5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
4XSGA 4XIGS 5F98A 2IEYA 1Q44A 1E96A 2J3EA 5AK0A 4B71A 1JW9D 1Z47A 3W3AA 3IGFA 1BKDR 3CX7A 2D3WA 1QDEA 1I4DD 3LXRA 5ANRB 4A82A 1FPMA 1SVWA 2F7SA 4F4IA 1BO6A 1XNJA 4G01B 5E7MA 1ZOYB 3WHKA 1VG8A 2JLVA 3SE0A 1MO4A 3GFPA 3A8TA 3P4XA 3T12A 2XNDD 1A1VA 4YMTA 2ZYVX 2CE2X 4JLJA 4ASUA 2BMEA 3AEEB 1U8ZA 2QAGC 3C5HA 4BASA 1E6EB 2YWHA 3AVOA 1FNNA 1S4QA 1KJWA 1IN5A 3IPXA 3DM9B 1TEVA 3FKSD 1QHHB 1Y63A 2IEZA 2R62A 1XO3A 2RHMA 3NH9A 4Q1CA 2J9RA 4OQLA 2P65A 1J8MF 4RZ3A 1XP8A 1QLBB 3CH4B 3LO5A 3NVVA 2EW1A 3B60A 4M2LA 4M53A 4P4TA 2QROA 2CDNA 5FPKA 1R0XA 5B58C 2G3YA 1M7HA 2G0NA 2REOA 3T15A 3EIEA 1L6UA 3VAAA 4Y0AA 4DDWA 1YQ3B 2JJ2D 4KU4A 3THWB 4JWSC 2V1UA 3KKNA 3U7EB 2EYQA 1KHTA 2E9SA 2ZE5A 1UKVY 3LX8A 1XTJA 1Z0AA 2JLWA 1XX6A 1G291 1KZGB 2X19A 3K0CC 3LV8A 3TUZC 4D26A 5JI2E 3DWMA 4IOJA 3CX8A 5CLLA 4B35A 2QE7D 1WBBA 2GNOA 2OE2A 3CKLA 4MGZR 1ZM4A 1E9MA 4A6XA 3LW7A 1NMXA 4QGAA 1IXSB 2ZI3A 4IFEA 2JEOA 3C8UA 4C7OB 3GLFA 1GG2A 2AXNA 2GEVA 1CULC 4I1OA 5G53C 2XNDA 1VDVA 4CVNA 4B73A 2VP6A 1WDTA 2YC2C 3WMEA 3QG5A 4TL6A 5HE9A 4QKQA 1G16A 1DGJA 2O8BB 4I1SA 4DDVA 3CH5A 2WLBA 1N61A 4O0MA 2YYZA 3FKSA 4MYTA 1UFQA 2HCJB 4LBWA 2RGBA 5AJYA 1BYUA 3T5GA 2NMVA 1KI8A 4KCGA 3UK6A 4D82A 3DOEA 2AK2A 4GMDA 1BOFA 3PUZA 1GKUB 4HEJA 5P21A 3AE5B 2QPTA 3FHTA 3DPUA 1NLZA 4C3ZA 1RYHA 2AD5A 1QHGA 4JT4A 4Q4LA 1D9ZA 4BFSA 3ZZ0A 1EFUA 4P6VF 2JJ2A 2BBWA 3X2SA 1JROA 4DLTA 3U4QB 1UJ2A 4M1WA 3FB4A 3PVSA 1VMAA 4S35A 1O3YA 4EIWA 3IHWA 3SDZA 1YZQA 1SIJA 4RCYA 4NCHA 3QF4A 5EE3A 1KKLA 4LJ4A 4NCJA 3EXAA 1KDPA 2B76B 1VG1A 3UG6A 1VJKA 2GKSA 4EFNA 2MSDB 5GJCA 1IXRC 2GESA 4G3XA 4NP6A 2ZJ2A 2GJSA 1E9FA 3IDQA 2JASA 1XLPA 5EE9A 3AKDA 4CRWB 4NPHA 4QRHA 1A70A 1HQYE 3ETRA 1DTSA 4M21A 4JBYA 4NMMA 3AV0B 2WU5B 5BN4A 1E10A 3EPHA 3ONWA 2OCYC 4UNSA 3TW8B 2F3RA 4PO1A 3AKYA 1UF9A 2ODEA 3LVQE 4YSYB 4WZAE 2VF8A 4UXJA 2J45A 4PSAA 1ZNZA 4POAA 1AJEA 1IUEA 1VCMA 4YLGA 3SFVA 3BB3A 1XTQA 3DVLA 3Q7QA 3NG1A 2MMCA 4A6PA 1VCIA 3WNCA 2N42A 1ZD8A 4TWZA 4D25A 4D0LB 3RS0A 1N6RA 4D81A 1VYVA 4FXCA 2CCJA 2NQ2C 4CGZA 2QMOA 4IDPA 1GNPA 5AWFC 3ZYCA 4ERNA 2OCAA 3QNUA 4OQFA 2PKOA 3IUYA 3R9WA 2MH7A 4V0MA 4MRNA 1LS6A 2CLCX 2QRZA 2ZE8A 1FRRA 3M0EA 4LPKA 1E9BA 2QU8A 1T5LA 4B47A 5C2TB 4HRSA 2BJVA 4OI0A 3I8SA 2VSXA 1T6NA 1VG9B 4CEJA 1JBKA 2HT1A 1RM6C 2ZTSA 2G1KA 1W1WA 2GRJA 4WXPA 3UXMA 1QZXA 1YJJA 3EC1A 3RSOA 2IYSA 5J40A 4IEIA 2A30A 5JS7A 1EFHA 4B3FX 2JIZD 1NG9A 1XF9A 1M74A 1EFTA 1NENB 2XOKD 3C4JA 2B6HA 1JPNA 3MMPA 2FDCA 1GPXA 1EXMA 4US2R 1F3OA 1G3IA 1QG4A 3D31A 3RRYA 1ANKA 1DE0A 2NO7A 5J4VA 2PT7A 3ZS9A 3I8XA 3A58B 1SVIA 2ZM5A 1KO5A 2IUTA 1N62A 4TMTA 1G8YA 1VCOA 3P27A 4JMPA 3SNHA 1GNRA 1E2HA 3FYHA 3K9GA 3QVUA 5JBQA 1KF6B 3AEBB 4ARZA 3FDIA 3L0SA 3MFYA 1RYJA 2CK3D 4TQ9A 4FCTA 3QF4B 3HJNA 2VO1A 3T35A 2ODWA 5B30A 1YE8A 2FFQA 1P3JA 3QY0A 4D0GA 1IN6A 1Z6XA 3I62A 1XD2A 1R0ZA 4PC1A 2G1JA 2WWHA 1JJ7A 2WTUA 1FRDA 4BFWA 4PPNA 1I2DA 4X8LA 1KMHA 2LWIA 3DM5A 4MYUA 1OJLA 2NTYC 4W9MC 2BVNA 5G41A 2OT3B 2QI9C 4E5UA 3K0AB 2O8CA 4N0DA 4QNMA 1QF9A 1YKSA 2DFLA 2GCPA 4BEJA 2ZROA 1TKEA 5KSYA 5BYJA 1VPLA 4TTQA 3VTKA 4LGMA 5TY0A 3EZ6A 3OESA 2E1RA 1WA5A 1IY0A 4WWMA 5KSOA 1CR2A 1SZPA 2BM0A 2XOKA 2I4IA 2B7CA 4MKFA 3MUFA 4NZYA 3VKHA 1W4RA 4JLOA 3KQHA 1TF2A 2GAAA 2ZRGA 4ITKA 2F9LA 2C99A 2WIAA 4MRPA 5FOSA 4L9SA 1J90A 2ZI6A 2D62A 1ZUHA 1YZKA 3TNFA 2DHRA 3NEYA 1KZ7B 1MABB 4DLWA 3H0KA 2G77B 2ZIAA 5GJBA 2DWQA 4TTRA 1N2CE 1NJGA 2V9PA 3WHLA 2LKCA 1S1MA 4TZ0A 5EP1A 4ZKDA 2PVGC 4FXPA 2WWGA 4TN1A 3R7WA 1XJ0A 2CK3A 3VKWA 2FA9A 4PO9A 2ZYWX 5E7JA 2DY1A 2V3CC 3AF2A 3AE9B 4G5SA 1TTTA 2BMFA 3HYTA 3B7GA 4Q1AA 3W9CB 1WP9A 2H7VA 4BLRA 2O8FB 1KI9A 1KYIA 4TMWA 4BECA 1UKYA 2VF7A 3KB2A 4JZKA 1AKEA 1TYGB 2QMUA 4CEJB 2ZUCA 5A4JA 3CX6A 2NO0A 4GBMA 5GADl 1YU9A 1XB2A 5JCZA 1AYFA 1R8QA 3K9LA 4YMUA 2L83A 3GD7A 1S8FA 1FFHA 2KAJA 1SHKA 1TPZA 5DYIA 4PXAA 4B6FA 3T1VA 2ZRKA 3BIID 1U94A 4TQUS 1NSTA 2ZRJA 3SFEB 2PEZA 1TQDA 2C03A 1S9HA 1G41A 4HUQA 5HKKD 1YR7A 1IJEA 2J7PA 2JDID 1R2QA 3CRQA 4PHFA 4DIEA 1GL7A 4IXNA 2FX3A 3A37A 4YONB 3MSXA 1XLOA 5C4MA 3ECCA 1G6HA 1ELOA 4I1UA 3U2QA 2GVDC 4P31A 3NBFA 4A2QA 1PV4A 1SB3C 5E4FA 1Q3HA 4LZZA 3B82A 2EFDB 4ZDJA 3HDTA 2ZE6A 1OSNA 4FWTA 1M34E 3AEZA 5KYKA 3AF3A 4Q9IA 3TW4A 1GWNA 4RD4A 1W0JA 2IS4A 2IYVA 2ODNA 1SHZA 4I4LA 4LHWA 3VQTA 2J0VA 3A4MA 4G5OA 5EXSA 5IRCD 1ONBA 1VKJA 3KKOA 2WU2B 5EE0A 1CS4C 1HQCA 2Z4SA 4LJ5A 2RAPA 3QBVA 3FWYA 1G19A 1G3UA 2IYTA 2RCNA 3KXKA 3SYNA 2WMNB 1N60A 3NTUA 4DLXA 2A3RA 1UKEA 4BE7B 3SN6A 4JVSB 4RZ2A 1L0VB 5J4YA 1DG1G 1WB9A 1N6HA 2TMKA 3NH6A 4WXRA 1Z0JA 1LVGA 2XB2A 2K22A 1XMIA 3IIJA 1AQYA 5GXGB 2GZDA 2PX0A 2O8CB 2HTME 5EXXA 1E7PB 1OH6A 3QKRA 4LHVA 5CJPA 1NBMD 3PJRA 3EZ2A 3DKPA 5SZJA 4HLCA 1GL9B 2F3TA 3N2IA 1WGKA 5UKDA 3L43A 1FMLA 2OBNA 2O52A 1KNXA 3QPVA 1IBRA 1RRFA 1ZINA 2LEKA 4KYUA 3UANA 1G17A 3VR1A 3P4QB 1X8KA 4F91B 4C80A 4JSTA 2G6BA 3ADDA 1UBGA 2QIEB 1A2BA 1JXMA 1YZNA 2FN4A 2ZE7A 4GZLA 2JA1A 3W5JA 3VRBB 4XSHA 2VLIA 3AUXA 1NN3A 