5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
3G82C 1II0A 4UQOA 4N59A 2ZRPA 4MGYR 2V9PA 1OH6A 4FMCB 1AYFA 2BKEA 2D62A 3CNNA 4QJ5A 2YOGA 5IDVA 4BUJA 5C1BA 4PZLA 1F2UA 4BRWA 1T5IA 5KO2A 1UWMA 1S0UA 5A0FA 1ZNZA 1ZNYA 3AN1A 2R6DA 2QN6A 1KAGA 5SZHB 1NG9A 2W6JA 3IQWA 2OV2A 1H8HA 2GJSA 3FKSA 1KI6A 2H16A 2PX0A 5DYIA 2ZVQX 3SJCA 3DWMA 1J90A 1Z07A 1CZPA 3B13B 4RZ2A 5KPJA 4M21A 2A5YB 4GMXA 2J5XA 4TLBA 4M1OA 4PPFA 1JROA 1FRDA 3T1TA 1P2UA 2XZOA 1NVVR 3K53A 3B6EA 5FBWB 2NZJA 4ZKDA 2MMGA 3QKTA 1ANKA 3K0AA 2EFGA 4JSTA 4CRWB 1F48A 4GI7A 3VR1A 4DSOA 3M4YA 2F55A 3AB3A 3B78A 2PCLA 1WQ1R 1G41A 1M1YE 1E9BA 3BFVA 4E22A 4MRNA 5KNDA 1NKTA 1N60A 1TU4A 2W2VA 4IEEA 2ZS8A 2V8OA 5TMPA 1VCIA 1Z08A 3MG9A 3GJ4A 2WWFA 2WU5B 3PUXA 1R4AA 3KWLA 1M7GA 2WAXA 3T1OA 4M9QA 2HCJB 2FF7A 3ICEA 1G18A 1LTQA 4LZZA 1FMAD 1U9IA 3EZ7A 4ZDWA 4LTUA 5FPTA 1Q3TA 2P0EA 2ZJYA 4HSEA 1XXHA 2WJGA 3FOZA 1CJEA 1JAIA 2O8FB 5FBQB 2R44A 1OYWA 1XTJA 4DIDA 1ZNWA 3FKQA 4HI0E 3WRXC 4IOLA 1AQYA 3E5HA 2HJVA 4BLSA 3PO0A 2GWHA 1OXSC 3E1SA 4Q03A 3LW7A 4KFRA 3OE7D 1RRCA 2MJDA 3TBKA 3CH4B 4B73A 3CRW1 1FTSA 2QORA 1N25A 5FFMA 2DWQA 1HUQA 1TKGA 4EFNA 3I1FA 5DI3B 1Q1QA 3R9WA 4Q9KA 1L4YA 5EJEA 3TUZC 2KWIA 2UKDA 1OQQA 1A5TA 1GRRA 1PFDA 1U0LA 2GESA 1P6XA 1U94A 2ODNA 3WCQA 1KKMA 2D06A 4W5WA 2CCGA 1H8EA 3F8TA 1T3QA 2ZRAA 1DAFA 3LX8A 1E0KA 3V4RA 4MYHA 5LDDC 3VR8B 1PLJA 2G1JA 2C8VA 2JDIA 2ZETA 3QKSB 5EXPA 1XPRA 1NN0A 1UM8A 2ZRDA 1GKIA 2YINC 3D31A 2JX5A 2ZSFA 4URWR 3ZZTA 1E2PA 4MQBA 2G3YA 4Q7LA 5G3ZA 4B2IA 1KO4A 1QRAA 3A1SA 4NHOA 3GJ5A 1ZRHA 3PFIA 1XZPA 1FUKA 2WBLC 2WV9A 4LV8B 3AE8B 3FAHA 2FA9A 3AH8A 3AE9B 4RFVA 3WMEA 2CJWB 1VG0B 3BB1A 4RZ3A 2G9NA 4FXPA 1VCOA 4URYR 1R0ZA 2PX3A 2EYQA 5FOUA 1AJEA 1RVDA 3EXAA 1XB2A 4IXNA 5JHGB 1KI6B 2IW3A 1UBEA 5ELXA 1OB2A 1FP7A 3ZIAA 1G20E 1COWA 1FX0B 4DCVA 1OIWA 4EPRA 4MRSA 2RAPA 1KJYA 2QY9A 1XD2A 3A4NA 4Q1AA 3U3KA 2FJUA 2GILA 4IRUB 1I7HA 4ZI3A 2JIZD 4YMSA 1L6UA 4P0TA 