5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
5TY0A 5L3QB 2D2FA 2ZVPX 3EPKA 3F8TA 8OHMA 4PO9A 5KSYA 2WWXA 1VIAA 2FEOA 3CPJB 3HYRA 2ZI7A 3QXXA 4JVSB 4NYIR 4Q47A 4DLVA 4E07A 1KJZA 1SHZA 2GWHA 3BK7A 3HP1A 5LB2A 1PV4A 3X1WA 1JJ7A 2OBMA 5EUMA 3RRYA 3NBYC 3I3SR 3KTAB 4XWOA 2C2HA 4Q4HB 2RMKA 3K8YA 1WE2A 5LD2C 2QTHA 1Q3HA 1Z0DA 2V55B 1V8CA 2KBFA 2OXRA 4QBIA 4Q9KA 3BIID 1XEFA 4G01B 1NMZA 2JASA 3ZDQA 4A8JA 2ZXUA 2CVHA 3P32A 2Q9AA 1OXUA 4Z54A 2FPMA 3IIKA 4O3MA 5AUIA 2WWFA 3CBQA 2OAQ1 2ZRFA 4ZV4A 5KNCA 3I62A 1NL3A 4WOPA 4KI0A 2RHMA 3LX5A 3KJEA 2ZI4A 5AUQA 5DN6D 2PVGC 4BLSA 2GK6A 1RRCA 2GXAA 1EFUA 1P2UA 1DGJA 2OM2A 2QSYA 4HAWA 3LD9A 4A36A 1YJJA 3AUXA 3IDQA 3EA5A 2Q0HA 1CR4A 1OF1A 1ZBDA 4OJKA 1S1CA 4I1SA 1YR9A 1KGDA 3TVDA 3ZIAD 4W5HA 5AUNB 4WZ6A 3PJRA 4CGZA 2QQ0A 3KDSE 1F2UA 1DAEA 3MWLA 3GLIA 4GZMA 1AQYA 1G5PA 3BC1A 2ZYVX 2KE5A 2FSIA 1ZNYA 3TR5A 2WDRB 3GEEA 1W47A 3OAAA 2JATA 4NL4H 3RS5A 1SXJB 2PVOD 4N58A 1I4LD 2VSXA 2Z0MA 1E9MA 2ACZB 2WSSA 3QG1A 4LBZA 2QPOA 2ZREA 3S1AA 1HA3A 2HCJB 4DEYA 4NCIA 4OI4A 1NBME 3D3QA 3TQCA 3NG1A 4DVGA 4R2IA 1SQ5A 5C4GB 2I3BA 5HE8A 5G3ZA 4GBMA 2OT3B 3I8SA 2ZPTX 1R5BA 1W0JD 4RD6A 4RFSB 2REXB 1N6PA 3DPUA 5IF9A 3H1TA 4EFLA 4LJ9A 4XVUA 2IHYA 1XTIA 2YOHA 1KNXA 1CU1A 1NRJB 3M0EA 1Q12A 4L8GA 1FXIA 1QZXA 4X8MA 3UMFA 1VCOA 1FFVA 1QF6A 4MYTA 5JWRA 5LD2B 2WJJA 4NE2A 5L3RA 2QA5A 3AM1A 4QM6A 4ZDJA 1VKJA 4DSOA 1KMHB 2KJQA 2AX4A 2WU5B 1H65A 1UKYA 1P2VA 2P65A 3JVUA 3RSLA 2F3TA 1DPFA 5B57C 4TLDA 4LHVA 2O8BA 4C0QC 2WJIA 4HZUA 4K8OA 2EYQA 1GPXA 5G40A 3PUWA 2EVWX 1AZSC 1X3SA 1A2KC 3KKQA 3V00A 1XMSA 2QMHA 2XXAA 2GESA 4ZKDA 1FX0A 4IEIA 2VQSA 3W3ZB 1HEIA 2HJGA 1GAJA 3ND8A 3CIRB 3BH6A 1GRQA 1N6IA 4I1UA 4JYCA 4PANA 4LYJA 4HAVA 1MKYA 2GILA 2W6JD 2ZI5A 4HB0A 3SYLA 1ZXIA 1VPLA 4EAQA 2OBNA 4URXR 1XPRA 1OJLA 4HDOB 2WM9B 3LWNA 1HE1C 2NTYC 5FUWA 1R4AA 1CIPA 4F7WA 2DFTA 1GG2A 3K70D 4QRHA 3DO6A 2AXPA 2ZRJA 5IRCD 1NIJA 1XMIA 1VLBA 1GNPA 4E5UA 3B2EA 3D31A 4Q7MB 1G291 5DLQC 3AB5A 3L8YA 1GAQB 2W54A 4KYUA 4FMBB 3U61B 3VU9B 121PA 2XITA 5B58C 1N60A 5B2ZA 4PPNA 3I8XA 1E1QD 4OJQA 2O8CA 3B1XA 3HDTA 1N5WA 2NPFA 2J0VA 1F2TB 3VR2A 3AEEB 4C4PA 1KI6B 1QG2A 2Q9CA 2IYYA 2ZI9A 4Q9IA 5EP2A 5GJCA 1E2IA 2JDID 3FB4A 5KTYA 4HAYA 1AGPA 4BGDA 2Z83A 1SKYE 1RFKA 1N5LA 1T8UA 1CEEA 1DTSA 1VECA 5BXQC 1RPZA 1QOAA 1TUIA 4NBSA 4LJYA 1GL6A 4KSBA 4QBGB 4B74A 2C03A 1RVDA 1XLOA 1OKKD 4JKIA 1W1WA 5B30A 3SFZA 2CJOA 1UBFA 1YRAA 1AA9A 2G1KA 2XTNA 3WYFA 3IO5A 1QVRA 3R20A 5AJYA 2OLJA 3RVBA 3C41J 2FSGA 5KDOA 4RVCA 3LB8C 1ZIPA 4IOLA 1IN7A 2WTUA 1N2CE 1Z0IA 4LOAA 4C3ZA 4MKGA 2BIFA 5TARA 4P32A 1R8SA 4PAMA 2ZANA 1YZUA 3OHMA 4JVNA 2WJGA 1PFDA 2ZRGA 5JCZA 2CJWB 1GL7A 4QJ5A 2AD1A 1GP2A 1E32A 4NCNA 4CT4B 2WOJA 4KLZA 2B76B 3B82A 1BO6A 2B8TA 2IEZA 5B64A 1UPTA 3SYKA 2JJ8A 2W2XA 2GJ9A 1NEKB 4A15A 2OE2A 4TLAA 2FA9A 3L8ZA 4RFVA 2ZRBA 3AE3B 2ZS8A 2IX3A 1W48A 3A1TA 3VX4A 1OQRA 1OIXA 2MSEB 2GA8A 2QROA 4URZR 4B6EA 2AX5A 4P33A 3C14C 2AKYA 4W9MC 4GOJA 2FNAA 3DZ8A 4ZOHC 3VR8B 2K9XA 3FFAA 5CJ2A 4MGZR 4NYMQ 2O8FA 2ZJAA 3KQNA 3AE4B 4ZCLA 5UKDA 4B3XA 4TTRA 3FHOA 1IN6A 4Q1EA 4B2PA 1G3MA 2FJUA 2FGJA 3L0OA 3V9PA 3P4SB 1WDTA 3OE7A 4LGMA 5JJLA 2XZPA 1ETUA 2ZJOA 2D4HA 1W36C 4Q7LA 1AIPA 2CLDX 3A1WA 2N0SB 1LFDB 4UNRA 4AI6A 2NO0A 5K8LA 4DSUA 4UNSA 4JZKA 2GAOA 4BFXA 4C2TA 1E2GA 4CW7A 3PFIA 4DZZA 3R9XA 1WWTA 3RDPA 4YTPB 1ZIOA 3A37A 1KK3A 1MO5A 1XX6A 1GNRA 2A30A 4H9GA 1IHUA 2ERXA 1CLUA 5FOSA 1NN1A 2MSDB 2H88B 3LW8A 4EQ6B 3CR7A 3HR7A 4HDQB 1SULA 3RPFC 1KSHA 3WY9A 4CVNA 2J1LA 4BFYA 1VTKA 1YKSA 2PZFA 2ZJZA 3N70A 3REGA 1MO3A 3ZZTA 1R0WA 2WWGA 3BH0A 5G53C 4UXJA 1CR2A 3IQWA 2D3WA 3THWA 2YOGA 3ABVB 4DC9A 4X8OA 2ORWA 2IUTA 2V6JA 1T3HA 4B2LA 2LKCA 2VRWA 3G82C 1EFRA 3GJ4A 1SKQA 3KX2A 5AJVB 1M34E 4DLWA 2CHGA 4HEJA 2JJ1D 1L4UA 2AWNA 2VSOA 4KHZA 1XXHA 3VRAB 4DLZA 1NY5A 4M53A 4NYMR 2A2ZA 3TUJC 5F9FA 4DXAA 1QT9A 4ZDWA 4LBVA 1RJ9A 3LQQA 4DJTA 5JFGA 1E10A 4HYYA 3T61A 1NY6A 1Z0KA 1Z6GA 1ZP0B 2GBLC 3KUDA 1A1VA 2RB4A 2W0SA 3WNCA 1N62A 1U94A 5L3SA 1RYJA 3AE1B 1OH7A 3IEUA 1KK2A 1G4AE 3JVVA 4OL0A 1FFHA 4QGHA 5EJEA 1B9RA 2Q3FA 4JLJA 3T34A 4AYXA 2JLYA 2QE7D 2W2VA 3IKJA 3NC1C 5MPOA 1RRGA 4JWUC 1W36B 2PMKA 1E1RD 5BW8A 4DSTA 4B48A 5FI0B 1A70A 4AKIA 2TMKA 4V02A 4BRWA 4U02A 4PZYA 1TQ6A 1YHNA 2IYSA 1N61A 4URUR 4F91B 1XEXB 2L0XA 2ZS7A 3F0TA 4MA4A 1AS2A 2ZRLA 1SKYB 3HWSA 1TJEA 1OT3A 1Z22A 5BN3A 1R0XA 5H68A 3SFVA 1KHTA 2DWQA 2FFQA 1AS3A 1L6VA 1OV4A 3U44B 3SJBA 1EWQA 3T06B 2BVNA 2D7CA 5DYGA 3DVLA 2IEYA 2ECKA 3TQFA 1TL7C 4MDEA 5FR1A 2CBZA 3DM9B 4LDJA 3QG5A 2XOKA 3IIMA 4HI0E 4F4IA 1U8YA 1TMKA 3B6EA 3NBFA 4HLUA 5JWHA 3IGFA 1MO4A 2D2EA 1VJKA 2J3EA 3C5CA 4IDPA 1JPNA 1A4RA 2YWFA 1DOAA 5AR1A 4QL3A 3RWOA 4LJAA 1CP2A 2ZAOA 2WJYA 4A0RA 2XTZA 3OZXA 1JRPA 1CTQA 2X1VA 4M22A 2WIAA 1ESNA 1FL9A 1BH2A 2G77B 1ZNWA 2JCSA 4IXMA 2CCJA 5HZHA 1CF4A 2PIAA 1E2EA 3OFND 3EARA 4WQMA 3NKVA 4F4CA 3LVQE 1RM6C 4JT2A 5EQTA 3TUZC 3T1TA 1KSFX 4GDFA 1B0UA 1AKYA 4FMCF 3VAAA 1FMAD 4GRAA 1SIJA 2HF8A 4QG7A 5BQ5A 2GJKA 1QHNA 