3LDAA 4TMXA 1U98A 1OXTA 3IILA 4Q4AA 3D8BA 4PHTA 3TKLA 4MKGA 2ZJ5A 1XMVA 1XD8A 3G5UA 4WBSA 2CVHA 3AVQA 4CT5A 2CHVA 1NLYA 3B2EA 4QG7A 3R7WB 4JVNA 121PA 3LBHA 3B78A 2J0QA 4GFDA 1Q0UA 4LYFA 4JLKA 4KITB 1XFAA 3A1TA 5JEDA 2WKRA 1ZIPA 5H92C 2GJKA 3Q5EA 2ZR7A 4OK3A 5DI3A 3X1DA 5AUIA 4JS0A 3AE2B 1LF5A 1KAGA 1U0LA 4JL5A 3RWOA 1FM0D 1KSFX 5IF9A 2ZUBA 3QOFA 4PZLA 1GOTA 1H65A 2WKPA 3GJ6A 3DMDA 3QKUA 1VTKA 2DFNA 2B21A 2A9KA 4FCWA 3ICQB 3IQXA 1W44A 4KBGA 3LAWA 3ZDQA 5HCIA 3GLIA 1NBMA 2RGAA 1L7VC 2F1RA 3GJ5A 1RFLA 3KUCA 1CJKC 5G3YA 1QOFA 5DN6A 4QL3A 5JS8A 2C95A 1Z8FA 2KE5A 2I3BA 3BRWD 5TDHA 1IJFA 2D7CA 4HDQB 1GILA 4L4UA 4LHYA 4C0AC 4JYBA 5C4GB 4OK6A 1G18A 1IN8A 2J0UA 3GEHA 1FW6A 5EZ5A 1XEXA 2IS1A 1ZC3A 4CF7A 3AVXA 3A4NA 1KY2A 3GJXC 2ZITA 5DYGA 4RD3A 5H8WA 1ZW6A 2XITA 3AVVA 1RW4A 2GDJA 3OEED 1F2UB 1HUQA 1J7AA 1D2MA 2N1BA 3AVYA 5E3HA 2XB4A 4EUNA 2KBFA 5FFMA 1YQ4B 2GF9A 2H57A 4KXFB 5SZKB 2MJEA 1MT0A 4PAQA 4LJ7A 4H9GA 5JRJA 3AM1A 1W2HA 1KDRA 2QN6A 3BC1A 1YJ5A 3KDSE 1ZNXA 1E0AA 5G3ZA 2AX4A 2GILA 3CR7A 4OHWA 4IOKA 3BFXA 4NTZA 1JRPA 4N58A 3E1SA 2WBLC 3FE2A 2QAGA 1CR0A 4RZXA 1ODFA 3U3OA 5JRZA 1MKYA 1E2PA 1N6IA 3MJHA 4F92B 1ZYUA 3K70B 3B85A 4MYHA 1DG3A 4KLZA 4AURA 3FFBA 2CE7A 1HV8A 3KL4A 3X1WA 3RLFA 2H1LA 3KQUA 2PBRA 1MR3F 1JR6A 1PZNA 5J4HA 1FMJA 4HROA 3ZZUA 3Q3JB 3C15C 1D2EA 1JPJA 4D80A 5F9FA 1GIAA 4F38A 2GCOA 1KSHA 2GVZC 3OEEA 4TYPA 2JLQA 2PCJA 4Z8YA 1T0JB 3TE6A 5K8TA 3K0CA 4F7WA 1AA9A 2WP9B 3NWJA 4ZI3A 2IYYA 2ZSDA 5KPJA 2WQYB 1HE1C 2C9YA 4LYAA 4GL2A 4PTLA 2CMKA 3ICEA 2Q3FA 1NVXQ 3ZD6A 4QHTA 3F0TA 2YINC 2F1IA 1WRBA 1E2LA 3AP2A 3K0EA 3HRDD 3U44B 1OXUA 1W5SA 3HR7A 1TEXA 5KNBA 4DLUA 3TMKA 2UVQA 5K8IA 2DYKA 1UWMA 2FE4A 4LHZA 3SHWA 5FTJA 3TVDA 3GLIB 2IXEA 1E9EA 1NN1A 3FC4A 2ZJZA 4D2IA 4JBXA 3QEOA 1E9DA 2GXUA 1E2JA 2GXQA 1G7RA 2ZYUX 3DHWC 3OEHD 2IS6A 1DS6A 4OI4A 3K70C 4DSUA 3P1MA 4LTUA 5G5HA 1CJTC 2DFKB 2Z6VA 3IPYA 3NVWA 3QVVA 3RVBA 3W9YA 1W7AA 2Q5WD 3L8ZA 3S1AB 1G4UR 2HJGA 2W6JD 1XBTA 3NDPA 1JALA 1NF3A 2OAQ1 3K0SA 1XDBA 2VHUA 3CWQA 1KI1A 1E9AA 1N6OA 4R71A 3F3YA 2G83A 4HATA 4DSTA 2V6JA 4MITA 1LW7A 1QRAA 3K1JA 1Q1ZA 3QQ5A 5EUMA 2ZJBA 3HP1A 4U00A 2CJWB 1C4OA 4O25A 1ZD1A 1TKGA 3MCAA 1OLOA 3TQCA 1J8YF 2MMGA 2VYFA 3JVUA 3N70A 3T1QA 4DSOA 2ZSBA 1UPTA 4QBIA 4GMXA 1P61B 2Z5FA 1KI3A 4DVGA 2HDNB 2ZRHA 1D8TA 3U60B 1Q21A 4EFLA 1E0ZA 1XCPA 3DO6A 1OF1A 3O47A 1N0UA 4NYIR 3HU3A 4C7OA 4OHZA 3SBDA 1E0SA 4LK2A 2GCNA 2W3SA 4TQAA 4ASUD 3EA0A 2OM2A 4GOJA 5TV2A 2QP4A 1GAJA 3T06B 4ABYA 5FBWB 5IHPA 1Q12A 1F5NA 4IOLA 4Q21A 4Q19A 5F2EA 3ZVLA 3AEAB 3PV0A 3P20A 3PO0A 3LWNA 1EWYC 4YXDB 3OEHA 1KO1A 2WZQA 1U0JA 5TMPA 4IDQA 3KKQA 1KOFA 2C98A 2NPIA 4PAMA 4LWZA 2VQSA 4URYR 1JAHA 2W6JA 2P6NA 2FBWB 3TLXA 1K5GA 3CF6R 2DBYA 1L5PA 5HZHA 1DPFA 5EP4A 4HAUA 5EUQB 4BZXA 3T1TA 3ZVNA 2QORA 2VEDA 4PAOA 4V03A 1JEEA 3BK7A 3P26A 1QBKC 3LQQA 2ZYTX 1XMSA 3NKVA 4ACBA 3Q72A 3GP8A 2GXAA 4XVQA 1Z06A 2AHOA 2FEMA 3KWLA 2WJIA 1PJRA 2UZIR 2FSIA 1JI0A 1E9RA 4GSYA 2L0XA 2JLUA 1PLLA 3K09A 1P2VA 4B6EA 3U7FB 4W5WA 1E1RD 4MGYR 3FMPB 2WIBA 4ZCLA 2OXRA 3PG5A 4M8NE 3GLHE 3PEUA 4JLBA 2BBSA 3WBJA 3TQFA 1P5ZB 1VDZA 3DMNA 5JI3E 2B92A 2RMKA 1N0VC 2BEJA 2IYZA 4IOMA 1E9CA 2ZSAA 2BS3B 4LPSA 4B44A 5C2JB 2DPXA 1KIMA 5JJKA 4EPTA 2CL6X 5CIQA 1LB1B 1WRIA 4B76A 1V97A 4PC2A 3WY9A 4QC2A 3H1TA 4LCBA 1WQ1R 2OBLA 3B1ZA 1PVOA 1US8B 4QGHA 5AUOB 1P2UA 3CONA 4PHHA 1XXHE 5CK5A 4N1AA 1OYWA 2H8KA 1OE0A 5J47A 1HYQA 3W6NA 4MA4A 5SZHB 2G9NA 1EX7A 2H88B 4EPWA 1M1YE 3BWDD 4Q48A 3AMZA 2Y8EA 3ND8A 2CLDX 4URUR 2UZ3A 2QMHA 1E32A 3CB4A 2AX5A 1NKTA 2GJ8A 4DLZA 4JJKA 4LV5B 2J0SA 1X8LA 2KI5A 1VCNA 1RRGA 1W46A 2IYWA 2BBOA 3AEFB 1NKSA 1YR6A 4LY6A 5KDOA 3NDBB 3BXZA 3SBEA 2P3SA 4FN5A 1SVSA 2ERXA 1OHHD 2XSZA 2BS4B 1E1RA 4EDHA 4ZDKA 1WCV1 4DUGA 1HT1E 4QHYA 1K6MA 3IO3A 2ZS8A 4ON9A 5H1YA 4C2TA 1G1MA 4J0QA 4C0KA 3NS1A 1GRNA 1TQ6A 4D4LA 2N0SB 4PR0A 1L2TA 4OHXA 3FFAA 3LD9A 1C9KA 1G8HA 3W6OA 3A36A 2W00A 5AUNB 3NRZA 4YDSA 4YQFA 1XLQA 2KB0A 3F5FA 3I3SR 3VR4A 2FGJA 4I81A 3AEDB 3LW8A 3SR6A 3KJIA 4XVRA 3UMFA 3AH7A 2D7DA 4PANA 1H8HA 2PVOD 3SI7A 1E2NA 3KUDA 3L0PA 3AECB 4JLAA 1GAQB 4QBFA 2PCLA 4C2UA 4Q66C 3BD9A 1N6LA 3OE7A 3UWOA 1KFYB 1JNYA 1XU4A 2OHFA 1Z07A 3H86A 4US1R 2DR3A 4EPRA 3W8RA 4Q47A 4A0RA 2RGDA 5CYOA 4BFTA 4C0LA 1JXOA 2FSFA 1EWQA 3GLHA 5J4KA 1ZMXA 3RHFA 4A15A 5D3MB 1UM8A 1BMFD 2HXSA 2H18A 2YV5A 5JJLA 2W0SA 5EE5B 2ZVQX 4IFBA 4A36A 3L82B 4NYJR 2W58A 2ZJ8A 1KDTA 8OHMA 5D3QA 1OHHA 1OT3A 3WYFA 1BH2A 1OFFA 1JQLB 4E09A 1GRRA 1KI6A 1QT9A 2PMKA 4HB3A 1RJ9A 4QBHA 3W34A 1E0KA 1Z6TA 2QENA 2XX3A 1D2NA 3VR9B 1NRJB 1WXQA 3BH6A 3K0AA 4EJSB 1E79A 4AG5A 3DL0A 5AJXA 1UEIA 1EESA 4UJ3A 4JLDA 4FD2A 1YHNA 5FOTA 5AUKA 3WRXC 3ZS8A 4C0JA 5A5GA 1OXVA 3KQLA 1Q1QA 3E70C 3KZ1E 1CIPA 4JL6A 4JX1C 1DAEA 1Z2AA 1AZTA 3RS4A 4JBWA 4A2WA 1MRSA 1KJZA 1N6PA 4JYCA 2XTMA 4B34A 4B2PA 2VSOA 2WV9A 1XLNA 521PA 2CXXA 3CRVA 2GZAA 2JGNA 4P0TA 2YKGA 5DO9A 2FH5B 4IDIA 1MABA 3N5CA 3ZJYA 4MDEA 2F6RA 4LOAA 1EG7A 2R6DA 1GFIA 1BIFA 1AIPA 5JCPA 3SJZA 3KTAB 