1UJ2A 1OPXA 4G5OA 3THWB 2V55B 2F1JA 2X8AA 3KUDA 4LPSA 1F6BA 1KDTA 3DL0A 1FXAA 4NYIQ 3BD9A 4P4SA 4AY2A 4D25A 2NMVA 3EZ9A 4PXAA 1NVID 2ZITA 4QBIA 1KY2A 1N63A 2VIIA 1S1CA 521PA 1WCV1 1YQ3B 1XCGB 1BMFA 3VKHA 5C2TB 1F2UB 2ZRJA 1Q21A 1W48A 1CJTC 1V5WA 2ERXA 2IYZA 3AECB 2WIBA 2DCUA 5KOYA 1M2OB 4Q1EA 2WJJA 1OH7A 4K81B 1KRHA 1OHHA 1ZBDA 2PT5A 4E03A 5H70A 4G5GA 2FG5A 2FEMA 3PR1A 2QT0A 5JWHA 2BV3A 1R6BX 3AM9A 5FI0B 5C18A 821PA 4C30A 4JKIA 4XH9B 3EX7C 1SXJA 1XTKA 5JSZB 1KDPA 2P67A 1FNMA 1CXZA 2KI5A 3ZJYA 3I3SR 3SHFA 3LRPA 2VP5A 3GLFA 1G19A 1XF9A 4YT0B 2GEDA 2FBWB 2WS3B 1XCMA 2A9KA 3DOFA 3QXXA 5CK5A 1JQJC 4BECA 1G4AE 4KYIB 3RS5A 3BB3A 4QC2A 1AKEA 3VR6A 4NYIR 5KU1A 3NH9A 2Z6VA 3WMFA 3TR5A 4FMDB 3TSWA 2ZRKA 3U7HB 2G88A 2KBFA 3LQQA 2GKSA 2G77B 4YC7A 1JJ7A 4P3YA 2W0MA 2H57A 3KXKA 2W00A 4R7ZA 4IDOA 2QMHA 3R8CA 3A8TA 2CMKA 3AE3B 2OCYC 3BS4A 1JR3E 4GPTA 5FOSA 2QBYB 1NNEA 5GXGB 2W54A 1JAHA 4RSGA 5GVSA 3UPUA 2XB4A 5H92C 1NL3A 2P6NA 5CDFA 4CT4B 1ZNXA 1CKEA 1E1RD 3AMZA 3GLFE 2XTMA 1KIMA 3AE6B 4ZOHC 1L5PA 2XITA 2EVWX 1T0HB 2FFQA 5B2ZA 4AKEA 4BFXA 3SS8A 1ZD9A 2W58A 3Q5EA 3S1AA 3MGCA 3VKWA 1Z0JA 4D26A 2REXB 3W6OA 1RPZA 3RS2A 1UKEA 4TTRA 5AUPB 2QPOA 4CVNA 3KQUA 3QG5A 4WBSA 2AKAB 4V03A 2WVJA 3GFOA 1T3LA 1TL7C 3EWSA 3AP1A 4LWZA 5LB2A 1UADA 1OKKA 2JAQA 5CIWA 1OKKD 4URZR 3HYTA 4IDQA 3LX5A 4PFSA 3SDZA 1JPJA 5C46F 1UBGA 1Z6AA 4CEJA 1BIFA 3NVVA 2BS2B 1FOEB 2J7KA 2O52A 1OFTA 2DY1A 2I4IA 3GEHA 1XWIA 1LFDB 1TQ6A 4ZKEA 1EX6A 3O8BA 4F4JA 3QQ5A 5F98A 1R8QA 4V0KA 5JEEA 5IRCD 1FZQA 1G3IA 4GSYA 2YZ2A 2W2TA 4FXCA 2XTNA 1G8YA 2XZLA 1E2EA 4C0KA 1EFHA 4JLAA 1AS3A 1G3MA 4QM7A 5JHHB 1IY2A 1SKYE 1H8ED 3THWA 3L0PA 2OLKA 3TUJC 4BPBA 5AJWA 1P2VA 4YMUA 3SYNA 3QPWA 4IDHA 4C7OA 4K8OA 4C3ZA 2N1BA 5K8TA 2Z0MA 1NSTA 4KLNA 1KI2A 3L43A 4HATA 4W5JA 3ZYYX 1AGPA 4TYQA 1TF5A 2WDRB 2VPPA 3RWOA 2BBSA 2WJYA 2PKOA 1AKYA 2ZVPX 2M19A 2DWOA 3PQCA 3J81k 3VR3A 3IEVA 3TRFA 1CR4A 2O8DB 1BOFA 