2ZEJA 3GCGA 4MQBA 3AGPA 3ADKA 3FYHA 5G41A 2JJ1A 3X1YA 2DFNA 1IBRA 1UKEA 2V4ZA 1A82A 2WICA 3NTUA 3T1VA 4CF7A 3ADCA 1DO0A 2X2FA 3ZYYX 1NF3A 2CVFA 3CF2A 2VL7A 4CEJB 3SQXA 1WRBA 2EFGA 3M1IA 3K9LA 2ZRAA 4OI2A 2W3RA 2BBTA 1D8TA 2ZITA 1YQ4B 1CJMA 3CWQA 4LV6A 4O2LA 4B32A 3QKRB 4FCVA 3TKLA 4DCSA 1T0JB 1OFTA 3CPHA 2VHTA 4PQYA 2DY1A 3W6PA 2FF7A 4PPFA 4A0HA 3AKDA 3SOPA 1US8A 4LV8B 2J0UA 2WIBA 4N0DA 3WRYC 5C2JB 5KDDA 1WMSA 2FOLA 3NVWA 3C4JA 3QEOA 5J4HA 3CO5A 3BERA 2OILA 4C0BA 1JW9D 3B1ZA 5LDDC 4Z1MA 2AN9A 3VR5A 3U3KA 3PR1A 4LX0A 4QM7A 2QORA 3EWSA 3K0FA 2ZE5A 4PC2A 4NYJQ 3AEDB 2FN4A 1GRRA 1OFIA 4Q1CA 4XOIA 3UK6A 2GEUA 3WP0A 2PH1A 3A6PC 1N5JA 1P62B 3K53A 1E0AA 1OH5A 5AUKA 3TH5A 4IVRA 1GNQA 4D0GA 3FOZA 3EAQA 3UWKA 2WSMA 3EIHA 3PEWA 2VF8A 3KKOA 2Q9BA 1R6BX 4V0MA 4EUNA 1XLNA 4N59A 2PJZA 3AVVA 1W5TA 1W49A 5JEEA 3OEEA 5KSZA 1MOZA 1N6KA 1JR3A 2Z6VA 1VG8A 3TVTA 5SZKB 1SVMA 4F92B 2XNDA 3R8FA 4M1SA 3T5GA 4ZDIA 1LS6A 4USAA 3O47A 2XTMA 3PEYA 5KNDA 1G21E 2WPDA 2BS2B 1NVXQ 4BLPA 1QDEA 1VYVA 2BEKA 4ZIRB 4MKFA 2WWWA 1ZNZA 1TX4B 2JEOA 1ZM2A 4GMDA 1WF3A 3U4QB 1VYTA 2BM1A 1VHLA 3L2OB 3IBGA 1NYQA 2BMJA 4XD7D 5FTNA 4D80A 2V8OA 3GJ0A 2F1RA 3LVRE 1ELOA 1GIAA 1WCV1 4GP7A 1J7CA 4IXNA 1MRSA 1TTTA 2ZVQX 3CNLA 3THOA 4TSFD 1JROA 4R71A 5J4LA 2ZROA 1ZW6A 5HPYB 1IM2A 3K0CA 2M56B 4O25A 5K8IA 1P73A 3U6KA 2GNOA 3GLHA 3P1JA 4HLQB 4JL6A 3IO3A 5F2EA 1U0HC 2QT0A 3U3RA 3GPLA 1UAAA 1QHXA 3UXMA 2W3SA 1DOXA 3WHKA 4PR0A 2HLDD 4H1VA 4OQFA 1BOFA 4XVRA 3LXXA 5FH9A 1R7SA 4JLPA 5JJIA 3OIWA 1GTVA 1ZCAA 3SHWA 3L0IB 2BT6A 1S0UA 4NYJR 3KFVA 2A7QA 4RKFA 2BCJQ 5CM9C 5EXTA 3T35A 3WNDA 2ZJYA 2PL3A 2CMKA 2HXYA 3IHLA 4GP6A 3DM5A 3IHWA 4KVGA 3L43A 4BFWA 3EPLA 5FPTA 2JAQA 3OESA 2ZRMA 3TIFA 4ZDKA 4XIGS 3SJAA 2ZI3A 3QSYA 3TBKA 2QRZA 4A6XA 2OCBA 2FPLA 4TTPA 1Z0JA 2IYUA 1R0ZA 3ICEA 2CLSA 1UEJA 3FFBA 4J0QA 4R98A 2QQEA 2X8AA 4JLBA 3FKSA 5L8VA 3QE0A 2C04A 4YXDB 2XJ4A 4BEJA 2VP9A 1IONA 3MCAA 3NVVA 3N2EA 2FG5A 4UXHA 3ZH9B 1G8HA 3GLFA 2VO1A 3DEFA 2VF7A 4G5OA 4KODA 4BASA 2SHKA 4DIEA 2VH5R 5E7IA 1QF9A 1Z0AA 2LCFA 1ZM7A 5AJXA 1XD2A 3AM9A 2Y5CA 1SVLA 3ZJYA 1PVOA 1G9XA 1N6RA 1AZTA 2PEYA 3IIJA 4M1WA 2ZI6A 4X8LA 1P2SA 1IN5A 4FXPA 1G20E 1Z6XA 3AVOA 2ASEA 1WBDA 2F1JA 1G6OA 1HYQA 2JLVA 2I4IA 3KZ1E 5JLJA 1LB1B 5FOVA 3EZ2A 2YWHA 3SFEB 3EXAA 5CB6A 5JCPA 2IHBA 4JVMA 1KTVA 621PA 3KB2A 3GEHA 1Y3AA 1KDTA 5H92C 3OAAD 4ON9A 1G16A 1E6EB 1K8RA 3O8DA 3F3YA 3BAFA 3WHLA 4BLRA 4B33A 2FFHA 2Z4SA 1II0A 2WSSD 3GD7A 2WKQA 5JRJA 4XD7A 3A4LA 1ZYUA 4JLAA 3RANA 2C95A 1QBKC 2F43B 4PC6A 3THXA 1KI8A 2H7VA 2WAXA 2NZJA 3GLGA 4PPQA 2OCYC 1U81A 3UMSA 4YSZB 1CXZA 4S35A 1HURA 2NGRA 5DIFA 1N0UA 4TSFA 3HRDD 2W2TA 2B6HA 1RWSA 3KQKA 3CH4B 1EX6A 1X1RA 5CYOA 4JVLA 4ACAA 2FEMA 2WWIA 4BFZA 1E2HA 4IDHA 3BH7A 3VRBB 5JS7A 1BYIA 1O87A 2HF9A 3OIVA 3NEJA 1G1MA 2KAJA 1MR3F 4W5WA 3U3OA 3MAAC 3LQRA 4Q9HA 4C30A 5DI3A 1AM4D 1M2OB 1RYFA 2QTFA 3RHFA 5E7MA 5D3MA 3SZRA 2DHRA 1W4RA 1KO8A 3LBHA 1ZP6A 2M19A 3FDIA 1HTWA 1NLZA 1TF5A 4IVPA 3W34A 4BFVA 3PXGA 2O8BB 4M1OA 4Q48A 2QPAA 4HZUB 1EG7A 4BLQA 3ADBA 1OYWA 3GMTA 2DCUA 4BLTA 4OQLA 5H1YA 2XXAB 2ATVA 2G0NA 1J7BA 2AK3A 3EZFA 2MJ3A 3B5JA 3EC1A 3K9HA 4MRVA 5FUYA 1TQ2A 4Q21A 1EFHA 4Q4JB 5FTKA 3LY5A 1NKSA 1Q0UA 1U9IA 3UG7A 2Q3HA 3CZPA 4GI7A 2NQ2C 4ZCIA 1G5TA 4IDQA 2VP4A 3KJGA 3CWZA 1S8FA 5EXXA 2E87A 2MJEA 2ODNA 4F38A 4G5RA 1IN4A 2UZ3A 3NH9A 4C7YA 2VHQA 2MMGA 3EZ6A 4ZKEA 1LTQA 3B2GA 3QI2A 3QQ5A 1QHHA 1GKIA 2PCJA 2IK8A 1OXVA 5C18A 3SYNA 4IDNA 4XH9B 3FC4A 1NYRA 3O8BA 4PC3A 4PZZA 2BMDA 5FBLB 4KX6B 4Y0AA 2CE7A 2BOVA 4P4TA 3BRWD 4B73A 1FRRA 2O8CB 2BMEA 1F48A 4RZ3A 1T0HB 1L2TA 2ODBA 1WA5A 2GAAA 4LHZA 3K70C 4FMCB 3U7EB 2H92A 1OIWA 1Z07A 1ZM3A 2WOOA 3D8BA 4TZ0A 2JLXA 3B7GA 5JRZA 2PLFA 3BBPA 1E94E 3ZGXA 4RCZA 1R10A 2FPKA 1SVWA 1FMLA 3PUXA 4ESHA 1CS4C 1R5NA 2GRJA 2QRNA 4B75A 5EE9A 2JLQA 5EE5B 1XMJA 3K0EA 2D7DA 4ITKA 3EUB2 2FWRA 2J0SA 2HDNB 1AWDA 5FUXA 4Q7KA 5E3HA 4TYWA 4L5BA 3PCRB 4ARZB 3BWDD 2QBYB 2J5XA 1NI3A 3P4XA 2BEJA 4DLSA 1TF7A 1E2FA 3FGNA 4XWKA 4URWR 3OEHA 1C1YA 2FE4A 2QT1A 1N3BA 1CRPA 5TV2A 2WV9A 1WRIA 2QG6A 1II8A 1T5LA 2D06A 4KFSA 3DWGC 2CE2X 1N0VC 4FWIB 3VR4A 5AUOB 3RS3A 1WB9A 2V9PA 1E6CA 1VMAA 3C5HA 4LCBA 1S1MA 1G41A 2C9CA 3CRMA 3TMKA 1N6OA 3GJ8A 4BWYA 2ANCA 3GQBA 4XSHA 1E9SA 4P4SA 4PSAA 3TNFA 5KNBA 3MD0A 1FUKA 4XWAA 4HLCA 1NENB 2GJAA 2O52A 1E4VA 1WXQA 1PZNA 1U98A 1YRBA 4MRPA 3SJCA 3U2QA 4L9WA 4ZCMA 4RD2A 3K9NA 5EE0A 3AE9B 4ILEA 4CEIA 2WDVB 2BCGY 2R62A 1N5XA 2IW3A 4PHGA 4JJKA 3AE5B 1TUEA 4N1AA 2ZUDA 2O8EB 5FOUA 1GITA 1Z47A 2O8FB 5C4MA 2JLSA 1IXZA 4YC7A 4BE7B 3R7WA 5FL3A 2PMDA 1DAFA 1K6MA 2RGNA 4IEEA 2EYUA 5DE3A 4FWTA 5L3QA 2N1BA 1GWNA 4QHSA 2RCNA 5GADl 2OAP1 1OSNA 4PO8A 3U6BA 3MMPA 3K70B 1ZRHA 2BJVA 3OE7D 4V0NA 3H86A 1ZU5A 2EW1A 4LJ8A 3WCQA 4B35A 5JHGB 3K0AA 1L7VC 4I1OA 2DR3A 4OK6A 4RZXA 2YOFA 4M21A 4PZLA 5HTKA 1UEIA 2AD5A 1Z6TA 1T3QA 4M8NE 3RS7A 4GL2A 4Q03A 4Q4HA 1X1SA 3QUSA 4FIDA 5FTJA 4DB4A 3X1ZA 4B3BA 4DDTA 4Q00A 1SVSA 2VHCA 1TADA 4NU0A 2IT1A 4Q9LA 1T9HA 2KBEA 