1CKEA 1BMFA 1QOAA 1R10A 5J4LA 2ASEA 4HDCA 4TT3D 1VIYA 5TARA 5JLJA 2EFHB 3CRMA 5L8VA 3K09C 2XGJA 2O8FA 5CYPA 1OIVA 2BBTA 3O8CA 1UADA 4NONA 2WWFA 2CLSA 2WJJA 5LD2B 1I2MA 4B75A 2NOAA 4TMKA 3VR2A 3X1YA 5FPYA 1FNMA 1R5BA 2VP9A 1W49A 2Y5CA 3PUXA 3DDCA 1P9NA 3LBIA 4K46A 4CDGA 4AKIA 3GJ7A 1PFDA 5EXTA 3W5UB 4R2IA 4EJSC 4H1VA 2ZU6A 1XTSA 1NYQA 1Z83A 2V4ZA 2WKQA 1UKZA 3BGWA 1DVRA 4M1KA 3HUIA 5BN3A 2QGZA 1FQKA 2C78A 1Z08A 4CZ2A 2QTHA 4G5RA 5L3VA 4US8A 4EQ6B 1DBSA 4BFZA 5JMTA 3GLHB 3AP3A 3WMGA 3SYKA 4DJTA 5JWRA 2FPKA 2R9VA 1FXAA 1Z6GA 2W2XA 3G82C 4YXWA 1C1YA 4HLDA 3TJZA 1HE8B 1SVMA 2GAOA 2CJNA 2CEAA 2RHDA 4D4MA 1Q3TA 4A0HA 4PZZA 4L15A 3M6AA 4TT3A 2YOFA 1KMQA 2B8WA 1Y3AA 4BLQA 3CBQA 1QF6A 4OL0A 1N5WA 2W55A 1YRBA 3GJ3A 4IW3B 4PZYA 3EPLA 3V4FA 4A9AA 1G8PA 1KI6B 3Q8XB 4U02A 1AK2A 3AQ4A 1AWDA 3TIFA 1RJ9B 2FFAA 5C1BA 1W36C 1E69A 5CIWA 1XXHB 4TLBA 1CZPA 4FMCF 4Q9KA 2NGRA 1Z0DA 2IF2A 2GBLC 4QOSA 3RC8A 3TSWA 5LD2C 5JHHB 1XWIA 3R9IA 1W2GA 1QHYA 2ZETA 3A1VA 3SYLA 4IDHA 2HJVA 4DRZA 1JWBD 2PX3A 2QMEA 2R6AA 3TR5A 2HLDD 3ND9A 3FHOA 3D6TB 1LTQA 2CVFA 1II9A 2J7PD 2Z4RA 3EPJA 4BRWA 1YJIA 4Q9LA 4FCVA 4LYHA 1OH8A 2D4HA 4BRUA 5FOWA 2V8OA 4URXR 1N6KA 1RC8A 1SXJE 2BDTA 2PLRA 3B1WA 3AKCA 2MJ3A 3R9XA 3PUWA 1PDXA 2VRWA 5JHGB 1X1RA 1OYYA 2BCGY 1W0JD 3K0FB 3RS5A 1P75A 4P4UA 2JLZA 1G5PA 2W6IA 4ZOHC 5J5CA 2IC5A 2ZXUA 4WQMA 2CHQA 1CBUA 4Q4HA 3BS4A 4M22A 3ZVRA 5CLQA 5B2ZA 3VHXA 4RCZA 2Q9BA 4HYYA 4Z51A 4QGFA 2KSQA 3IEVA 1R6BX 3Q5DA 1KK1A 2FMXA 3SC3A 1R0WA 4DCSA 4E03A 3QJYA 4IVRA 4UNRA 4RD2A 3R20A 3JZAA 2MJDA 3AE1B 1HA3A 4NE2A 4DCUA 5KDDA 3R8CA 1A2KC 5H8YE 4LI0A 3K70D 1UBFA 4W5HA 4PSVA 5IT5A 1E1QD 3UG7A 5JZVA 1ROEA 4V0KA 2HLDA 2REBA 2R65A 2IYQA 1T9HA 1FTNA 2EFEB 4A1FA 3AVUA 2FSHA 1Z28A 2ZRMA 4B3GA 4B2LA 4QJ4A 2ONKA 3P32A 2VBCA 5FL3A 5TXGA 1DO2A 3V00A 4D4KA 4JSYA 3K8YA 2FJUA 3TRFA 1P9WA 4LV8B 4Q9HA 1F2UA 4NYMR 5FBVB 1Z6YA 4OI1A 3FAHA 1IN7A 2PIAA 3WRYC 1T91A 3PR1A 4Q7KA 2VP0A 2WHXA 2WPDD 2ZRBA 4IEEA 2JJ8A 3PITA 1ZP6A 1ZU4A 421PA 2ZVPX 4CT4B 1LF0A 2ONJA 1DAHA 4GT1A 3MD0A 4ZDWA 2ZJOA 4MGIR 4USAA 5DE3A 1TUIA 2OFWA 4K81B 2M19A 2XZPA 4GOKA 4DLYA 5HR5A 2HYIC 3SJCA 1FP6A 4QJ5A 3SR0A 4YTPB 1G7TA 4OJKA 1X3SA 2C5LA 4QNRA 4CEHA 2NPFA 2LCFA 2RKOA 3ZGXA 3CUEF 4ZKEA 3EUB2 1P6XA 4GDFA 3BIFA 2QSYA 3QPWA 1II8B 3QXXA 1VHTA 4MRRA 2FZLA 2CHGA 1ZM7A 2VHQA 4L16A 5DN6D 1B9RA 2MSCB 1CR1A 1E1QA 4MUBA 1ESMA 3AN1A 1KAOA 4KFRA 2OFXA 3AB5A 4UXIA 4Q18A 4QM6A 3NVAA 3BH7A 3CRRA 3MWKA 4Q5IA 1CP2A 5GJVC 1ZUD2 1NVVQ 1N25A 1KJYA 4C7YA 4KVGA 2WAYA 1E3MA 2ORWA 2WJVA 2F43B 1RVDA 1G3RA 3FGNA 4BLSA 5L3SB 1XZPA 1GDDA 1QHNA 1NMYA 2BHRA 3CM0A 5HCNA 4OHYA 1GL6A 2KJQA 5FI1B 3AP1A 3MLEA 4Q4HB 3GLGE 2WJHA 3FOZA 2WPDA 1DOIA 1MH1A 1MRNA 4M9SA 1PLJA 4IVQA 3W3ZB 4A4DA 1YRAA 1AGPA 2PZFA 1EWRA 3O8BA 1FP7A 5BWMA 3RRNA 5K8UA 1RPZA 2Q9CA 4JKIA 3TSOA 4M1SA 3CWIA 4KFUA 3U44A 2FPLA 1F6BA 1X8JA 1JAIA 2ZUDA 1S3GA 3KFXA 4BFYA 3EARA 5KNCA 3R8FA 3PFIA 1MO5A 1ZBDA 3B5JA 3EG5A 4TYYA 4YMWA 1CJEA 2H89B 1QHIA 2QY9A 3F8TA 4HUTA 1L8QA 2XAUA 1XPUA 3LLUA 3ZYYX 5DH9A 4W7SA 2QBYB 1J70A 3M1IA 4WIAA 5H70A 4LC1A 4ZCMA 4BQSA 5FBQB 4DLRA 3ZVMA 5F3WB 1X6VA 3U3MA 3S1AA 2WVJA 3ZLJA 1A82A 4L8GA 2O0JA 3PENA 1JECA 3AB3A 3WYAA 4XWOA 5LB2A 2I1QA 2LKDA 2IWRA 4V0OA 2ZR9A 2ZRPA 2WAXA 3AKEA 1K8RA 1OB2A 1E99A 4PC7A 3PCRB 1G6OA 2Q3HA 4NYIQ 3VFDA 2P0EA 2JJ1A 2H17A 4IKEA 1JQJC 4R9UC 1G5TA 3ABVB 1CTQA 5EZ6B 2C04A 4QHSA 1QVRA 1M7BA 1OQQA 2CJWA 3AF1A 4X8MA 4XVUA 3EZ9A 3VNVA 1J99A 2JATA 1G4AE 4K8OA 5GVRA 3MG9A 3CPJB 1ZAKA 2ZREA 2GF0A 2O5VA 4DDTA 3OF5A 3EX7C 3W5IA 4DKXA 4ZIRA 2FWRA 4ZV4A 4CEHB 2CCGA 3EC2A 5KO2A 3T1OA 3LRPA 2WOOA 3KJEA 4ZPXA 2RGNC 5FUXA 1B23P 4EPXA 2J87A 3EZFA 4ACAA 3CIRB 1NJFA 1Q1BA 3OFND 1G3QA 2AXPA 4OQXA 3GMTA 3SU8A 1KSJA 3GPLA 3JZMA 2WDRB 2ZRNA 4CIDA 1SXJB 2WSMA 4RFSA 4XOIA 5EJEA 1JR3E 3KJHA 1Z22A 4TLDA 4MYCA 5TB5A 1AGRA 5FR2A 2BT6A 4AKEA 2W3RA 5KSZA 3DZDA 4HAVA 5FTKA 1J7CA 3BBPA 3AVTA 2C9OA 3EW9A 3THYB 1Z0KA 4QM7A 4CEIA 3PUVA 3X1ZA 3IIKA 4NBSA 3ZQ6A 3EWSA 1NN0A 2VIIA 3VNUA 4YC7A 1FZQA 1OH7A 1FFVA 4F93B 1CRPA 2DWPA 3FVQA 4BLPA 3OZXA 4AD8A 2R6GA 1N5IA 2J5XA 5CDFE 4ILEA 1II0A 3B1YA 1N5JA 3AVPA 4Q1BA 4B43A 1Z5ZA 3P4RB 2ZSFA 2ZRAA 1M8PA 5JSZB 1KKMA 3UPUA 2W2TA 2IL1A 4N6EB 1ZVQA 1JWAD 3IIMA 3OIUA 2DB3A 1O87A 4UQOA 2OESA 3SJBA 3CR8A 4DT1B 1W4BA 3CNNA 4GOXA 5DLQC 4FMDF 4AYXA 3IEUA 2IYXA 3WMFA 3OFNA 4KODA 2IA5A 1W0KA 2WMOB 2ZRFA 4MGKR 4KSBA 2AWOA 1DAGA 4XWAA 4HAYA 2QP9X 4Q1DA 4ZDIA 1KY3A 1E98A 3CZQA 3EZ7A 3B13B 2D2FA 3EIQA 3DZ8A 3V4RA 2NO1A 3GJ8A 1DARA 1SXJC 3MJRA 3FPAA 3FMOB 1M2OB 5A0FA 4GRAA 3FMFA 3I73A 4URVR 3AE3B 1Z6AA 721PA 2RGXA 1US8A 2JX5A 4GI7A 2ATVA 1DAIA 2ACZB 2XNSA 4TMZA 4DLVA 5FPTA 5LBIA 2Z0MA 4FMBB 5EQTA 3QENA 4MDFA 2OXCA 1U90A 4Y0VA 3AGPA 1DAMA 2O0HA 4M9ZA 1CRQA 1DAFA 1E94E 3B8HA 4P4SA 2IUSA 3QPUA 3DEFA 1KO7A 2A5FA 3HU1A 821PA 1OKKD 3P4YA 1AKYA 1UEJA 1Z3IX 4LBVA 2WICA 1E2FA 1TNDA 3NEJA 4HAZA 4CYMA 1X86B 4BLOA 1ZD9A 1ZUIA 4ZIRB 1A5TA 3D3QA 1JR3A 4O3MA 1E4VA 2ECKA 3BAFA 3NHAA 3T61A 2XZOA 