5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
2HCBA 3AECB 1FNMA 1ZNZA 3TW4A 2ZIAA 3GJ3A 4B2PA 4DXAA 4BFTA 5LB2A 2VHJA 3UATA 1DAKA 5HPYB 1G7RA 4DDVA 4CVNA 3AE2B 5GVRA 4C4PA 4D80A 4TL7A 3KQHA 1A1VA 1TEXA 2FF7A 4S35A 3TAUA 3P1JA 1KK0A 3LO5A 2MJEA 2O0KA 4M9QA 4OI2A 1ETUA 1Z2AA 4C0AC 2BMJA 1MR3F 3RVBA 4OHVA 3QKRA 1L7VC 4TMTA 1BMFA 2ZE8A 4JVLA 3LX5A 2EQBA 2JAQA 4C0QC 2BS2B 3GLGA 4XSHA 3IIKA 3NTUA 4A4DA 3TLXA 5K8LA 5TARA 2O0HA 3AF3A 3IO5A 1Q44A 3C8UA 2Q0HA 2ZRJA 2XB2A 2NQ2C 5F3WB 1RE0A 3LA6A 4B44A 3GLHE 3SEAA 1N5IA 2F43B 5TB5A 3AM1A 4OQLA 1M6NA 2FJUA 3LQQA 3WYFA 1Q1BA 5L3SA 3TH5A 3WMFA 2DY1A 2FSGA 3BFXA 3REFA 3FKSD 1Q3TA 1XD8A 1TF5A 1PZNA 4M53A 1Q12A 3R7WA 2EWWA 5DLQC 1F48A 3QF4B 1W49A 4CEJB 4JL5A 4M4SA 4D81A 2NZ8A 4ARZA 2H92A 4JVSB 4MRSA 3TBKA 4QHSA 4NU0A 4I81A 3U60B 1GKIA 1SZPA 2ERXA 3DPUA 4FD2A 1L2TA 3AEGB 1GZSA 2IK8A 1UBGA 4ZCIA 1J70A 5HKKD 5EQTA 5B64A 2KWIA 4XWKA 3GJ7A 4KVGA 1VIAA 1HT2E 1QOFA 1KJYA 2QAGA 2GVZC 5FL7A 3QXJA 2XTNA 1KKMA 5DN6D 1KI8A 2M19A 2R62A 3HP1A 4UJ3A 2XXAB 4AI6A 1UKZA 4FMDB 3SNHA 4QKQA 2EFGA 2O8EA 4S2EA 2HXSA 2MJDA 3HRDD 1N5WA 2JLXA 3GJ6A 2ZANA 1RYFA 3EARA 3ETRA 1OXXK 4TLDA 3ZVMA 1KSHA 4ITRC 4JLPA 4TWZA 1XP8A 4H9GA 3T15A 4ARZB 2QPOA 4TTPA 3AVYA 1YU9A 3P20A 3RS5A 5IDVA 1RVDA 4BECA 3PUVA 3VR8B 2X19A 4MUBA 4WXRA 1DO2A 5FOWA 3UWOA 3KQUA 2J0QA 4B47A 1ZIOA 1FXAA 4KCGA 1N6PA 4TMZA 4W5WA 4CDGA 1Z63A 1SXJD 1P2VA 4GMXA 2RGCA 1NMYA 2W3SA 2IYLD 2ZJBA 3ETLA 4QGGA 5G5GA 3ZGXA 1TAGA 4V0MA 1E2PA 3C16C 4JYCA 5JEEA 4HAUA 1D9XA 3K9HA 2X2FA 4HRSA 2HF8A 3CWIA 1G8GA 1VYUA 5SZIA 3VR2A 2V6JA 3P63A 1F3OA 2NO9A 3RRMA 4BGDA 5F9FA 1P2TA 3Q7QA 1MO6A 4HEJA 1FZQA 5FBRB 3LBHA 1XLPA 3EUB2 5FBWB 5CDFE 2REOA 5DNYB 3AVPA 1W47A 1N5XA 2IXGA 2ZUBA 3NBZC 3L43A 1E2QA 3TK1A 3KUDA 2ONKA 3C4JA 1XZQA 1JQLB 1G41A 4HUQA 4M9ZA 2R6CA 1EESA 4KFTA 2Q9BA 3EPHA 2WWFA 2D7CA 1VDVA 1QZXA 3W3AA 4I1VA 4EQ6A 2ZE6A 4G1UC 3W6OA 3VU9A 4Q1BA 1YZQA 1E0JA 3U44B 5JCZA 2ZSAA 2KE5A 4IOLA 4BE7B 1KK1A 4NCJA 1GRQA 3H0KA 5J47A 4HROA 5HTKA 1U0HC 2OESA 1HH4A 4DZZA 2ZSEA 2RHDA 3IEUA 3RAPR 1OQQA 1WWTA 3FC4A 3GFTA 1NIJA 4MYTA 2AR7A 2EW1A 3AE8B 1OXTA 2QTHA 2GJSA 4PZZA 1WP9A 4JLNA 3CR7A 4BZQA 1KI9A 3EC1A 3CNLA 2DWOA 2RGDA 5L3QB 4KFSA 3Q8XB 3AGPA 1GOTA 2PLFA 1FXIA 4B2LA 2H18A 2RGNA 2XZLA 1Q57A 2JJ8A 1UBFA 4KODA 3B9JA 1JXOA 2XNDD 1VECA 2YNMA 3PUXA 3I72A 4ZIRA 1A2BA 2YOFA 1JW9D 3TQFA 4LRWA 1E3MA 3CX6A 4Q4JB 4P4UA 4D26A 3MUFA 3KKQA 1U9IA 2H89B 3HWSA 4ZPXA 4A9AA 1NEKB 3S1AA 5CYOA 2DPXA 2F1RA 4CYMA 2ZRBA 4TMVA 4BWYA 2OBLA 1YHNA 3AVWA 2O8DB 2QGZA 3WBJA 4MITA 3Q85A 1N0UA 2D2EA 2W2VA 1GL9B 5C18A 5JI3E 1EFTA 2QMOA 5UKDA 3NIBA 4Q4AB 1DAFA 1A7JA 1QG4A 2ZR9A 4B2IA 1OLOA 2JLSA 3EWSA 4KITB 1P62B 3P4QB 1T3HA 4AWXA 3B5JA 1XO3A 4KX6B 3VR9B 1DOAA 5E3HA 4Z1MA 4P3YA 4QM6A 1SVIA 3KZ1E 4NBSA 1E2EA 1R7RA 2I1QA 3HYTA 5FOXA 3A4MA 4F4JA 3DM9B 3CM0A 2R6GA 3PIRA 2PVGC 5EZ6B 5BXQC 1XTKA 1UJ2A 3K0CC 4XJXA 3I61A 2O8EB 3U7EB 1RJ9B 2ZYUX 3ZS9A 1MV5A 1LVGA 2Q9AA 1E79D 3LXXA 4L15A 4Q1AA 1NKSA 1W0KD 3AVOA 5JS7A 1ESMA 4NHOA 1E9BA 1FNNA 3LVRE 4A36A 4YXWD 2C04A 4IW3B 2RGGA 1GKYA 4PZYA 4M1WA 3WYGA 1YE8A 2Z43A 2IEYA 2G1KA 4WA7A 1AS3A 1E0ZA 3I8SA 3J81k 3THWB 4XVUA 5JSZA 1KMHB 1AGPA 5JBQA 1TL7C 5LD2C 3W5JA 1W44A 2ZI9A 2QJLA 2P3SA 4KO8A 4LSGA 5JECA 5JS8A 1KI6A 3UK6A 1OB5A 2QAJA 2V54A 4K81B 3BORA 5C2TB 1S1CA 2C95A 1BOFA 2FSHA 5DN6A 4C0LA 1AJEA 4UXIA 4ZV4A 2FEMA 1N6RA 3AB3A 5L3RA 1XMSA 4D6PA 1ZU4A 1KTVA 1W7AA 4I99A 1P61B 5CYPA 1W4RA 2E87A 3BH0A 1G3RA 3NDBB 1K6MA 3OAAA 4CZ2A 1X1SA 1PVOA 1P73A 1G4UR 2BM1A 2P5SA 2BCGY 2RB4A 4LTUA 5EZ5A 1EG7A 2FOLA 5E7MA 3VQTA 4C9BA 2CVFA 2ZSDA 4DB2A 4QFMA 2PKOA 5J4HA 2QZ4A 2IHBA 5EE1A 4TTQA 2CCKA 1E9CA 5FFMA 3R9WA 2ZS8A 4PHFA 121PA 4NYIQ 5LB4A 1KAGA 3CNNA 5TMPA 1FRRA 1U9IC 4JLOA 1Q20A 1NENB 1LS6A 4A0HA 1VTKA 3LB8C 4DUGA 3PITA 2FGJA 2PT7A 3EW9A 3RS3A 2X77A 4A2QA 3OIYA 4DUGD 1QOGA 1E9EA 2Z6VA 3SBEA 4C7YA 2QMHA 3TJZA 3KQKA 4TLEA 1XTJA 4MRNA 4PPNA 5KO2A 4H1VA 2FBWB 5BN5A 1FUKA 3K0SA 1OXSC 1G8YA 3RWOA 3MGCA 4JVMA 3AVXA 2AX5A 1CTQA 1QOAA 1W2GA 4NCNA 1J90A 2A9KA 1DAIA 2G1JA 3LD9A 4PFSA 3EZ6A 2GCOA 3TR0A 1UKVY 2RGAA 1AK2A 2JCSA 5SZHB 4HB2A 1IBRA 2BBTA 3AE7B 4CGZA 3DKVA 4FMDF 4HAWA 4LJ6A 2GJKA 5A4JA 3C7KA 4BFWA 2AD5A 2FE4A 3FTQA 2CJWA 3OEHD 1QRAA 2QMEA 4RD6A 3LWNA 1OFTA 3PVSA 3SFEB 1JQ4A 4YSZB 2A5DA 4KV9A 5KNBA 4BFYA 1G5TA 3B2GA 3KJGA 4MH0R 3D3QA 3U7GA 5KDOA 1D5CA 4MKIA 3RS4A 1I7HA 1A82A 2FSFA 3TIFA 4LJ8A 3G0HA 2CK3D 1DOIA 1GG2A 4LK2A 4Q7KA 1LV7A 3RSOA 2VLIA 3PENA 4LV6A 2B8WA 2GCNA 4B71A 2YZ2A 2H8KA 2I4IA 5GJBA 3CRMA 4Q7LA 4QL3A 4DCVA 2B92A 3CRRA 2RCNA 4PC2A 2GA8A 2ORVA 1UEJA 3ZYCA 2DFNA 1II0A 3KJIA 4FMCF 3G5UA 4IHQA 3AF1A 4QGAA 1JAHA 2SHKA 1GL6A 1FP6A 5EXTA 2BMEA 2ANCA 3ND8A 3BIFA 1VG1A 1EWYC 3BOSA 3F5FA 1E2NA 1E9MA 1VHTA 1S3GA 1XEFA 4Q19A 2JLQA 5JSZB 2CVHA 1OW3B 1UDXA 4PO9A 1UPTA 5KPDA 1IY2A 3WMEA 1NYRA 1AN0A 3EA5A 3UANA 4OHXA 3L0SA 2W6JA 4Q1DA 2EFDB 5GADl 1NY5A 4JLVA 4AG6A 3UPUA 3RDPA 4EPTA 3R9XA 2FPLA 1J8MF 1J2JA 2BKUA 3CIOA 1J7CA 