4MGZR 1KGDA 1DAGA 4D4LA 2O8EB 2OLJA 5J4LA 4R2IA 3GLGB 3I5YA 3UMFA 3EUB2 1Z28A 4II7A 3IPYA 4QBGB 4D81A 4A36A 3U7FB 1ZVQA 4BFZA 4LBYA 2H92A 2ZR9A 3W8NA 1HH4A 3T35A 5CDFE 4HUQB 1KI9A 3EWAA 3QXJA 5HE8A 2DBYA 3GP8A 2JQRB 4DB4A 3Q3JB 4Q66C 4Z1MA 3RRZA 1GKYA 3BGWA 3IDQA 1G7TA 1N6IA 1KI8A 2CCKA 3BH7A 3IPXA 4M2LA 1OIVA 4DSUA 2JLZA 1NBME 1XEFA 4LYHA 3KDSE 1L0VB 1UKYA 4C0QC 3DKVA 1HTWA 1GZSA 2X1VA 4Q4AB 3VU9A 1JPNA 4DDWA 1FW6A 1OXVA 2V54A 1KZGB 2WPDA 3QOFA 3GFPA 3LQRA 1X8JA 3AVQA 5LBIA 3AE5B 2ZI3A 4ESHA 1XLPA 1VG9B 5JWRA 2JASA 1MR3F 2RCNA 2GJ8A 2ZUDA 4ZI2A 1OQRA 1II8B 1S4QA 1N5LA 1WDTA 4MYCA 4QHSA 2B7CA 2KSQA 2WP9B 4G01B 4W9MC 1KMHB 5F3WB 1RC8A 3IIKA 1E9MA 3SFDB 1AA9A 1ZM4A 1RYHA 2AN9A 4Q02A 4OHXA 2VBCA 2HCBA 4OKSA 1L8QA 1OV4A 4BFYA 1KNXA 1XBTA 2AK2A 3D3QA 3KFXA 1ZU4A 1COWD 4HB3A 1RFLA 5DE3A 3H4MA 5DO9A 5HCIA 2IF2A 2ZU6A 2ZROA 2IYLD 1UKZA 1VYUA 3Q72A 4JT2A 2JIZA 3FPAA 2NZ8A 1OW3B 3U61B 5E4FA 1WYGA 2ZE8A 3SYKA 3KQNA 3DHWC 1WMSA 1DOXA 1AGRA 3SI7A 3RANA 5AJZA 2XAUA 4US1R 2FSFA 2ZQ5A 3KUCA 2I1VB 4QBHA 3CW2A 1E2LA 1WGKA 1DG3A 2NPIA 4EJSB 4FMDF 3KQLA 4LV5B 2IBMA 5L8VA 3W34A 3ZQ6A 3PUVA 3ZDQA 3B2GA 1T91A 3A37A 3QVVA 3RRNA 4Q1DA 3B1ZA 2PIAA 4YXWD 4EIWA 2LCFA 1JRPA 2FZLA 3TH5A 4M9ZA 4M0LA 3VHXA 4C2TA 3PEYA 1Z47A 4NH0A 1BYIA 2GJKA 4GZMA 2OFWA 2LWIA 1U81A 4LJAA 3IBYA 4A8JC 3ECCA 1G6OA 3OFNA 4Z51A 221PA 3TGPA 2QAGB 3ICQB 2RH5A 4H1UA 1AZTA 2AXPA 3HR7A 1IN4A 4KO8A 4C0BA 4M1WA 4NYJR 5DN6D 1EFRD 1P7CA 2YC2C 3AEAB 5CJ2A 4MYTA 1L6VA 4B34A 4WIAA 1G3QA 2KJQA 4R2HA 4ZIRA 3FC4A 1EGAA 1GILA 3B9QA 4JL6A 4FWIB 1V97A 3GQBA 3I5XA 1E9RA 1U8ZA 3HP1A 5C2JB 3TW4A 3X1DA 3WNBA 3VNUA 4B43A 5CYPA 2QNRA 1XEXB 1JR3A 1WB9A 1X1SA 1N5IA 2CHGA 4Q4HB 2W3RA 4CDGA 5IF9A 4POAA 2P3SA 4A2QA 2HF8A 4LSGA 3LLUA 3D8BA 1XJ0A 3AE2B 2V6JA 1XD8A 3GFTA 2W3SA 2REBA 2V4ZA 2DFLA 4MITA 3GLHE 1YJIA 2V7QD 3K0FB 4JLKA 4DLXA 3L0SA 4KX6B 1LNZA 3OIVA 2ZRMA 4PC6A 2R6CA 4TMZA 4B35A 3O8DA 3W5JA 4G5SA 