4JL8A 1ZU5A 2P67A 1ZCAA 4JWUC 2PL3A 2QEQA 1OV4A 1SKYE 2RH5A 4RFSB 3RAPR 3BB1A 1I7HA 2R44A 3CW2A 3QI2A 2FEOA 4FW9A 3KFVA 4HAWA 4KFTA 4LHXA 2HT6A 1W5TA 2QA5A 3CLVA 1IAQA 2BKEA 4KBFA 4AG6A 5KHOC 2PMDA 3BFKA 3N2EA 1AN0A 5FR1A 2V55B 5CDFA 2QTFA 5FTLA 4CEIB 3X1XA 5FOXA 1DOXA 4RKFA 3W90A 4M1TA 3H4MA 1XD9A 3BE4A 3NIBA 3AUYA 5DHAA 3L0IB 2NG1A 5HE8A 5KSPA 3GLGB 3RABA 1DEKA 1U8YA 3GFOA 4W5JA 2V7QD 2W0MA 4DCTA 4EFMA 4Q7JB 4DLSA 2RGGA 3KX2A 3LH5A 2VH5R 2IHBA 4HZUA 2FV8A 5F9HA 3E2IA 4IHQA 2ZJYA 4C0HA 4DCVA 1OH5A 3B9PA 3GLFE 3H2YA 4LC0A 3SHFA 1OKKA 4G1UC 2GK6A 4LUCA 5D3MA 1D9XA 5FUWA 2HEIA 4OHVA 4B74A 2JLXA 1WWTA 3A6PC 4TL9A 1IONA 2PJZA 4MUAA 4DIDA 2XSZD 3AV8A 1COWD 4M9XA 1XTKA 1TU4A 5FOUA 4DUGD 2EWWA 3OAAD 1QVAA 2AR7A 4UNNA 2YJTD 5JECA 4A8JB 1Q20A 2FU5C 1E2EA 2YWFA 5DISB 1Z2CA 2VHJA 1L4UA 3CIOA 2ODBA 1SF0A 3AE6B 3HPQA 4NCIA 3KKMA 2W54A 3E5HA 4LJ6A 4WVFA 3OIWA 4JLPA 2PH1A 1TUEA 4TSFA 5KU1A 2HYDA 1P9RA 4IRUB 3HYRA 4EJSA 5SZIA 1NSFA 1YZTA 1H8HD 5EXPA 2CCKA 4DEXA 4HLQB 1ZCBA 2PJRA 1TKYA 2ZRDA 5CB8A 4URWR 5EP3A 3QXJA 1KI4A 4MQBA 4RZUA 1T5IA 3CRW1 1FL9A 1L6VA 2CBZA 3OE7D 3PUYA 2WJYA 1U9IC 2OSBA 4KYIB 5JWOA 4HAXA 4YDHB 2V7QA 3THXA 3B2GA 4JKYA 2A78A 2QT1A 1Z0FA 4ZCIA 4KSCA 4P4SB 4V0NA 2XXAB 4TL8A 1DADA 1LY1A 1ZIOA 2XTNA 4WZBE 5CJ2A 2ZU0C 4HSEA 3TUJC 2XJ9A 2FFHA 4PPGA 3KQNA 1UBEA 4M1YA 4XWKA 4B2IA 3KTAA 3RSLA 1S96A 2EFCB 2NZ8A 1XJCA 2A5DA 4LJYA 4Z1MD 4OBEA 4YSZB 2F9MA 3C7KA 2XEXA 1W47A 5CM8B 1H8ED 1S1CA 5B57C 3CF2A 2AN9A 2NIPA 4PC3A 1WE2A 1N3BA 1ZC4A 5AUQA 1COWA 2AK3A 3REFA 4BWYA 2XJ4A 2B8TA 1M6NA 3OAAA 2K5UA 1F2TB 2WS3B 2QGNA 3NBYC 2C8VA 1SGWA 2YOHA 2GBLA 4A8JC 1FUKA 4Q7MB 4WA7A 3WP1B 4D0NA 3B2FA 3AM9A 5KTYA 1E2MA 1E79D 1WMSA 4OKSA 2OAP1 3SEAA 3VX3A 2ZPTX 3W8NA 2VP2A 3GCGA 2BKUA 1RFKA 4ITRC 1J7BA 1GNQA 3TAUA 4FWIB 1RWSA 1JEDA 3UWKA 1R7RA 3LA6A 3MWJA 4R7ZA 5L3QB 1TU3A 3QXHA 1VG0B 2GXSA 2HUPA 1J7KA 2ZANA 4LDJA 4L5BA 4L9WA 1EFCA 1GITA 1X1SA 4HZUB 3U7HB 1WYGA 2QQEA 3ZIAD 2C96A 3A1UA 4IVPA 1A7JA 1RIFA 4DB4A 1QHXA 4EQ6A 4V0ME 4N3NA 3WBKA 3W5VB 2VPPA 4E07A 5FPSA 1SQ5A 3BERA 4QGGA 4ZO4A 1EK0A 2YVUA 3TK1A 4BGDA 3I5XA 2HCBA 1WBDA 1E6CA 2YWEA 4S2EA 5KOYA 1WF3A 1RE0A 4Z1MA 3IHLA 2PEYA 2BC9A 5HZKA 5HPYB 1H8EA 3MWYW 4OI2A 1PUJA 2ATXA 2ZR0A 2J59A 1DOYA 4TYWA 1G8GA 3AF4A 3RNLA 1HTWA 4LSGA 4URZR 1NL3A 1TF5A 4GPTA 4XJXA 1A4RA 2OBMA 1OIWA 1N63A 2ZSEA 3RC3A 4HZIA 1XXHA 3KXLA 4HB0A 3TGPA 1JJVA 4NKRA 2ZQ5A 2EFGA 5C3JB 4QXAA 3ZD7A 1S2MA 2OCBA 2QE7A 4Q4JA 1U81A 2A7QA 3IQWA 5JEEA 1J2JA 2QG6A 2HV8A 4RD0A 2RGCA 2ZS9A 2WDQB 3P4PB 3GEEA 5CK4A 3VR5A 4C0BA 1N6NA 2WWYA 4TLCA 1IXZA 4BZPA 2Q9AA 4MH0R 1TQ2A 3THOA 5FH9A 4C9BA 2AD1A 3THXB 2FSGA 2DFTA 3BH0A 2YHSA 3I4LA 4NCNA 4PQRA 3RANA 3ZIAA 1AZSC 3HWSA 4JVMA 1V8CA 4WOPA 4ESVA 4KV9A 1LV7A 1IN4A 3DWGC 1VLBA 1E9SA 1EX6A 2CL0X 2FGKA 2GTPA 3DKVA 4YXWD 3K0FA 5C18A 4JVLA 1OFTA 2RB4A 1FMAD 1DAKA 3ADKA 1XTRA 1SULA 1QHSA 5CB6A 1SKYB 4M4SA 1GZSA 1T3SA 4MKIA 4P3YA 3LY5A 3RWMB 4C4PA 2I1VB 5M04A 1YVDA 2J46A 2VSFA 3AGQA 5E95A 5FUYA 2GEUA 2IW3A 1R8SA 3CNLA 2DWOA 4X8OA 1W36B 1CU1A 4F4JA 3ZQJA 3HR8A 4FMCB 2IUUA 3QE0A 4AWXA 1OFUX 1YZGA 2GZHA 2PLFA 3EPKA 1QOBA 3PQCA 2QZ4A 1L4YA 1IY1A 1VYTA 5BW8A 5AJZA 3A1SA 1NVID 1DOAA 1KI7A 1YQTA 2BIFA 2FZ4A 4PPFA 1AS3A 3MRSA 1ZM3A 1NVWQ 1QG2A 4ZI2A 3RS2A 3AVWA 1G21E 2E3TA 2IWHA 2D2EA 4NYMQ 1E2KA 5EE1A 1ZXIA 4BLTA 4B3CA 4UNQA 1GVNB 1V5WA 4AYTA 5JFGA 1V43A 3GLFB 2AFHE 2A5GA 2X8AA 2AL7A 3VR3A 1AS2A 1XCMA 2WWIA 4Q9JA 3LQRA 4RVCA 1E4YA 1T0HB 5BQ5A 2YNMA 3FTQA 2NO6A 3PEVA 3SQXA 2X2EA 2VP5A 1KK3A 2ZI5A 2F55A 2ZRCA 3VX4A 1BYIA 1KGDA 2VP4A 3IKJA 1NIJA 1FO4A 2C9CA 2W6ID 3NVZA 1R7SA 3QF7A 5FBLB 3W6PA 1W48A 1I4TD 1R0YA 2X2FA 1DO0A 1N5KA 2FNAA 4V0LA 4DC9A 1ZNYA 3VR8B 5CM9C 4BPBA 3OIVA 1KSGA 2Q21A 2KWIA 3I1FA 3BB4A 1GTVA 4B3XA 2D74A 3LBNA 2GWHA 3IBGA 4GNKA 5B64A 1NEKB 1TL7C 1ZNWA 3WXMA 3U6BA 1OW3B 3LVRE 4RKEA 2K5PA 4MKHA 1NMZA 3HPRA 2YOGA 1BS1A 4TLEA 3SOPA 4HLUA 3U3RA 3WNBA 1II8A 1XCGB 5CITA 2O0KA 4DSNA 1XEWX 4Q4JB 2FOLA 1JQ4A 3IBYA 4N0EA 5K8LA 1GRQA 3T34A 1MV5A 4XD7D 2O8EA 1EFRD 1FTSA 1FX0A 1CLUA 4DBLC 1R4AA 3PIRA 4BEBA 2WOJA 3NXSA 4PO8A 4RJLA 4KO8A 5IDVA 4BFUA 1T3HA 2QM7A 1RRPA 1LNZA 1G9XA 2VHCA 1D6JA 1CXZA 1NY6A 1Q22A 4OJQA 4PC6A 2ZRLA 3T5DA 2F43A 2QPAA 3LFUA 4KI0A 2GA8A 4TMVA 3TUIC 3QXSA 4B32A 5L3SA 3L8YA 1KI2A 4ZHPA 2H16A 4AIIA 2QSZA 3K53A 5DI9A 2JIZA 5IK2D 1FQJA 2IYRA 2E87A 1GSIA 1KO8A 2BEKA 3ADCA 2QJLA 5TVKA 2FF7A 3TH5A 3G0HA 1GKYA 4AC9A 4BFXA 3CZPA 1GM5A 2QP3A 2G0TA 3TAHA 1UAAA 2EWVA 3V9PA 2KMMA 3AE8B 4P33A 3WP0A 2F1HA 2WSSD 3ZZTA 4JT2A 2RGNA 1KNQA 2AWNA 5GVSA 2Q6TA 2V1XA 2R6CA 4TLAA 5FUVA 4PQYA 4NL4H 3U3JA 3KKPA 3I92A 2IYUA 3QUSA 4PSKA 2F1JA 3NC0C 4JLMA 4US9A 2V54A 2JLRA 3A1WA 1QOGA 3B9JA 1SXJD 1XMJA 1TX4B 3FKQA 4DZZA 5BXQC 3ADBA 4JIMA 1XPOA 2X1VA 4FIDA 2H92A 2IXFA 2BV3A 1OXXK 2QAJA 1D5CA 3K9HA 4KAXA 4KHZA 4LYJA 4UNPA 4XD7A 2HXYA 3VHLB 1RRCA 1EFRA 2QBYA 4DCNA 2QL6A 4OQNA 3LLMA 5KDLA 4O2RA 3FMIA 4XTCS 2Q0HA 2FG5A 4BZQA 2ZRIA 2FFBA 4IDOA 3WYGA 2EQBA 3U5ZB 