3B2EA 4HZUA 3ZJYA 4TSFA 4EDHA 4Q9HA 2OBNA 3AP2A 1N0VC 3TKLA 1KRHA 1JROA 1G21E 2JEOA 2XTZA 1J99A 3U7HB 1QHHB 4RD0A 1YRAA 3QE0A 4KU4A 4CEIA 1L0VB 4XH9B 3HR8A 4WOPA 1WYGA 2PEYA 4JL8A 1DAMA 1IXSB 5EJEA 3I92A 4USAA 4EPWA 2C96A 2GTPA 4PC6A 1JI0A 1XXHA 1SHZA 2J87A 3QKRB 3QY0A 3NEJA 3PJRA 3O8RA 1MO3A 2IWRA 2NO1A 2ZR7A 3SYLA 3T61A 4F93B 4DLRA 2W6JD 1Q0UA 1WQ1R 4BZXA 4DSUA 5AK0A 4Q4LA 3OIWA 3NRZA 2YC4C 3AF0A 3AE1B 1Z6AA 2VHQA 4EPVA 2REBA 2PVOD 1IAQA 3L0PA 3DWGC 3T34A 2IWHA 2Z83A 3QXSA 5AJZA 1OFFA 4FW9A 4KHZA 2XZOA 5TVKA 4DB4A 4B6FA 1XF9A 1W4AA 1WMSA 4AY2A 4R9UC 2A5GA 1P6XA 5DO9A 4C0HA 4Q9IA 4TYYA 1TKGA 4XD7D 5C4GB 1US8A 2ZYTX 1XRJA 1NLFA 1XCGB 5D3MA 3QSYA 4URUR 5IK2D 4P4TA 4F38A 3AE4B 4B43A 3TNFA 2WZQA 2C99A 1ONBA 4I1UA 1AWDA 3R9IA 4DSTA 1DOYA 3KKOA 3P26A 5DI9A 3SI7A 3H1TA 1VJKA 1QHGA 2VP2A 4JWSC 4MRVA 4RFSB 2H5EA 3O8DA 4FCTA 5G3ZA 4A2WA 1ZU5A 4DLUA 3BFKA 1E0KA 2XSZA 4YMUA 4UJ5A 4LV8B 3D8BA 1NI3A 2A78A 3IQXA 3PEUA 3AKYA 4LWZA 4E09A 2OAP1 3BB1A 1TQDA 2BWJA 3BK7A 3L2OB 1E2LA 4YSXB 3U3JA 4A0RA 4URVR 2XNSA 5FTNA 5CIWA 1ODFA 4YMVA 3PEWA 5AUNB 3X1WA 1K5DA 2W00A 1UWMA 2V8OA 1TQ4A 3BH7A 1E9FA 1F5NA 4QBHA 2FFBA 2VP5A 4EPRA 4AYXA 2QORA 1Y63A 2BM0A 4MGIR 3ZZ0A 1PFDA 1B9RA 5DI3A 3VKGA 4ITKA 2EYUA 3PQCA 2V1XA 2RH5A 4LBZA 8OHMA 2WTUA 2YJTD 4A6PA 4Q7JB 3P1MA 2NZJA 2WAYA 4D25A 1ZJ6A 3MD0A 3BAFA 4F7WA 1DPFA 3GFOA 1E79A 5E7JA 2PZEA 4ABYA 3UMRA 1R0ZA 3GJ4A 1NVVR 2X1VA 1E9DA 4PHTA 3AE9B 3EIEA 1WB9A 1CKEA 4AIIA 2WDVB 1NP6A 1T6NA 4LDJA 3NHAA 5FOSA 1N60A 4CW7A 1F2UA 3AGQA 3THYB 1LB1B 4JBWA 5CIQA 2WWYA 4IKEA 3GEEA 1Z22A 2EWVA 1EFCA 1D2EA 2F9LA 3VKWA 2WMOB 1KDOA 4HZIA 1YJ5A 2HLDA 4MDFA 1JEEA 1B23P 1AKEA 3BRWD 5HZKA 1VG8A 3SZRA 3W34A 1EK0A 4LJ4A 1XLNA 1XBTA 2ZJ2A 5L3VA 2QBYA 4TZ6A 2JGNA 4IVQA 1XLQA 4Y0AA 4QNRA 1XTSA 4K8OA 2XOKD 4LJAA 5HE9A 1EFHA 2ZQ5A 4HYYA 1OQRA 4O0MA 1IJFA 1DG3A 1XEWX 1AS2A 1WXQA 2R6DA 2VIIA 2OHFA 4DSOA 1RFLA 4IVPA 1AZSC 3TR5A 3LV8A 1TQ2A 1US8B 3U7FB 4Q9LA 5FUVA 1MRSA 2ZYWX 2EFEB 3UMFA 4NKRA 1G7CA 4CEJA 1X3SA 3RC8A 3RLFA 4ASUD 1AIPA 1KF6B 2GZAA 4W5JA 1E2IA 4OI1A 4ZKEA 1XTIA 4ZCLA 3A4NA 3K09C 4WIAA 2QGNA 4B48A 2WDRB 2PCLA 2QN6A 2G88A 3Q5EA 2CLSA 4OKSA 2DBYA 3KXLA 4GMDA 4U7DA 1G3QA 3OAAD 2Q3HA 4N59A 2GJ9A 2WV9A 4C2UA 2WS3B 2IUUA 1OYYA 4BUJA 1QHYA 2ECKA 1W48A 1C4OA 2BEJA 2OAQ1 1D9ZA 4MUAA 2YWGA 5EXXA 5FTKA 1U81A 2W2TA 1CJUC 5JI2E 1JXMA 2IT1A 1R8SA 2UKDA 2G1EA 2F1HA 2IYQA 4TLBA 4HLQB 1JR6A 2J46A 1I4TD 4O25A 2QL6A 4IFEA 4RCZA 3CW2A 2M56B 4M2LA 3O47A 1YZUA 1VKJA 2VTKA 2ZSBA 3K8YA 1S0UA 2ZROA 4BLTA 4NMMA 5EP4A 2FFAA 721PA 4MGZR 3RRYA 1KHTA 2E9SA 1IN5A 5M04A 1ZW6A 5E4FA 1W2HA 1YQTA 3LQRA 4ZDIA 1P9RA 1NY6A 1UBCA 4RZ3A 521PA 3U3OA 1A5TA 2F3RA 5IHPA 2ZI4A 2B21A 4FMCB 2MJ3A 5FUYA 2KBEA 2OFOA 4A2PA 1QG2A 1SIJA 1U98A 3PG5A 3N2EA 2G6BA 1WA5A 3RS2A 4LPSA 3FAHA 1E94E 4G5QA 4IXNA 4N58A 2QTFA 4B75A 3TQCA 4ZCMA 1Z6GA 2G77B 2XNDA 3TUZC 1CBUA 1ZIPA 4EUNA 2VRWA 4JKYA 3V9PA 5JLJA 3THWA 3C15C 4UNRA 2JDID 1MOZA 5DGXA 3AE3B 1KDPA 5C46F 5JWOA 3KQLA 1ESNA 4CEHA 1ZOYB 2D74A 3I73A 4IDOA 4B35A 2KAJA 1H8ED 1NJGA 2QTVB 1FFUA 2JQRB 2CJNA 4KJZA 4UNPA 4B3DA 3AEZA 1L5PA 2QP4A 3IPXA 1Z0IA 5KSZA 3QPUA 4HB3A 1LY1A 3W5UB 4HZUB 2CL6X 1IY0A 4HATA 1KJZA 2AFHE 1XD2B 3RRZA 1I4LD 3KFXA 1JR3A 4BFSA 3LXFA 3DL0A 1R10A 5B57C 2JASA 2CCGA 4OQFA 3MRSA 4RJLA 4PSKA 4CRWB 4ACBA 3W90A 2YWHA 4RD2A 3NVZA 1KDTA 3ZD6A 1KI4A 2OG2A 1W0JA 3RS7A 1Z83A 4GP6A 1G6HA 2YWEA 1Q21A 4US0R 1DAGA 4OHWA 3R7WB 4B76A 3IKJA 4RY2A 1SHKA 3B82A 1DTSA 3CX8A 1OH7A 1WF3A 2F1JA 1T3LA 4AYWA 3LNCA 5DH9A 3WHLA 4HUTA 2A30A 2PIAA 1S3SA 2ODWA 2V55B 4JLAA 3FB4A 2IYXA 3KB2A 3LDAA 4NYJQ 4C2TA 2CLCX 5GVSA 2WWWA 1LTQA 3B6EA 3FOZA 2GCPA 3QEOA 4YTMB 4DDUA 3BC1A 1Z0JA 2J7PA 1U90A 2EVWX 4LJYA 4MA4A 3THOA 4US2R 4EFNA 2I1VB 3JVVA 4F92B 2OT3B 5LD2B 3Q3JB 1E0AA 1BYUA 2EFCB 1XB2A 5LPNA 1Z0KA 1KSJA 2XTMA 1GP2A 1MRNA 3HJNA 2WKQA 1PUTA 1I2DA 1IOZA 4EJSA 4QHTA 3V00A 4Q1EA 2K5PA 3SR6A 1YQ3B 4TL9A 2IYRA 1YJJA 3FFAA 2OXCA 3L8YA 5JRJA 3EZ2A 2XEXA 2F6RA 4GZMA 4GL2A 1JWAD 1XTRA 3E1SA 3NG1A 2AK3A 1P3JA 2PX0A 4W9MC 1CR1A 1N6NA 4MQBA 5JEDA 4OK3A 2YVUA 4BRUA 4P33A 4IEIA 3LRPA 3HDTA 3IIJA 3QENA 1CRQA 3ZQJA 5GXGB 2F7SA 1BIFA 3A36A 4NONA 1KKLA 4JS0A 4O2LA 3W6PA 2ORWA 1Z08A 2BMFA 1OIVA 4F4IA 1ELOA 3ZVLA 1S9HA 3ZZUA 1N6KA 1ZP6A 1DOXA 4LV5B 2ZRAA 3CRVA 4YSYB 4AKGA 1H8HA 4EJSC 5FBVB 2IF0A 1ZUNB 2VL7A 2IS6A 1L8QA 3OEHA 3TW8B 2VP9A 2D2FA 3W9YA 1LF5A 4HDCA 4RZXA 3GLFE 1XZPA 3SJZA 5F9HA 2C2HA 4DEYA 1VCMA 3MJHA 1E99A 3JZMA 5DHFA 4DCTA 4OHYA 2ZITA 4NYMQ 5DYIA 1G16A 4RD4A 4O3MA 3A4LA 2QIEB 1MO5A 1FO4A 3QNUA 3ADBA 2WJYA 1QVRA 1HT1E 4Z54A 4KI0A 2A5JA 2BS3B 1XMVA 5GJCA 1NVWQ 1XEXA 3TSWA 4GRAA 2O0JA 4WVFA 3ZD7A 5AJWA 3SBDA 1QBKC 1E10A 6Q21A 4NYMR 1K5GA 1W36D 4FXPA 1JALA 2VSOA 4G5GA 1HEIA 4EPXA 4P4SB 2FMXA 2GESA 4AKEA 1P60A 4IDHA 3SR0A 3FMOB 2WSSA 1T0JB 4JSYA 5LBIA 1F6BA 3L0OA 3QQ5A 3EPKA 3W5VB 4L9SA 1SXJC 1QOBA 3THXB 5B58C 1COWA 2GDJA 1ZNYA 2JJ1A 2JLRA 1U0LA 3GLFA 2CL7X 2Z0MA 5EUQB 3SN6A 1EX7A 3K0CA 4RCYA 2ATVA 