4WZ6A 1E9DA 2CJWA 4HLCA 5AUNB 3GJ0A 1G21E 1G6HA 2FEOA 2IWRA 3R9IA 3DPUA 1GIAA 3VX4A 3LO5A 4Z8XA 3REFA 1KY3A 4IW3B 1Z0KA 4BLRA 1KI1A 4NYMQ 3MWYW 2Q3HA 2J0UA 2XZPA 1W36D 2BCJQ 4YXDB 4FIDA 1M6NA 4KJZA 4IFBA 3R7WA 2ZRLA 1N6KA 1S2MA 5CK4A 5EUMA 2ZSDA 3AF0A 1VDVA 1Z2CA 1SXJC 4TYWA 1A1VA 2AR7A 2QP4A 1YR8A 3DZ8A 4MRVA 4FI3C 2A2ZA 3A58B 3LXFA 3FHCB 4TQUS 4F7WA 3K70B 4MRRA 2PLFA 1W49A 3OE7A 3H86A 3UANA 1WF3A 2G6BA 2XNDD 1A70A 1OFIA 3ZS8A 1OFUX 4YDHB 3I62A 3KB2A 4LJ7A 2J46A 4A4DA 4FCTA 1MO5A 5DNYB 2J41A 5J4HA 3VR4A 3P1JA 3VR9B 5AWFC 4L5BA 3AVPA 4HZIA 3JZMA 3K9GA 1Z0IA 4KBGA 1E2DA 2OBNA 5FTKA 1E9FA 1II8A 1HV8A 3OAAA 3CF6R 3U6KA 2A5DA 1TF2A 4ASUD 4PO1A 4IHQA 4HDQB 5DI9A 2HEIA 4GL2A 1XRJA 3M6AA 3RWMB 3CUEF 3CWIA 3P4XA 1DVRA 2JLQA 4G0NA 4Q4JB 3T34A 3FVQA 5GVRA 3B82A 3ZH9B 2QMUA 3CNLA 2WKRA 1KHTA 4UKDA 2QJLA 1T8UA 1XTIA 3L0IB 3R8FA 3BIID 1W44A 2ZUBA 1E7PB 4GZLA 1VHTA 3VRBB 1MO4A 3A1TA 2IF0A 1KO1A 1YHNA 3ZD6A 4CEIA 4LJ9A 4KYUA 3HUIA 2CBZA 5KSPA 1II9A 1WA5A 3NG1A 1Z63A 5E7MA 2CL6X 3AKEA 2ATVA 2IYVA 3EG5A 3FKSD 721PA 3N2IA 3UMSA 4JMPA 4JT4A 4TL8A 3KXLA 5HE9A 2N0SB 1FP6A 3I32A 4IDIA 4U02A 5DH9A 4BFVA 3IBGA 1YZLA 2ZRNA 3MSXA 3BFKA 2XOKA 1P9RA 2ORIA 4GOXA 1VG8A 3IQXA 1U8YA 4X8LA 1JALA 3KL4A 1SVOA 2J0UB 1K6MA 1QOGA 1XNJA 2ZSBA 1VYVA 1DOAA 2Q9BA 2XOKD 1KSFX 3SYLA 1AM4D 3X2SA 3DEFA 4WWMA 2E87A 3LNCA 4LBVA 2HXSA 2RGGA 2A5JA 4C0AC 2YV5A 3TR0A 2XSZD 3WRYC 2A7QA 2BBWA 4CW7A 4KFUA 4NDZA 3L2OB 2CL7X 4ACBA 2DPXA 1EX7A 3SFZA 1JXMA 4DLRA 2ZYUX 4DVGA 3QY0A 2WAYA 4OI0A 3BH6A 3K9HA 3O8RA 2J7PD 1Q12A 3GMTA 3ONWA 4KSCA 3BC1A 4RCYA 4RZXA 4DEXA 1EFRA 3AVYA 2WSSA 1LF0A 5AJXA 3QEJA 4TLAA 4AG6A 2K5UA 1GM5A 2FGJA 4BASA 5JZVA 2P65A 2AXNA 1VCMA 5FPYA 1F5NA 4Q1BA 2ONJA 1KK3A 1TPZA 1R2QA 5HZKA 1QZXA 4QHTA 3HU1A 4DXAA 4E07A 4WAUA 5J5CA 5A5GA 2JJ2D 1NN1A 2GBLC 2QMOA 1FFVA 1YZUA 3B85A 3F5FA 1E4YA 2NO0A 2ZJOA 1Q0UA 3C7KA 1RZ3A 2WWYA 3IIJA 2ZXUA 2NQ2C 2JLVA 1J7BA 3IO5A 2JATA 