 3MFIA 4RQMA 3OPXA 4EELA 1ZQSA 3BS5B 5GTHU 1K1SA 5CP2A 1K5OA 3RH6A 2VA8A 3JPNA 4O0IA 4MFFA 1SV0A 2AJQA 2BKEA 4MEXA 4CF4A 3ISBA 4CRXA 1Z1VA 1DGSA 4QZFA 4MFCA 1S5LU 1S0MA 3F2BA 2M9NA 4P0QB 4DSKA 5AI5A 8ICHA 4DF4A 1S8OA 2W8KA 5KFYA 1FFVA 1JXEA 1DRGA 4BJQA 3G6VA 4ED7A 3HJEA 1L5UA 4ELTA 2W7PA 3PSPA 1ZQUA 4C7YA 3RRGA 7ICGA 1X9MA 3V7JA 3OGUA 3UXOA 3ISDA 4Z6DA 5CB1A 3SV3A 2Y1JA 4I28A 2QARB 3RRHA 4I2CA 1JI7A 5HHIA 4O3RA 4M9LA 1UHUA 1XWLA 4RT3A 1JRPA 1HUOA 4EX6A 2XGQA 2NYVA 4DF8A 3BZCA 8ICTA 4QZ8A 3SAGA 2VA3A 4QIWC 1ZQRA 1LB2B 4EEKA 3FYHA 5CWRA 4B9UA 5CRXA 1L8OA 4Y2VA 2AGPA 4CDGA 1ZQGA 3N7RC 2BCRA 4JB3A 3ZDEA 3IHQB 3VC8A 4J9LA 3C21A 4JK1A 3QX7A 1NK8A 1WUDA 4AYBF 2JGAA 2KICA 3QE9Y 2Z7JA 4B9NA 4EBDA 1MN8A 1U47A 1XS9D 3N97B 4C8KA 1HJPA 3PMNA 5KFAA 1U9LA 5IIJA 4OJLA 1XC9A 4IR9A 5ALHA 1UT8A 3EZ5A 2HHTA 2KFNA 2CPRA 1ZQIA 5CEHA 2KFZA 3Q8QB 1KFTA 3FDSA 4R65A 3B9JA 1L3SA 4JV2A 3H8SA 4Y2RA 5AKEA 2R8KA 1N5WA 1Z4NA 3C28A 2WF8A 4RPZA 5KG4A 2HVHA 3F53A 1WWUA 4CE6A 1C7YA 4TURA 3HT3A 1KW4A 3M1YA 5F3XB 3GIKA 3KOOA 2I6XA
chains in the Genus database with same CATH topology
2DUYA 4PJ0U 4UB8U 5H2FU 3WU2U 5B66U 5KAFU 5E79U 2AXTU 1S5LU 3KZIU 5KAIU 3A0BU 4UB6U 3A0HU 5TISU 5GTHU 5GTIU 5B5EU 4IL6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  4PJ0 U;  4UB8 U;  5H2F U;  3WU2 U;  5B66 U;  5KAF U;  5E79 U;  2AXT U;  1S5L U;  3KZI U;  5KAI U;  3A0B U;  4UB6 U;  3A0H U;  5TIS U;  5GTH U;  5GTI U;  5B5E U;  4IL6 U; 
#chains in the Genus database with same CATH topology
 2JZB B;  4RT2 A;  2G0A A;  4M6W A;  1BNO A;  5CR0 A;  3OSN A;  2AU0 A;  4BWJ A;  1NZB A;  5K4L A;  1SWW A;  1SV0 C;  5ALX A;  5J2A A;  5KT5 A;  1F5S A;  3A0B U;  1SXE A;  5AI0 A;  2N1R A;  1KSP A;  2G5H B;  5AM0 A;  5J2K A;  5ALQ A;  4DL6 A;  1QSL A;  5DLF A;  4QW8 A;  2XVT A;  4I2G A;  4ECT A;  2D6F C;  4Q8E A;  2H3V A;  2F8K A;  4I2J A;  4ED3 A;  4NWI A;  2J6S A;  2RRD A;  3MDA A;  3WK5 A;  3MR2 A;  8ICM A;  1HEK A;  4NJ8 A;  7ICT A;  3WK8 A;  4A8E A;  5KFD A;  8ICV A;  1ECW A;  5ALI A;  4Y2T A;  5J0P A;  4M6W B;  5KG0 A;  4RNN A;  2HBM A;  4NXZ A;  1TK5 A;  4KLI A;  4O3O A;  4ELU A;  2O6K A;  5D49 A;  3PX6 A;  2E3T A;  4EYH B;  4DL5 A;  7ICV A;  1JAL A;  3TAQ A;  3RTV A;  3QNM A;  2DKX A;  4RQ5 A;  5AK6 A;  3NS1 A;  1XO1 A;  5J0Q A;  4QW9 A;  1A76 A;  3SYZ A;  4I2B