2QAGB 2OFXA 4FXCA 1GWNA 1Z28A 1ZMXA 3VX3A 3NVYA 4Y0VA 2G3YA 2D4HA 5CB8A 4TT3A 2IYYA 2V7QA 5H92C 1FMLA 2C03A 4DDTA 5L3SB 4XWOA 2C9YA 2PT5A 1NBMD 1YVDA 5BWMA 3TSZA 1L4YA 1DAEA 4PC1A 2HT1A 2ANBA 3GCGA 3IIMA 3VFDA 1WE2A 3QF4A 4GSYA 2G0NA 3K0FA 2F1IA 3B9QA 3X1YA 1RRGA 2NIPA 3EXAA 3VRBB 1A4RA 2G0TA 3OEED 3SU8A 3VMFA 3PEYA 3FHOA 2UVQA 1W36C 3FHCB 3MAAC 3TVTA 4TYWA 4DC9A 1Z6YA 3ZIAD 1KOFA 1FIQA 4U02A 1FTNA 2B6HA 3GP8A 2E1RA 2B7BA 3BIID 1G5PA 1GVNB 4YMSA 1P7CA 4DLYA 4MGKR 2F43A 1JEDA 3WNCA 3IEVA 1UAAA 4M0LA 3OFND 4YTNB 3U4QA 4NTZA 4GT1A 1AKYA 1P2SA 2V4ZA 1HY3A 3WHKA 3EIQA 1TQ6A 4X8LA 5KSOA 1SULA 4I4LA 1VDZA 2QMUA 4WQMA 3CLVA 1EWQA 1QDEA 1DGJA 4K46A 5A0FA 1AZTA 4ASUA 3D31A 2L0XA 3W6NA 3EG5A 5D3QA 3Q7PA 1R4AA 3ND9A 2P0EA 4V03A 3OEEA 4OQNA 4NL4H 2H1LA 2VP6A 2JJ2D 3ZYYX 1OHHD 1W4CA 1ZM3A 2LKCA 2PMDA 3CZQA 3IPYA 4TQUS 2P6NA 3CUEF 1OH5A 1Z29A 2VHUA 3RHFA 3SHWA 1UDWA 2OZEA 3ONWA 3K9LA 4BQSA 3C14C 2JLWA 2NPFA 2V3CC 4CF7A 1G8FA 4UNSA 3MWYW 2AD1A 2ZVPX 3AUYA 3QVUA 4HB0A 2QA5A 4Z51A 2ZRGA 3OF5A 1SVKA 2P6UA 1G19A 2N1BA 4BLSA 4AKHA 3WRXC 4M21A 1J7AA 4DT1A 2WJJA 5D3MB 2PCJA 4IRUB 4GNKA 2FFQA 3SHFA 1SVMA 4QG7A 3AV0B 3FKQA 1E2MA 3QF7A 5CJ2A 1G8HA 2QP9X 4RKEA 2FN4A 5BN4A 3FVQA 2JJ2A 3NH6A 4UXJA 5B30A 3PUYA 2C9OA 1R0XA 3FFBA 1IN4A 1P9NA 2DYKA 1OH8A 2WKRA 1S2MA 2ZEJA 3GLIB 4PPGA 2WPDD 1AS0A 1TTTA 1NVXQ 4XIGS 5DHAA 1OT3A 4M1TA 1OFHA 3CWQA 4O2RA 4UQOA 5H8WA 4MYHA 1W5TA 4LHWA 4OK6A 3I62A 2ZRLA 2DWPA 1CZPA 2FEOA 4PSAA 3VR3A 5AJXA 1TUIA 3ECCA 1KO4A 3NH9A 4TZ0A 4YDSA 1MKYA 4Q66C 1G64A 3TE6A 3MFYA 1XEWY 2J9RA 3CPHA 3OE7A 3GJ8A 2DWQA 3VKHA 1AM4D 5FUWA 1WDTA 4D0LB 4GPTA 2HT6A 2QEQA 1XWIA 4ZDJA 2RAPA 3LFUA 4KFUA 1D6JA 2ZRIA 4TLAA 5EE3A 3IHLA 2HYDA 3TUIC 2NTYC 3F3YA 4Q48A 4AD8A 2FV8A 1FPMA 3NS1A 4IDIA 3FMPB 1KY3A 1RYHA 2QRZA 3PCRB 3TAHA 3AEFB 4ESHA 2B76B 2L52A 1OJLA 2ZUCA 4JJZA 2JLUA 1ZNWA 3C5CA 1KI1A 3IHWA 4YC7A 1KAOA 2F55A 1FX0A 1HQYE 4JL6A 2QAGC 2BHRA 2JIZD 3DOEA 3QKTA 4IOJA 1QT9A 3K0AA 1K8RA 2ZAMA 1CIPA 2V9PA 2WHXA 4UKDA 1WBDA 2PX3A 1SKYB 1L4UA 3NBYC 2CBZA 3G82C 2O8FA 1RRFA 2GK6A 1Z0AA 1X86B 3TMKA 5BN3A 4PC7A 5KUTA 3GLIA 1NSFA 2MSEB 4W7SA 5CB6A 2IEZA 4A0FA 5KPJA 4YXWA 2RKOA 5IF9A 4IOMA 3W5IA 1OKKD 3A1WA 2LWIA 4HSEA 2Q3MA 3U5ZB 2GJ8A 2B7CA 2Q5WD 3VR1A 2VHTA 4PHGA 1AGRA 2P67A 4PTLA 1V8CA 5TDHA 4AKIA 2IX3A 4N6EB 1M1YE 4HAZA 4Q21A 4R2HA 1OFIA 1ZINA 5HE8A 3I8XA 5IRCD 2F3TA 1NN1A 3PFIA 3AKEA 3WY9A 3QPWA 1X1RA 4KSBA 3AH7A 4AC9A 2YHSA 3H2YA 3N70A 4B74A 4JYBA 4LYFA 4C7ZA 4G01B 2N0SB 1II9A 2RMKA 4XTCS 4IXMA 2IXFA 2ZUDA 2IYVA 2WM9B 1KYIA 2UZIR 3DZDA 3I32A 4N3NA 1IN7A 4NYIR 2K22A 4QBIA 3B1ZA 4BEBA 1CU1A 1KI3A 1GRRA 2D7DA 3QG1A 2O8BB 2VSXA 1SQ5A 1SXJE 1HYQA 1T0HB 2OO7A 5FTLA 4D4LA 1HE1C 2KMMA 3AEBB 2BJWA 1RFKA 2CNWD 1QHNA 1UBEA 1FRDA 3DZ8A 3T1TA 3JVUA 4DLZA 4ZDWA 2R6FA 1NN5A 2HJVA 3E2IA 4HAXA 5TY0A 3VR4A 3HPRA 2MMCA 2QPTA 4A8JA 1RW4A 2ZE7A 3RSLA 1M74A 3B85A 2W3RA 2QT1A 1BO6A 2NO7A 3AKDA 3SS8A 1IUEA 5BW8A 2D3WA 3H4MA 2QT0A 4QBGB 1JRPA 3AEEB 4CT4B 1E32A 4R71A 1OH6A 2ZXUA 3MWKA 4Q4HA 3PO0A 1ZAKA 2ZRHA 1L6UA 1P72A 1UADA 3AKCA 4NP6A 5JJLA 4B3CA 1R2QA 4M9XA 1CJTC 5EP3A 3LVQE 1LS1A 4HAYA 5JWRA 2FZLA 2IYTA 4H1UA 1Z6XA 1TNDA 1ZVQA 1T5LA 1E1QD 2AFIE 2OBMA 1QLBB 3WNBA 4GDFA 2PBRA 2IUSA 1QHIA 2R44A 2WWHA 4AK9A 3TGPA 2IYUA 2XITA 4LYJA 4L9WA 1E6EB 3ADCA 4Q00A 1UEIA 3KQNA 4FMBB 4YQFA 2AHOA 3U44A 5KSPA 3AB5A 2ZU6A 3R8FA 4G5SA 4B3XA 3LXRA 2QROA 3WNDA 2W55A 4WBSA 4ZOHC 1U8AA 1PUJA 1XDBA 2ORIA 1HTWA 4R98A 1G3IA 3GJ5A 1JECA 1XXHB 5AWFC 5A5GA 5HKKA 1XPRA 1OF1A 4LHXA 4KXFB 3U3RA 4TL8A 4JKIA 3KTAB 5J40A 3UG7A 5P21A 5CK5A 3BWDD 4XTRA 1NLYA 1U0JA 1J7KA 2HV8A 4LCBA 5DIFA 3V4RA 5J4YA 5MPOA 1T9HA 1KZ7B 1MABB 3EX7C 2IXEA 1E98A 1ZXIA 3KXIA 4LYHA 1E6CA 3QOFA 2RGXA 2O8CA 2QI9C 3BGWA 2YINC 3TVDA 3ZLJA 2BDTA 4E22A 4ILEA 1SVLA 2GZHA 1RRPA 3K70D 1NVID 4Q03A 2W6IA 3W8NA 1ZCAA 1SXJA 3EZ9A 1R0WA 1IQPA 2HLDD 5FOTA 3KL4A 1M7BA 2FX3A 2ZYVX 1U99A 2GNOA 1OKKA 1QF9A 1F2UB 3CH4B 2BS4B 2JDIA 3EC2A 1P5ZB 2AKYA 2GAAA 2C77A 4LJ9A 5EXSA 5TV2A 3IBGA 4B73A 3THXA 4CEHB 4BZPA 3RYTC 4EIWA 1Z47A 4JMPA 1S8FA 5GJVC 3LLMA 1CRPA 2WWIA 3OFNA 2WP9B 4DCNA 3FGNA 2GEDA 2YC2C 3QKSB 4BFVA 2FPMA 3FE2A 4LC0A 1OPXA 3ASZA 3EAQA 2GHIA 4YDHB 1G291 2JLZA 1U8YA 2VHCA 2VP4A 3LH5A 3OIUA 1VCIA 1SVOA 3KB1A 5EE5B 1T4GA 3LX8A 3R8CA 1TF2A 2HTME 1YR9A 4AYTA 1PLKA 3CH5A 3BH6A 2ZJOA 1NVVQ 3KKPA 2WQYB 1G7TA 1G7SA 4QBFA 2WOOA 4X8OA 1ZC3A 4Z8XA 4WZ6A 2PZFA 5KU1A 5C3JB 4PQRA 1Z8FA 1CS4C 3DVLA 3CF0A 4URZR 3OHMA 3I5XA 3PEVA 2F9MA 2IS4A 1SVSA 4II7A 2GCOB 3DMNA 4GOXA 4JVNA 1S96A 1ZM2A 2ATXA 1E4YA 1KO5A 2AKAB 4TN1A 1NN0A 1FFHA 1G1MA 2VEDA 3I1FA 1HUQA 3LBNA 1Z07A 3GLHB 4CIDA 1DE0A 1GPXA 4G5RA 4WW0A 3AF2A 3X1ZA 4BLQA 4DCSA 2EFHB 2GVDC 3M6AA 2BKEA 3SJBA 1ZD8A 4BPBA 2H88B 1P75A 2FPKA 1GNPA 1IHUA 1W1WA 4XWAA 5FL3A 3T5DA 2OCYC 3SDZA 3B7GA 1YZNA 4OJKA 1FUUA 5J4LA 4NPHA 1N61A 3MWLA 1EFRD 3ZVRA 1U94A 1EGAA 1RIFA 1H8HD 4JBXA 3U6KA 3NWJA 4PQFA 3VU9B 3CONA 1Z2CA 3A1TA 3NC1C 3PUZA 2OSBA 1ZUIA 4A15A 3NKVA 3AN1A 4JIMA 