4EPXA 3SN6A 2ZTSA 4XOIA 1N6RA 2IHBA 4X8OA 1RIFA 1SGWA 2A30A 1NG1A 2EFEB 2OO7A 3I92A 5EE3A 1ZP6A 4D4KA 1YR6A 2GF9A 3C14C 5ANRB 1OH8A 2Q3FA 4DLWA 1OJLA 5FL7A 2VP0A 4KI0A 1DTSA 1JQLB 1VDZA 1NY5A 1JWAD 4BGDA 2QBYA 1Z6XA 4GOKA 4JLOA 3QI2A 4BZPA 3THYB 3IGFA 3TLXA 2IUSA 5A4JA 1QVAA 3TK1A 3QKSA 2ZS7A 4LHZA 4B71A 2IYRA 1DAHA 3P4PB 1TF7A 2OFOA 2EYUA 3OESA 4I1UA 3CRQA 3KKPA 4RZUA 5E7JA 3FMFA 1E1QD 1KO7A 2NPFA 4M1YA 3QXHA 4LI0A 4F4CA 4M53A 3B2FA 2VO1A 1KK1A 4BFWA 1T8TA 4UXJA 1J7AA 3F0TA 5KNBA 3LA6A 3B5JA 3QNUA 4OK3A 3SJAA 3C16C 2IS6A 1JWBD 4MKHA 1RJ9B 1W4RA 3SU8A 5KHOC 1VIAA 2CLSA 2VHQA 3AEZA 4DHEA 1ZP0B 4EFLA 3AM1A 2YWHA 1ZAKA 3NBFA 1MO3A 3WP0A 1R7SA 1TJEA 1DEKA 2RB4A 4EJSA 2ZRFA 1XMIA 3GD7A 3HWSA 4QNMA 3N70A 3NIBA 4Q7MB 3A1WA 4TMTA 4PZYA 4BFUA 1IY0A 4Q9IA 4DSNA 2GDJA 3FB4A 4KVGA 1S8FA 2F3RA 4C7ZA 2TMKA 4DLZA 2VEDA 4TMKA 4QKQA 5JRZA 4NP6A 3LB8C 4ASUA 4ITRC 3BERA 2QGZA 4IOMA 2BT6A 2R2AA 1GRQA 3CX6A 3A1VA 3EA5A 4PAOA 1FUUA 2AD1A 2ZE5A 4NU0A 4R9UC 4Z1MD 4OI2A 5HCNA 1AS0A 2ZRCA 3VRAB 4HB0A 1XJCA 2WHXA 3AEDB 1IY1A 4JJKA 5KSYA 5KSOA 4PC3A 1XO3A 2YWGA 4LRWA 4JBYA 5C4MA 5JWOA 1JECA 3MJHA 1EFTA 2IUTA 1Q3HA 2E9SA 1N5WA 1W46A 1BMFD 2YOFA 3B7GA 4HYYA 5BYJA 4ARZA 1DADA 4JL8A 2WIAA 4NYJQ 4OQLA 4PTLA 3VU9B 5K8IA 1NYRA 5L3SA 2YWFA 3ND9A 3NVWA 3AF1A 5AK0A 2Z4SA 4TL6A 1AZSC 2F43B 3CPHA 5EE1A 5EXSA 3WBKA 3WNCA 2BS3B 2BEJA 1P73A 4B44A 1L7VC 4CF7A 4XWOA 1BH2A 3NVAA 1YQ4B 4WZAE 1M74A 1VTKA 2PCJA 3U7GA 3OIWA 3Q85A 5LPNA 1ZCAA 4OI4A 1F0ZA 1R5BA 3W6NA 4BZXA 4DT1A 1QOBA 2GCOA 3U5ZB 3UG6A 1JI0A 2OXRA 3TAHA 1W0KA 2W83A 4M1MA 1CULC 3QF4B 2WWWA 3AVTA 3ZIAD 4ZCIA 1RE0A 4DSTA 2AWNA 2DFKB 4CEHB 4RD2A 1TMKA 5L3VA 2F43A 2EW1A 1W2GA 2HF9A 3OHMA 1ZW6A 3RC3A 1PJRA 4U5XA 3RDPA 2PMDA 1NMYA 3FYHA 1FIQA 1XD2B 5JFGA 4Q9JA 2EFHB 3CM0A 1ZYUA 4DT1B 5MPOA 2ZANA 3BRWD 3HU3A 2FMXA 4I4LA 2QI9C 2BBOA 2OCBA 1G5PA 5CJPA 2FOLA 4C0SA 3MWLA 2JLXA 5G5GA 3WMGA 2GJAA 1KMQA 3ZZ0A 3A36A 3L0OA 