A;  8ICW A;  2K8A A;  3RBE A;  4NLZ A;  3SZ2 A;  2KJ8 A;  2EAN A;  4JUZ A;  3I1Y A;  2V4R A;  3WU2 U;  2H5X A;  8ICS A;  4C4S A;  2B21 A;  1ZQJ A;  2LYA A;  4EZ9 A;  5KFL A;  2OCE A;  1L7O A;  3LVW A;  1LKY B;  3KZX A;  1BPY A;  3BS7 A;  4YQW A;  1ZQN A;  3JPT A;  2JEG A;  4QWE A;  1BPB A;  4PHA A;  3QU7 A;  3WK6 A;  2B6G A;  2F1I A;  1TE2 A;  2HOQ A;  3FC4 A;  1ZXI A;  5DB9 A;  4K4G A;  4KLQ A;  5F9L A;  1L3T A;  4RQ7 A;  3Q8R B;  2QLT A;  1K1Q A;  3L5K A;  5J0R A;  5J8Y C;  1BPX A;  2E8O A;  1B22 A;  3S6J A;  4DSL A;  1QLN A;  1TVA A;  1ZRM A;  3SAH A;  2MU2 A;  2DL0 A;  3CRX A;  3HW8 A;  2JMG A;  2ZTE A;  1X6J A;  3RFA A;  5F9N A;  1QSY A;  5EWG A;  2KJ5 A;  2JXJ A;  2ZIX B;  2BCU A;  4QZE A;  3TQ1 A;  4UAY A;  5J8Y A;  4ED8 A;  4DS5 A;  3PW4 A;  4KLU A;  2MA1 A;  3TAR A;  2A1J A;  4IR1 A;  4C8M A;  5AKX A;  2C2D A;  1OXJ A;  2WF6 A;  5KT4 A;  2AQ4 A;  1RPL A;  1BGX T;  4QZD A;  4RU9 A;  4ED1 A;  5T14 A;  4PHP A;  1NJW A;  4EBC A;  1S77 D;  4F4Z A;  4PGY A;  1X40 A;  1WWV A;  3MBY A;  2NRT A;  5HNK A;  2JR5 A;  3EPG A;  4Y2X A;  5JU5 A;  5DB6 A;  4O5C A;  2NRW A;  1U48 A;  3RH5 A;  4UAZ A;  2WFA A;  2G07 A;  3PW5 A;  3BQ2 A;  1T4G A;  2FMP A;  2EQY A;  2HMX A;  1YZ6 A;  3RB0 A;  1WG8 A;  1L7N A;  2QKQ A;  5KFN A;  3PW0 A;  4AYB C;  1S10 A;  2IMW P;  2LMR A;  4YR3 A;  2F1H A;  4DCC A;  4P4P A;  2BCQ A;  2K60 A;  3QXG A;  3NTU A;  4K4H A;  3ONN A;  3RJJ A;  4GFJ A;  1CRX A;  1COO A;  2BPF A;  7ICL A;  1X9W A;  4UAW A;  2C2R A;  2F8L A;  2KMD A;  4YP3 A;  4JWM A;  4LZD A;  3HP6 A;  3UMC A;  2FPK A;  5J0T A;  1SKR A;  2KV2 A;  9ICQ A;  2EZY A;  1L7P A;  4I2F A;  3UMG A;  4G9B A;  2K4I A;  1KRP A;  2E5S A;  2KP7 A;  1J97 A;  1SL2 A;  3K1R B;  1B0X A;  3KD3 A;  1N56 A;  1ZQT A;  4I2A A;  4GC7 A;  2W9C B;  5AKI A;  2G08 A;  2W9C A;  4KLD A;  2WF9 A;  4YXM A;  5IIO A;  2LPE A;  1ZET A;  4DEZ A;  2WB1 F;  3M7D A;  2W9A A;  4QIW F;  3E0F A;  1QTM A;  4PJ0 U;  5AKK A;  4QZB A;  2IA6 A;  1UA1 A;  1ZQF A;  2J6T A;  2HSZ A;  2R8J A;  1UT5 A;  2XCA A;  1SKW A;  2NO5 A;  3KHH A;  3V7L A;  2BHN A;  3CYM A;  2XY5 A;  5L1M A;  5L1K A;  4KLL A;  8ICL A;  3PO5 A;  3TAN A;  2ZIX A;  4KMO B;  4UAR A;  5ALY A;  4DLG A;  9ICR A;  3GZF A;  3PR4 A;  2BDU A;  9ICS A;  4OJ5 A;  4ECU A;  1UPH A;  4ZOH C;  2UVR A;  2AXT U;  