3FMIA 2QNRA 4HUQB 1CJEA 4LY6A 3EIHA 4C0SA 1EXMA 1GDDA 3W8RA 2GXQA 2ZJ8A 3DO6A 4YTPB 1SKQA 2ZVQX 4GP7A 1T3QA 1BS1A 1M34E 2QU8A 5EXPA 4PPQA 1BKDR 3LW7A 2OCPA 3OZXA 1CR2A 4V0LA 4BLRA 3VNVA 4QC2A 1J7BA 2NGRA 3CRQA 3P4YA 1QVAA 2VYFA 4M1YA 2V1UA 4DIDA 1TYGB 2IUTA 2PZGA 3QXXA 1M7HA 1RWSA 1E2DA 2FWRA 2VH5R 2Y8EA 3A8TA 5DI3B 3PXGA 3QBVA 2V6IA 5BYJA 4BFUA 1YQ4B 1S4QA 2GRJA 3B60A 3KFVA 5F2EA 3SFVA 5E95A 4DLSA 1E1QA 1JPNA 1GNRA 1Q1ZA 2DHRA 3MLEA 4TYPA 4B34A 1VYTA 3CO5A 3NVAA 1W36B 1NG1A 4A0GA 2UZ3A 4GI7A 4LHYA 5AR1A 3B1XA 5JJKA 2DFKB 3QXCA 4TLCA 3GJXC 1J8YF 1KY2A 4NCKA 2GBLC 4MYUA 4YMWA 1TU4A 5HZHA 3WCQA 1NYQA 2J0SA 1KI7A 1TF7A 1N5JA 3CB4A 1NIPA 3VX4A 1GITA 1CULC 2LCFA 2VBCA 3GLFB 3U4QB 2ZR0A 1LF0A 3U61B 1IXZA 3AE5B 3A6PC 1IM2A 2QSYA 2TMKA 4M1KA 5H1YA 4ZHPA 1NN3A 2GBLA 1NBME 3BXZA 1VIYA 1XMJA 3C5HA 5HCNA 4YLGA 3JZAA 3BERA 4URYR 2FSIA 4V0KA 1W5SA 1Z5ZA 3K9GA 3U6BA 4PAMA 3PR1A 1E7PB 1TKYA 5FI1B 3CX7A 5JHGB 2BBOA 1GAQB 3DM5A 4YONB 4JZKA 2NMVA 5L8VA 4ZHOA 2GF0A 5EP1A 2ONJA 1Q3HA 4OL0A 2WICA 2W58A 4BFXA 1YR8A 1FP7A 2WJIA 2WWGA 3ZVNA 2GZDA 3CIRB 4OBEA 4RKFA 1S9DA 2CJWB 1Q1QA 4G0NA 2WU2B 1OFUX 3IQWA 2GEUA 2O8DA 3ASYA 4D82A 421PA 4TYNA 1I4DD 1YR7A 4BLOA 4G5OA 4U00A 3S1AB 1XNJA 5DYGA 1HV8A 2FGKA 2FFHA 1XMIA 4DIEA 2OV2A 1VG9B 3FYHA 5FUXA 5FPSA 3BFVA 1E4VA 1II8B 2ZPTX 3SC3A 3Q72A 2D62A 1R5OA 3OESA 4M9SA 2IC5A 4M1SA 4KBGA 4ZIRB 2KSQA 5FPYA 4BLPA 3EZ7A 2YKGA 1XXHE 3B2FA 3GLGE 4M1MA 1F60A 4GFDA 5H8YE 1X8JA 3CZPA 1NMXA 2QE7A 2X2EA 1E69A 4DT1B 1E0SA 4J0QA 2EYQA 1JB1A 1XFAA 3HU2A 4XOIA 1DS6A 1N6HA 3AQ4A 4LGMA 4PQYA 1MH1A 4D0GA 1N3BA 2QUZA 4TMXA 3T5GA 2QM7A 4B3BA 4LX0A 2AL7A 1DG1G 2HDNB 3R20A 1N6LA 4UNNA 4LBWA 2OCBA 4IEEA 2IS1A 1NMZA 2QM8A 1E2HA 3AVQA 3K53A 4HDOB 4ZDKA 3A1SA 2XJ4A 2WJVA 4PZLA 2CJOA 2DCUA 1NSTA 1GAJA 2Q21A 1KIMA 2WWXA 4EQ6B 2LEKA 2KBFA 2OE2A 3K0AB 4AURA 1PLJA 3BB3A 5IK2A 4DKXA 1X8KA 4FCWA 3GLHA 4JLDA 5KYKA 1ZC4A 2FDCA 1YZLA 3WP1B 4RZUA 3SYKA 4NDZA 4N1AA 2ZS7A 4FINA 4PR0A 5FI0B 1IONA 1MT0A 3HVZA 2P65A 4Z1MD 4OJQA 4HDQB 4BASA 5J4KA 1COWD 1G18A 4FCVA 3QUSA 1VYVA 1GTVA 2ZRKA 3AP1A 2IHYA 3X1DA 2JJ1D 4OQXA 1X8LA 1FFVA 4FWIB 1V97A 2G83A 4QJ4A 4QJ5A 1II8A 2ZETA 3NDPA 3KKMA 4FIDA 2ZU0C 1CJVC 1Z0DA 2VF8A 2OFWA 3RWMB 1R6BX 4B33A 2AXPA 2Z5FA 4BEJA 2HF9A 5FR1A 2A5FA 2CMKA 4GBMA 2AWNA 1RRCA 1UFQA 2ZJAA 1KNXA 3FKSA 2O8CB 3HU1A 1N25A 2L83A 2PLRA 5FBQB 1EX6A 3B1WA 2W6ID 3IUYA 4Q18A 3HUIA 3SE0A 5KDLA 3K70B 2DB3A 1ZBDA 2W83A 3QKSA 2BJVA 1XJCA 5G5HA 4Q4AA 3RNLA 1GM5A 2NO0A 4N0EA 4NZYA 1H8EA 4C7OA 3DHWC 2ZI7A 3T1VA 4TTRA 4Q7MB 4DCUA 2FZ4A 1GNQA 4PC3A 4Q1CA 4C80A 1SGWA 5KHOC 3HU3A 4US1R 4C3ZA 4FI3C 5IT5A 3SJCA 1FMJA 2BOVA 1R0YA 4QRHA 1DEKA 2WLBA 1XLOA 2WJGA 3CBQA 5CLLA 2G9NA 3AV8A 5EUMA 1KO1A 5EP2A 2J7PD 3CKLA 1XPOA 3TRFA 4RVCA 1Z06A 2AN9A 3D7MA 3DOFA 1B0UA 4A8JC 2E3TA 1MO4A 1T5IA 2BBSA 1OIWA 3CRW1 3T1OA 2Q6TA 1AA9A 2GAOA 2AK2A 3VHXA 1KSFX 1BYIA 3AP3A 3UKDA 1HURA 2FNAA 3KX2A 5ELXA 1XD2A 1TU3A 1N5KA 621PA 2BT6A 3B1YA 2WU5B 3ZDQA 5FPHA 1GSIA 4N0DA 2IS2A 3CF2A 3HR7A 1X6VA 4Q4HB 3ZS8A 5CDFA 4OI4A 5JFGA 5KNCA 3I5YA 5C4MA 4BFZA 1NG9A 2R2AA 3P27A 4QXAA 4PO1A 1DADA 2IYWA 1JPJA 1ZUHA 1OYWA 2XZPA 3K09A 4Z8YA 4PX9A 2XJ9A 1DO0A 5TXGA 4E5UA 2A7QA 3IBYA 1G5RA 4X8HA 3MWJA 2O52A 3NEYA 2OCAA 2GK7A 1NL3A 2WMNB 4ZKDA 4OYHA 4WXPA 2GEVA 2J0UA 3CPJB 4JWUC 4QGHA 4TQAA 3ICEA 2VP0A 1M7GA 3FWYA 2QQ0A 3CF6R 3K0EA 3ADDA 2DR3A 1G8PA 2QE7D 4TQ9A 4L4UA 4B32A 3M1IA 4KVAA 4LPKA 5K8IA 3QPVA 5GJWC 1W4BA 1G6OA 1WGKA 3MSXA 1QHHA 1SF0A 2QG6A 1P2UA 1KDRA 1VMAA 1KK2A 3GJ0A 1PDXA 1V43A 2LKDA 1DBSA 4GOJA 4LUCA 1R7SA 4P32A 2HCJB 1NF3A 4YT0B 1TPZA 1TUEA 2J3EA 2XSZD 4WAUA 5DSZA 5KDDA 2ZM5A 3D6TB 4XVQA 4TMKA 4LJ5A 3BE4A 4LI0A 4D4KA 5KTYA 3GLIE 4PHHA 1ANKA 1G3MA 5KSYA 1G9XA 4EJSB 1ZRHA 4QNMA 4OK5A 1TJEA 2MH7A 1T91A 2R9VA 2ZTSA 2VO1A 3P4XA 5JWHA 3EPJA 2WVJA 4RZ2A 1GFIA 5HR5A 4OHZA 3NVVA 1CLUA 2DFLA 4C0JA 2VQSA 5AUKA 4URXR 1WCV1 1TADA 4L16A 1YZKA 4MRRA 4Q5IA 1M8PA 3QKUA 3RC3A 1C1YA 2J41A 3OE7D 1Z0FA 1YZTA 2GWHA 2J0VA 4URWR 3UMSA 4WWMA 2IA5A 4LC1A 5ANRB 2BCJQ 4DEXA 2R65A 3NBFA 4DHEA 2N42A 1G20E 3CNOA 5FOUA 1TEVA 5BYKA 2ZJYA 2FA9A 2C98A 4GZLA 4EFMA 1FM0D 1G17A 2GXSA 1V5WA 5JZVA 2YV5A 1O87A 4TL6A 2ZRPA 5J5CA 3K0FB 2X8AA 2J1LA 4P6VF 2QENA 2K5UA 4IDNA 4IOKA 4LJ7A 3QI2A 1KMHA 1ZUD2 3REGA 3T1QA 1I2MA 4M22A 5KNDA 1GL7A 4JT4A 2GJAA 4DSNA 1NLZA 2FU5C 4XSGA 1ZP0B 4R2IA 3X2SA 4V0OA 3AUXA 1NNEA 4QM7A 3UIEA 4EPYA 1QF6A 3SFZA 3VTKA 2ODNA 2ZREA 3LBIA 3QVVA 4TT3D 5DISB 4P31A 2ZRCA 5JMTA 3NC0C 4MYCA 4NYJR 4R7ZA 2CDNA 2JX5A 2WIBA 4I1OA 4M1OA 1VCNA 4NCIA 2WSMA 5J4VA 1ZM7A 1RYJA 1VPLA 1GUAA 5JJIA 2VA8A 1XEXB 4BRWA 1BH2A 3QIAA 1M2OB 2C5LA 1HQCA 4A82A 1PLLA 1PUIA 2MSDB 2H7VA 3C41J 3DEFA 4QOSA 5AJYA 5DE3A 4HLDA 2J59A 3ZZTA 2EKIA 2BVNA 4EAQA 4IJMA 1GKUB 5AJVB 4ZI3A 2D06A 1E2JA 2JIZA 3BS4A 4LOAA 3LLUA 5EE0A 1JR3D 3SJAA 3HPQA 1RKBA 3KXKA 3GQBA 4G3XA 5FL7D 3SYNA 1JR3E 2QQEA 5G3YA 1L6VA 1FQJA 1FTSA 4KYUA 3VR5A 2PJZA 4DWJA 1RZ3A 2PEZA 3L4PA 4DDWA 4Q4JA 1OHHA 1YKSA 1FW6A 