1G8FA 3OZXA 3WHKA 1XP8A 3MMPA 1SVSA 1MT0A 3AF3A 2FDCA 2ZJ2A 3HDTA 4M1KA 1OHHD 4Q7JB 5GJCA 2JJ1A 1R5OA 5SZKB 4A8JB 1GAJA 1DOIA 1A82A 2H5EA 3T5DA 4ARZB 4B3CA 1OT3A 1TAGA 5JJIA 4LBWA 2BM1A 4XJXA 2E1RA 4JWSC 3WYFA 3W5UB 4LHYA 1K5GA 3WBJA 4US2R 1XD9A 4TL9A 1GNRA 3HJNA 3QKRB 4A0FA 4RJLA 2ZJ8A 1CR1A 3QXSA 1GL9B 1LW7A 2Q9AA 2B8WA 5L3QB 3SE0A 1X6VA 1C4OA 1H65A 4NCHA 4QBFA 2NG1A 3AKCA 4F91B 2CLDX 2GJ9A 4OQMA 3TUIC 1XTRA 4BFTA 1J70A 4C2UA 2BKUA 2GAOA 2ANCA 2FN4A 3KKQA 4HDOB 1QF9A 2O0KA 1Z6GA 4O2LA 4W5HA 5FR2A 1E32A 3QEOA 4FMBB 1E0ZA 2AKYA 1B23P 3VMFA 2YOHA 2R8RA 5L3QA 1WWTA 2ATXA 2H18A 4BWYA 3L4PA 3BWDD 3W3AA 5J4KA 2OBMA 3N2EA 1GOTA 1N0WA 2GNOA 2GK6A 2QROA 1XPOA 2CJOA 5FBVB 4UJ5A 2WWIA 5JEDA 1F2TA 2JJ1D 2Q3MA 5TARA 3RHFA 2RMKA 1N61A 3A4MA 4YXWA 1WBBA 4HROA 3MUFA 5BXQC 2ERYA 2GZHA 2X2EA 1SKQA 1S3GA 4CIDA 3TSZA 1KO8A 1UPTA 4DKXA 1W5TA 1XXHB 1Z06A 4A2PA 2WTUA 3LFUA 5J40A 1HYQA 2IUUA 1UAAA 1P62B 1FL9A 4K46A 2QMEA 3OIYA 4EFMA 3M0EA 1T3SA 1YR7A 4LHVA 3GLIE 2QSZA 2DHRA 2DFNA 1JQ4A 3DMNA 1JNYA 1O87A 3E70C 4DLUA 3RABA 2ZSEA 4P4SB 1UDWA 4GMDA 4PPQA 1M7BA 2WWGA 2VF7A 2ZEJA 4Y0AA 3UMRA 1WRIA 4R98A 3PIRA 2ZI7A 2G1KA 2VSFA 1S1MA 1X1RA 4TSFD 3FMOB 1W4BA 4LYJA 1K5DA 4IVPA 1QOFA 4TSFA 2D74A 4B76A 4AG5A 5AUQA 2FE4A 1Z29A 2L83A 1GRNA 3B1YA 5JSZA 5EE0A 1NRJB 2QTFA 1D2EA 3U44B 2CDNA 1E2HA 1SKYB 1KOFA 3TNFA 4GRAA 3SQWA 2ACZB 4BLOA 2JJ8A 1G4UR 3EIQA 2IS1A 3NTUA 2D2EA 2HUPA 3U3RA 2HJGA 4DLVA 3SR6A 1G291 5G41A 1FQKA 4PHFA 4C7YA 1I2MA 3A1UA 3B1WA 1TQ4A 3T1QA 3EA0A 1KSHA 3IHLA 3V4FA 1PV4A 421PA 3MJRA 4I81A 5J47A 1YZQA 2X77A 3CBQA 2OBLA 2EU8A 4NL4H 4TMXA 4B6EA 4ZO4A 2OESA 2VHJA 3FWYA 4CYMA 1N0VC 4NMMA 4L16A 4M1TA 1YKSA 1IQPA 4UNPA 4IXMA 1KK0A 5EXXA 1NF3A 3Q8XB 1ROEA 3MD0A 3NHAA 4KODA 4MKFA 1GNQA 1VIYA 2HLDD 3X1ZA 1QHYA 2GEVA 2QPAA 3FHOA 4OBEA 5HR5A 1YJ5A 3EC2A 1NJFA 3UG7A 3ZVMA 5J4VA 1KFYB 1XEXA 4HAUA 1GPXA 1PLLA 2N42A 3WNDA 2PMKA 4EJSC 1YZGA 2YKGA 1VCNA 2QP9X 