2DBY A;  1XSP A;  1ZQQ A;  4ECQ A;  5ALS A;  5FP0 A;  5ALW A;  2H3Z A;  2BCS A;  3H0M B;  2H3Q A;  2K8B B;  3V6K A;  2P6R A;  3V7K A;  4B9S A;  5KFC A;  4BWM A;  2W03 A;  3RF9 A;  3OSP A;  2DFL A;  1XSL A;  3TAP A;  5DGA A;  3M9O B;  2JEJ A;  4FBT A;  2ISP A;  2P66 A;  9ICU A;  3BQ7 A;  4BGD A;  1TAU A;  4IQV A;  1Q3U A;  1EXN A;  5D4B A;  3NVW A;  2H3F A;  2VAN A;  3VCB A;  3TKA A;  2C2E A;  4FZN A;  7ICJ A;  1PVP A;  3B0X A;  2CXY A;  1IIP A;  3C5G A;  4J9S A;  3OTQ A;  4J03 A;  3H4B A;  5KL8 B;  1WCN A;  1SL1 A;  3AMZ A;  1T3Q A;  2KIW A;  4DFK A;  5ALV A;  5KFR A;  5ALO A;  4CF3 A;  3RJG A;  5HML A;  3NGD A;  3JPQ A;  1NJZ A;  4KLO A;  2CN1 A;  4RUC A;  4CGZ A;  3NRZ A;  1TAQ A;  3PVX A;  2FPM A;  3EUB 2;  3M9M B;  5ALN A;  5KFM A;  2Y0S F;  4GXI A;  4FZL A;  9ICT A;  4KLE A;  4ED2 A;  5G5H A;  3LWM A;  2FMS A;  1PK1 A;  9ICK A;  2W54 A;  2NRX A;  1JUD A;  2OXO A;  3AU6 A;  2DKZ A;  3RJH A;  2OYY A;  4G3I A;  3L3F X;  4XUS A;  2PI5 A;  1T8E A;  4M9J A;  7ICE A;  3NVZ A;  5AK3 A;  1SWV A;  4YR0 A;  4R63 A;  8ICN A;  4F5P A;  1N62 A;  3C2L A;  2R18 A;  3MR6 A;  5EWF A;  1KLN A;  3WKB A;  4LZG A;  3ZD8 A;  4F2R A;  9ICH A;  2HHX A;  1Z00 B;  1TK0 A;  2W3R A;  4YD1 A;  8ICQ A;  4TUS A;  1ZD5 A;  2PFO A;  4DOC A;  4NM1 A;  2P35 A;  2DUY A;  3M6K A;  1PVR A;  3F5A A;  7ICP A;  3IN5 A;  4BDP A;  3WK4 A;  1UCV A;  3RB4 A;  5AM5 A;  2BQU A;  7ICR A;  4F5N A;  2QB0 A;  3H4D A;  2K4E A;  2EDU A;  4FE3 A;  2UVW A;  1L3U A;  5EE0 A;  1A6S A;  3V6J A;  4IRD A;  4AP9 A;  4DO9 A;  1KQQ A;  4Y2Q A;  1TK8 A;  4DSE A;  5J0S A;  2ZTD A;  4F71 A;  3C1Z A;  1M6Y A;  4PHD A;  1N61 A;  5CHG A;  3MR5 A;  3EWA A;  3H0L B;  4EBE A;  5ALZ A;  5B66 U;  5KFB A;  4DL7 A;  4EEY A;  5KT7 A;  2OM6 A;  3QZ8 A;  3MGH A;  2VIX A;  3H8J A;  3U26 A;  1SXD A;  3K4G A;  2C28 A;  4C4R A;  1DXS A;  3ISC A;  3NRW A;  1BNP A;  7ICM A;  4KN4 A;  5DB8 A;  1RG6 A;  2F1J A;  4BXO B;  1URJ A;  4M0A A;  9ICA A;  3PW7 A;  4KLJ A;  2QAR A;  7ICH A;  5DB7 A;  5AIC A;  3UQ2 A;  2LBO A;  3DDH A;  4NV0 A;  4KMU A;  4DFD A;  4ECX A;  1BVS A;  5J2B A;  4F5Q A;  4J9P A;  1KDH A;  3NAS A;  5BOM A;  2RHF A;  5KFO A;  4RQ2 A;  2NV3 A;  2KVS A;  8ICF A;  5DBB A;  2D3D A;  2XCP A;  2EZZ A;  2KG5 A;  3T5K A;  2HW3 A;  4RQN A;  2K8C B;  4GLX A;  8ICZ A;  5CJ7 