3LDAA 4LJ7A 1OFUX 3ZVLA 1KI9A 2GHIA 4AG5A 5JBQA 1KKMA 4WZAE 2XNSA 1XTSA 3D7MA 1XCPA 2WWHA 1UADA 5BN4A 3P20A 3PUZA 3W3AA 1XDBA 4B6FA 4KFTA 3Q85A 1KI1A 4OBEA 5JECA 2J0QA 1JAHA 1XTKA 4MRNA 2ORVA 2P6NA 3PVSA 3QEJA 3LFUA 4R9UC 4K81B 4PFSA 2I1VB 3B60A 4HLUC 2XZOA 3THYA 1KYIA 4NTZA 2OO7A 4AC9A 1CR1A 3R9WA 1UDXA 3QVVA 1IAQA 2DYKA 1KI7A 5EXSA 2R2AA 3CNNA 5CDFA 4CYMA 3FPAA 2GF9A 3GJ5A 2W00A 1EFRD 4G5GA 1Z28A 2ERYA 1FZQA 4IVQA 4K46A 3GFPA 1XXHB 1KDRA 4B34A 3RC8A 1DOIA 2ZRPA 4RY2A 5J47A 1TKEA 4ABYA 3AUYA 2PJRA 4TN1A 3VMFA 2P5TB 1W46A 1RJ9B 3P63A 1VCIA 3SEAA 3CPEA 4OHWA 3TRFA 1OB5A 4DCVA 1SXJA 1ZMXA 4LJ5A 5ANRB 3X1DA 1N5IA 4EJSC 2CL7X 5L3SB 4RD3A 4CT5A 2OSBA 3EASA 3ZVRA 4LSGA 4AKEA 1YR7A 1KDOA 1D6JA 3QNUA 2CL0X 3AH8A 1D2EA 2CLCX 4JWSC 4ERNA 4L9SA 1KFYB 4TYYA 3E70C 1GL9B 2R44A 3WMFA 4RFSA 3I61A 4M1MA 1LNZA 5K8TA 1IY2A 3AEBB 2O0HA 3BJIC 2GZHA 3SI7A 1K5DA 3FAHA 1XPOA 4Q7JB 4WXPA 1T91A 5GJBA 1E7PB 3SBEA 3ETLA 2QMUA 1HH4A 2VEDA 3P4YA 4Q18A 1IXRC 3AF0A 1XLPA 5GJWC 4LPKA 4A2PA 3B85A 1JBKA 3I72A 1J90A 4LC1A 1KMHA 4ZI3A 3KQHA 2QGNA 4C7OA 2QPTA 2GEDA 1Z6YA 2C78A 4KFUA 3FHTA 3AP3A 2CHVA 2DFLA 4GOKA 5CITA 4EFNA 4XVQA 1DO2A 2ZRHA 4TWZA 1TPZA 3MRSA 1EX7A 3KB1A 1OLOA 4TLBA 5DHFA 5FOWA 3NEYA 3QKUA 3KXKA 1FFUA 2BS3B 4YMWA 3DWMA 2XOKD 4I1VA 1G18A 1GVNB 4US9A 1J7KA 1HT2E 2B7BA 2B8WA 1P4SA 3CF6R 4DLTA 5EZ5A 2W58A 2LKDA 3W6OA 4BUJA 1FTSA 2VPPA 4Q19A 3B2FA 1I2DA 2JA1A 2NZ8A 4PSVA 4A2QA 2XB4A 2J46A 2IWHA 2KMMA 1MV5A 1U99A 2REOA 1DVRA 3VKWA 1A7JA 2CNWA 1AK2A 2C98A 1Q22A 3LXRA 5DSZA 4YQFA 2H1LA 1NMXA 2QU8A 4L15A 1JQLB 1TAGA 2ZYTX 4BZQA 3AF1A 3QKSB 1GZSA 2WKPA 2YV5A 4LK2A 4C0HA 3AECB 3BGWA 3VU9A 1E2MA 3RABA 2QEQA 3LAWA 4LHWA 4EJSB 2WJVA 4QGGA 2QGZA 1FTNA 1QHSA 2VP6A 1LW7A 4TMKA 1S2MA 3DMDA 5CIWA 1ZJ6A 2OEPA 1XZPA 3EIEA 4RSGA 4MKHA 2FV8A 3R9IA 1E0JA 4W5JA 3SHFA 3BB4A 3P4QB 1G19A 3MWJA 4M9ZA 1XPUA 2X77A 1ZINA 4TMXA 1TYGB 5KPDA 1L5PA 3AP2A 4DCTA 2IUUA 2Q6TA 5LB4A 2H17A 2FBWB 1E96A 1NN5A 4AWXA 1MT0A 3P4PB 2BS4B 3IQXA 3K0CC 4DSNA 4JBYA 1F0ZA 2C99A 3AVQA 4C0KA 2ZR7A 3VQTA 1M8PA 3B8HA 4UNQA 1W4CA 1G3UA 4IOKA 1NIPA 1K5GA 2GEVA 4AYTA 2QAJA 1BIFA 1VDZA 3CX6A 1SHKA 3Q9LA 1FMJA 3E1SA 1CJKC 1JECA 5KDLA 3T5DA 5FTLA 4D4JA 4RD1A 1AKEA 1DAHA 1GKYA 3LNCA 1BMFD 4LUCA 1GFIA 3I92A 3ASYA 3SC3A 4EPTA 1PUJA 1TU3A 2GXSA 2KWIA 4BRUA 4Z1MD 1L4YA 1UBEA 3K0FB 3PUYA 2YWEA 2EFCB 5EUQB 1P5ZB 3FMOB 3TW4A 4JLKA 3MUFA 2N42A 2QAGC 3H84A 1XZQA 4A82A 4D4KA 1X8LA 3K09A 3KKNA 5CIQA 1DADA 4B3GA 2ZJ8A 4MKIA 1TU4A 4LBWA 4WIAA 1NJFA 2AKAB 4AURA 5ELXA 1GRNA 3GJXC 5C46F 4DUGA 5EE1A 1CRQA 1F3OA 2IXGA 1W2GA 2ODEA 5LPNA 1E9FA 4B43A 1F6BA 5GJVC 2VIIA 1XF9A 1FOEB 4KLNA 3OEED 1U0LA 4A9AA 4TL7A 1JR3D 2ZETA 4YSYB 1E9AA 1G64A 2QTVB 2ZR0A 2Z4RA 2XNDD 1R7RA 2IS6A 5IDVA 5CM8B 1YZQA 1XTQA 4N3NA 3ZS8A 1KIMA 2WPDD 3AQ4A 5AWFC 1JEEA 2QIEB 2XJ9A 4DCUA 4RCYA 5GXGB 3NXSA 4Q1FA 1X8KA 5C2TB 2NO6A 1HV8A 4R7ZA 3V4FA 3VX3A 4BFTA 1NN3A 4E03A 5IT5A 1W4BA 3C16C 3NRZA 1G3QA 4FI3C 5HKKA 1DAKA 4YONB 3KJIA 2UZIR 5KSPA 3T1QA 3WYGA 4P6VF 4Q02A 5E95A 1XD8A 1TKGA 1KZ7B 4O0MA 3BE4A 1T3SA 4H1UA 4QJ4A 2I1QA 4C0LA 4C9BA 3GLHB 4TYQA 2PT5A 4BEBA 1Z83A 3NHAA 1NMYA 4WVFA 4D81A 3GLIE 4AKHA 2VBCA 1DE0A 3VR3A 3SBDA 4KYIB 3E5HA 4EQ6A 4QNMA 3UG6A 2RGBA 3AF4A 4TQUS 3RWMB 1NKTA 521PA 4OHXA 4ZHPA 1KI2A 1MH1A 2REBA 2V7QA 2QP4A 3HPQA 1P60A 3LV8A 4HUTA 3PO0A 4LBYA 3ZVMA 4KAXA 2XSZA 5TMPA 2ZE8A 1G7SA 3FHCB 2CJNA 3W8RA 2B7CA 3EZ7A 1OFHA 1Z2CA 2RH5A 2WMNB 3CF0A 1I7HA 2PX3A 4C2UA 4MGKR 2QAGB 1NLFA 4D82A 3TSZA 5KSOA 4M9QA 1KK0A 2HEIA 1KJWA 1XTRA 5CLLA 2WBLC 1GOTA 3OIUA 4GZLA 4IOMA 2V6IA 1BMFA 2CDNA 1TKYA 3KQUA 4DLRA 3KKPA 4Q5IA 3FKSD 2Q21A 3AVUA 2QL6A 3AN1A 3NS1A 2NOAA 4JX1C 2WAYA 4IDIA 1W44A 1LV7A 1XFAA 2QP9X 5IK2A 2BV3A 4URVR 1P75A 1EK0A 3QXCA 4Y0VA 3MFYA 3MWYW 1XD2B 4RD0A 4WAUA 2IF2A 2WLBA 1Q57A 4EPYA 4OI1A 3K9GA 2O5VA 3NBZC 4C0JA 4Q4AB 4A8JC 3VR9B 1FP7A 2J7PA 4KU4A 4BZPA 5EP1A 3I1FA 5TXGA 4N0EA 1G17A 3ZZUA 3ND9A 4TYPA 1N63A 4V03A 3AF3A 3RLFA 5J40A 1ESMA 4YXWA 3CW2A 4W7SA 2OFOA 2ONKA 3BB1A 2EFDB 4R2HA 2GVZC 3UANA 4TT3A 4LYAA 1XEXA 4IOJA 2IUSA 4UKDA 1ZM4A 5BYJA 4C0AC 1OQQA 1ODFA 1QLBB 2C9YA 3P26A 1N6LA 1DBSA 4ACBA 4V0LA 1Z63A 2R8RA 4I81A 3ZD7A 3T1OA 4JS0A 2XAUA 1YE8A 5HCNA 4QJ3A 2E9SA 1RC8A 4GMXA 2GTPA 4YMUA 3UMRA 4PO1A 5DNYB 3K0SA 3W5JA 1M74A 1HT1E 2HUPA 2YC2C 4AKGA 5TVKA 3AKEA 3QBVA 1J8YF 2A9KA 3CLVA 1OW3B 2J9RA 3B9PA 1LS1A 4OYHA 2OLKA 1OH8A 4M1TA 3ZZ0A 3LLUA 5JWOA 1DG1G 3X1XA 4YTMB 1Q1BA 3ZS9A 1ZUIA 2ZRKA 2K5PA 1U90A 1CULC 1N5KA 1XO3A 2GCOA 1JJVA 3EW9A 5KYKA 3KL4A 5D3MB 5KO2A 4HB4A 3SJZA 3ECCA 2WQYB 4TMWA 1M7BA 1SVKA 3Q8XB 2EFHB 4YLGA 3GP8A 1ZD8A 5GVSA 2QENA 3NVAA 2F6RA 5KPJA 1XBTA 3M4YA 4E22A 1YJIA 4JLOA 5FPKA 5FBQB 3G5UA 1YJ5A 5J5CA 3QF4A 1KDPA 1YZGA 1EFTA 1T5IA 4NMMA 2GBLA 2BMFA 1BKDR 4AY2A 4M1YA 4Q1BA 3TJZA 2HT6A 4NCJA 5A5GA 2XZLA 2IC5A 2AFIE 1Z6AA 3ZQ6A 5F3WB 1YR6A 4G1UC 1W0KA 1E9DA 4A8JB 721PA 3PV0A 4G0NA 1JXOA 4YMTA 3QPVA 2Q5WD 3BS4A 4NCKA 3A1UA 1IXSB 4JKYA 4JYBA 2FZ4A 2QI9C 1SF0A 1L0VB 4ITRC 