5J4YA 2AX4A 4RD3A 2ZJAA 5BQ5A 3C5HA 3P20A 4PPGA 4ZV4A 1OXXK 5AUOB 5KYKA 1A2KC 4V02A 5BYKA 3DMDA 1A4RA 1DG1G 4V0MA 3TAUA 1FXIA 1MABA 1DO0A 1GAQB 2ZYWX 3K9LA 5KNCA 2WWHA 4TLEA 1QOAA 3ABVB 2QUZA 3AKYA 1AK2A 2ODWA 2BCGY 4HZUA 1W36B 3IHWA 3E2IA 3UIEA 1HA3A 1Z6TA 2CNWD 4TZ0A 4G5RA 4MRPA 4D0NA 1NKSA 2LKCA 1YQTA 3H0KA 2FNAA 3GJ3A 1ZUD2 4X8MA 4KXFB 4DWJA 1DGJA 1J7CA 2HXYA 5HZHA 4Q4JA 1F2TB 5BWMA 1Z0FA 2BIFA 1EFUA 1CS4C 2CHVA 2NO9A 4LC1A 4AWXA 4O0MA 3NEYA 4DCUA 3U2QA 1J99A 3SFVA 3NBXX 1SXJE 4H1VA 4JKYA 3UK6A 1RM6C 1TU3A 3KKOA 4QJ3A 4TTQA 3OEED 1KI7A 1E1RA 3AB5A 1J8YF 4L15A 5FOWA 2W0SA 5BN3A 4V0NA 2CEAA 4QOSA 3DZDA 3LBIA 4KAXA 4DBLC 4ABYA 3THXB 3K9NA 1R0XA 4DCTA 4MDFA 2B7BA 4LGMA 4YTPB 5IHPA 4A9AA 3CX7A 1ZUHA 3B60A 1E3MA 5B30A 2C99A 1HY3A 1T5LA 3UKDA 4YSXB 1KDRA 1IN6A 4PAMA 4PC1A 5EZ6B 3TJZA 4QGAA 1P9WA 1NI3A 1CF4A 4UNQA 2Y8EA 4IVQA 3W3ZB 1RRFA 4B32A 3PVSA 3PUYA 2QIEB 1NLFA 1YRAA 4M9XA 4MKIA 1OB5A 1NLZA 3RS4A 2PEZA 3X1WA 1XPUA 1Y63A 2PEYA 1NVWQ 2RHMA 3MWKA 2Y5CA 1E94E 2DR3A 1P3JA 1W1WA 1GFIA 4UXIA 3VAAA 2GK7A 4HRSA 3CRRA 5AUKA 2JA1A 2MSCB 2J3EA 2XSZA 5TXGA 2A5GA 5IK2A 4GP6A 1W36C 1YZNA 1KI3A 3W5IA 4DIEA 2ZAMA 2XXAB 3TQCA 4ACAA 1L4UA 4US0R 2WOOA 2O8BB 1W5SA 3DVLA 3BOSA 1Z3IX 2GZAA 4UJ3A 4ESVA 4LBZA 2QU8A 4HAVA 2C9YA 2D3WA 3FDIA 3RS0A 4B3XA 1PDXA 5IK2D 4LK2A 2H89B 5CYOA 3PJRA 1IXRC 2X19A 3EZ6A 1YU9A 4JLVA 1SHKA 3ADDA 3AEGB 1JBKA 2VHCA 2ZI6A 4W7SA 1RYJA 5KUTA 1W4AA 3D6TB 5FUYA 1JB1A 4JLPA 3NEJA 2LKDA 4C0JA 1IJFA 1E1QA 3AVVA 1P9NA 1I4TD 1SVKA 4YMWA 1RW4A 4EAQA 2HTME 3LDAA 3BXZA 2XJ9A 2WMOB 4B6FA 1UDXA 2AK3A 4MYUA 1FX0A 5F9FA 5H8WA 1NVVQ 2FPKA 2D7CA 2NTYC 4DRZA 4PO8A 2P6RA 2O8DA 4KSBA 4URVR 2GF0A 4QJ4A 5FL7D 1KI4A 2ODBA 2NO1A 4AYXA 1IOZA 1MRNA 5FI1B 4KVAA 2FSHA 2AFHE 2VYFA 2Z43A 2ZPTX 4AD8A 1LV7A 1GWNA 3KJIA 2BC9A 5AJVB 1TUEA 2J0QA 2H7VA 2VRWA 1G8HA 2RGXA 2O0JA 1XLQA 2IEYA 3CO5A 1Z0AA 3SNHA 1K8RA 2WSMA 3GLGE 2Z5FA 4MA4A 2IYSA 2J59A 3WHLA 