A;  2ZTC A;  4QZH A;  5DDY A;  1D9D A;  4BXO A;  1B43 A;  3N4M B;  3H8W A;  2A1A A;  4US8 A;  5JUM A;  2LYH A;  3Q8P B;  3M9N B;  4OCZ A;  3KTQ A;  7ICS A;  1KEJ A;  2RDJ A;  4OO1 J;  3UXN A;  5G5G A;  1HIW A;  1DK2 A;  9ICC A;  5DGB A;  2ZIU A;  4XRH A;  1NK5 A;  4DL3 A;  1SIJ A;  5J0X A;  3PW2 A;  4F4X A;  9ICO A;  1U45 A;  2PFQ A;  5ALD A;  3OHA A;  1ZQH A;  2BPG A;  4QWC A;  1QCK A;  5KFE A;  1PK3 A;  4F93 B;  2NRV A;  2W8L A;  3BZK A;  2GWS A;  4NL9 C;  3ORY A;  5J2H A;  1U49 A;  4GC6 A;  4DQP A;  1S0V A;  2KNJ A;  2KVC A;  1ZQC A;  3SAF A;  5IIL A;  4M04 A;  3QU5 A;  1D8Y A;  4O3S A;  3WKA A;  1NKB A;  2LHT A;  2WHE A;  2FMQ A;  4F4K A;  3RR7 A;  4Q43 A;  4KTQ A;  8ICO A;  2PXI A;  5DBC A;  2WF7 A;  1JX4 A;  2KKV A;  3UMB A;  4KLS A;  1ZQW A;  2EH9 A;  5KG3 A;  1T3N A;  1T7P A;  4DQR A;  4UAV A;  9ICP A;  2RQ5 A;  3AM9 A;  3QU2 A;  2Y9T A;  7ICO A;  2HOI A;  4YG2 A;  5HR6 A;  1SKS A;  5EE3 A;  4I2I A;  2K89 A;  2YTU A;  3C1Y A;  5III A;  1VJ5 A;  1BPE A;  5J0O A;  1D8L A;  3GQC A;  1V97 A;  1RQL A;  3SMV A;  1HUZ A;  3T79 A;  5ALM A;  4OD0 A;  3IM1 A;  4YD2 A;  2FLP A;  1ZQ1 C;  1IV8 A;  5KG7 A;  2JV3 A;  5AIB A;  2Y9U A;  3IDW A;  1DOQ A;  5KFP A;  4ECR A;  4IL6 U;  5BOL A;  9ICE A;  2HHU A;  2HBL A;  4RUA A;  3N7P D;  5ALP A;  3AL0 B;  1LKY A;  2KN7 A;  5DG8 A;  2A1J B;  4K4I A;  9ICN A;  4QZC A;  4J9K A;  4DWI A;  4QZG A;  4M9G A;  3AQF A;  2EAM A;  1IM4 A;  4YMN A;  2R8G A;  3NVY A;  3LK9 A;  4YVZ A;  3H8M A;  8ICG A;  4DSJ A;  9ICL A;  1X66 A;  1MQ3 A;  5L1J A;  3AU2 A;  5J2J A;  2Q0Z X;  5AM4 A;  1D8B A;  5KFS A;  4DS4 A;  1MC8 A;  3I76 A;  4RQ4 A;  4MHV A;  4KX5 A;  4CF5 A;  5L1I A;  2A3V A;  1VDV A;  2I1Q A;  1KFD A;  3PSF A;  4F92 B;  2FLL A;  3D2Q A;  3QYP A;  2KIV A;  2H3I A;  3PO4 A;  4MFA A;  3MFH A;  1N2X A;  8ICB A;  5HR7 A;  1COK A;  5J0U A;  4QZI A;  2ESE A;  2GLE A;  3QUB A;  9ICB A;  1XU4 A;  5KAI U;  5J2C A;  5KT3 A;  2XY6 A;  3GIJ A;  5DG7 A;  4EEN A;  4NY8 A;  1ZD3 A;  4Y2S A;  3AUO A;  5HMM A;  3C29 A;  5EE9 A;  2BQR A;  1S0N A;  1KFS A;  4R64 A;  2WAQ F;  3KBB A;  2OHF A;  1X6I A;  3PV8 A;  5KG2 A;  2NRZ A;  4LJX A;  4P4M A;  4XQ8 A;  2K4H A;  4OJ6 A;  3BQ0 A;  2F76 X;  5L9X A;  4F8R A;  2W43 A;  5IIM A;  1RXV A;  2XGP A;  2XI9 A;  3EW9 A;  4B6J A;  1Z00 A;  4PL1 A;  