4CEJA 1PDXA 3I73A 1Z3IX 1DAGA 2J41A 1QHHB 1KSGA 1IJEA 2H18A 2RAPA 3NDPA 2CL6X 4EKDA 3VNVA 3CONA 4CRWB 3QKRA 2JX5A 2ZRCA 2QN6A 421PA 5TB5A 2RGNC 4UNNA 5FPYA 2K5UA 2F55A 2V1UA 3BORA 3CKLA 2NMVA 1DS6A 1FNMA 2ZSEA 2IF0A 3A1VA 3Q5DA 4ZI2A 1Z06A 3NBXX 3P27A 1D5CA 2IYVA 5F9HA 1ZC3A 4TMTA 4JLDA 1D2MA 1XJQA 3AEFB 1F2UB 4ESVA 3HU2A 3MJHA 1ZOYB 2GF0A 4IW3B 3GLIB 4HUQA 4JJZA 2YYZA 1E9BA 2G1EA 1J70A 5EE3A 2ZR9A 1G7TA 4TLCA 2VP2A 4UJ5A 2IWRA 4II7A 3SR6A 3UWOA 5FBRB 1XRJA 2W6IA 4NHOA 3SFDB 4ZPXA 3RS0A 4TYNA 2ZYUX 3KQLA 2OXCA 5HCIA 3P4RB 2GVDC 2RHDA 3SNHA 3FKQA 1S4QA 3S1AB 3QY0A 2GCPA 2NPIA 2V1XA 1GILA 1LY1A 1MABA 2E1RA 1CJTC 2ANBA 1IJFA 2B21A 1E9EA 4MUAA 1AS0A 1L8QA 1N25A 1II8B 1SVIA 3FMPB 3OEHD 2ZUBA 2QY9A 2IXFA 4TQAA 1KZGB 1X8JA 2RGDA 4YT0B 3HYTA 4HZIA 3U3MA 1U0JA 3A4MA 3AH7A 2BWJA 3CWIA 1P2TA 4P4SB 5DI9A 2H16A 5DO9A 3R8CA 1FQJA 1DELA 3W90A 4UQOA 4ZIRA 5BYKA 4YMSA 3U4QA 1RIFA 2G3YA 2OFXA 1TF2A 1NNEA 3HJNA 2JJ2A 4GOXA 1ZU4A 4D4LA 2ZRDA 1E79A 2OZEA 3B9QA 2BM0A 4HAZA 4PHTA 3BD9A 4UNPA 3W5VB 4CEIB 1ONBA 1FO4A 1Z08A 5P21A 3EIQA 3WBKA 4FW9A 4B44A 1CJVC 1FX0B 1RE0A 2BKEA 3TSOA 2ZTSA 1XXHE 3AV8A 4NCHA 4FXCA 2MSCB 3HPRA 2JLUA 1VCMA 3BOSA 1E9CA 4CDGA 1O3YA 1CJEA 1I4TD 3ADDA 1UF9A 5F98A 3NVZA 5HE9A 2QUZA 1RFLA 4KJZA 1COWA 2G88A 3K0AB 3N5CA 4M1KA 5HR5A 4S2EA 3U5ZB 1LF5A 2P6RA 3RC3A 4PHHA 1P3JA 3ETRA 5IHPA 3AE8B 3NVYA 4LJ6A 4WXRA 2BBWA 2DWPA 2ZE6A 1R8QA 4ASUA 3W5UB 1QOFA 1XJ0A 1KO1A 2GCNA 1YR8A 1KRHA 4YDSA 3EPHA 1SB3C 4BECA 3KJHA 3CIOA 221PA 2RGEA 2B92A 3LBIA 4DWJA 1E99A 4LRWA 5FR2A 3W8NA 1H8EA 4C80A 2ONJA 5JEDA 4V0OA 5H70A 3I4LA 4YMVA 5G5GA 4CEHA 4LI0A 1F5NA 2G83A 3NH6A 4Q01A 1G6HA 2QP3A 4PX9A 2ZU6A 5JSZA 3ASZA 2GK7A 1H8HD 1WYGA 4DBLC 3KXIA 4PQFA 3THYB 3T12A 3SU8A 3CB4A 3AE6B 3QVUA 4LYFA 1J99A 3DOFA 2R6GA 2CK3A 2P2LA 2Z5FA 3VKHA 1E98A 1G3IA 4AD8A 5CYPA 2O0JA 5AUPB 2MH7A 5AJWA 821PA 2VTKA 2P6UA 3TW8B 3DL0A 2RGAA 3ONWA 4PQRA 4MYCA 4NPHA 3VKGA 2ORIA 1ZUHA 2IYTA 2GKSA 1Z0FA 1ZM9A 2OG2A 4I4LA 4U5XA 2GJ8A 3KWLA 3DZDA 5TDHA 4B3CA 3EX7C 2A5YB 2YJTD 1V5WA 2OFWA 4LHYA 3VHLB 5CLQA 1OXSC 5A0FA 4URYR 1SXJD 4HATA 2OHFA 2F1HA 4JSYA 1Q1ZA 3MGCA 2JIZD 1FRDA 3MSXA 3HUIA 2IYXA 4U7DA 3I5XA 4LV5B 2F43A 5FUVA 2O8DB 3TK1A 3TR0A 5FL7A 1XJCA 4HRSA 4DT1A 4OHVA 2ZAMA 4RD4A 3WMEA 3VNUA 3AVWA 2GXQA 1FNNA 1VG0B 4L16A 1E2QA 2YNMA 3ZYCA 4IFBA 3FVQA 1NSTA 2NO7A 2UVQA 4D0NA 3U7GA 1VCNA 2CU3A 2MMCA 5KUTA 1JWBD 4E09A 5DGXA 4NH0A 1EWRA 3NWJA 5C1BA 3Q7QA 4BPBA 2WHXA 1PUIA 2PCLA 1PLJA 4Q4LA 4POAA 2O8DA 3DMNA 5KU1A 3EPJA 5KOYA 4C7OB 3IUYA 1KSJA 4BFUA 3O8RA 2FMXA 3MLEA 4RKEA 4QKQA 2ZM5A 3BIFA 2AWOA 3BFXA 4MUBA 3PENA 3B1WA 5A4JA 2NO1A 2DFKB 3LH5A 2DB3A 2E3TA 2A78A 2QMEA 4JSTA 3WP1B 4ZHOA 3KTAA 4RZUA 2PZEA 4Q4JA 4TZ6A 1KAOA 2D62A 3RS2A 2YINC 4DLYA 5K8UA 3LW7A 4QNRA 1HQYE 1E4YA 5CB8A 4XTCS 3K09C 4OI0A 4XJXA 4YSXB 5E7JA 1Z8FA 4IDOA 4FCWA 3QXJA 3TE6A 3MWKA 1CR0A 2RGCA 4EIWA 4JLVA 1N0WA 3SQWA 4D6PA 1DARA 3CUEF 1R0YA 3RRZA 3Q72A 2ZE7A 5DN6A 5FPHA 1UKVY 3TAHA 3LBNA 4TMVA 1H8HA 1FIQA 2Y8EA 4QBFA 2CNWD 2BDTA 2FSHA 1KKLA 2QMOA 2HTME 3GJ7A 2BBSA 4QGFA 4LPSA 3DHWC 3QOFA 1UM8A 2EU8A 2WVJA 3QPUA 2YHSA 4A1FA 3THWB 2C8VA 1MRNA 4KVAA 3ZIAA 4V0ME 2BC9A 1VHTA 1JR3E 4BQSA 3Q3JB 3AVXA 4LY6A 4WA7A 1XTJA 1HY3A 4QOSA 4RZ2A 2GETA 5FOXA 1P61B 2G0TA 2VYFA 4D4MA 2OCPA 1Q1EA 1YZTA 1G4UR 4Q9JA 2J59A 3E2IA 3Q5EA 1HE8B 2PBRA 3SE0A 1P9RA 3NDBB 2VA8A 3W6NA 1D9ZA 1T3LA 1W5SA 2JIZA 4JMPA 1EWYC 2ZSBA 2A5DA 4ARZA 3IBYA 2QBYA 2A5GA 1T8TA 2OUKA 4LYHA 4U00A 2DBYA 4M4SA 1RZ3A 2QZ4A 4B47A 3LA6A 1G8FA 2PKOA 1W0JA 3GLHE 3TUIC 3DDCA 2A3RA 4KBGA 2VP0A 1QRAA 1T6NA 2YKGA 3OIYA 1II9A 3KFXA 1NVVQ 3I32A 1IOZA 5FBWB 3CNOA 4UJ3A 3VR1A 1NVUQ 1XCMA 1NN0A 4OQMA 3DKVA 2PEZA 1KI3A 1QHGA 4GSYA 4D0LB 1AQUA 1OH6A 2ZS9A 2V54A 4FN5A 3W5IA 1JI0A 1G3RA 3DKPA 4A0GA 1Q44A 4LHXA 1S3SA 1TNDA 3EA0A 1J2JA 2BHRA 2ZUCA 4PXAA 2ODWA 4HDCA 4MYHA 4AIIA 3VHXA 3CRRA 4DUGD 1U2RA 1UWMA 4QXAA 4MDFA 4D2IA 2P5SA 4A92A 1C9KA 1S9DA 4GPTA 1UKZA 3PEVA 2IYQA 4DCNA 3H2YA 2O8EA 3QXSA 3JZMA 4V0KA 4KITB 1E3MA 4I99A 2HYDA 3NC0C 2W6JA 1JB1A 2QNRA 4A0FA 1KJYA 4KO8A 3FTQA 3RSOA 3VFDA 3AF2A 1EGAA 3CZQA 2LEKA 3GLFE 2ATXA 4LTUA 2O0KA 2AR7A 1E9RA 1SVOA 1G8YA 5M04A 5AK0A 3B1VA 3B1YA 1QOGA 3TLXA 1Q1QA 4JLNA 3W9YA 1ZCBA 5HKKD 4DB2A 2RKOA 3GFTA 3JZAA 1PUTA 5FTMA 2VLIA 1E2PA 5SZIA 3LXFA 2OV2A 1NBMD 3B9JA 1RKBA 4TMZA 1EESA 4EPRA 1E1QA 1KY2A 4OHZA 4KSCA 2PZGA 3PITA 2FZLA 3H0KA 1EFCA 1AJEA 1F2TA 1P72A 1UJ2A 1KI6A 4G5QA 4HSEA 2JDIA 4IFEA 1BYUA 4TTQA 1KI4A 1B23P 3Q7PA 3QENA 5JJKA 4Q66C 5FFMA 1NVVR 4MITA 4DDUA 2N46A 2OCAA 4HAXA 3SR0A 3LX8A 1RRFA 5EP3A 1ZVQA 2V7QD 2JQRB 4MGYR 2H57A 1S9HA 1HQCA 2HV8A 1OKKA 2R6FA 1V97A 4UXIA 2XSZD 3QKTA 1UBCA 3GLGE 1HUQA 1UBGA 1Z5ZA 1KY3A 1E69A 4MRSA 4IHQA 5FPSA 2L83A 2WU2B 2CHQA 3IPYA 3C7KA 4RJLA 4CIDA 4A2WA 4DDVA 3B13B 4D25A 4MH0R 4G3XA 1PLKA 4QHTA 1WBBA 1US8B 1QOBA 3AMZA 1IUEA 2J0UB 5CK5A 3D6TB 1VDVA 3AE2B 4TL6A 4HROA 2RGXA 4B2IA 2PLRA 3BXZA 4PAQA 4TL8A 4EPVA 2H8KA 1TQ4A 2GZAA 2W83A 4JT4A 1XLQA 1E0SA 