3I32A 1IHUA 1VECA 3OIYA 2BS2B 3RS3A 1NG1A 1PLKA 4QBGB 3UIEA 4LRWA 4FINA 1LFDB 5JJIA 4II7A 2RGEA 2ANCA 2HF9A 3CPEA 4BFVA 2O8DA 2B7BA 2XZLA 2JAQA 3B1VA 2ZI4A 4CW7A 2MSEB 4C7ZA 1YZUA 1Q1EA 3B1XA 1N0WA 4PQFA 2M56B 1IQPA 1Q57A 3QKSA 3GLIE 1NBME 2WSSA 1P2TA 4LJ8A 2VTKA 3SQWA 3IO5A 1YZLA 4KVAA 1JB1A 4Q02A 4V02A 4G5QA 3AE7B 1W4CA 4XTRA 1AQUA 1G7CA 2CU3A 4UKDA 2JQRB 3BJIC 4YSXB 3GEIA 3LNCA 4ARZB 1RYFA 2GJ9A 3GJ0A 4HB2A 3O8DA 4NH0A 5G5GA 5DNYB 5HTKA 1OFHA 1KDOA 1MO3A 1SXJA 1TADA 2BJWA 3GJ4A 4TZ6A 2O8EB 3AEGB 1XZQA 4NDZA 2CJOA 1XD2B 2FPMA 1OXSC 2ZS7A 3LXXA 1FX0B 1T8UA 4RD1A 5AR1A 1NI3A 4X8HA 1KK0A 1S9DA 1Z0IA 2YC4C 4R2HA 1KMHB 1S0UA 4RD6A 3WCQA 3THYA 2PZEA 3P4SB 1FXIA 2PZGA 1CJUC 4DWJA 2ZAMA 5EP2A 3Q7PA 2DCUA 4M1MA 2WWXA 4TTPA 5AJVB 1E2IA 4EAQA 1NP6A 2HF8A 2YWGA 3TSZA 1SVLA 3UKDA 1E2DA 3EASA 2IYLD 3BOSA 4EPYA 3O8RA 2BMDA 1FIQA 2JJ1D 4WW0A 2BWJA 1R5NA 2ORVA 1PUIA 3DOFA 1P4SA 2ORIA 3LB8C 4ESHA 1F48A 1AS0A 3H84A 2Z83A 3VMFA 4KJZA 5JSZA 2BM1A 5HKKA 1XJQA 2JDIA 2N46A 2ZJAA 5MPOA 1KRHA 2OV2A 3SZRA 4LX0A 4PPQA 1OPXA 1OIXA 1IOZA 1FOEB 2D06A 2J7KA 4WAUA 4YTNB 3L2OB 4DT1A 1Z29A 4PX9A 4Q03A 3CF0A 4QFMA 3EWAA 2BMJA 1TF7A 1VIAA 221PA 4QJ3A 2H5EA 4DXAA 3HU2A 3QIAA 4HLUC 4MRSA 3B6EA 3PXGA 4A0FA 1RZ3A 1ZM9A 3NC1C 1G5RA 3CNOA 5FL7D 2L52A 4AYWA 3ASZA 2IXGA 4D4JA 4R98A 5AJWA 4U7DA 4AY2A 3D7MA 1SKQA 3RDPA 4YT0B 1NN5A 3M4YA 3U3KA 2V6IA 3MGCA 3L4PA 4AKGA 1NY5A 2A5JA 1PUTA 4A92A 2WWWA 5AUPB 2IS2A 1UBCA 1IY2A 1U2RA 3RRZA 5FTMA 4FI3C 4U5XA 4B3BA 3TR0A 2CNWD 4M0LA 2P2LA 3AH8A 1P2SA 2J41A 4I99A 1R5OA 1G7SA 621PA 1B0UA 1T3LA 5DIFA 3JVVA 1GP2A 3KQKA 1CJVC 1OFIA 5E7IA 3REGA 2AKYA 3OHMA 1HEIA 1HH4A 2KBEA 2REXB 1TMKA 2O8DB 3C16C 4HUQB 3SJAA 1N5LA 2IF0A 2J1LA 1G8FA 1ZM2A 2OG2A 1F0ZA 2OO7A 3QKSB 5DHFA 4Q1EA 3UMRA 2EKIA 4FMDB 5FBRB 2ZI7A 1CR4A 1P62B 4Z8XA 3EIHA 4A0GA 1GKIA 4Q7LA 3P63A 4B33A 2GEDA 4C0SA 4Q1FA 5KPDA 1E2GA 3QXCA 4LV6A 1U99A 4NHOA 1W0KD 4B3DA 1ZUNB 3VU9A 3QBTA 5IK2A 1UDXA 5FPHA 2NO9A 1DELA 3SFZA 1CEEA 3RS7A 5G40A 2P6RA 3BFVA 4PFSA 1XEFA 5FL7A 1U0HC 1P60A 3SS8A 4DDUA 1NIPA 2OLKA 5L3RA 2IX3A 3B9QA 5LPNA 4G0NA 1ETUA 1U9IA 3U6KA 2WDVB 3LXFA 3RPFC 2VA8A 4YMVA 4MRVA 4NCKA 2BOVA 2QNRA 3GLGA 2QQ0A 3ASYA 4EKDA 2ANBA 2OUKA 2YZ2A 4JJZA 2EYUA 5GJWC 2OCPA 2CNWA 2GETA 3QKRB 4IJMA 2QPOA 2ZI9A 3Q85A 2JLYA 4AKHA 2NZJA 1TJEA 1NVUQ 2QT0A 3KXIA 4DEYA 4I1VA 1N5XA 4Q01A 3EAQA 4KX6B 1CF4A 1YR9A 2PT5A 1G3MA 2BCJQ 2A5YB 2IHYA 4N59A 4YMSA 3UATA 3C41J 4LBYA 3I61A 3P1JA 2OZEA 3C5CA 1JR3D 2C77A 4HB4A 1Z63A 4G5GA 1UDWA 5FI0B 3RRMA 4BUJA 4UJ5A 2R6FA 4Q4AB 4OK5A 5LB4A 4A8JA 2W2VA 2OLJA 1P73A 5KNDA 3TBKA 4IXMA 1G64A 1T4GA 4C30A 4RSGA 1ZP0B 4DHEA 3QSYA 1FFUA 2UKDA 3NBZC 4H1UA 4E22A 1T3QA 4DB2A 4AI6A 3MAAC 1NVVR 4RFVA 1RKBA 5DI3B 5JWHA 2JLSA 3I72A 4O2LA 2GJAA 2OEPA 3FHCB 5KUTA 1E0JA 3QKTA 1I4LD 3U61B 2P6UA 3U7GA 1SVKA 3A4LA 1VYUA 1SVOA 2ERYA 2WM9B 1K5DA 4OYHA 3VKGA 2IBMA 3PEYA 2CL7X 1HURA 4RY2A 2XXAA 1VHLA 3C14C 3KJGA 4US0R 5BYKA 2P5TB 2R8RA 1QHHA 4OQMA 2QUZA 4F4CA 2OFOA 5FOVA 5ELXA 3SFDB 4PHGA 2G88A 1MOZA 2GHIA 1KK2A 2J0UB 1FUUA 1XEXB 3EA5A 2G1EA 4IDNA 2QRNA 3BORA 4WZ6A 4ZHOA 1YR8A 4LBZA 1CJMA 4JLNA 3CWZA 4D6PA 3NVYA 3THWA 4TL7A 2W83A 2R2AA 3MWLA 1P72A 1F2TA 3VU9B 5DGXA 5LDDC 1NLFA 1ZJ6A 1GUAA 3AF0A 3PEWA 1E2QA 2WJGA 4M9QA 4TSFD 6Q21A 1KO4A 2EU8A 2ZEJA 3AE4B 3TVTA 3GFTA 2JCSA 4P32A 1T8TA 4YTMB 3UMSA 3HVZA 3RYTC 2AKAB 4UXHA 1OB5A 2Q3MA 1ZRHA 4LJ9A 5FTNA 4XH9B 2EVWX 1W4AA 3CPHA 3NBXX 1HT2E 3NHBA 1G20E 3CO5A 5L3QA 4GZMA 2Z43A 3QG1A 3KB1A 3VR6A 2P5SA 3Q9LA 2QAGB 4Z54A 4M1OA 1U8AA 1TQ4A 4NU0A 2GK7A 4NYJQ 1AM4D 1P7CA 1M7GA 4AK9A 2C2HA 3ETLA 4HDOB 1XTIA 4LJAA 4JLVA 1NYRA 2O8BA 4EPVA 4KFSA 1F60A 4C0QC 4KLNA 5C46F 1OQRA 5DSZA 4GP6A 2IT1A 1IM2A 1EGAA 3I5YA 5BN5A 1KTVA 4HI0E 2IK8A 1ESNA 2OILA 2QTVB 2SHKA 1XEWY 3QEJA 4Q00A 3WNDA 4B48A 3VRAB 2VL7A 2AFIE 3L0OA 3K9NA 1LS1A 1S3SA 2QM8A 2VHTA 3GQBA 3LX5A 1XPRA 2GCOB 1MO6A 3ZH9B 1HY3A 2A2ZA 4A2PA 1W36D 1TAGA 2ZAOA 4GP7A 3J81k 2K9XA 1XRJA 2XTZA 5H68A 3U4QA 4TYNA 4TYQA 2X77A 1NNEA
chains in the Genus database with same CATH superfamily
3JZDA 1FLNA 4HEQA 2BP7B 4MP8A 3LXRA 1SVWA 2OZVA 5J2AA 3E5NA 2XNDD 5IBPA 2L17A 3DT6A 4ZYUA 5JIBA 2Q1UA 2R62A 5KTKA 5JSKA 3BWXA 3DZFA 2IOFA 4RZ3A 4G5YA 5JASA 1MTOA 1QLBB 5FPKA 5AW6A 2G3YA 3GIDA 2LVBA 2YDYA 3VAAA 1NNSA 2O2ZA 5EJ8A 3KKLA 2K87A 4BMZA 2G4DB 1QKJA 5LCXA 1UUFA 4KP7A 3EXG2 3VKVA 2O4CA 1D1QA 2XOEA 2VHVA 4XUGB 4HAOA 5CG1A 2AVNA 1KEVA 1P0MA 1K7FB 5C34B 1BYUA 3IPAA 3EEYA 3U2SC 3DOEA 1BOFA 1IIPA 4DQQA 4KQXA 3FHTA 4C3ZA 2AN1A 1PN3A 2VYNA 4BFSA 2BGIA 2OK7A 4UBIA 10MHA 3GT7A 4EBEA 4S35A 4DXFA 2A1IA 1SZDA 2EZUA 3DCNA 4XPZA 5TMEA 1FTWA 3HN7A 4C03A 2H5LA 4H16A 5F2OA 4FHGA 1OTXA 1TAMA 2HRCA 3GJQA 1WRDB 3NBMA 3DZKA 1QP0A 5DNEA 2ZJ2A 1GEGA 4TWIA 5EE9A 1A70A 5I9BA 3VSBA 3VI4B 2BMWA 1UAGA 2PXAA 4F86A 2RKWA 4DCPA 1MFWA 1XZJA 2JXTA 1T0RC 2JPDA 3EQ9A 2QG9A 1IUEA 3ITDA 4BCCA 3FJ1A 2D59A 4KGDA 2E18A 2YQZA 4EGFA 3R3HA 4B82A 4GVLA 3V7WA 2YRWA 5JTUA 1ESEA 3G1UA 2ZW1A 1GJZA 2QRVA 