4GXK A;  4J9R A;  1NJY A;  1RM6 C;  3IP4 B;  2ASL A;  2ISO A;  2HHW A;  1ZQP A;  1NK7 A;  2UVU A;  3ETR A;  5D46 A;  4O3P A;  3H40 A;  2ZIW A;  2ZUD A;  2E8N A;  1V9P A;  2HHS A;  4NLB A;  3JPP A;  5ALE A;  3H7I A;  4RPY A;  2ZUC A;  3Q8M A;  4RPX A;  1T94 A;  4Q45 A;  5AHX A;  1A0P A;  5E79 U;  3HIL A;  5KFV A;  1A77 A;  1ZQV A;  9ICX A;  2FE9 A;  3MDC A;  4F91 B;  5J29 A;  1KN5 A;  1TAM A;  2FLN A;  4IQW A;  1OW5 A;  2YX8 A;  5DKW A;  4TQS A;  1SL0 A;  4P4O A;  4Z6E A;  2AQ0 A;  1NK6 A;  5AM3 A;  2KZZ A;  4KLH A;  1NOM A;  2ODG A;  1ZOL A;  4KX3 A;  2ZJ8 A;  4RNM A;  2W3S A;  3E58 A;  4IRC A;  1Z1B A;  4ED6 A;  4O5K A;  1PZN A;  3KKA C;  4ECS A;  3V6H A;  3PZP A;  5DQI A;  2DGZ A;  1O03 A;  5L1L A;  5ALK A;  2KKP A;  1ARO P;  1CUK A;  4FS1 A;  4PHE A;  2RP5 A;  1KBU A;  2ASJ A;  1BPD A;  2HCF A;  3N28 A;  1FO4 A;  1AQ6 A;  3PX4 A;  4JV0 A;  3GV8 B;  2WAQ C;  5DDM A;  2E8P A;  4UB6 U;  5AKG A;  3PR5 B;  7ICU A;  4ED0 A;  2GH1 A;  2KTQ A;  4F72 A;  5AKZ A;  1KL9 A;  4XA5 A;  5HHH A;  4USA A;  4C7Z A;  2G09 A;  2GOL A;  1FFU A;  5ALG A;  4F5R A;  4FO6 A;  4C80 A;  4DOA A;  1CEZ A;  2HVI A;  9ICG A;  2IHN A;  4TUP A;  3SEI A;  4RQ3 A;  2G06 A;  3AN1 A;  5KAF U;  1N60 A;  4F2S A;  2EAP A;  1H38 A;  4U6P A;  5HP4 A;  5KFZ A;  1C20 A;  8ICC A;  4DLE A;  2OWO A;  2BDP A;  5KFJ A;  4NLN A;  5KFF A;  3GU3 A;  5AKY A;  5KFX A;  1Z19 A;  5AK4 A;  4WJ3 B;  4M9N A;  4Y2Y A;  4Q8F A;  3HX0 A;  1ZQL A;  4UB2 A;  4QWD A;  3G6X A;  1L6N A;  3K1Z A;  3C23 A;  4QZA A;  2QB0 B;  2UVV A;  1XSN A;  3FM9 A;  4FZM A;  2IOH A;  2KHV A;  7ICI A;  1Z4O A;  5DQH A;  2DPJ A;  1TFR A;  3SEN A;  4UAS A;  4I29 A;  1RDF A;  1QQ7 A;  5KFH A;  2YQE A;  3MC1 A;  4MF8 A;  2KD1 A;  3ZDC A;  5KTQ A;  2LM4 A;  3HPO A;  1P7D A;  2IHM A;  2F44 A;  5DG9 A;  5H2F U;  3LWL A;  3LVV A;  3MR3 A;  1QH9 A;  1F0M A;  2V9W A;  5DBA A;  3C5F A;  2DPI A;  4P0P B;  2J6U A;  1S76 D;  2PI4 A;  2W55 A;  4UB3 A;  4DOB A;  3K75 D;  4GIB A;  2IBK A;  3RR8 A;  3PML A;  5KFW A;  2YB4 A;  4J9O A;  1WYG A;  2F2A B;  1ZQX A;  3THV A;  4IS7 A;  2AHO B;  3ZI4 A;  2AGO A;  4JWN A;  3EYZ A;  2W9M A;  3UQ0 A;  4BUG A;  2KZ3 A;  3IG5 A;  3M6Z A;  1VLB A;  1ZJM A;  7ICN A;  2QB1 A;  3RAQ A;  4ZH4 A;  4OJO A;  2KSO B;  5KFT A;  2IOF A;  3TAD A;  2PMZ F;  2MUT B;  2YMQ A;  