4FMDF 3FMFA 3IPXA 3C8UA 1GM5A 2WZQA 1GSIA 1JPJA 1E2DA 1VYUA 4IKEA 5FOTA 2AFHE 2CJWA 2ZSFA 2XEXA 4QFMA 4QHYA 5EZ6B 5IK2D 4NZYA 4WZBE 1E2KA 3AEZA 2IXEA 1XU4A 4JBXA 2IBMA 2WWYA 3V4RA 3A4NA 1XMVA 3PEUA 2OBLA 2WS3B 2KB0A 1D2NA 3P1MA 4LZZA 1KK1A 1SZPA 2J7PD 2GDJA 1OXTA 1OXXK 3SN6A 3SS8A 2CXXA 1W36D 4A6PA 2DPXA 4JL8A 4US8A 1ANKA 2KSQA 4JLMA 1QVAA 1T4GA 1Y63A 1ZUD2 1YVDA 2EWVA 3HU1A 5JMTA 3QXHA 4YXWD 1KAGA 1G8GA 1IQPA 1NVWQ 4US0R 2CCGA 4TT3D 5H8WA 3MJRA 3WBJA 2WMOB 4OK3A 2WP9B 2IYLD 4IRUB 3ZD6A 1QG4A 1KO4A 5H8YE 4EPXA 5JI2E 1NVID 3GEIA 3FWYA 1XEWY 2CEAA 4C0SA 3W9CB 1XWIA 3G0HA 3WMGA 3C15C 1FM0D 2YVUA 3TAUA 2AHOA 2AL7A 1E2JA 2BJWA 1NBMA 4NONA 4TL9A 2ZYWX 4Z8YA 1KO5A 1AN0A 1NLYA 1N6HA 1XD9A 1G7RA 3BB3A 3KUCA 3SDZA 3UKDA 1S96A 1E2LA 5AJZA 3CRVA 4BLOA 4P0TA 4DEXA 1YQTA 2H5EA 2IYZA 1OHHD 2J87A 2NO9A 3HU3A 1I4DD 4WWMA 2GCOB 2NIPA 1PJRA 2FU5C 2P67A 3LLMA 1F60A 1YZKA 3N2IA 2IS4A 2RGGA 4MYUA 4DIDA 1M7GA 4DLXA 4KBFA 4YTNB 4TQ9A 4JL5A 4US1R 4OHYA 2DWOA 1JEDA 4Q1DA 2VHUA 3CX7A 4OQNA 1ZD9A 1P6XA 1LF0A 1JXMA 1L6UA 3QF4B 3QKSA 2LWIA 5CJPA 3L82B 5SZJA 3H4MA 4EJSA 2GZDA 2Q3MA 4GNKA 1NJGA 4HB2A 1IN8A 3TGPA 2G6BA 4WBSA 2F9LA 1OYYA 2JGNA 4B71A 4EPWA 1ZD1A 2P3SA 2R6AA 4G5SA 4HAUA 2FDCA 4LWZA 5L3VA 1W0KD 2FH5B 3AKYA 1SGWA 2L52A 1C4OA 4PAOA 3RYTC 1NP6A 2R6CA 4TLEA 5GVRA 1AGRA 4CZ2A 2FX3A 3U7HB 4DKXA 2IYWA 1YU9A 2F1IA 5G3YA 2PT7A 5J4KA 1ROEA 4NDZA 3U3JA 3GLFB 2HCBA 1V43A 4OKSA 1ZAKA 3B78A 3AEGB 1OIVA 1TEXA 4JBWA 1WQ1R 3U60B 1U9IC 1X86B 2X19A 5C3JB 4WW0A 3EZ9A 2G1JA 2JLRA 2QE7A 3NHBA 4PC7A 2V3CC 5DISB 1FQKA 3EWAA 4OQXA 2YWGA 5BN5A 5E4FA 1D9XA 1E1RA 1M7HA 2J7KA 2W0MA 1LVGA 1M1YE 4KFRA 4M0LA 4PC1A 1EXMA 3EC2A 1QHYA 4FINA 2QSZA 3IEVA 1JR6A 3AGQA 3LRPA 2C77A 3UPUA 4DLUA 4HUQB 4AG6A 1DOYA 1KNQA 3RS4A 2FSFA 3CRW1 4NP6A 1W2HA 1ZC4A 1I2MA 2QM7A 2ZQ5A 3CH5A 4DDWA 1G5RA 1MO6A 2W6ID 4IJMA 4MGIR 3ZQJA 2YZ2A 2C96A 3RNLA 1ZUNB 3RRNA 3AE7B 3FE2A 2G9NA 1QHIA 1MABB 1YZLA 1M6NA 3U44A 3THXB 3GLGB 1DAMA 3A36A 2JLWA 2Z43A 1OE0A 2NG1A 3REFA 3AEAB 2ZU0C 3QPWA 4P4UA 1Q3TA 4ZO4A 2HJVA 4B3FX 2CCKA 3X2SA 1J7AA 4F93B 2J45A 3WXMA 5CK4A 1DG3A 1VG9B 1OFFA 2MJDA 4GT1A 4MRRA 5BWMA 3PIRA 2A5FA 4QC2A 3HVZA 1Z2AA 4BFSA 1OHHA 4B76A 5FI1B 1PLLA 2WJHA 1YQ3B 1OPXA 1A2BA 3A58B 2QM8A 1XB2A 3QIAA 3VR6A 5DI3B 4GFDA 2EQBA 3GFOA 1FPMA 2EWWA 2IYRA 2WDQB 3OFNA 2PX0A 2ZJ5A 4P3YA 2FFAA 3F5FA 4F4JA 3L0PA 4EFMA 1W7AA 2JJ2D 4FD2A 3I5YA 1E79D 2HXSA 5KHOC 1JAIA 3FMIA 5CDFE 3MG9A 1JWAD 1UFQA 4US2R 1P9NA 2H89B 2IL1A 4HB3A 5J4YA 4C7ZA 1UDWA 4O2RA 1E0ZA 1Z29A 1KOFA 3OF5A 1P9WA 3GJ6A 2ZRIA 3CRQA 2YC4C 2EKIA 5JS8A 2F3RA 1RW4A 5SZHB 3RRMA 4P31A 1OB2A 3L0SA 1XP8A 1FUUA 4A4DA 1SXJE 1CBUA 2F9MA 4KV9A 4HLDA 3J81k 3HR8A 1NG1A 3ICQB 1KF6B 5LBIA 2R9VA 3AKCA 3AVPA 1FW6A 3AVYA 4M9XA 1COWD 4Z51A 5JHHB 2XB2A 1GKUB 4XTRA 3ZLJA 2VP5A 4BZXA 1Q21A 3AV0B 4EDHA 1E0KA 1WP9A 4QGAA 1NSFA 2P0EA 3PUVA 2ZIAA 2QAGA 4JIMA 2JLZA 2X2EA 5DHAA 5EP4A 1DEKA 1GDDA 4ASUD 2IS2A 1XCGB 1XEWX 1IY0A 3A1SA 2VHJA 4QBHA 5FBVB 2UKDA 2XGJA 5D3QA 5DH9A 2XX3A 2ZJBA 3RAPR 2ZJ2A 1G8PA 4DHEA 3L4PA 1N6NA 1VIYA 1RRPA 3T15A 4AK9A 5JI3E 3KKMA 2A5JA 4CEHB 2FFBA 1H8ED 2GXUA 1NG9A 3O8CA 2FGKA 4B3DA 2F7SA 1J8MF 2AK2A 1IY1A 3CX8A 5JSZB 2C9OA 4NYIQ 3VTKA 1R2QA 4XSGA 5HZKA 1JQJC 4PTLA 4YDHB 3PQCA 4D26A 3NIBA 4FCTA 1RYHA 1ZNXA 4AYWA 1KO7A 3CM0A 1CJUC 4LJ4A 3QJYA 4Q1AA 4Q4AA 5EXPA 1BS1A 2ZSAA 3QBTA 4DRZA 2CK3D 3M6AA 2K22A 4PPGA 1JNYA 1WGKA 1TEVA 4PSKA 3UATA 1S3GA 3AVTA 2D74A 1P7CA 4Z8XA 1FP6A 4PHFA 1TQDA 3CR8A 4OK5A 4M9SA 3ZVNA 2BKUA 1A5TA 3TSWA 3AB3A 3PG5A 2VSFA 1W4AA 2KI5A 5DYIA 4KCGA 2IS1A 3WNBA 1G7CA 1DAIA 3EG5A 2EFEB 1U8AA 3IILA 1XNJA 1VG1A 3GJ3A 1JQ4A 3QF7A 4N6EB 1GUAA 3DOEA 4FMDB 2AXNA 3WRXC 2ZRNA 2HYIC 1E2NA 3BFVA 2R6DA 3U7FB 1KMQA 6Q21A 3BFKA 3WYAA 4DT1B 4L4UA 2OESA 5FL7D 2W55A 2BBOA 3UIEA 1AYFA 1CZPA 1CKEA 1R5OA 4LC0A 2ZSDA 2C5LA 3LO5A 2GJSA 4X8HA 4NKRA 4M2LA 2HT1A 3KXLA 1X6VA 1SXJC 2WKRA 2IA5A 4KXFB 1Q20A 1JALA 2QJLA 2R65A 3R7WB 2HLDA 5JZVA 3AP1A 3A8TA 5G5HA 1YZNA 5J4VA 1U8ZA 3K1JA 1FXAA
chains in the Genus database with same CATH superfamily
5TY0A 5EESA 2AEHA 1K4MA 4E3WA 4J1TC 4WCFB 3RARA 3NBYC 4X6XA 4QODA 1WVGA 3RBEA 1XEFA 1P4HA 5AVRA 1G2PA 3C97A 2DNFA 5AUIA 2OAQ1 2ZRFA 3PQ7A 2R7KA 5FKAC 1X94A 4JBHA 3T8MA 4TTTS 3AUXA 4MR9B 3PC7A 1VA4A 3SOZA 3RVLA 1AURA 3A2NA 1G5PA 4BNMA 1IXKA 1OBCA 1ZNYA 2ODQA 4Y9TA 2PVOD 1UMBA 4L85A 4EHJA 2HSDA 3V4VB 2O6LA 5J2GA 2HSWA 2HC9A 2XWJI 2TRSB 1HSZA 4MA5A 2WXPA 1JLLA 1CU1A 3M0EA 3E22B 1EDOA 2HOQA 1EWVA 2IGTA 5D85A 3HQ4O 4DTCA 5SYAA 4DABA 1R00A 5G1PA 1GNUA 1CI4A 2Q4TA 4BQPA 3MGBA 4BNLA 2J33A 2EYQA 2F3UA 2HNKA 4GC6A 1JDPA 4LRUA 4ES6A 2RGYA 4FO6A 1C78A 2FG6C 2P27A 3KW5B 1D8BA 3EB9A 3TL2A 1PSWA 3AB5A 2NU9A 2QRQA 2VF5X 1GAQB 5CHYA 1M2NA 3QPBA 5T6MA 3E7WA 3LHFA 3B1XA 3KTQA 4QARA 3UIOB 4TVOA 4LI3X 2IYYA 3IBFA 3KD2A 4FHDA 2BGJA 1SQ6A 1M2VA 2C03A 3C3CA 1YUBA 5D86A 5H9WA 4DQ0A 4L0DA 1JTVA 3ELBA 3FRHA 2DUJA 4F6RB 1XTPA 3WIOA 4QQRA 1PK1A 4PAMA 4XX0B 1NFQA 3TE7A 2E1FA 4YAIA 4RC9A 3HUFA 