2PKOA 4YA6A 1L5YA 3M0EA 1FRRA 2AQIA 4EJFA 1Y8QA 4V2UA 3V7UA 1OEYA 5BYSA 1T6NA 2WI8A 3C5WP 5J40A 3A4SC 1V7CA 2DKNA 3D32A 1XF9A 1EFTA 3MMPA 4X57B 1GZHB 3O83A 5CU7A 3KXPA 4BNJA 2J48A 3P27A 1R4MA 3SNHA 3A04A 1L9KA 4O4IA 2O5EA 5B30A 2PAFA 3B9BA 1OQYA 1YGYA 1R0ZA 4F4ZA 4QW9A 1P5FA 1ZOPA 5E3JA 1OJLA 2QYSA 1Y9AA 5IJWA 4FADA 3F2IA 2VT2A 5TQ0A 4YAKA 3TW0A 1P4AA 5TY0A 2VWPA 4U7PB 3USZA 1NUUA 4EO4A 4EECA 1YS7A 4ARCA 4RV4A 2D62A 4IJQA 1T8EA 2DHRA 1NJ1A 1MABB 3FCYA 4BNVA 5L7TA 4J9UE 4IJVA 2RAFA 1WP9A 3BMNA 5EMNA 3V33A 3KB2A 2Q5CA 2QMUA 3S3TA 4HPJB 1N36B 1J24A 2BCEA 1C4KA 3O8NA 3OICA 3UT6A 1QU2A 2HX1A 4PXAA 4BO8A 1NSTA 4BNDB 1BDIA 2WT9A 4G85A 1IJEA 1J21A 3ETCA 2QN1A 1E4OA 5AI4A 1DHRA 2K6GA 2EFDB 4KOAA 4FWTA 1GTRA 4H4EA 2IYVA 4LHWA 5IRCD 4Z9XA 3D8UA 3BD8A 5KTPA 2IZ5A 3EUEA 3KR9A 1QS0B 2OB2A 5TGDA 2MU1A 1WB9A 2MBBB 3NH6A 2BEUB 1Z0JA 4K86A 2YQEA 1DQRA 4LHVA 3MMSA 2G5GX 1P7PA 3EZ2A 5ARDA 1P1CA 2LEKA 3WDMA 1X8KA 4F91B 1G21B 1QAOA 4L51A 3RB6A 2KTRA 3WGIA 3IHPC 3ZY2A 4ZAXA 1VKRA 1OLUB 1R0CA 4MS3A 3JRXA 5LU9A 4GFDA 1R4MI 1I13A 1WGDA 4UOZA 4H4CA 4DL9A 3PDIA 3E4DA 3R6TA 3B1LX 2WKPA 3BN3A 2DFNA 2DZDA 3LCJA 2LV8A 1REQA 1NBMA 4ND3A 5JS8A 1RAFA 1PK9A 1XEXA 2PRIA 1ZC3A 2ACWA 4F1WA 4KPYA 4RT2A 1YV9A 5J2CA 4IPTA 1ET9A 2KS6A 2EX0A 1A9QA 3IFWB 2H57A 3BJYA 2MJEA 2PFPA 2QDKA 8ICJA 4GS5A 4MPTA 4LGCA 2XGSA 2IU6A 2GILA 3BCSA 3M6ZA 3G0DA 2Q6OA 1BQ3A 4AS3A 2ISSD 3HL0A 1TAQA 4N58A 4LLGM 2QDXA 2GBIA 1MKYA 1X15A 2GI9A 4LG1A 5BQXA 1R0SA 2MLBA 3EFOB 3TZLA 1RWNA 4MEMA 1Z45A 1JR6A 2CNLA 1WHSB 3C15C 3VO8A 4EM6A 1E6MA 2NNWB 5I8PA 3Q7SA 4WJLA 4F6RB 1ECFA 1X80A 1JL3A 5K8TA 4PL1A 4YXMA 4V0SA 2ZGVA 1TY0A 1C4CA 1PQPA 3COJA 3ZI4A 2EF1A 3W4IA 2PUBA 3DDZX 2VIXA 4D3YA 1ULBA 4ZRDA 4KZKA 2J4XA 5C1DA 1EP9A 4QFCA 1E2JA 5ERXA 4DMUB 1FDIA 1UWCA 4RGVA 1AKWA 1LKYB 1W7AA 3NIGB 1G4UR 4E31A 3PSTA 1PL0A 3EAGA 3KUXA 2I1WA 3P5BA 4RESA 3IUNA 3UC5A 2XC9A 2V6JA 5EUMA 4U00A 1OLOA 1DKUA 4DFKA 1D8TA 2OCXA 3JASB 1BXGB 3HKBB 2J5RA 2YL2A 3L8GA 2DUWA 2IGTA 5IHPA 2KD0A 5HFYA 5JCJD 3D3WB 1TK5A 2KP7A 4DIKA 1U0TA 1FXTB 3IVXA 3LYHA 3GR6A 5BQFA 2ZP1A 1K5GA 1NUSA 4G1VA 5HZHA 4YR2A 4GH5A 2WNSA 3ZVNA 2GRUA 2VZ8A 3THVA 3LQQA 4NRDA 2MR6A 1N9GB 1KOJA 2L0XA 3MBIA 4KXXA 4HGYA 1M2KA 2PX8A 5JYDA 2JI7A 3DOOA 3TEZA 4R41A 1RZVA 2ZSAA 3C6MA 1ZMBA 2GWRA 2H3QA 2XUGA 3UKOA 3V4VB 2UDPA 2WWTA 1WW2A 1GAWA 1XXHE 2QD4A 5CTJA 4QOEA 3NGDA 2G9NA 1EX7A 4QDTA 3ND8A 2QR3A 2QMHA 4MCIA 3WWPA 1EDEA 3TL6A 3O95A 2BQUA 4EJ0A 5KCZA 1X8LA 4UTVA 1Q0WB 1ETHA 1YR6A 2P3SA 4YROA 5CM2Z 2ERXA 3BQ1A 2ZS8A 5LIPA 2VUIB 1UJ6A 3HA5A 4PR0A 4FS2A 1WMEA 1UAYA 4I81A 4IZ6A 3DFMA 5G0TA 4JENA 4N9WA 3VDNB 1JNYA 1L7BA 5FA8A 1V7ZA 1JQBA 4BFTA 2FWNA 1Z18A 1W1UA 3U30A 5TJ9A 5CAEB 4PLCA 1UM8A 1VFPA 3GQVA 1MX3A 2AKEA 2F17A 1KI6A 2Q7OE 4LXQA 1DBVO 3CMMB 2H08A 3U16A 1Q1AA 1FS5A 1X9SA 4FYVA 1PNTA 1UEIA 1JIUA 3WRXC 3IOEA 3SEQA 1CIPA 2E7ZA 3STYA 1AZTA 1D8LA 1QORA 4QVIA 3JPWA 4PW0A 3DMYA 5J43A 4CIAA 5TQJA 3QH4A 5DO9A 2YKGA 4LVSA 1YHZA 4AJNA 1ZONA 1VIYA 3GIIA 8ICWA 1OIVA 2BBTA 4NONA 3NTOA 2B4AA 3PQFA 4BDTA 3PUXA 1SCDA 1IOLA 2B1IA 4R2IA 1UMBB 4AZ3A 4G0QA 3EHEA 1MB0A 3BGWA 2OPHA 4CZ2A 3TZHA 3K20A 3ZJ4A 5E4YA 2HJ8A 4REOA 1JX6A 4Y6OA 5KYWB 1EM8B 4FZ3A 2DUJA 5IAJA 4YO7A 4NPCA 1PR9A 1XYVA 4BLQA 3AJEA 4U02A 4DSFA 3CNQS 2AHRA 3DVSX 3N0XA 2A1JA 2JJYA 2RK4A 3I01M 2PX3A 2YZGA 4S0RA 4CKEB 5IM5A 5FOWA 1RC8A 3R9XA 2VRWA 5JHGB 1WHTA 5EXDA 5DPTA 4WQMA 4BO1A 1ZKHA 4FJVB 4KIWA 4YJ3F 4EYEA 3Q3HA 4DM4A 5E6RB 1ODIA 5AVWA 1N57A 3T5MA 2I03A 5IASA 2Q5LA 1K66A 5K7SA 1GCIA 2GPNA 4ANVA 3C29A 1YA4A 3P32A 3EGXA 1KDYA 4AKSA 4EMUA 2JWZA 2YXBA 3F4BA 4PBSA 1IN7A 2O0LA 4Q7KA 4IEEA 3PITA 2P69A 4B0OA 1KTIA 2PD4A 1IM4A 4YXFA 3ZGXA 4HDAA 3CUEF 2VHYA 3QPWA 3FCCA 4BO9A 2FZLA 2A1UB 5DN6D 3N9IA 1CI4A 4KRXA 1CW2B 3MQ4A 2G5CA 4YALA 5LQRA 1K68A 2WJVA 2FE1A 4BMYA 5AVJA 3BD6A 1B1CA 1H3EA 2BQRA 4I2VA 5HK8A 2W22A 2PZFA 5BWMA 1ZR4A 3HK2A 2Y1XA 1X8JA 3C7CB 4O4HF 1FLVA 1RJFA 3R8FA 4YV1A 4XKJA 4GWLA 2POCA 5BT9A 4B0EA 1L8QA 1QYWA 3EQ2A 1JDJA 1NJYA 2PUDA 3UJ9A 4XWOA 4P2HA 3M70A 4UZEA 4B6RA 3HCRA 1DYQA 1K8RA 1UBKS 5C1PA 1WL8A 3CLRD 4WXYB 2C04A 3U56A 1YX5B 4JL9A 2HFJA 5KFPA 1P6QA 4CEHB 1SXDA 3T1OA 3LRPA 4I3GA 3D7SA 4KVZA 1KRWA 3KQMA 3FTPA 1S2GA 1KE2A 2OO5C 2JHGA 1CQJA 4AY4A 4IOIE 3EW9A 3EWNA 3W8FA 4KB5A 3VU3A 2GEKA 1A95A 1KRPA 3LT0A 2X2OA 5JU6A 3H9EO 2NZYA 3KAKA 1VL6A 4ZCPA 2IZ7A 4MULA 1M2JA 3GE3C 2IYXA 1C80A 2ZRFA 1JHMA 3V4RA 3IQIX 2QARB 2JEGA 2SEBD 2CKHB 4LZGA 3SMVA 4URVR 2HNAA 3M83A 3GMDA 2ACZB 4GX5A 3HJRA 3FDXA 1WMFA 4B3MB 3QMPA 4X64B 1ZL0A 1UEJA 4LBVA 1R6VA 2UUPA 3MINB 4AT1A 2WR8A 4IL5A 3UJDA 3NUZA 1X86B 2PKQP 4WWOA 3OKAA 4XRHA 4JODA 3I2GA 4JA2A 4G0VA 3T61A 4MV6A 2O2CA 2GHQA 1CJSA 3MGBA 4YUVA 3E0XA 3CLVA 2VF5X 4KIKA 1WUJS 1BU5A 3FRHA 1UM9A 1DEKA 4GZ6A 4DLSA 2HWXA 2X0IA 2P9QA 4M0PA 3EGWA 1OH5A 4DV1B 1GTMA 2GK6A 3R4CA 1D9XA 3PFBA 4OHVA 1TJ5A 3SVLA 2JH1A 3WK7A 4GOCA 4GI3A 1WB6A 3AEKB 3BMOA 4C43A 2FU5C 4IS3A 2ZB7A 4C4XA 1SF0A 3AE6B 1EAYA 5KSWB 2HYDA 2W11A 3HYRA 4D9NA 