4RZR A;  3RJF A;  4JMU A;  4Y2P A;  3DV9 A;  4ACO A;  4UB1 A;  3H0R B;  2Y1I A;  5KT2 A;  9ICI A;  1XO0 A;  4Y2U A;  3RBD A;  3JPS A;  3KKA A;  4QZ9 A;  4Q44 A;  4UB8 U;  2ZIV B;  3GIM A;  2MRL A;  2GO7 A;  5KFQ A;  3T5J A;  4ECZ A;  5C0Y A;  4YR2 A;  5AK5 A;  5AM1 A;  3WK9 A;  2HBJ A;  1SV4 A;  4YMO A;  4KLF A;  1V38 A;  2BPC A;  2JRZ A;  3CW2 C;  3JPR A;  4RQ0 A;  4C8O A;  3A0H U;  5EWE A;  1B4F A;  2E1F A;  3WKE A;  1MQ2 A;  2OEH A;  2XC9 A;  2KZM A;  1RYU A;  2KSO A;  1ZYQ A;  1Q46 A;  4UB4 A;  1U4B A;  3ZD9 A;  3UPQ A;  3GFK B;  3SI8 A;  3RB3 A;  3RB6 A;  2ZXH A;  3HKZ C;  2YB1 A;  4ECW A;  4HYK A;  2ZIU B;  4PZN A;  1NKE A;  2RDI A;  2E8M A;  4O5E A;  3BDP A;  2LM1 A;  1XNS A;  4TUQ A;  1FEZ A;  5AI8 A;  3SQI A;  3CNH A;  4F5O A;  4DFM A;  2Q4T A;  4R8U A;  5GTI U;  2YN4 A;  2JHD A;  2BGW A;  3TFS A;  4P0P A;  2DWQ A;  5B5E U;  3RH4 A;  1ZQD A;  4QJF B;  2B0C A;  1QQ5 A;  2R8I A;  3IG8 A;  2CRX A;  5KG1 A;  3BQT A;  3RJI A;  3IV6 A;  3FAH A;  5J2F A;  4DL4 A;  1SGG A;  5ALJ A;  4ELV A;  3ZDD A;  4J9M A;  3IRU A;  3L4P A;  1JIH A;  3N7S C;  3KHG A;  4PPX A;  9ICJ A;  5KNI A;  4F50 A;  3KZI U;  4O3M A;  4B9V A;  1ZQY A;  2YMM A;  3CP8 A;  3SR6 A;  4PZO A;  4UBC A;  3R9K A;  1X9S A;  3TFR A;  1ZQO A;  3OHB A;  2XID A;  1MA7 A;  5TZV A;  4Z6C A;  1JN3 A;  1J2M A;  1Q3V A;  1L3V A;  1N5X A;  4QWA A;  3ICX A;  5KFU A;  2VA2 A;  4RNO A;  5J0W A;  4UB5 A;  4KLG A;  4NLG A;  2DF4 B;  8ICX A;  3ALR A;  3QU9 A;  2VJ5 A;  5AKJ A;  1UA0 A;  5J2I A;  2Y0S C;  4B9M A;  3D2S A;  2D8C A;  4F4Y A;  4LVS A;  4I2D A;  4O3N A;  4EYI B;  3Q8L A;  1X9X A;  2W7O A;  2JH1 A;  3MGI A;  2WTF A;  1PK1 B;  9ICF A;  3PX0 A;  2ES6 A;  3T5L A;  1NJX A;  1IXR A;  3Q8K A;  1Q8K A;  3LDA A;  3HKZ F;  4R66 A;  3PSI A;  1WCL A;  4ECY A;  4MEY A;  4O9M A;  1Y88 A;  4PH5 A;  1ZRN A;  4Z6F A;  2VKQ A;  5CA7 A;  1ZQA A;  1NK4 A;  4M2Y A;  4RQ1 A;  3QZ7 A;  5DLG A;  3TAD C;  4IRK A;  2XY7 A;  3HRD D;  7ICK A;  3GDX A;  2AH5 A;  3ZDB A;  5AIA A;  4PGQ A;  1DGJ A;  1SB3 C;  2WB1 C;  3J81 j;  1NK9 A;  5KL1 B;  4KIT B;  2JEF A;  1RQN A;  1CI4 A;  3MAB A;  1ZQK A;  2KOB A;  1L8L A;  2IOF K;  2ALZ A;  4US9 A;  4ICA A;  2W9B A;  1SZH A;  2W9B B;  4Y2J A;  3QUQ A;  3C2M A;  3GIL A;  2DQN B;  1NK0 A;  1LV5 A;  3NVV A;  1QSS A;  1JXL A;  4FBU