1L4KA 2VHWA 2NP6A 2LCQA 3ZJUA 2E4VA 1YMQA 2X2PA 3HP7A 3AE3B 3HYLA 4KAFA 1XVAA 1C8LA 4WOBA 1Q2UA 2AKYA 2LGJA 3BRSA 1TMGE 4C56C 4MGZR 3LGAA 4DA0A 4JR0A 4LCJA 1IN6A 2FGJA 5BOSA 3A4YA 3JXEA 4JI5B 1V3UA 1C2TA 2NO0A 4BJ6A 3CW2C 3CP8A 1KZ4A 3ZBQA 2R2QA 3MJEA 1ZIOA 1PJQA 1W96A 1XX6A 3DFIA 3EDOA 4YRJA 2H88B 3L05A 3LW8A 3M1LA 4NMXB 4EQ6B 1CUGA 2ZJ4A 3B3FA 4K26A 3ZDCA 1FFXB 1EEXB 3WLFA 4CKEA 3CKYA 5KYYA 2EHDA 2HHUA 2GZSA 4KO3S 3H6HA 2XZDA 3EZYA 5E4TA 2Y67A 4RADA 4IVNA 1RJ9A 3T7KA 5JDCC 3KUDA 4N0MA 3B3QA 1L5GB 2W2VA 4WFJA 1MOPA 1W59A 3QFTA 1YKFA 3TO5A 5HIJA 1XO1A 4D74A 5KL1B 4W63A 2ZS7A 4O02B 2QI9F 4W1RA 3HWSA 2UXCB 1YV9A 1XU9A 3AILA 5CG1A 5AEKB 3G49A 3IDZA 4BPRA 4MHOA 1UANA 2X4GA 3B2NA 4A0QA 1ZVKA 4X1IA 1RQGA 2CBZA 3SAGA 2ZVDA 3Q2IA 3QOYA 2KDFB 1DOAA 4QL3A 1W35A 4A0RA 4EBBA 2VWGA 2CCJA 3FBTA 3HBNA 5JNRA 4NLKA 4MRAA 1QZUA 2YWRA 5H9VA 4FMCF 1FMAD 2CXHA 5ENZA 4LF8B 1EFPA 1NMSA 2V7UA 3BSYA 3U4GA 1GCUA 4IDCA 2LDXA 3WWZA 2VPYA 3PHWB 3NHKA 3PYXA 2XOEA 4EHBA 4PYIA 3UV3A 4LV6A 4DCSA 3QAQA 2FF7A 4A0HA 2HA5A 3U37A 2J0UA 3WRYC 5C2JB 5C0YA 3IP9A 2IVZA 3BERA 1QGOA 2QX8A 1X77A 3N74A 2QORA 2PGLA 5IEJA 1Q16A 2GEUA 1E0AA 4EFOA 3AG5A 5SV2A 1TZCA 3E7DA 5ECYA 5D84A 5FUMA 2HEGA 1P3DA 3JV7A 3OEEA 3U7RA 1LS6A 4R3DA 4ECZA 3O47A 1JS1X 4K88A 1N77A 1ZM2A 3OHPA 4IDDA 2BMJA 1RLTA 3ADPA 2ZXHA 3THOA 3NHMA 3BMNB 4GXNA 5HCUA 2M56B 3H1EA 1Z5OA 3WGLA 4JELA 3T9FA 1U80A 3VVMA 2A7QA 3CUTA 3MHZA 2YNMC 3IERA 3IHLA 4LKRA 4NBLA 1WY7A 3PHJA 3DC2A 5LA6F 5KX5F 4ZDKA 1RZTA 2BUBA 1E5VA 3HXKA 4MINA 3R7QA 2CLSA 3FFBA 3L3FX 3H0RB 3G2LA 5L8VA 3QE0A 3CVWA 2KDBA 1EEHA 2G80A 3NS8A 4CDNA 3C6MA 5MN6A 2JSVX 5GY7A 3ZI4A 4E5PA 2HIMA 1R0RE 1N6RA 1XNSA 3PE6A 1TV9A 1KVQA 1ZFNA 1I6LA 5IJWA 3OM8A 2C3YA 3A4SC 3EZ2A 3P9YA 2PRKA 1FSPA 4YROA 3P2KA 4W9CA 3L5KA 3O8DA 1D8YA 5HS6A 1OA0A 1EUCB 3PS6A 4Y8VA 3D8SA 2RG1A 2JVJA 4PPQA 2NTEA 4ENRA 2NS5A 5EC8A 4PBTA 1RWSA 3CH4B 1REQA 1J0BA 2XVZA 5JS7A 1EPUA 3DE3X 4Q9HA 4M47A 1M2OB 2QTFA 1TF5A 4M1OA 2YZGA 3SBXA 3C3WA 4OQLA 4Z7QB 4W5NA 2GD0A 2W48A 2G0NA 4F8JA 1Y9DA 5CA1A 1XZHA 2FMUA 5K0LA 3ZYZA 1PTJC 3TNLA 3G6VA 4GW3A 3H2SA 2C8LA 1P0IA 3DO8A 5C18A 4ND3A 3FC4A 4YCDA 3ABSB 4Y0AA 1MO2A 2EBHX 4RZ3A 1PDWA 2CF5A 2LXNA 9ICKA 3U7EB 5G2OA 4DSIA 3UICA 2QTNA 4QUKA 3K30A 1Q7TA 4GM1A 2UVRA 4ITKA 1X7WB 4P3OA 3LYYA 1NJWA 4Q7KA 1GUYA 4ARZB 4X20B 3ROPA 3UGBB 2Q9UA 3H4DA 2QG6A 3PPIA 3OJOA 1PR9A 4CKXA 4LCBA 4OYLA 4REQA 3A33B 1GNLA 2DBQA 4JKOA 1YRBA 3SEFA 2NR2A 4QVIA 1SIOA 2N4FA 3EPGA 2O8EB 4BE7B 1TK5A 2WFZA 4HRXA 2EFJA 3MQ4A 2ZCCA 2OAP1 1H1LB 4LJ8A 2RPVA 2W42A 3HWRA 1V3VA 1W94A 1SVSA 4OJ5A 1P80A 3NMUF 1KKXA 1T4CA 1UQRA 1SAYA 4Z9AA 1KI1A 1WDMA 1QS0B 4PBRA 2X5NA 2X8LA 4UMDA 4QNNA 3PNPA 4DANA 4UATA 3FPAA 3D7RA 4BDPA 4OLHA 1NJ1A 3ENVA 1OB5A 2O05A 1Z4JA 4OXNA 2O2SA 3PI7A 3EASA 3PLUA 5L1JA 1D6JA 4TM7A 2CL0X 1JA9A 3U09A 1WG8A 2I6SA 1ZZEA 2R7LA 4UVGA 2F8KA 3I61A 5EKDA 4BEWA 2EKBA 2YDYA 4DWVA 1E7PB 2QMUA 2QN1A 2G9QA 4A03A 4GUDA 2NMQA 4P08A 1RM4A 2IYAA 3K35A 1Z6YA 5HJEA 5BUCA 2PD6A 2W2QA 3KB1A 3AT1A 2MIIA 4JFRA 2OCEA 3WNQA 2HK6A 5K3SA 4KLFA 1W6RA 1QIKA 2Z2XA 4XJTA 3DE6X 1W4ZA 5BV7A 1DVRA 1AK2A 4G50A 4Q0MA 1FJGB 4DSZA 3OY2A 2PW9A 3UJAA 1DCMA 3RABA 1NQOA 3AZOA 4ED2A 3PWTA 3DMDA 1NUAA 2UU7A 4OLJA 2VT6A 4M9ZA 1M2EA 4YL8A 2Q6TA 4ZCTA 5GIOE 3EXG2 1M2HA 3K0CC 3DC7A 3IOMA 1M8PA 2XE7A 3S68A 3WWYA 2YXEA 2WD8A 4MVJE 5CVVA 2C20A 2FPWA 1XE3A 4LUCA 2B1IA 4MQMA 1UBEA 3W1SC 2BGTA 2Q3JA 4WZAB 1Y8QB 2C2RA 2FPIB 1ZH2A 2WC1A 2C61A 1NJFA 4X92A 2RARA 1L0YB 2JF5A 4RIHA 3DLPX 3N2NA 5KT5A 3DUFB 1XF9A 2QG9A 5CA0F 3SZLA 4TL7A 5HX7A 3V7WA 3OU6A 3U9SA 3LK6A 4HWIB 4DSEA 1C5KA 4V3BA 5GGXA 2DL0A 3Q8QB 4R7ZA 1LFDA 3NCTA 1V3QE 3K0HA 3IVRA 2HO4A 3SHVA 4AWJA 4FSHA 5TQ2A 3GYBA 3QTTA 1KLGD 4BEBA 4AKHA 5F3XB 4ISCA 4UTXA 3VR3A 1Z5WA 2N9LA 5HIAA 3EPIA 1YHYA 4R54A 4ZTBA 3FHCB 3MS2A 2Q1UA 1B2LA 3RUEA 1KJJA 2EP5A 2HEIA 4MGIE 3S3TA 3VPSA 4HDKB 4W9KA 1TKYA 3DDSA 4B2YA 2NOAA 3B6JA 4KIUA 4KZKA 3QXCA 1ZY2A 1L8OA 3RT1A 5DF1A 3I1FA 2JCYA 4EJ6A 5TT1A 3DYBA 4Q3LA 1E3JA 1VMIA 3N7SC 2DKOA 3AF3A 3GCWA 2GN9A 1YFZA 2OFOA 4WXYB 1PJ2A 4GI3A 4N5HX 2QRPA 2GS9A 3QLUC 1L1RA 4ZOBA 1EJBA 3MWFA 3K32A 2DF8A 1WCLA 4AZWA 1R0BA 4P92A 4CTNA 5DNYB 3TRJA 1RM5A 2JRLA 3GN1A 2X0RA 5CD1A 1OBVA 4J16A 4HB4A 3ECCA 1Y9JA 3U7IA 3M5CA 4WWPA 3D0OA 1OU0A 2HLHA 1RI5A 3BJRA 4WZZA 2YRFA 1OI7A 4EB6B 2HT6A 2MOKA 2OB1A 3EIOA 2IPXA 4KIFA 2QX9A 4G25A 3A1UA 4EP1A 3EGXB 1IV8A 1M8FA 1KSGA 2XECA 1SJ9A 4CRWB 1T1GA 1URPA 5J2JA 4OZAA 2PD3A 1DS6A 4H16A 1F14A 1U28C 4BMXA 1K86A 1FFCA 3UH0A 4OX9B 4RSRA 2E6UX 4ZMBA 2YYZA 2EAMA 3PGJA 1M1NA 1XRRA 3L4JA 1U0GA 2V1XA 2X40A 4GXRA 1FLVA 3HKZF 4KDCA 8ADHA 1Y9EA 3PW0A 1L8QA 1BVYF 2QZPA 3JTMA 2ALJA 2MBEA 1U0JA 4GVPA 1DELA 4QOIA 4ACOA 1Z5NA 3OJEA 2QG4A 1VPEA 3SKYA 1GPBA 2V3VA 5I9LA 5CU7A 1YKGA 3FNHA 1ZN7A 2D5LA 4F7ZA 3QUCA 3LP8A 2JLUA 2FN8A 4L02A 5JH5C 4U0KA 3U4DA 1Y6GA 3D0RA 2YXLA 2BCSA 2PNFA 4PYLA 3FBWA 2FQWA 4UVDA 2CVOA 2BBWA 4PYMA 1R88A 1ZQWA 2FK7A 4L23A 4JJ7A 3W78A 1X9HA 3M4ZA 5G5GA 1NUHA 