3ZXIA 3FDFA 5EP3A 1RBZA 3WBFA 1NQ5A 4D9BA 4YCAA 4LKRA 2XXAB 2GB1A 2XTNA 4O1NA 3GROA 3HSKA 3U4DA 4GSLA 1P45A 4Z1MD 2A9JA 1RADA 2BUBA 3JTMA 1SB8A 3ICOA 4BWYA 2A3VA 4V24A 3RGWS 4D0NA 1ZK3A 1YVUA 4EKNB 3VX3A 3W8NA 3E8MA 3EXHC 1U9YA 4EARA 1R7RA 3B3GA 3QXHA 5EQDA 2ZANA 1M67A 4LCJA 5AKEA 1QHXA 4EQ6A 4EG3A 3RVPA 3ZRFA 2Q62A 3UJPA 4CLRA 1TKBA 1NOKA 4WXEA 4HGQA 3GQBB 5HPYB 5EVJA 4K1RB 2FEAA 5ER6A 1JXQA 1XDGA 1N63A 3HUDA 1Y7PA 1AKQA 5C3JB 4C08A 2OCBA 5BOLA 3G5MA 3GUZA 3U4GA 1KYVA 1HWYA 2WTEA 3W4JA 3LIIA 2ZS9A 3GIMA 1KTKA 1NTRA 2HCRA 3IQHX 4NBRA 2X8XX 4O3RA 2AD1A 1HKUA 3DHIC 3I4LA 4OB6A 4JVMA 3ZW9A 1EX6A 2FGKA 4YXWD 3V6LA 4JVLA 1BCRB 2B9EA 1C2TA 2FEXA 1X77A 3WLQA 4P3YA 3RWMB 4J16C 5JDIA 1M4VA 1XYGA 1SWVA 1YBVA 1YZGA 4W9GA 2PLFA 4B6JA 2GNPA 2Q6KA 2Y99A 1QLNA 1E2UA 4WD3A 1TZ2A 4BLTA 5DIZA 1K9SA 2HA7A 4IH4A 4QZ8A 2YWXA 3FTQA 1ZG3A 2YHIA 5LMCA 3HBMA 2DAFA 1BYIA 2W6ID 4YJ3B 3EDMA 3OIVA 3MWFA 4MVJA 2D74A 3TRDA 2RHFA 2GWHA 4GNKA 2ZZPB 1U4OA 1ZNWA 7MDHA 3ONSA 1WGRA 1BS1A 3U3RA 1IC6A 3WK9A 7REQA 1XEWX 5K8LA 4JQWC 2ZJ6A 1FBNA 3GCXA 4E7PA 3OCWA 4MVJH 1RRPA 5CA1F 4QYXA 4B81A 3EXEA 4J91A 3LL4A 2PZAA 5T4BA 2FF5A 1URJA 1JHYA 3F4LA 1UAAA 3E3OA 2W9AA 3G02A 4PQYA 3U3JA 5EPOA 4CQMA 3FY4A 2XDQA 3C1ZA 4RK1A 1NFQA 4CXMA 1D5CA 1PEDA 1SCKA 3BSSA 4DCNA 3F8SA 2HXGA 4ZARA 3FMIA 4RSHA 5C5IA 2PBZA 1WUIS 1VOTA 2OV1A 4S05A 1BXZA 2XQKA 1Q1EA 1NXWA 4EZEA 3IXLA 3JVZX 2DXIA 5KG1A 1SV0C 5KJ6A 1W4CA 4UVIA 3MUOA 4RIFA 1L0BA 2JAXA 1B2RA 2NW6A 4PN3A 5DCNA 4RD1A 4RXUA 1SBIA 1I2BA 3WK5A 2V97A 1CFJA 2G72A 2HHWA 3KOOA 1PWHA 4EPYA 3EASA 4KQKA 3QUCA 4B6PA 3CF6E 4KJZA 5KFGA 2JDIA 4E5DA 2OV2A 4LX0A 2KMCA 1OIXA 2C28A 2IFTA 1FOEB 4KC0A 3M3JA 4MVJI 4C1BA 3NBUA 1C3XA 3CNOA 2P41A 3ASZA 1PTKA 4D4JA 5CR9A 4U7DA 2MUTA 3D7MA 3AXSA 4MUEA 1EB9A 2CVZA 1MX9A 2WP8J 1SCUB 3D3KA 3NYQA 2IS2A 4Q7QA 5FTMA 3G2JA 4DQSA 3X2FA 1EFPA 3ZE2B 2GN2A 1R16A 3I1YA 2BI4A 2HU7A 2O7NA 1OFIA 4GPIB 1HEIA 1QF7A 3EC7A 2HHVA 4QO8A 2Y76A 1CEQA 2HHQA 2K7FA 3IEIA 4MDHA 2ZULA 1CR4A 1XZNA 3W7VA 3OFVA 4WV3A 3AXCA 1J0BA 3EUAA 5JDCA 3ORYA 2DMRA 4GDKA 4HF7A 4K6MA 3JU3A 4BU0A 4CTMA 4R6WA 2JFGA 4QDJA 4MS4A 3QKRB 4IJMA 3C0KA 3K05A 1OLSB 5SYMA 2JLYA 1DEHA 1RPJA 2FVYA 4YLEA 2KLGA 4Q01A 3TL2A 3E7WA 1J0CA 1XJ5A 2RDHA 2GBKA 3TNDA 4CL3A 1X7XA 4ITVA 1O9BA 5G55A 1WR6E 2Q5QA 5HMMA 3WDLA 3GOQA 4FUQA 4RFVA 2HSDA 3EXIB 5DI3B 4E74A 2FY8A 1CE8A 2VJNA 2PMZF 1CUZA 2RBEA 1SPXA 2O7SA 4EHJA 1P8AA 3WYNA 3KUCB 2C2BA 5BYKA 3FLAA 4C8KA 4W7HA 4AM8A 1YK1A 3SFDB 5AXAA 4GOND 5J18A 4C4TA 4N5NA 4P81A 1UXKA 1O95D 3LUKA 1P72A 4H0FA 4HXYA 4D9FA 5I5GA 4HLNA 3R0ZA 4O3QA 4TKVA 4GI5A 1E7QA 3SD7A 3HVZA 1UZAA 1J23A 2Q3MA 3NOQA 3R7BA 3E3LA 3OZWA 1V1PB 4U7GA 3Q9LA 2QAGB 4R05A 5A9SB 3TX6A 4S1OA 1YI1A 1P7CA 4ECWA 5DDMA 2IELA 2ZZKA 1Y34E 2Q45A 4X7BA 2ZB8A 4HI0E 2EFYA 3QEJA 4Q00A 3MTDA 3RIMA 3ED1A 3I2JA 4PZNA 2ZBPA 4X7PA 3OWHA 5EHGA 1RTTA 4KQCA 3AUJB 3T7IA 5GZ1A 3DULA 2QTGA 4UATA 4GXTA 2JJMA 4QG3A 1T0QC 2YB1A 4MI1A 2IQ5A 4J0JA 5IU6A 2BMEA 1PDVA 3BGSA 4BASA 2JHAA 1LBSA 5B4UA 1KJWA 1IN5A 1C50A 4LDTB 3RARA 1EFLA 3AKZA 3KUZA 1GV0A 3UV6A 5AXBA 2B1RA 3EIEA 4KU4A 2V1UA 2E9SA 3LX8A 1XTJA 2PLNA 1XX6A 1DIGA 2FZGA 2X19A 2IZ0A 4MV8A 5CLLA 5L6MB 2Y1JA 3QTBA 3AFMA 3LW7A 2OV4A 4I2FA 3QE9Y 4G37A 3GMIA 5KWVA 2FEWB 4BVLA 5HE9A 3CH5A 3QVOA 4L0MA 2HLNA 2ALZA 2RGBA 4KQIA 1OXKB 5DKFA 5IFLA 1YC2A 1AY0A 2IP2A 3C3DA 2AYZA 3LWLA 4E1VA 4RCYA 3QF4A 3WLAA 1VG1A 3EYZA 2WLTA 4LFCB 4BL5A 2GESA 2IY7A 2C61A 3GEPA 4M21A 1LK0A 3EPHA 1Z0UA 5BVHA 4XEHA 1I1QB 4PO1A 1QLWA 3UC9A 4YSYB 4UB1A 3ZHTA 2H5XA 2H9YA 3B6ZA 5KFDA 3N07A 5H3HA 1YZ6A 5JQGB 2YXEA 2KN4A 3UFXA 3EBOA 3X44A 3Q8FA 4JEIA 1JEYA 2NQ2C 4CGZA 2QMOA 5LZ7A 2HZBA 4DG9A 4CR6A 2AX3A 4EKGA 3LCRA 4KN9S 4DG5A 1URPA 2AFIB 3U4IA 2G1KA 5IAKA 4B3IA 2AOUB 1RWBA 1T1RA 2A92A 4DSAA 2J31A 1ZMOA 2A30A 4Z6KA 2Q7XA 2NBVB 3F7NA 1FDSA 1GPJA 4HDRA 2JKYA 2P66A 4L6IA 2FMKA 3PNVA 3CZ9A 3D4PA 1X1EA 5BSKA 3W5SA 1WXVA 3FDIA 4BVUC 3DEZA 3O31A 4ECSA 5ESWA 4YO8A 1JDPA 1IN6A 5LZ9A 1XD2A 4IW0A 4DLAA 2FJPA 1JJ7A 4GXBA 1C7YA 1T5BA 2NTYC 4DMGA 2KDBA 4B95A 4BHTA 1MAWA 4QAYA 1Y9DA 3ZX4A 2BCRA 4CCHA 3LRXA 2WB4A 2DWCA 4O3NA 3NVDA 3HT3A 4JB3A 3BMQA 2Q4TA 2DQYA 4FT2A 1I2ZA 5D87A 2YVLA 4P7JA 4DLWA 7ICLA 2DY1A 3HYTA 4LOKA 1SKRA 3W1WA 2R86A 1BT0A 1UKYA 2VF7A 3OU6A 1WCWA 2XODA 1YMHE 1V3VA 4IIFA 1TU0A 5CCEA 2JCVA 1EU3A 4W9KA 3WWCA 5GADl 1RXCA 4G9EA 1XB2A 5E6SA 1YDGA 4YRNA 3D1JA 2PFGA 2KAJA 4CDNA 1IXKA 4ENTA 1JWMD 5L3ZA 4X1IB 3ECCA 4I1UA 4IM7A 4U8HA 3GQCA 4ZDJA 2QNIA 1OSNA 4R5MA 3FIUA 4G5OA 1KP9A 4MQ6A 1NPTO 3OUZA 1DK2A 3SYNA 3A2NA 3I9V1 1N6HA 1ONPA 5KG4A 3IIJA 2QHXA 2PX0A 2ZLBA 4QOFA 1I3CA 3D2NA 2VRRB 1N1MA 2J6HA 2Q4BA 4Q05A 3GGDA 4NPAA 1RRFA 3BTVA 4MQUA 4NNPA 1F8YA 4AX4A 1HDCA 4G1CA 4FJZA 1OXTA 5EY5B 4MKGA 4HWKA 2PU7A 4CT5A 3L84A 2J0QA 2OCEA 1FXUA 1RYMA 3RYTA 4KITB 4ZCTA 2GJKA 3N20C 3T3DA 2CXPA 1QFYA 5IH7A 3QKUA 4RTPA 1SZHA 3MCZA 3IQXA 3WLPA 1TIFA 3HBJA 4ZQCB 3P9PA 3Q8AA 3BRWD 1JEQA 4JYBA 5MF6A 4I6EA 5KFVA 5EZ5A 1OR8A 4RGMA 3WICA 1L4LA 3OP4A 