A;  2ZIV A;  4X5V A;  1JMS A;  2KHQ A;  4KN7 A;  3D6J A;  3UM9 A;  4CNQ A;  1JRO A;  4OJP A;  4P2H A;  1V85 A;  4M47 A;  2W04 A;  5KFI A;  1GO3 F;  1LVH A;  1N63 A;  2FDR A;  1ZJN A;  4NL9 A;  3AEV A;  3KFU F;  4UBB A;  1PUZ A;  2KK0 A;  4PGX A;  5KT6 A;  5J2G A;  2ZIW B;  1ZQB A;  2KEY A;  3GV7 B;  3PY8 A;  1D9F A;  2HHV A;  2JZB A;  1OUQ A;  4F4W A;  4C4T A;  1IG6 A;  2I9G A;  4IQU A;  1NNL A;  2K4P A;  1ZD4 A;  2EAO A;  2LI6 A;  4C0Z A;  4FFD A;  1N48 A;  5AI9 A;  2KE7 A;  2G5I B;  2HOF A;  5J0Y A;  2PMZ C;  3QEA Z;  5J2E A;  5KFK A;  4B9L A;  3QUC A;  2HI0 A;  3WKC A;  3M8S A;  4NLK A;  3BQ1 A;  4BX9 C;  2OH2 A;  2HBK A;  3AQE A;  3KHL A;  1FIQ A;  4HAI A;  1YZ7 A;  5EE1 A;  3F2D A;  9ICM A;  2MUT A;  4YXJ A;  4UW9 A;  4DQS A;  2ZXI A;  7ICF A;  4DL2 A;  2A19 A;  3TAC B;  4RQ8 A;  3ED5 A;  1Z3E B;  2WF5 A;  3PNC A;  2ZG6 A;  8ICY A;  4C8L A;  8ICI A;  2KJ9 A;  4KLM A;  5AKL A;  1ZQM A;  2PFP A;  1S9F A;  4J9Q A;  4YMM A;  3QU4 A;  2BR0 A;  3F5E A;  1YT3 A;  1NKC A;  2M0N A;  3B0Y A;  4DFJ A;  2ZJA A;  3RAX A;  3RJK A;  3SV4 A;  3DEE A;  4I2H A;  4YFK A;  4RQ6 A;  3I28 A;  4YN4 A;  2F77 X;  2HHQ A;  7ICQ A;  1S0O A;  1TV9 A;  8ICP A;  1L7M A;  1NI3 A;  2W11 A;  1ZD2 P;  1S97 A;  4C8N A;  1KTQ A;  3G6Y A;  4YCX A;  4FS2 A;  5KFG A;  1KKX A;  4DQQ A;  1PVQ A;  8ICR A;  2YMP A;  2MSN A;  3QEB Z;  5J2D A;  1BPZ A;  4ECV A;  2JH7 A;  3PST A;  4MF2 A;  2I5H A;  3QUT A;  2ZUB A;  5A0L A;  4I2E A;  3HWT A;  4J9N A;  2ZJ5 A;  5AKH A;  3V72 A;  2ASD A;  3WKD A;  2V4Q A;  2AGQ A;  2BZF A;  3ETL A;  5ALT A;  2XIC A;  1ED1 A;  2PKE A;  4TQR A;  2YML A;  3WK7 A;  2BQ3 A;  3UXP A;  4P0Q A;  4E0D A;  2E1E A;  2FJ6 A;  1SZP A;  5ALU A;  1O08 A;  3O0F A;  2RLT A;  2L5Y A;  1QQ6 A;  4KLT A;  4DSI A;  5DQG A;  1MSW D;  1X2I A;  5ALF A;  4CCH A;  1TKD A;  4QNL A;  3E2E A;  3JPO A;  2PFN A;  3LYS A;  4PL2 A;  3D2N A;  5KG6 A;  4R8U B;  4EX7 A;  9ICW A;  5BPC A;  2C22 A;  2EZX A;  9ICV A;  5JRT A;  1ZQZ A;  2P6U A;  5IIK A;  5TIS U;  3TI0 A;  5C5J A;  3T5H A;  3T3F A;  1J2N A;  3F2C A;  4JV1 A;  3OJS A;  2LKY A;  2JEI A;  4F3O A;  5AM2 A;  5IIN A;  2FI1 A;  3SD7 A;  4O3Q A;  8ICK A;  2BCV A;  3BS5 A;  8ICJ A;  4IC9 A;  3OJU A;  3GV5 B;  1RYS A;  4QWB A;  3ZDA A;  4GXJ A;  3KHR A;  1F44 A;  4NLC A;  4DFP A;  2LYB A;  