3JASA 2H1OA 1QMPA 1N3IA 1H8HD 3T12A 1VDMA 3DOFA 3WMWA 5CYPA 2IHTA 4QYMA 1U48A 2GCEA 1NVFA 2AW5A 3VKGA 5KHOA 1F0YA 4W99A 4COKA 2JARA 1MIOB 4TT8A 1GUDA 3C4VA 3ZU2A 3UAYA 4M9CA 4E5SA 3NIFB 4XKJA 3F5DA 2X4DA 2D3DA 2C1EA 2ISPA 3ODPA 1AW7A 3DLCA 3ZYCA 2C7OA 1GQRA 4OMFG 2AG5A 1V37A 4E09A 5KREA 4NH0A 4EHAA 1JA0A 2O8DA 3ZHYA 3L8MA 4DNFA 2PUCA 3HSKA 5GMVA 4JUBA 1DUVG 3PENA 4LVSA 3B1WA 1L3UA 1XDZA 5E8JA 4NMLA 3ZWPA 4TZ6A 4ZEOA 1E3EA 2VXYA 3QXJA 4K9PA 2I87A 3SQWA 4D6PA 3HLKA 2ZVNA 1QGDA 1UIMA 4MVJG 3HKZC 5JAQA 1FIQA 4DY6A 2YV4A 2B1JA 2WVJA 4EELA 3F7NA 1DHRA 1DPGA 3S2AA 1NDQA 3IAAA 1CUHA 3DT9A 4WA7A 4NECA 2VYFA 1Y7IA 4DQPA 3DCIA 1HE8B 2N9PC 3PKIA 1UBMS 2R8EA 2ZBVA 4KMRA 3SD7A 2JIZA 3RK0A 4MCJA 3SKXA 1T8TA 1YB5A 3HMKA 2CT8A 3OKAA 3ORSA 5DSXA 3W6ZA 1NVVQ 3KLSX 1EGMB 5FBWB 1WOMA 4HQOA 4BJHB 3CV3A 4TV8A 1OH6A 2O1WA 1ZQSA 1V1RB 4L7QA 4WBNA 1M6VA 1RLMA 2KJRA 1S3SA 3LVBA 2G4LA 1TIKA 4RULA 1FBTA 1IK6A 1N8KA 2TECE 3QH4A 2OP0A 4YRLA 4TS9A 4CV1A 4A0FA 4EATA 3ZE0B 2HU7A 4LTUA 8LDHA 1H4QA 1ORWA 3ERCA 1JLSA 4WY5A 4R2MA 5HKKD 2OV2A 3DP7A 1JH8A 2XE4A 5IDXA 9ICUA 4TSSA 3REQA 4UDYX 3MOSA 4JJ8A 3WRWA 2N46A 3ESRA 3EN0A 5JANA 1TZBA 3G79A 3TTXA 3V1TC 4M8LA 1WR8A 1FP4B 2CWDA 1P77A 4IHQA 1BU5A 4BGEA 3JPSA 3PV8A 1X2BA 3AMZA 4W5OA 4ANUA 4PZEA 4UU0A 3VZDA 1C4AA 2PV7A 4BXOA 4CIWA 5FOTA 3GIIA 4F4HA 5DQIA 4NZYA 4WZBE 3BG5A 2V9ZA 2GI9A 3BQTA 3V34A 4ER7A 2JEJA 2IGGA 5GP1A 1ANKA 4G56A 3ICPA 2CCGA 3FWYA 4LE0A 2D5GA 4LXYA 1GL3A 3SV3A 2XCUA 1NF8A 4Z8YA 3WO0A 1ND6A 2NVWA 4LSWA 1UHUA 3QJ5A 4B80A 1I4DD 2P67A 4EUKA 3UBMA 5EZYF 1EA5A 2OAGA 1RCUA 1JMSA 2J6BA 1XQXA 3PY8A 4OQNA 1NAIA 3RO7A 1T36A 1U1IA 4Z4QA 4IBOA 3HR4A 1IGCA 5CAEB 4EJSA 4TROA 2G6BA 5DYTA 4GRIA 2C2KA 4MJSA 2BFEA 4LJLA 1I3OA 2R6AA 1GV1A 4B3JA 4WLFA 2I9KA 3NORA 2LI5A 4WURA 1QGAA 2PXXA 1C0EA 4BNJA 4JEHA 2X19A 2PKCA 2R87A 3NHBA 5G0TA 3V7KA 2AQ4A 5DISB 4M8NA 1T8RA 2OQRA 5F51A 3KEQA 1D9XA 1LVGA 2H5JA 3KLNA 2K8AA 4IQ0A 5A3JA 4R2WA 1XF5L 2G5HB 3CISA 1ZC4A 3FOBA 3E9EA 3BQNB 3PA8A 4RXUA 3RYCA 1YZLA 4ARUA 4I8XA 1K7XB 2IUFA 1Z3CA 4JI1B 2HJVA 1X9XA 3PTFC 5E6UA 2ASVA 3GU3A 3U49A 4B76A 5FI1B 5A0TA 4Q8EA 3SDSA 2EQBA 2IUEA 2EWWA 5IFKA 3O4IA 4EFMA 2C2EA 1W581 1HF3A 3ZIUA 5CDFE 3MG9A 3OQVA 5J4YA 2FPOA 4I66A 3DB2A 3EVNA 1BXRA 1I3LA 3W04A 2B30A 2G8NA 1UL1X 1RRBA 2G63A 4HQ0A 2IPOA 2WX0A 4M9XA 1TS3A 4XTRA 1DKLA 3VTVA 4KG7A 4QZFA 3PGXA 3AYZB 1GDDA 4QSHA 4O5EA 3V8RA 1I7LA 1N6NA 3NT5A 1H8ED 2F7SA 3PFGA 1D6EC 4R1MA 1WCXA 4KLLA 1CDDA 1JQJC 4D26A 1XVUA 4AYWA 4NJCA 3OQHA 2KMDA 1OBFO 2J0KA 4HN4B 4PPGA 5LVAA 4Z8XA 1ND5A 1DKRA 2BKUA 1NONA 3RCBA 3AB3A 4AO6A 4YO8A 3X1MA 2QEJC 1TA9A 2OZLB 3QEMB 2I3AA 3WYAA 2ZSDA 1MA7A 4RFLA 1AGYA 4UDUC 1X6VA 2PFGA 2FNJB 2Q7XA 2IHMA 5MN4A 1G4HA 4DM7A 1CUAA 3QVJA 5KSYA 1VIAA 2ZI7A 1Z3EB 4IIUA 3A0RB 2X8XX 2NN3C 2RMKA 3JARA 5EIFA 1TKAA 3H83A 3ZCTA 4YWJA 1S9FA 1GSAA 4EGQA 5DYNA 4DE5A 4W7HA 1E60A 5KNCA 4J1SA 4NV0A 1R6VA 2C5SA 2JD1A 2FR8A 1RRCA 3LQKA 1B1ZA 1OXMA 1NUTA 2QSYA 1YJJA 1YE5A 2Q0HA 2GHQA 3WK6A 1S1CA 1GPAA 3JPPA 2LHTA 1AUVA 5CEEA 2ZBFA 2P75A 4EKGA 1CJBA 3OPYA 3GZNA 1XAHA 4GAEA 3NG1A 4LDZA 2O7VA 2I3BA 1UFVA 4PYUA 4PCLA 4IL5A 1PWEA 4X93A 5TPWA 2JJYA 4U9UA 2JFVA 3UMFA 3R8BA 2SCUA 1R4NI 2IU4A 3LNTA 4NMWA 3AI7A 1VJTA 3PYMA 4TLDA 1GPXA 4BCCA 1AZSC 2ZW9A 3V00A 5CM2Z 4DMGA 1LBSA 4OU5A 4KQHA 4BB6A 3CIRB 4I1UA 4RY0A 4NJ6A 1OJLA 5A6VA 3PGLA 3RRFA 1EUZA 1DKMA 3B2EA 4GFJA 3QVGB 2QVZX 2YXDA 1N5WA 1PR5A 1YT5A 4MW9A 1AGPA 4X41A 2BWFA 1NKEA 2YYAA 1I1QB 4MELA 2O3JA 3DBLI 3MCWA 8GPBA 5AVKA 4EL5A 4NU8X 4ZC8A 3N07A 3C41J 4ILKA 5I01A 1Z0IA 4JCCA 2ZWPA 5DPSA 1E5DA 1BEUB 2KG5A 1GP2A 4KRYA 9ICJA 1BO6A 3C28A 1L5KA 2WQ7A 4H6VA 2PO7A 3OZDA 2AX5A 3Q0IA 1W93A 3BILA 3AE4B 4F4WA 1J07A 1E90A 1WDTA 3GDGA 3NFYA 4XCQA 3KVNA 2WIDA 5ALMA 3DS8A 3H1PA 3AKZA 4AI6A 4BVEA 5K3OA 3MC9A 4LDRA 2ZJFA 3CBGA 4QPCA 2GOYA 3E23A 3A1QA 4B8YA 3H6KA 1IHUA 4C4ZA 3CSDA 2ZZPB 4IKPA 2DR0A 3VTAA 1WR6E 1U9LA 2B9EA 2UYQA 2BDUA 1D0IA 3AF5A 1NWHA 3BH0A 4NS4A 3ABVB 2RHJA 4YLEA 4LQ4A 3GJ4A 2V5AA 5C7LO 1L4UA 2ZYRA 5EKUA 2VQ6A 4WJQA 2KX0A 4IUBS 5F9FA 1VSQA 1L5QA 3STYA 8ICTA 4LZPA 2EZ8A 1N62A 5JT1A 4W9RA 2E8OA 4M46A 1DX6A 3I1JA 3NRBA 2JFUA 1O0BA 3NC1C 4QULA 1JTEA 3ROZA 1C3LA 3K16A 1YHNA 5FV7A 1WRDB 4G4SP 3LUJA 1BH6A 2B1RA 1RCFA 5T7BA 4KVFA 1ZMTA 3AUFA 4D9GA 1Z22A 5H68A 5EHIA 5TR5A 4DR7B 5CWRA 1OV4A 4ZT6A 2AGVA 4WAFA 3QG5A 1ISHA 4F4IA 3CG4A 4YP9A 1B1CA 2JUOA 2Z3ZA 2FWNA 1CP2A 3GRVA 8ICGA 1KDZA 1QVWA 2JCSA 1N4AA 2A1AA 3GS2A 2FPSA 3IAUA 4ALLA 3MYRA 1X7XB 2PKEA 3UJDA 5EOZA 1KSFX 2HBMA 4BWVA 2BQUA 1Z26A 3A9SA 2DFNA 1MD9A 3SC6A 5IF3A 1G38A 3PWSA 2DETA 2QHXA 3CF2A 4CEJB 1D8TA 3DL7A 1T0JB 4XDZA 4ED6A 4M1ZA 4C6SA 3IC5A 1XQ1A 3HW8A 3QEOA 2W9XA 3WGZA 3VSCA 3E84A 3EWSA 2ZE5A 3TCXB 3UV7A 3AEDB 2GEFA 1GRRA 4X44A 1AD2A 1OH5A 3FSGD 3BULA 2BEWA 1I4QA 1RXCA 1HLFA 3R8FA 1GTMA 3VBCA 1DINA 1ZI6A 1F0KA 3FR8A 2P79A 3Q11A 2W9BA 1JMLA 2AJLI 2F1RA 1ELOA 2O3SA 4Y1GA 4DILA 1X80A 4NJEB 1HZ6A 3F6SA 1LC3A 4XUSA 4H77A 1IHOA 3GFKB 1DIRA 3OHBA 1DC3A 2OOKA 