3BD9A 4DLTA 1RM6C 3AVTA 1P9WA 2DFTA 4P0TA 4PSVA 2NG1A 4JLJA 1DVRA 2ZAOA 1KI2A 2KI5A 1KZGB 5JHHB 3AH8A 2YWFA 1WRIA 1ZD9A 1E1RD 3NBXX 3RPFC 1KO7A 1VHLA 5FPTA 3KTAA 1VCOA 1HA3A 4RFSA 4QGFA 4JBYA 3EPLA 1G4AE 2VPPA 4DBLC 4PANA 5JCPA 1OXVA 5E7IA 4QJ3A 3T06B 1O3YA 4A8JB 1IN8A 1R5NA 1GIAA 2ASEA 3A1UA 1Z6TA 3MJRA 4MKFA 4C30A 1W46A 2IYSA 3N2IA 3AEAB 4RD3A 2XB4A 3DMDA 3U3KA 1DELA 5AUOB 4ESVA 4D0NA 4HB4A 2CCJA 1U8ZA 4D4MA 1YZGA 2JA1A 3MMPA 2PMKA 1QHSA 1HE8B 4X8MA 1OE0A 2CNWA 4PAQA 3SQXA 4XVRA 4ERNA 3AVVA 1ZNXA 4PAOA 4JX1C 4JLKA 3AF4A 4KFRA 1N0WA 3TUJC 1JJ7A 1XJ0A 3SQWA 4EKDA 4MDEA 2BIFA 3FHTA 2CLDX 1FL9A 3IGFA 4HLUA 3UXMA 2A3RA 1LW7A 2Z4RA 1S1MA 1UKEA 2BEKA 2RHMA 4L5BA 2OUKA 1F2TA 1P4SA 4CT5A 2B8TA 1Z3IX 4EFLA 2MSCB 2ODBA 3VHLB 1R8QA 3KJEA 1DARA 2ZI5A 3DKPA 5FPKA 2GXAA 2QP3A 1D2NA 1U2RA 4Q9JA 4WZBE 1N62A 4JLMA 1N5LA 2I3BA 4TMWA 1WRBA 1ROEA 1NKTA 1UF9A 4LZZA 1RJ9A 4QHYA 4F91B 1CJMA 3W3ZB 1CXZA 3O8CA 5CJPA 1N6OA 2XGJA 4JJKA 2WSSD 1XCMA 2CU3A 4B3FX 3L8ZA 2P6RA 3ZH9B 2HYIC 1CJKC 2O8BA 3I4LA 1CF4A 4KLZA 5K8TA 2IF2A 1EFRA 2ACZB 3AE6B 3EASA 3W9CB 3E5HA 3KUCA 4MRPA 2W0SA 3IDQA 3VR6A 1ZD1A 5AUQA 2WJHA 1IXRC 2KJQA 3B1VA 3B13B 2CK3A 1NBMA 5H70A 4ON9A 1XTQA 2GILA 3BB4A 1XX6A 2MMGA 2W2XA 4E03A 4NCHA 1KSGA 1ZM9A 3RABA 2WAXA 1TKEA 2ZI3A 1OV4A 3E70C 1EFUA 2OLKA 2GKSA 2CL0X 2RGEA 4UNQA 2YYZA 5CK4A 4CEIB 3VAAA 2EU8A 3PV0A 3ICQB 2QY9A 3KWLA 4DJTA 2ZRDA 2H16A 2ZRNA 1OB2A 2GETA 4NE2A 5H68A 2CXXA 5C1BA 4FWTA 3SOPA 3WXMA 1XD9A 2VSFA 3L82B 2OXRA 4KYIB 1KK3A 1E9RA 4Q9KA 4ZO4A 1G3UA 5K8UA 2PH1A 2V7QD 1C9KA 2BC9A 3EZFA 2IW3A 2NO6A 4Q1FA 3BJIC 3TSOA 4PXAA 4YMTA 1PV4A 2HEIA 2P2LA 1Q22A 4D4JA 1R5BA 3AEDB 3L0IB 3M0EA 4YXDB 3U3MA 4V02A 1NVUQ 4TSFD 1UKYA 1CP2A 2HXYA 1ZYUA 2CE2X 5BQ5A 1FX0B 3WYAA 1EWRA 4KAXA 1NRJB 1T8UA 2JLVA 4GOKA 3P4SB 3P4RB 4OI0A 1NJFA 2P5TB 221PA 3IILA 3GMTA 4KLNA 2K9XA 3ZQ6A 4IVRA 2J45A 1IY1A 1VLBA 2IBMA 1XJQA 2RGNC 3QG5A 4Q02A 4P4SA 2VF7A 4HLUC 1CR4A 1E9SA 2RGBA 4LBYA 3QJYA 1AQUA 4C0KA 3GLGB 5JRZA 1AQYA 1T8TA 3AMZA 3GEHA 2Z4SA 3P32A 5LDDC 4JT2A 5G41A 1F2TB 3H84A 3MG9A 2ZRFA 3A1VA 5FR2A 2PJRA 1N2CE 4OQMA 1VG0B 2ERYA 5AUPB 4LHVA 1AYFA 1LNZA 3VNUA 1A2KC 2A5YB 2QSZA 3I3SR 3SFDB 1F0ZA 1JNYA 3DWMA 4C0BA 4TYQA 3LW8A 1CEEA 3QBTA 2J7KA 5G53C 1YJIA 4KSCA 1Q1EA 3ADKA 4B6EA 5CITA 1JQJC 4WZAE 4W5HA 4A1FA 1FOEB 3WP0A 5FTMA 4ACAA 3AM9A 2OILA 2J0UB 2WDQB 4D2IA 4Q47A 4DLWA 2QPAA 3M4YA 4XD7A 3T35A 3ABVB 3A58B 5AUIA 1TMKA 2KB0A 2XX3A 3O8BA 3Q5DA 3CR8A 2ZI6A 4HLCA 1RPZA 2QBYB 1JJVA 2CEAA 1CR0A 1YRBA 3CWZA 3K70C 2WOJA 4C7OB 3NVWA 2W54A 1KFYB 1E2GA 4LYAA 2CHQA 4RFVA 2C9CA 2HUPA 2ZRMA 5CM8B 3KDSE 1KI6B 1N63A 2Y5CA 3B78A 5C2JB 1XU4A 2ZJ5A 2AXNA 4UXHA 3H86A 2XXAA 2IYZA 2C78A 2OM2A 4US9A 2YOHA 2R8RA 4RD1A 1E9AA 4ZI2A 4KBFA 4LBVA 5F98A 1SXJB 2HJGA 4IDQA 5CLQA 1XPUA 4HI0E 4MKGA 2CHVA 3EWAA 4V0NA 2FG5A 3THYA 1GRNA 3K1JA 2WPDA 2ZE5A 4MKHA 3A37A 1WBBA 4AG5A 1ZM4A 4MGYR 4IDPA 3RRNA 4DLXA 4B3GA 1JWBD 1IJEA 3RS0A 1W0KA 3B8HA 5FTJA 1RC8A 2H57A 3OIVA 1MABA 2A2ZA 2JLYA 1IN6A 1W0JD 1JBKA 4M8NE 4V0ME 4DLVA 3B9PA 1LFDB 2WIAA 1YR6A 4NH0A 4DVGA 2NPIA 1E2KA 2O5VA 5FH9A 3WMGA 3FPAA 4HAVA 4PO8A 1SVWA 3GEIA 2OEPA 5B2ZA 3K9NA 1XCPA 3EA0A 3UG6A 1DAHA 2O8FB 2BMDA 4E07A 1PJRA 5G40A 3F8TA 3LAWA 4I1SA 3IO3A 4DRZA 3KKNA 2N46A 1QHXA 2WBLC 4Q01A 3NXSA 4JLBA 4RSGA 4F4CA 1TX4B 3P4PB 5FOVA 5CM9C 1A70A 1ZCBA 1SKYE 2FH5B 3UWKA 3GFPA 1D8TA 2AWOA 2C8VA 2NOAA 2QRNA 3HYRA 3CPEA 1KGDA 3KJHA 2WKPA 5EE9A 1GILA 2OLJA 3FDIA 1JAIA 2W0MA 2J5XA 3DDCA 3MCAA 2XAUA 3QEJA 821PA 2ZS9A 4JSTA 4IFBA 1KNQA 2GXUA 4U5XA 1N6IA 1D2MA 1KMQA 2ZJZA 2IL1A 3Q9LA 3QXHA 1FMAD 1KJWA 4L8GA 4LHZA 5HCIA 2JATA 2ODEA 2CE7A 3RANA 2R6AA 1FQKA 5SZJA 3BBPA 3N5CA 2XOKA 4POAA 4US8A 3VRAB 4A6XA 4A92A 4PPFA 3GD7A 5FBLB 5KOYA 2Q9CA 1E1RA 1SB3C 2YOGA 3WRYC 2REXB 3ZIAA 3GPLA 3X1XA 1UM8A 1E2FA 3AVUA 3WBKA 3U2QA 1H65A 2CHGA 3F0TA 2H17A 1Y3AA 2GF9A 1OIXA 1T3SA 2PL3A 3FMFA 1OXUA 5SZKB 1KO8A 2ZSFA 3V4FA 2AX4A 5L3QA 1BMFD 2BBWA 4FN5A 2Q3FA 3LY5A 3NHBA 3T12A 1OSNA 3PUWA 2BV3A 1E96A
chains in the Genus database with same CATH superfamily
2I7XA 3DR3A 3ED1A 1ILWA 4UQPA 1M33A 3KQQA 1H38A 2FF7A 3DDZX 2G07A 2FWNA 2PL1A 1BS2A 3RQIA 4M9QA 4OHVA 1E5LA 4TMTA 2PUBA 1BMFA 1BWPA 3OP4A 3EE6A 2PQ0A 2OD2A 1TJNA 5KC9A 3MC9A 1QZUA 3TLXA 3CKMA 1YR2A 1CEXA 2XB8A 4WY2A 4EG4A 5P8WA 3SEAA 1TK3A 2F43B 3O93A 1P7WA 3LQQA 1UBUS 1FFEA 3VTZA 5CXSA 3P2BA 1TF5A 1QGZA 2O2EA 4YNBA 2EWWA 5K2OA 3CNHA 4EW1A 2J9GA 3MT9A 3U4AA 3A1QB 1GKIA 3A31A 4C4YA 1GZSA 4CCWA 3O9MA 4QYTA 2WQZA 2XXAB 4RK0A 1ZDMA 2WD7A 4DL6A 5KTQA 1N5WA 3ETRA 1K8ZB 3UY4A 3MDAA 2AW5A 4KWEA 3RS5A 1KYYA 3VR8B 2PRSA 2YS6A 1EWYA 6GPBA 5MHTA 2NP6A 5A2GA 4ECZA 3ZHUA 4WLOA 4WZAA 1SZJG 2K7FA 1W35A 2IE8A 2EJCA 1BUIC 4HRSA 2V6JA 3DB1A 1Q2XA 3LBHA 1YDWA 3ZEIA 2ECOA 2F17A 4X5VA 2P40A 3IVGA 2WQ6A 5G4KA 2GEJA 3KHTA 4Y6QA 2FW9A 1HH4A 4QECA 5GINE 1F7VA 3I9V6 5K4AA 1C4XA 1UH6A 1HZZC 2W6PA 1UBFA 4HS4A 1I7QB 2NNWB 1JWMD 5T67A 4UQGA 4D26A 2QR5A 4E0DA 2DPXA 3RJ9A 2OBLA 2R00C 4YJHA 4C1BA 