1UQV A;  1ZQE A;  4I27 A;  5EOZ A;  8ICE A;  5AI6 A;  2F3N A;  8ICU A;  3Q8S B;  1RXW A;  2ATL A;  4DSF A;  5ALR A;  8ICA A;  2YY6 A;  3RJE A;  4M9H A;  2HDO A;  2FPL A;  2XO7 A;  1RZT A;  5ALL A;  2NO4 A;  4U7C A;  4NM2 A;  3M8R A;  1NZP A;  3MGV A;  3BJY A;  1RYR A;  5KG5 A;  3GII A;  5JTI A;  1X42 A;  2VJ4 A;  4UAU A;  4UAT A;  4B9T A;  4UQG A;  3NUQ A;  2R8H A;  4IQT A;  4EZ6 A;  3EPI A;  4DQI A;  1DK3 A;  2MAX A;  3C2K A;  5AI4 A;  3MFI A;  4RQM A;  3OPX A;  4EEL A;  1ZQS A;  3BS5 B;  5GTH U;  1K1S A;  5CP2 A;  1K5O A;  3RH6 A;  2VA8 A;  3JPN A;  4O0I A;  4MFF A;  1SV0 A;  2AJQ A;  2BKE A;  4MEX A;  4CF4 A;  3ISB A;  4CRX A;  1Z1V A;  1DGS A;  4QZF A;  4MFC A;  1S5L U;  1S0M A;  3F2B A;  2M9N A;  4P0Q B;  4DSK A;  5AI5 A;  8ICH A;  4DF4 A;  1S8O A;  2W8K A;  5KFY A;  1FFV A;  1JXE A;  1DRG A;  4BJQ A;  3G6V A;  4ED7 A;  3HJE A;  1L5U A;  4ELT A;  2W7P A;  3PSP A;  1ZQU A;  4C7Y A;  3RRG A;  7ICG A;  1X9M A;  3V7J A;  3OGU A;  3UXO A;  3ISD A;  4Z6D A;  5CB1 A;  3SV3 A;  2Y1J A;  4I28 A;  2QAR B;  3RRH A;  4I2C A;  1JI7 A;  5HHI A;  4O3R A;  4M9L A;  1UHU A;  1XWL A;  4RT3 A;  1JRP A;  1HUO A;  4EX6 A;  2XGQ A;  2NYV A;  4DF8 A;  3BZC A;  8ICT A;  4QZ8 A;  3SAG A;  2VA3 A;  4QIW C;  1ZQR A;  1LB2 B;  4EEK A;  3FYH A;  5CWR A;  4B9U A;  5CRX A;  1L8O A;  4Y2V A;  2AGP A;  4CDG A;  1ZQG A;  3N7R C;  2BCR A;  4JB3 A;  3ZDE A;  3IHQ B;  3VC8 A;  4J9L A;  3C21 A;  4JK1 A;  3QX7 A;  1NK8 A;  1WUD A;  4AYB F;  2JGA A;  2KIC A;  3QE9 Y;  2Z7J A;  4B9N A;  4EBD A;  1MN8 A;  1U47 A;  1XS9 D;  3N97 B;  4C8K A;  1HJP A;  3PMN A;  5KFA A;  1U9L A;  5IIJ A;  4OJL A;  1XC9 A;  4IR9 A;  5ALH A;  1UT8 A;  3EZ5 A;  2HHT A;  2KFN A;  2CPR A;  1ZQI A;  5CEH A;  2KFZ A;  3Q8Q B;  1KFT A;  3FDS A;  4R65 A;  3B9J A;  1L3S A;  4JV2 A;  3H8S A;  4Y2R A;  5AKE A;  2R8K A;  1N5W A;  1Z4N A;  3C28 A;  2WF8 A;  4RPZ A;  5KG4 A;  2HVH A;  3F53 A;  1WWU A;  4CE6 A;  1C7Y A;  4TUR A;  3HT3 A;  1KW4 A;  3M1Y A;  5F3X B;  3GIK A;  3KOO A;  2I6X A; 
#chains in the Genus database with same CATH homology
 2DUY A;  4PJ0 U;  4UB8 U;  5H2F U;  3WU2 U;  5B66 U;  5KAF U;  5E79 U;  2AXT U;  1S5L U;  3KZI U;  5KAI U;  3A0B U;  4UB6 U;  3A0H U;  5TIS U;  5GTH U;  5GTI U;  5B5E U;  4IL6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...