3AVYA 3AX6A 1YQ4B 4MR9B 4LNNA 4OBBA 1EPUA 2O05A 4BP8A 1DKMA 3E7XA 4XVHA 1L5OA 1KP2A 4OB8A 4C8NA 1NVMB 2KYWA 1CB0A 4K9PA 2WYVA 1A77A 3K70B 4IZIA 2X0FA 3FFBA 1LEHA 3SSMA 2CNNA 5FWYA 4TTJA 2C7MB 4QQFA 1DQSA 3TQSA 1W9MA 4BVGA 4LNUB 1O94D 2FETA 2IYYA 2VWQA 1NAIA 4ED0A 3AJ8A 1LA2A 1Q0RA 3FMVA 5JSYA 3GZNB 5CXUA 3DCYA 3P9RA 1LBHA 1U63A 3TMKA 2XWPA 1U0GA 2QL5A 4FS8A 5ERYA 1FF9A 4X60A 3EZNA 1E9DA 2ZYUX 2P27A 1K97A 1NGSA 1LSOA 1QE5A 3L8ZA 4HV4A 3ZJ5A 1HMPA 2PIDA 3MOSA 2CJWB 2JC3A 2ODGA 1ZBQA 4DVGA 2QLTA 2O2SA 2BFAA 4OHZA 3SBDA 3DV9A 3O38A 2XN9C 1O9GA 3IJPA 1I3NA 1D0IA 5E6UA 5DLYA 1BW9B 1ZCZA 3WHPA 3PO0A 2C84A 4NG4A 1X0VA 3EN0A 2WXIA 2O1WA 4RM3A 1PDWA 1GGVA 2VA3A 1OCEA 3WIMA 3CF6R 2QK4A 1G5IA 1YZ3A 5BV0A 3GP8A 4F45A 1TD1A 3TNJA 3TAPA 6AT1A 2UZIR 1E9RA 4GSYA 5TMBA 4I9FA 3PG5A 5J5AA 2X5XA 1QRTA 2BMAA 2QB5A 3G6KA 2VTVA 3NM4A 1VDZA 2XD4A 2IYZA 3O4HA 1PT7A 1C1DB 5BMVB 1RVV1 4YAUA 4NNJB 1WQ1R 1NU8A 1US8B 1P2UA 3F6CA 2QQFA 5CK5A 2O19A 4DA0A 3H7SA 1QGDA 1Y80A 3SZGA 3O2JA 2AX5A 2J0SA 3HW8A 3PD0A 4JX8A 2QHOA 2XSZA 3OJ3A 2XXBA 4ON9A 2C1ZA 3K1AA 3PXAA 4OHCA 4BJHB 4J9OA 3LW8A 4XVRA 3AH7A 2IODA 4DS4A 3DF7A 2BSAA 3S68A 4QBFA 2DYOA 4J9RA 4OAOA 2B34A 2IHVA 3ML1A 2QW0X 3NX4A 4MOWA 3RJJA 1YNSA 4GR5A 1RU3A 2RGDA 4HNUA 4O3PA 1VLQA 4RJIA 3TACB 4L5IA 4JX9A 2HXSA 4G5XA 1NE2A 4MLPA 2IV3A 2COKA 3L82B 1K0FA 4ZOLA 2NVOA 1SSNA 3GUVA 3O82A 3ISDA 1A8IA 1TZOA 1UMCA 3RVRA 1PWYE 3DL0A 4JLDA 4FD2A 4M87A 4BO5A 3W78A 3IM1A 3FF1A 1BVHA 4GW3A 2XNAC 4ECTA 3D5EA 3ND5A 3CKYA 2GYUA 4FKMA 1BIFA 4WTOA 1KSPA 4JNKA 3OQVA 1WZ0A 1C3OB 1ATZA 4NNOA 2YS7A 5L1KA 3ETEA 3DFZA 2ZZNA 2EP5A 3RQIA 5ENVA 3LX4A 3R0JA 2EJVA 1NXXA 3BKXA 3TANA 3P97A 3ZLUA 1XELA 5DMHA 2JA2A 3BL5A 3AFIA 2P91A 3U4AA 3TTWA 5BN3A 5JPCA 1RWPA 1FQKA 2XEDA 5D5PA 5CT4A 5CLJA 5JWRA 4YFVA 3ZWBA 3G82C 3PHJA 4HLDA 3CEMA 1SVMA 4MYSA 3RZFA 1PYOA 3TFOA 1QF6A 1MFZA 5JFOA 2Y4OA 5CNJA 1YH3A 2W4IA 4GMGA 1QQTA 1MG4A 3BBLA 1M1YB 1L8AA 2CS4A 4JBLA 2QX4A 2MRPA 2QMEA 3D6TB 3HB0A 3IELA 3L0CA 3WOHA 4CTKA 3S2IA 4QPCA 4C4YA 3UAXA 2X6RA 3HDJA 2WLSA 2APJA 2JLZA 5D46A 5J5CA 1ZQCA 4C04A 2C20A 4M6WB 1U3WA 1NBWB 2WU3A 4ND8A 1S8AA 4YBRA 3X1KA 5D3IB 3JRNA 1VI6A 1M5TA 1BVUA 1WE7A 2WUFA 3CYFA 1P8JA 1JEOA 4ZN6A 5AW7A 2V7GA 3T5HA 5FUMA 3V00A 3KR1A 4RQAA 3GRAA 4PF1A 3IULA 1WXGA 4JSRA 2QLLA 421PA 3I5MA 2ZVPX 1DAHA 4UAVA 9ICQA 4IRMA 4MGIR 3ANMA 2DKZA 3SJCA 4OJKA 4YRAA 1GGKA 2YYYA 4WK2B 1L6NA 2HNKA 1ZW1A 1FRFS 7ICGA 2I7VA 3DLAA 1ZSYA 3UV3A 4QICA 3PVXA 1I35A 1SUFA 2W42A 4N0PA 4DLPA 1GCOA 4BEVA 4DWFA 2ECPA 1VPVA 4YRQA 4H60A 3RB4A 2YNMC 1XVVA 5IX8A 4MKRA 4E6EA 4YT8A 3QZ7A 2YFKA 3GLGE 3F2DA 3W3ZB 3QQ8B 5K8UA 3KUUA 1YL7A 2GTIA 5KNCA 3PHGA 1F0MA 5EG5A 3C97A 3M1IA 3CVWA 2CFRA 3A6GA 3LFTA 2D1FA 4NR0A 1P1JA 5H16A 2D3TA 5B3JC 2NSDA 3K0BA 1UXIA 5KNCH 5JZSA 3E9RA 4NYIQ 1G5TA 5EZ6B 2J0MA 1QVRA 3BTUA 3TB4A 2FW9A 3EZ9A 1SE4A 3HXQA 3OKCA 3OP1A 4QTZA 2X15A 3HYLA 4PYNA 2EBFX 3E4CA 1KYTA 3NOVA 4QDKA 3SU8A 2PKQO 1DCKA 3P2BA 1GNLA 1TJ3A 3LZDA 5H59A 3OWEB 4L23A 5KTRA 1UQRA 2OCGA 4F06A 1Y8CA 1FZQA 1CUIA 1K5OA 2KM1A 2FPRA 4WNAB 1N5JA 2XCRB 4LRSB 4B40A 5ITSA 5IUKC 3L1HA 3UPUA 1OX4A 3V1UA 3QVSA 4KRGA 1ZIDA 4TSSA 1O08A 2P2YA 3H2KA 1NBOA 2YYSA 2WMOB 2GBCA 3PMNA 2YJGA 3KQTA 2GJ4A 2H00A 5A4MS 4MH0E 4PNPA 4RL6A 1XCQL 4KLGA 2JX5A 1JHUA 2V7EA 3ISJA 4HDKB 1CRQA 3I42A 4NQZA 3HU1A 5IG2A 5J29A 1EXWA 2AGVA 4C4VB 1ZD9A 1ZUIA 1YS9A 3M2PA 3GA0A 1DLIA 4L2IB 4X9XA 3G8DA 4O33A 4JL8A 1EE2A 4E5NA 1TDJA 4EVRA 1JGTA 3WU2U 4JWUC 1GN9A 2WMYA 2RH5A 3R6DA 4WINA 3AEVA 2Q4RA 1FQWA 1D2HA 4CEIB 5FOXA 1SU7A 3AUYA 1IG3A 3RABA 3VC3A 5KG2A 3H87A 1T2VA 3LH5A 5EMKA 4GSKA 3JAKB 5CTAA 2ZJYA 3A0BU 1L4NA 5TSDA 3SHFA 4LUCA 5FUWA 3D8TA 3A6PC 3SQMA 1IONA 4N8SA 3NU1A 4DIOA 3VXKA 3HBAA 3RBZA 3TR6A 2J85A 4A8JB 3OPVA 2QVBA 2ODBA 3HPQA 1HE4A 4HWRA 4TVKA 4DNPA 2CV2A 4Z0HO 2VH1A 2N1RA 3C87A 1D6MA 1NSFA 3IS3A 1ZGAA 3H99A 4BQFA 4RZUA 5DM60 2IYDB 4NBLA 1YD7A 1GCAA 5BV2P 1KL9A 2VPWA 3DDSA 1U7PA 1N1DA 3TYXA 1WE2A 3REFA 2QGFA 2I1KA 2O7RA 4FFBB 1RKUA 3L7IA 1LVUA 3PXUA 4R8MA 1DC4A 2VP2A 3EEIA 1SGHA 2Y4NA 1YB4A 4ME6A 4FWIB 1U7TA 2NVUB 4R7ZA 1GAEO 4ICUA 3ZWNA 3DQPA 4HZUB 4H31A 3ND7A 4MGEA 4DB4A 5D1HA 1CYDA 4V0ME 5FPSA 2XWQA 1NFFA 3OPYB 3WK6A 3OO1A 5ABPA 4KQJA 2MSKA 3MWYW 4OJ6A 1OZAA 4NQKE 4UB5A 3EZLA 1G8GA 2CJYA 2BE9A 2ZSEA 3QBEA 3KXLA 2ZW0A 3N0RA 3M4NA 3MCVA 3AHJA 3C3KA 3V46A 3ICPA 3WA6A 3IP4B 1KYYA 1TO2E 3BS7A 4C0BA 4S17A 2Z5LA 3HUTA 2HHAA 2CC2A 2FMIA 3HWSA 1V8CA 4KV9A 4QDUA 2GTPA 1VLBA 2V0CA 3L41A 4QU8A 2J6IA 3JS5A 1ZK2A 1P0QA 3LVBA 1GZSA 4NH4A 2KMDA 4A6DA 1QYRA 2B3TA 4BKRA 3CURA 3T38A 4IF6A 1UBHS 4HH4A 1YJBA 2HQOA 2E3TA 3QITA 1L5FA 1V5WA 2FSPA 4MR7B 2V4UA 2ESRA 2I4TA 1VYHA 4AMGA 1RDFA 2BPFA 2ZRCA 4OMUA 3KWMA 3NVZA 4F3KA 4RA6A 4EBDA 2QD3A 5KJEA 4OHOA 5B64A 4LMBA 3RB8A 4TLEA 1JR4A 4QGBA 1HDIA 3U80A 3C5EA 4FFPA 4AX8A 3MELA 5LA6F 4WSOA 5CLFA 3E9EA 4R7GA 1TS5A 2OD7A 1X9WA 1SWWA 1Q22A 2I8AA 2Y5BB 4LYEA 4L1BA 2QSZA 3DOJA 2W37A 2EWVA 1KYZA 2VDWB 2GMWA 3ZZTA 2RAVA 1H4VB 3NIFB 5K01A