4B2IA 1QLWA 1T3HA 4DUZB 3DQZA 2K8AA 4KX6B 2OZLA 3PDIA 4P3YA 4YT8A 1ZYQA 4NBSA 4DSFA 2CLFB 2HIHA 1Z16A 2PVGC 3I61A 3EMBA 4EZ6A 4Q1AA 7ICHA 1W0KD 1HG1A 4RV5A 2H0QA 3KD3A 2YTUA 5LQSA 4NL9A 1WGDA 1SGHA 4GC7A 3V1LA 4X1KA 4W9DA 4MDHA 3M7IA 4AECA 4E0BA 3PFHA 5DBOA 4UW9A 2GN9A 3WYDA 3RUFA 3PGXA 1TK5A 5ALEA 3FBWA 1GN9A 2UYYA 2O19A 1IXRA 5DB9A 5HQ3B 1K4KA 3CW8X 4E1AA 2ATCA 3TSSA 1UJMA 4NXNB 1U9IC 1RRVA 3ML8A 4CMCA 1XZDA 2ONZA 1Z36A 4PLVA 3UF0A 3RS3A 2PT7A 5HCUA 1AV7A 1J56A 3NONA 3IE2A 4W5RA 1HZJA 2PO5A 4G50A 2R7KA 4M9HA 1DT3A 1EUDA 5C4IA 1NBHA 3H4VA 4BFLA 3ZHOA 4BFWA 1CB0A 1CE8A 3B08A 3OEHD 1CRZA 3GUVA 4RQ2A 5C7LO 3VU0A 5KNBA 1YX6B 3RS4A 1QONA 3Q9NA 4PLGA 4LK2A 4PTYA 4BQOA 2ID4A 1Z74A 3HV0A 4HGNA 5BOLA 2Q3BA 3CCCA 4PC2A 3WIUA 3IG5A 5DPSA 3BL5A 3I83A 4ETNA 2Z95A 1JAHA 1FDUA 2C5EA 2ZM6B 3JX9A 4RK1A 2BMEA 1UMCB 3F5FA 5JSZB 1Y33E 5HIIA 5K51A 4MI6A 4ED7A 3RDPA 1ZUD1 4DY4A 2BISA 2I2AA 4OYRA 4D8YA 3MD9A 1J99A 2AZMA 1TKDA 1BX1A 1C3VA 2BGTA 5F5LA 1BW9A 2QSJA 2BMWA 4EPWA 5AVTA 1VKOA 4GL4A 1U2GC 3CF4G 2C9MA 2JXJA 4DSUA 4JPSA 2VHQA 3AG5A 4BJ3A 2EQAA 2JZCA 3T34A 3HB4X 3VO1A 4NCBA 4FC7A 1SG6A 1ZH6A 1AN8A 5IVIA 3ZWBA 2I29A 3UGJA 3MB8A 1FTQA 4RMIA 2X42A 1X9MA 1TKGA 1US8A 1V8OA 2A1TR 3OSPA 4E5SA 4X71A 4I1UA 3VYUB 1TIFA 5EXDA 3P26A 4L6CA 3KSBC 2XBUA 3MJ4A 3ESZA 4R2KA 4KN7A 1E66A 4GX0A 5TVGA 1J33A 4DDHA 2YVCA 1DQYA 2UVPB 5CIWA 4HS9A 1Y8CA 1K5DA 1SGGA 1F5NA 1RYSA 4I27A 1ZD4A 3HVHA 3FVTA 3C6KA 4LBZA 1SXEA 3OZWA 2WTUA 4IL5A 1YB1A 2GCGA 4QDKA 1RMQA 3TI9A 1E6KA 4DV2B 3IKVA 4ABYA 2WXKA 4PHTA 3ZGLA 5GONA 2IX9A 2O1WA 3PGJA 1AGXA 5CHYA 2PX2A 4EE2A 3VKWA 5IJ0B 4QWEA 3ODGA 3W34A 3NJ8A 2QBYA 4TZ6A 3BWYA 4RKWA 4YN3A 5BT9A 4C0WA 1P44A 2WLTA 4PZAA 5CB0A 4C7KA 1N1EA 3WKBA 3DCYA 1YFKA 1SPXA 9ICIA 3A4NA 4GLBA 3TZ6A 3JQ8A 1H5NA 5B7QA 4B7XA 1ECGA 3H11A 1A0OA 2YICA 1NBFC 5HFYA 4F7DA 1MJNA 5JSYA 4MV1A 3W2IA 1TD9A 1R6AA 1Y8AA 4HDRB 1YACA 1X80A 3GB9A 2C0PA 4EL0A 4Q6BA 1NNUA 2ZBUA 1QK4A 4YP5A 2XNDA 5C5JA 4KR9A 3AQEA 5ELLA 4EUNA 3V9PA 4UNRA 1MOZA 5DGXA 5JWOA 1ESNA 2CYAA 1BZYA 4K9NA 2WXRA 1GPKA 3FSGA 1UANA 2PBLA 5I7AA 3V05A 3USCS 3FWKA 2NV0A 1OASA 1P7EA 2CCGA 2Q99A 4RJLA 1AHIA 2A67A 1PDWA 2A84A 1EDZA 3W90A 1FLDA 1K3UB 3EVTA 3KTOA 4OHWA 4EKUA 2J3QA 4FGJA 3V61A 3BQ9A 3BIWA 4EB8A 1J24A 2QLNA 4U6NA 2C2RA 4C2TA 3KKZA 3FOZA 5E0OA 1UZLA 2PFQA 1EUQA 4TVSA 1VKNA 4GOOD 1SBQA 5LPNA 4BU0A 4FBMA 3SQMA 3RB8A 3EGDA 3R5FA 4MTCA 3M5PA 1ECBA 1YJJA 2OXCA 5JRJA 3EZ2A 4DNPA 4V2IA 4W9MC 3VOAA 1OBHA 4YASA 1ULSA 2XGGA 3UMMA 4UAZA 2Z0EB 4BWFB 4F4IA 3ZWYA 2XUPA 2H3VA 4TT8A 2RD0A 3OKPA 1H8HA 5BXYA 3LCUA 3QMVA 2VP9A 2JH3A 4WNAA 1X8XA 2XB6A 1UMDA 3PT2B 5EWJA 1HNWB 3LZDA 1XMVA 3DBRA 1ZJ5A 1Q0ZA 3R23A 4RL6A 4YRIA 5CUQA 4LZAA 1W0CA 2BPSA 1OTHA 2I03A 4RA9A 2J30A 1LC0A 4UEJA 1CQJB 3ZJTA 1X1QA 1PT9A 3G9UA 2V7QA 4DXGA 2IEAA 4GEGA 1SBBB 5U9CA 3EODA 3FHCB 3RAJA 3ZIAD 5FV7A 5AKEA 3A32A 3A11A 2Q7DA 1AC5A 2PX8A 2I1KA 1R50A 3CLVA 3GWGA 3SK0A 2R4UA 1QWSA 3ZJUA 5D3QA 1UOPA 3Q7PA 4RS3A 4YJDA 2I5HA 1YR1A 4BV2A 3NX4A 1UJ4A 1Z0ZA 3QVKA 1G8FA 4KIKA 4AKHA 2W7OA 3R6WA 3TEFA 4PFQA 1RIIA 1DUVG 3EXFA 2PCJA 2CNOA 3QF7A 1T8YA 4AM8A 1I80A 2AEHA 2QP9X 1KEZA 3MUEA 1I8TA 2IP4A 2CJFA 1BXRA 1SBYA 1C1XA 3FVRA 4TV3A 1X19A 3ASVA 1EXDA 3UEOA 2JIPA 2YDYA 4PLTA 5H8WA 3ZLVA 4RQ3A 4D9CA 4G0OA 4ZVNA 2QB1A 2PFOA 3NH9A 4YO7A 1VZ8A 3VKHA 5FUWA 1Y5LA 1XWIA 1WM2A 3A2NA 3INGA 3MTIA 1XAJA 3EFOA 2QARB 1UMDB 3MTGA 4K3BA 2NT3A 2JIZD 1NJSA 2RJ3A 4GOND 3EVNA 2Z8YM 3WL7A 1QR2A 2PX3A 3LBFA 3NJ4A 3D8UA 1ENPA 4C0XA 3MLBA 6REQA 1X86B 1U5CA 4KYVA 1UXGA 2ZZKA 4UMDA 1EAMA 5IF9A 2X5KO 1TZCA 2GJ8A 4RCVA 4EO4A 3K6SB 4BMPB 3V8RA 3FDXA 5AKJA 2BUAA 4PTLA 4M9LA 1J39A 4BBNC 5TDHA 4D9EA 4YJ3A 1L0BA 4RTQA 2CKDA 3FSRA 3WU2U 1UFOA 2IYVA 5CBKA 1SXJE 3AJRA 1T0HB 5CVUA 1N8NA 2YV1A 1B2LA 4RVNA 3E2IA 2QVYX 1QQ6A 4I9NA 1IUEA 3Q3FA 2FPWA 5BW8A 4E14A 3AEEB 3S2GA 3PO0A 1ZAKA 1L6UA 1GD1O 3GB1A 5JJLA 3LVQE 5C1DA 3KLMX 1U6JA 1K4YA 7ICGA 2UYCA 4W8OA 2HNAA 3C3CA 5PGMA 4YIKA 1RYDA 2XITA 5CGQB 3P42A 4G0UA 4CF3A 1ZMOA 2W6NA 3MZ0A 3FD8A 4G5SA 1XDBA 4MUYA 1KVQA 1KP9A 5HKKA 2FEXA 2FZVA 4TL8A 1ZETA 3UG7A 1A04A 5P21A 3CGGA 5CK5A 1DRKA 2PKQO 3D5QA 2LDBA 3DVGY 3WAJA 3HH8A 4PT5A 1E6MA 5CBPB 3KXIA 2MHCA 1GYRA 3T38A 3T3EA 4RZSA 4OPMA 2IPMA 4LYYA 1NVID 4REMA 4IKPA 3JPRA 4D8TA 2BRUC 2HLDD 4QFCA 3K1AA 3M6LA 1OKKA 5HUJA 1UDAA 2C77A 3R3JA 4J16A 4F5RA 3L9XA 2EF1A 4YUYA 3KUKA 3BQ7A 3EDRA 4C3UA 4DV0B 4MCJA 3I04A 2WZDA 3C5GA 5ENDA 4I2VA 4GLJA 1ZC3A 5JXIA 4Z8XA 2YUIA 4BNTA 4XB6B 3OHMA 4HYQA 3I5XA 2C00A 3M8RA 1V45E 3GZNI 3OZ7A 2UU9B 1WDLA 5DHTA 2VDJA 1XAIA 1V25A 4Z6EA 5LBTA 5F3DA 1JDUA 2ZBFA 2WX1A 3KELA 3AXSA 2VXCA 2VAMA 1H8HD 3LP6A 3VPCA 2HTHA 3PUZA 4PRKA 5AW5A 3AN1A 3BF8A 4AJ2A 2Z08A 3JZFA 3FW1A 4IWNA 2VJYA 4P84A 1QS0A 4GP7A 3TOXA 2GZMA 1BKDR 1WUDA 3WA6A 2C1ZA 3CRQA 3E1KA 1QYXA 2F8MA 1XMOB 5KREA 1YI8A 1YQ4B 1S4QA 3ZCUA 3LVFO 3SFVA 3GNQA 3NVAA 5HFNA 2H52A 3Q0TA 3GJXC 1VKZA 1AV6A 4WJKB 4PPXA 5BSMA 4PIPA 4H4DA 4C4RA 1NBME 4URYR 3HXOA 3ZBQA 5F3RA 1FVXA 