3P1JA 2QRJA 3LWLA 5F2EA 1UAAA 3WGMA 4MAAA 4YCAA 4MUEA 3RBVA 2JCVA 2XAAA 5FH9A 5JJIA 4YRNA 1K8QA 2QZZA 2AQ1B 4NFHA 2LZ0A 3QVMA 4GQAA 1KH3A 3KSUA 1A9PA 2JAQA 2ZRMA 2ZI3A 5TNXA 4XUDA 2VUHB 4ICIA 2JZPA 1YDEA 3VUEA 3NVVA 3TQTA 2VO1A 2Y1KA 1ZH8A 4LMBA 2QV7A 4NY0A 4Z6KA 4RPKA 5GIPE 3EGVA 5DLPA 5EJFA 1G6OA 3F73A 1E8XA 2G1UA 2V4QA 2IHBA 3R3HA 3ZKAA 4H27A 2ZBQA 5HEKA 1II0A 3TDKA 4LISA 4ND6A 4MEMA 1D3ZA 5B7PA 4EHKA 4CMEC 3WG9A 3KQKA 3VR4D 5K2OA 2WWIA 3DTTA 1WV0A 2VPXA 1E6WA 1N1EA 4CCAA 1O87A 1R4MI 4ZALA 1ZQKA 3I1YA 2FMQA 2A4MA 1AKMA 4JDUA 2XWSA 4KRGA 3EZNA 5AH0A 9ICXA 3RJ9A 5E1OA 2XF2A 2NQ2C 1OREA 3CWZA 4KWCA 5EWJA 5EXXA 1WULS 3C6ZA 5TX7A 2RHBA 3GV5B 1EK1A 3K1RB 3TOVA 7ICLA 1J0GA 2PCJA 4MARA 3SZUA 2UZAA 1Z5PA 4O2AA 5KG0A 2G70A 1NDUA 1WA5A 3ZCVA 1VE1A 4ZT7A 4AXBA 1TYBE 3MCUA 3PUXA 4O29A 5DGAA 1R5NA 4QUEA 1UXOA 1X7DA 4KLCA 1YIAA 3P4XA 4QUDA 3MA0A 3OEHA 2QT1A 4JJAA 4X60A 5DNWA 1PGXA 4KFSA 1IWBB 1H4SA 4KDLB 3X23A 1C8VB 3DSRA 2HH9A 3E9NA 3GJ8A 3IB3A 1ZGAA 4O4HA 4DL2A 4KLHA 1Y1QA 3GDXA 2DQSA 4AMZA 2O52A 3C2QA 2QSUA 3F2CA 1U98A 5HKLA 3UB2A 4DS4A 2PLWA 2BCGY 1WCNA 4IIJA 2V3WA 3AE5B 3LUBA 2K2QB 1E6LA 4F3OA 2RGNA 5ALIA 3E56A 2NU8B 4EG1A 5L3QA 3P9XA 1AQNA 4PO8A 3MMPA 1ECWA 3H86A 5HA5A 3DBRA 2DR3A 4ALNA 3S7TA 4TV3A 4PZLA 3UGKA 1GCAA 1YTLA 5BNTA 3OIGA 1X1SA 4G0WA 4QE3A 4DB4A 3FPJA 1C3OB 1JHZA 4YDRA 4Z2AA 1WXDA 2L1AA 4A2CA 2W2KA 2WWHA 2BFDA 1EO6A 3TS1A 2NUPB 4HLUC 4GBED 3R74A 1MZPA 4K3CA 3DTVD 3I8OA 5LWHA 2UUCB 3WTBA 1ZOLA 2J9FA 3C1OA 1OVGA 3FWKA 3VMMA 1JFTA 2OHOA 3NC4A 1BCSA 4A1OA 3QQ8B 2FUG6 5JXGA 3B1LX 4L9SA 4N65A 1U2TA 1BFUA 5AVTA 4WPGA 1XCTL 1Q7RA 3TFWA 2H48A 3AWDA 1XTTA 4FDLA 4FIZA 1M0SA 2WFMA 5BQPA 4DYHA 3L7MA 2IU0A 4A2PA 4LPKA 3R2JA 3GAZA 5IDQA 2C4NA 3NYIA 2VF2A 3O75A 4ECXA 1U8EA 3JATB 3FZYA 2AHOB 1EX7A 2BPOA 2VZEA 1CZLA 1FFUA 4YMWA 3LCRA 3BWCA 2QJTA 4BUJA 1FTSA 1EDDA 5LLIA 1OTXA 4FFVA 2HIHA 2O50A 4WNIA 4KIKA 4K4HA 2HO5A 2ZYTX 1GZSA 2XMZA 4O6VA 4NJMB 4XYCA 3LAWA 4LHWA 4QGGA 5D5QA 4AN4A 1OX4A 1WZEA 1H2EA 1VLLA 4JD5A 1L5PA 4FT2A 3P4PB 3PA6A 5ICSA 3B8HA 2YIJA 2R8IA 1V1OA 3AJDA 1CQIB 1K5GA 4AYTA 5EIBD 5LWQA 1B3BA 3ONFA 2OH2A 1DAHA 4LRTB 5EUQB 1Z16A 3JSAA 4C78A 5CIQA 4UPDA 3A9KA 3RC9A 1TYZA 4TUYB 2IXGA 3V8PA 4G2NA 3BFPA 3COJA 4ESOA 4QJIA 3GARA 1FOEB 4EI8A 4QQFA 4FC7A 3LK7A 1XTQA 5F1KA 3C6XA 5E6RA 1XHFA 3O4RA 2FMSA 4RCYA 2BP7A 4DV6B 3VX3A 3ABZA 5AW6A 3ZGNA 4C4RA 4YR2A 2XK5A 3T1QA 1JDTA 3N9YC 1F9AA 1USIA 4R1NA 3MS7A 2B83A 3OG5A 1GPNA 5EMNA 1XYGA 4R8SA 4G0MA 1P6UA 4HDQA 4C7BA 1MG0A 4F84A 1JJFA 4DV1B 2WT4A 1KJTA 5ERXA 3M34A 5AW7A 4GZLA 2Z9BA 3PHLA 1ZN2A 3IOCA 1LPSA 3T7CA 1L5NA 3TZKA 3RB3A 4BB9A 2QXTA 4EEXA 3MFYA 1WCYA 1K98A 3KQMA 1XTVA 2OAEA 5KOIA 2VJCA 2RAUA 4M8SA 1A5ZA 5BSTA 1XEXA 4IOJA 2IO3B 2VNSA 2GB1A 4Z53A 3BE5A 3RKSA 3QE3A 4IIEA 2HA2A 2R8RA 4IIGA 4BNYA 2QNIA 3V55A 1SWVA 4Y2HA 1J9GA 1Q6ZA 2GTPA 1YN5A 1M74A 2YC2C 2J9RA 3LUAA 1W88A 3ZZ0A 3RS8A 1DG1G 4YTMB 2ZRKA 5K0JA 2AKEA 1SVKA 3OPMA 4FS8A 3NVAA 2FZGA 4P93A 5J2TA 3OZBA 4CLOB 2FIDA 4J29A 4A3PA 4FMPA 2FUEA 1OAOC 5KVQA 4FUQA 3S8MA 4D9EA 4G1UC 3OCJA 2I99A 1WXHA 3P9KA 3N8GA 4M0DA 3TOZA 5C23A 1TO6A 1ZOSA 2ZRCA 3CLSD 3C3YA 2E5LB 5ALTA 1C29B 2ZKLA 4FHJA 3PX6A 3MUOA 2ZSEA 3W8EA 1KZ9A 1WSPA 3U3XA 1XJQA 3F5EA 2B25A 2GF0A 4MF2A 4J0GA 4YNBA 2W6IA 1Z7GA 3KQLA 1A2QA 2GBIA 5HCIA 3JQAA 3OZRA 3FVWA 1GILA 4C20A 2ON8A 4EUTA 1QDUA 4BWGA 1WTCA 4RH6A 3QY9A 1SVIA 4WA8A 3VSDA 4A8HA 2IXFA 4YT0B 2BCQA 3A4MA 2P4HX 3R8CA 4ITUA 4QA9A 5JO0A 2I6TA 2H1SA 2H65A 5LDHA 4OJYA 2AI1A 2AFHA 3FTPA 3UT5A 1S2LA 4YBRA 1CZKA 4OVUA 3L1HA 4FDMA 4WADA 2FPRA 3HB5X 3EYZA 4PS7A 2PFNA 2O54A 3QOWA 4F46A 1XT9B 3B0XA 4L5YA 3BOSA 1E9CA 4B87A 3LC1O 5ESRA 2AS0A 1COWA 3K0AB 1RVV1 3DHIC 4LF6B 2O2VA 1DIOB 3P9ZA 4Q82A 3HDHA 5B53A 2ONJA 4V0OA 3QVWA 3H4BA 4RS3A 3NPAA 1P5RA 1YNOA 2DHCA 4K9LA 3OOYA 5MFPA 2NU6A 2X15A 5AUPB 4FHGA 1T13A 4ICAA 4NPHA 5HFAA 3RJTA 2ORIA 4A3OA 2YJTD 2FPGA 4QREA 1P1BA 1LDGA 4U7DA 1W1UA 5KKAA 5DZSA 1K6EA 1TDJA 3ZE7A 4DFJA 3WGGA 2WLTA 1FUEA 1MA0A 3DHNA 4DL5A 5E9WA 5I45A 4E0DA 3G2MA 4KWEA 3NWJA 2J85A 3X2FA 3KVOA 4QKQA 2J6TA 3A3YA 5I9BA 2KK0A 4K40A 4X7BA 1ENFA 4EBDA 1SHTX 1WUYA 3SQMA 3E8MA 1NM5A 4Y6LA 3KBOA 4Q4JA 1XTBA 1G2QA 5J2BA 1E4YA 4WK6A 2OK7A 5HR7A 1BXKA 1CR0A 2GMWA 4KKVA 3CSSA 2AQIA 1M1XB 3TAHA 1H8HA 4FJ0A 1QRUA 3I3TB 2YHSA 1R4NB 3TCAA 2FHSA 3ZIAA 4IS2A 1UP4A 5EERA 1V38A 3Q3JB 2HRZA 1LZKA 5I8WA 3ZRCA 4JBGA 1P1FA 4MYSA 3UK1A 4K9KA 4NV1A 1JJAA 3PSFA 4F72A 2WV7A 4RDIA 2CR5A 5L1LA 2DBYA 4TLLB 1RZ3A 3ACBA 2ZULA 3K75D 5K45A 4BU0A 4H3VA 4KPEC 4OQQA 1E9VA 1Q44A 3PHIA 1I2ZA 1S9DA 1UKZA 3DJYA 1SU8A 5AM0A 2J6CA 3WFZA 2FCQA 3DBLB 1ED1A 3MP9A 2CMGA 1EGAA 2BR3A 3F96A 3RVJA 2X5KO 2VHXA 1T2UA 4IIFA 3EYAA 1DXSA 1TTHA 3GFTA 3IP4B 5FTMA 4M9NA 4TMZA 4M49A 2DFDA 4RELA 1JUDA 4A8EA 1CC1S 3TZEA 1XG5A 4HSEA 1TAUA 4NNJA 4XSVA 4JJ4A 2QOEA 1JHUA 3GDHA 1FUIA 5I6DA 2H57A 4P0QA 2MWSB 4C6TB 4Z4CA 1FB5A 1HUQA 4IP0A 5JYBA 2CHQA 4GEKA 2QTZA 4OO1J 3DOCA 2PLRA 4DPLA 1L8LA 1I51A 1ZVJA 3FMFA 3IPXA 4XR9A