1VA4A 4NX2A 3P96A 1V5TA 5JAQA 5AW3A 4HT3B 3CLTD 2VJQA 1Q1QA 3MCVA 5BUSA 1YMQA 3HYSA 4BQRA 3EZLA 4D9JA 1E3SA 2FHSA 3NBKA 1P5RA 2IC5A 2HJ9A 1JVNA 4ZHQA 1YN4A 1E69A 4J0QA 4U2FA 4LJOB 4OSPA 4TMXA 3FCOA 2QM7A 1MGPA 1DG1G 2FCRA 1I7SB 4IEEA 3GELA 1KRWA 3ZNPA 2XMQA 1JP7A 2EJWA 2IJGX 1OAAA 3GLHA 2QR2A 3WP1B 2ENWA 3WLHA 2BR3A 1Q0LA 2QL7A 5TEVA 2FP4B 4BASA 3LYAA 3BIXA 1XSNA 1NP7A 4UTNA 2ZU0C 1Y6JA 3HCFA 5LIRA 5LJIA 4UAWA 1BXGA 3IUYA 4UDNA 3QKSA 1Z7WA 3KE9A 5K05A 1VJDA 4RK6A 2NO0A 1J06A 1Y9JA 3DHWC 5MGNA 1W94A 4HH0A 2KE7A 4DCUA 4PC3A 5BWBA 1KQOA 4US1R 1P0QA 1KSPA 4IILA 2WG2A 4AJJA 1NBWB 4LQCA 4GM4A 1P5HA 8ICJA 2RG1A 4IRXA 3TMYA 4GYKA 1BYIA 3GAMA 3BGVA 3KFLA 1XAHA 4A8HA 5FNZA 1ULBA 4BFZA 2GTHA 3KVFB 2XZPA 3GDHA 4LKOA 3K96A 3NEYA 5L1LA 1NL3A 4WL0A 2HJ8A 4NBRA 3MFIA 1J2RA 1PV1A 3F3MA 4QWWA 4JSRA 1MVKA 1ES9A 1KK2A 1V43A 2OP1A 5DBBA 1GVHA 4TMKA 3DHYA 3BE4A 5MF6A 4YT2A 2C88A 2QZ9A 2BZSA 4OATA 4XE5A 1GGFA 1NYLA 2CKHB 4CMAA 3O4RA 5DRYA 5ANRB 1Q1GA 3IE0A 3CYMA 5J2UF 1J9ZA 2C98A 2O3QA 5BOSB 1A8IA 5JZVA 2HM7A 5J5CA 4KQXA 4CUZA 2J1LA 4P6VF 1LBQA 1ZKMA 2DWUA 3LHKA 4EKIA 4PBSA 1Q0TA 4R2IA 2RK4A 1WHTB 2ZRCA 4N7RA 4DF3A 8ICNA 3L4BC 3VA7A 1D1PA 1V35A 1LX7A 2COUA 3QOYA 3VHTC 3HWRA 4LNKA 4EUFA 1NUPA 2FSVC 3E3LA 1CUZA 1XZAA 1X7WB 3DAOA 3X0WA 3A9KA 3FCUB 1ID1A 1V4NA 1J2YA 3SY8A 1ISJA 3M49A 1JR3E 1KP2A 4X91A 5IDWA 3ZK9A 5U1PA 3PUKA 5FORA 4PSVA 2G0AA 2YIDA 1NZJA 1ATZA 3BHMA 3PXDA 2WTXA 2CD7A 2V4RA 2GD1O 1VI6A 3LUGA 1PN3A 1LI5A 2VBGA 5F21A 4DBLC 1UL1X 3Q3OC 4PANA 1OXVA 2O2XA 3ND7A 3TQIA 4XJVA 3TM4A 2ASEA 3JQ6A 3RPEA 3N2IA 4YAIA 3AEAB 4IICA 5I4KA 4GKJB 2C9DA 1W30A 1J2EA 4H17A 2RSLA 2XNJA 4GQAA 4GGQA 1QV9A 5B5EU 2Z4RA 2XUQA 4KIWA 2HTFA 3WC4A 1HM5A 5AVOA 1AROP 2Y0EA 1K92A 2QX6A 5I7SA 3ZH9B 3QBDA 3ADPA 5KFMA 2NUBA 1EE2A 4ON9A 1JB9A 1J7JA 1QTMA 1SVNA 3FGOA 3T4EA 1TBEA 3FNIA 3HI6A 3LK7A 1XD9A 4KYIB 1A1SA 1VGVA 2YH2A 3TAPA 3TACB 2JXTA 3VZCA 5B1DA 1M2HA 4R2MA 2NO6A 2PT9A 2JZOA 4DS3A 4K0RA 5T5QA 1R5BA 3FSEA 4DDGD 2VLBA 3FJYA 4GOKA 1YULA 2WXLA 1X7XA 4ALMA 2IUFA 3U09A 3HJRA 1SIOA 1RPLA 3Q14C 3N74A 4DA8A 5FKAC 1P4HA 4JT2A 5G41A 2NCNA 3IP8A 4FOSA 4JN6B 1OWOA 5AUPB 1IM8A 2EATA 4LHEA 5ALDA 4IR1A 1FOEB 3P19A 5IC5A 3T7SA 3ZJ4A 1PG0A 5B3JA 1FA9A 3ONDA 1IBXA 3M4YA 2REQB 1TMKA 1CR0A 1DX6A 2WOJA 4ZJZA 2WJAA 5CM8B 2AQ0A 1PHPA 4Y2VA 1KJTA 1U5BB 3ENQA 2FG5A 3FYDA 2IDZA 2PMBA 4MKHA 4OXRA 2XVXA 2GNAA 1DOQA 3RR7A 4ISCA 3OIVA 1W0JD 2H48A 1SUIA 4WY5A 1ZJYA 2QL5A 4C78A 2BMDA 2IELA 3EDQA 2PH5A 5FOVA 3E18A 1KGDA 4HWPA 2XTJA 3DDCA 3RTBA 1WXVA 3N05A 5CNKA 1AHNA 1DQPA 4R31A 4GGOA 3RT9A 2E4VA 2CY0A 2CUNA 2FW6A 3GD7A 4V0QA 2WA1A 1M1UA 3HJFA 3WGIA 2AX4A 2NU9A 1ZQPA 4S05A 3PUWA 1MJDA 4A91A 2RAFA 2ZIAA 2JFFA 4B3SB 4ZTBA 1UOQA 3V4OA 2V9ZA 1KK0A 2MJEA 1HTTA 1W96A 3ELUA 1ZZGA 1V8ZA 5JD6A 3O3NB 4CQMA 3AUFA 5JRTA 1QWOA 1C30A 1DEAA 1W8IA 4C8KA 4GVPA 2P9QA 3H7PB 3NHZA 3T1HB 4A0SA 4X44A 1QV7A 2NVBA 1JH8A 4YQEA 3NT2A 4ECWA 3UFXA 1MQSA 4Q34A 4QDUA 4YP9A 3PLVA 2NRXA 4BNYA 1F48A 2P66A 4IMPA 4ECEA 4F97A 1X87A 5BV0A 1SZPA 4GDKA 3W5VA 2BEUB 2YWXA 3QOWA 3QXJA 3UPTA 4U7PB 4EYQA 1Y4ZA 3G8YA 1JKJB 1D5ZC 5F9MA 2UUOA 3P0RA 4F9TA 3OLQA 4NEGA 5IDVA 1ZA2A 1FU8A 2ZSHA 3ZVKA 1D4FA 2B3AA 4BJHB 4W5WA 4A8TA 1TZOA 3LXUX 3RSQA 4IQGA 3ETLA 5ED4A 4FFNA 4NAWA 2C9WB 3U2SC 1N3IA 3P9SA 2E5WA 4W6ZA 4PYKA 1FNBA 3ZKJC 2EOAA 2PYDA 2YXDA 4HEJA 4LVOA 1W47A 3VPFA 1KR2A 1RYYA 1WGHA 4HRAA 4MUGA 2VK2A 4LSZA 1XZQA 1IJBA 2WTNA 1EESA 1PP4A 4YRRA 2LXNA 4TKLA 1B0XA 4ZI7F 1U0RA 1JZSA 4H7KA 1J5EB 1C3JA 3FG9A 3W7AA 2D2QA 2A57A 3DV9A 1ZJJA 3LTEA 1WE7A 2XT6A 1BE1A 4PZZA 3W4KA 3EC1A 3Q8XB 3B3GA 4F4HA 3DNFA 5EIBD 1VECA 1HDCA 1LPAB 4DQIA 3VTAA 1A2BA 4GICA 2LGYA 3MUFA 4MLCA 4A9AA 5KVSA 1DINA 3O03A 4NZOA 5K3FB 1A7JA 4DSIA 2R84A 3OMWA 4FHCA 1IEWA 2M6SA 1TM5E 2DQ4A 1KXJA 1XTKA 5DNCA 3AEQB 3MILA 2QF7A 3ZS9A 2H3ZA 4IV0A 4ER5A 5DRTA 1FNNA 3UGKA 8ADHA 3WMRA 2WTMA 4PZYA 1YVEI 3CISA 2P41A 2IEYA 5ADVA 3THWB 2YCLA 1I4OA 5GZ6A 1WXFA 2H31A 3PA8A 4EYSA 1CX9B 1ZQYA 2JFHA 5JECA 2HVIA 3VQIA 3FGPA 5ES3A 5KG0A 4TQRA 4DV3B 2VOJA 1REQA 1XMSA 3NG0A 5BNIA 3SR3A 4Z6KA 3N2GA 3LKBA 2P5SA 4CM7A 1WCNA 4MB2A 4QFMA 2ZS8A 1R4NA 2HQBA 5TMPA 1CUIA 2NBWB 4QG3A 3DEZA 3IFSA 3TXXA 1DIAA 2Q6VA 3JPWA 4PGGA 4RA6B 4C7YA 2QMHA 5BN5A 1FUKA 4EKYA 3PJEA 4XM0A 3IA7A 4EG8A 1J90A 5JH5C 4RNCA 1UKVY 3RVKA 1XROA 5J0UA 4YRSA 1IBRA 3AIIA 3FTQA 2CJWA 3NHMA 2WG0A 1D5CA 1V2YA 1E3WB 4Q7KA 1GG2A 2IJ0A 3S8EA 4BDPA 4B71A 2YZ2A 2WFMA 1G6JA 4NAMA 4ED2A 1UJCA 2DFNA 1PVQA 1II0A 2VCEA 4IHQA 4MIEA 3BK1A 3B1KA 1PNOA 1C9FA 3PE4A 3VXKA 3M1AA 2YX1A 1CRXA 1XCOA 3L0SA 5DM4A 1G8MA 1IGDA 3I6IA 2IPKD 2I1LA 4J9VA 5BWOA 1Y48E 4IFIA 3V8QA 2X3YA 3QE0A 5FX2A 2PEYA 4JL8A 3QGMA 1XXHA 3A0RB 2R97A 2IWRA 2ZR7A 3SYLA 4DLRA 3RH4A 4UOQA 2CFCA 1VLHA 1XQWA 3MRXA 4KN6A 1W5EA 5T57A 2XZOA 5T8IA 3S28A 2X4GA 4O2AB 4Q9IA 2Q1WA 4XD7D 3V7FA 3QSYA 3Q6IA 5IK2D 2H5LA 4P4TA 2JB9A 2WZQA 4E3CA 3KKOA 4NBWA 2AFIA 3J81j 2VP2A 1M54A 1ZU5A 3LLVA 4LV8B 3OLVA 1AUQA 2CLIB 4LWZA 4E09A 3BL6A 3OM8A 4A0RA 2VTVA 4RACA 3BH7A 4RM8A 4U7FA 3I39X 3KPVA 4QBHA 2CD9A 3ABSB 3VR4H 4EPRA 3WJAA 2D0IA 3P1MA 4ZALA 2ECPA 1QGUB 5CDSA 2FN8A 4QLOA 1E9DA 1A27A 2Y0PA 3TDKA 4HRXA 3MJTA 4CW7A 1OWNA 4RKRA 3C1UA 1KPGA 4LDZA 4FR2A 4LMRA 5G0UA 2RONA 2QI9F 4N8SA 3VDMA 1IYZA 3K0HA 1HOTA 2O59A 3AEQA 1ZR2A 1DKQA 4HJRA 2OHFA 4IJUA 3LVWA 5FUVA 3FI9A 2ZYWX 3J81A 3SXJA 4LXHA 2XNKA 4UE2A 4K3UA 2XY4A 1WF6A 3FKYA 2PAFA 5BV2P 2PRZA 2H3IA 4MUAA 1U81A 2IT1A 2UKDA 1QYRA 2MX2A 1YZUA 4OXXA 1T0SC 2X9VA 5M04A 1NVEA 4GLOA 1MQ9A 5B6JA 3OT1B 2C97A 3DOOA 3RBXA 2X6TA 2WABA 4DQUA 3KJFA 4RK5A 1WA5A 3RS2A 4IXNA 8ICYA 1UGMA 3ZI7A 3KZMA 3N3KB 4K7UA 1RWKA 4MR8B 1RTTA 1ZOYB 2IEGA 4K81A 2FIFA 4NBTA 1N3LA 4HF7A 4B3DA 1IBCA 2CHEA 2R2QA 2AXEA 3PNLA 4XCVA 5LBUA 1THGA 2FPIA 5BPFA 4MHTA 3KWVA 2GN2A 3R7WB 5JC1A 4RY2A 3AZOA 2PHZA 2F1JA 3B5EA 4Q2JA 3QQPA 3PSIA 3C74A 4WACA 3NC4A 4GI1A 5FT9A 2GKGA 1JIKA 4JI3B 2FJ0A 1IEVA 2VWQA 2J7PA 4LJYA 2I4RA 3HUDA 4AJNA 1ZAYA 4GC9A 3RAGA 4RQ5A 4C2BA 1K8XB 5JH7B 4ZYUA 1FP1D 2FWBA 3RBDA 2HK7A 4N0PA 1P3JA 1F06A 1M34A 4XR4A 3I6MA 2YXNA 3LRPA 3UMYA 1LTKA 2VUTA 4WKNA 2D3GA 1ED1A 3RO7A 3KLNA 2GD0A 1E8DA 3AHDA 4X94A 5F9HA 4BX2A 2W6OA 3WLPA 2ZITA 2QIEB 4LCDE 4M46A 2HMAA 4KI0A 3PNCA 1H4VB 3TSWA 5EHZA 5EJAA 3AJEA 4AKEA 2GPBA 4R6WA 5B58C 3L1VA 3AULA 1ZNYA 2WTEA 1E4OA 2PKQP 4GMHA 2MWSB 1QBGA 3W2TA 1J0GA 3BZCA 4MJLA 2P2DA 2ZIWA 4Y0VA 4GG1A 3ZGNA 4N7JA 2ZSKA 5L3SB 2FJ6A 3R3ZA 4RULA 1VPTA 1CFJA 2FSUA 5FBKA 1A9ZA 3FHOA 3RC7A 4TYWA 3M3JA 2XCPA 3H1BA 1I2CA 4AXXA 2Y1IA 4FEYA 4R9VA 1OI3A 1K1EA 4NTZA 4B31A 5D86A 4BLVA 2FZKA 1QSYA 3RODA 5F2KA 4PCUA 2P9EA 2Z5LA 5LYJF 2B6GA 3TNJA 5JO0A 4KLHA 4XW2A 4BNHA 2NPFA 4C4OA 1CUBA 3M9XA 2QTWB 3D2CA 5D1NA 3AUYA 2QA5A 3D8SA 2V58A 1T9KA 4K9PA 4O4IF 3LRXA 4GNKA 1K66A 3DLPX 4RH3A 4GP9A 2NMQA 1AE1A 2GLTA 5EWLB 1AS0A 4RZHA 4UQOA 4OK6A 2O7RA 2WHRA 1GLNA 1V2GA 4TZ0A 4FZLA 1G64A 2H5XA 4EHIA 2PA3A 1BQ3A 4WOBA 2DLDA 1BVYF 3SBXA 2NTYC 4Q48A 1W29A 3NS1A 4N7BA 4KQCA 3AUSA 4KVGB 2L52A 2ZUCA 2J09A 3HB1A 2FLLA 3QVJA 2JMGA 1U3UA 1RAEA 1WDWB 1FX0A 2ZIWB 1QSLA 2K4HA 4QWCA 1L5ZA 1C14A 5LM3A 4W9FA 1SKYB 3S44A 4PC7A 1VMIA 5AW4A 4DMMA 4YXWA 1ZRMA 2Q3MA 3DMTA 3CMMB 2FPUA 1F0PA 1BHQ1 1AGRA 2P67A 3E7XA 4AKIA 2F3TA 1NN1A 1TMOA 1YZ6A 5ITZB 4JYBA 5JNRA 1V5EA 3P4UA 1Y6QA 3DZDA 4QBIA 1UXHA 3HN6A 2VFAA 1BNOA 1Q6ZA 4G97A 2R6FA 5FBZA 5TY0A 3RAEC 1A9PA 2GBIA 1XTZA 4XPZA 2JHCA 4G41A 5LQKA 2X9NA 1PT6A 1QLBB 1FS4A 4GDFA 2EV9A 3O8LA 4TS3A 2WWHA 5BSWA 2Z0DB 3KQNA 4AJLA 2YHIB 5DG7A 2E8PA 3GV8B 3G2JA 1PUJA 3I4FA 4YCCA 4S1TA 4PTZA 1JECA 1XXHB 5AWFC 5A5GA 2KNJA 2DQNB 1UR5A 3I6QA 4FYPA 2DTDA 2V5VA 1C4CA 3SAGA 2HV8A 5DK4A 3IHPC 2P27A 4URHA 2VPIA 2O2HA 4L85A 4M00A 3BGWA 1TYAE 3K70D 3NFRA 4RQUA 3EZ9A 1RFGE 1A4IA 3J7AC 1MOSA 3TMAA 5BSRA 1Y4AE 1QYIA 1QH1B 1QRTA 5KU7A 4H0NA 3FKJA 3WJ1A 4DCNA 1RYEA 1FP4A 2YC2C 2GHIA 1K8RB 4KQ2A 2EF0A 2I4NA 4D6YA 3KB1A 4GC6A 3TZKA 1TU0A 5IH7A 3CH5A 3ZCQA 1D3ZA 3OE4A 1Q7GA 1L5GB 1ZFNA 5C3JB 5CEJA 2FZEA 1Z1BA 1BPYA 5KFXA 1G2PA 2IKSA 3OX1A 2WYVA 4L7QA 4TN1A 2A33A 3OE1A 3LBNA 3OMLA 4G5RA 4WW0A 1OUQA 1IK6A 2A0FA 2JS7A 2GVDC 2Q3DA 5DZSA 2LDXA 4RF5A 4BPBA 4XIFA 4JU8A 4F4KA 4DQSA 2C2OA 1U94A 2B1RA 1S7CA 3CONA 3E9NA 1AH2A 1NXPA 4XQEA 4WGGA 1F12A 4I5FA 4HUQB 4IKOA 1JDBB 1ZICA 1GFWA 4EY3A 1E6UA 1JHVA 2ZUUA 3PX2A 4XDDA 4WOJA 2IZVB 4DIDA 2PZGA 3QXXA 1U3CA 4HDKB 1E3EA 2V6IA 1JSRA 5J17A 3OZFA 1EVEA 2WYOA 3NOOA 4W9KA 1KY2A 1TVEA 1ZI6A 4IX1A 1F44A 2J0SA 1N5JA 2LCFA 2E3JA 4XWGA 1NJYA 1R6XA 3P52A 3IQZA 5AVRA 4V0KA 1CETA 1E7PB 1NUSA 4KQWA 4ZP1A 1KU0A 5C23A 2CF5A 4Z4GA 3ZHVA 2GF0A 2C92A 2ONJA 4XB2A 4WV3A 1H0RA 3W3AD 2WU8A 2GERA 1P0PA 4NC9A 1XNJA 3MTQA 5ARBA 4C3OB 4JXKA 4RPXA 1ZQEA 1XEAA 5FHQA 5BPCA 5D2MB 4G1VA 4M9SA 1U9CA 5BVHB 2ASQA 5GV7A 2PH3A 3IVAA 1PQWA 1X8JA 3BZBA 2X2EA 4DT1B 1C29B 5LZ2A 3EOBI 4XGQA 2AL7A 2HDNB 1HE8A 2OCBA 1NMZA 1P4RA 5KTTA 3D4LA 4Q3NA 1GAJA 4CTKA 4AURA 1U45A 1YZLA 5JSHA 4Q93A 4WKPA 3AR6A 3Q2IA 3I1IA 1G18A 1C8BA 1DK2A 2IHYA 2DSTA 1QE5A 1ESDA 4UHDA 4TWAA 1O5TA 3PPWA 1KNXA 2ATLA 5EIWA 3HU1A 1F2VA 4D02A 2D8MA 1KEEA 2I3DA 3N86A 4CL0A 5JXHA 3AL0C 4P5EA 2A0YA 1BOOA 4M0EA 1QIJA 4WFKA 4OG2A 1WLSA 1JQ3A 1XSPA 3HXKA 1O5OA 1GC6A 3UN1A 5K20A 4YEDA 3AV8A 2KIVA 2X9GA 5ARCA 1KFDA 4BZWA 4MWEA 1KSFX 3ICWA 1CWUA 1HURA 4WXYB 3N5KA 2EDCA 2Q49A 4OI4A 5CNJA 3G7SA 2AUTA 5GM1A 2SBTA 4DXFA 4PLWA 5IIJA 2I6SA 4X00A 3K0EA 4PRLA 2DR3A 4RV4A 4DCPA 3JASA 3O38A 1LQBA 2DYOA 3I30X 1QHHA 1NW8A 3VH3A 4GUAA 1DBSA 4LUCA 4RHCA 4YAJA 4XVQA 2FZWA 2ICAA 4LI0A 4MVJD 5KTYA 3D0QA 5HRAA 4JR1A 4R9SA 3QHPA 4RZ2A 4PX5A 3GV0A 4K9LA 1C1YA 3OE7D 3GRRA 4HNHA 2DHZA 3ROGA 2FE1A 4AMGA 1HLGA 3O5AA 4KKJA 2BI4A 1T0UA 4Q3BA 4S1OA 3RG8A 1H1DA 2A0WA 3UOAB 3FGZA 1ZP0B 1SJ9A 2YN2A 2WF9A 4EZLA 4QWDA 4YP1A 5CIYA 2KHQA 3SFZA 3PEFA 1B14A 4QJFB 3NC0C 3MF4A 2WIBA 4HRVA 3ZZNA 3PHCA 2HI0A 5JDCC 4ELTA 2C5LA 2IY1B 2AYZA 2BVNA 1T1SA 3D4OA 1RXYA 2L1AA 1E4EB 3BS4A 5E79U 4LOAA 5JXJA 4DZRA 5L95A 3KB6A 5G3YA 4I55B 4L0MA 1XP5A 1NZPA 5JQWA 1KQ3A 2NRTA 1VCOA 2IGTA 3ZPXA 1UM9A 3DHEA