2FGKA 2NO7A 2B92A 5FTMA 3RVBA 2Q0HA 1MRSA 4UXHA 4G5QA 2R6GA 4QXAA 3D7MA 3W9YA 4OHYA 1I4LD 4M4SA 2VSXA 1U0JA 2M56B 4ZDIA 1A7JA 1Y3AA 3EARA 5JI3E 1ZM2A 4GDFA 2XXAA 3VKGA 4B33A 2B8TA 2PZGA 2E3TA 3W90A 5C4GB 2HLDA 4LJ5A 4B47A 1P5ZB 4RD0A 1NVXQ 5TB5A 4BLTA 5KDDA 4YTNB 1E2GA 4FD2A 1WXQA 4C4PA 2JLYA 1R0WA 3U3JA 1UBFA 2QAJA 2ZREA 5CM8B 1CTQA 1HURA 5JBQA 1G5TA 1KAOA 4A2WA 3TW8B 5FR1A 2NO6A 4RFSA 1IN5A 2OHFA 1E69A 1TTTA 1X86B 4D4JA 2P6UA 3R7WB 2C95A 3U7EB 1NYQA 2ASEA 2Z83A 1ELOA 4AURA 1XTQA 2QSYA 1Z22A 4HEJA 3IO3A 4C80A 4Q19A 1C9KA 3VR5A 3FMPB 4A92A 3UATA 4CEIB 4QL3A 4D6PA 3KX2A 1CRPA 1LB1B 1CJUC 2KBEA 2GA8A 3DM9B 1RJ9A 2IYYA 2UZIR 4KU4A 1E9AA 1X3SA 2CK3D 1SIJA 4RKFA 3C41J 4ZCMA 1AN0A 4BRUA 1CR2A 4FCVA 1N5KA 3KXIA 3TVDA 1EK0A 2DB3A 2KMMA 1G1MA 4N58A 3OIUA 3ZZUA 2YYZA 2F6RA 1S9HA 3QKUA 2XEXA 1HE1C 3W5VB 4JBXA 1D6JA 4ITKA 1EFCA 3B2EA 1W4CA 1R0YA 5FOTA 4JZKA 3LBNA 4RD1A 2F7SA 3HYRA 4IKEA 5D3QA 4PC2A 5JS8A 4XD7A 3EZFA 2CHQA 3NKVA 2OCAA 3LY5A 3LLMA 4U00A 3KTAA 5DHAA 2MJ3A 1HE8B 1HT1E 3CF2A 1DS6A 3CZPA 2O5VA 3SHWA 5JCZA 1RKBA 4HB4A 4YMTA 4MH0R 5HKKD 1P4SA 1J8MF 1SXJB 3ND8A 2NOAA 4A15A 5KPDA 2IT1A 2PJRA 1LF5A 3NVYA 2QPTA 4JSYA 3O47A 1XEWX 2QT1A 2WPDD 2ZIAA 3QIAA 1G16A 1ZMXA 1QHSA 2OSBA 2O8EA 2C03A 2IXFA 4PQFA 3KQHA 1Q1BA 4Q5IA 2PLRA 4O2RA 1F3OA 2BOVA 4HDCA 3EPKA 4HLUC 2JLUA 1T9HA 1QBKC 1AIPA 4KFTA 2WM9B 1IN7A 3RRMA 1N62A 5SZJA 2ZM5A 1GTVA 2QENA 3UWKA 1ZIOA 1CP2A 1E2JA 1ZC3A 2VQSA 1GL7A 2OM2A 2VA8A 4TYPA 1GUAA 3RSLA 1SQ5A 3IILA 4TLCA 1DAKA 1PUIA 3OEHD 4BEJA 3QE0A 3RNLA 3AVOA 2CLCX 2QG6A 1QHHA 2GVDC 4LHWA 2FU5C 4GFDA 4DZZA 3FMIA 2ZJZA 1E2FA 5DN6A 4CEHA 1VKJA 5CB8A 4EPVA 1KJZA 2BMEA 3NS1A 1NN3A 1PUJA 2J0VA 2ZRGA 4DC9A 2RGEA 2HDNB 1GVNB 1XXHE 2F1RA 2C5LA 1X8LA 2IYWA 3CIOA 3MFYA 1EWRA 4B2PA 4A6XA 3NC0C 4Q48A 4HUQA 4J0QA 1ESNA 2DWPA 4KFSA 3TQFA 2V3CC 4ZIRB 1XU4A 2ZRIA 1SB3C 1Z0DA 4ZHPA 3AEEB 2K22A 3SFEB 1KK2A 1ZM3A 2PZFA 2QRNA 3KJGA 3Q7QA 4L8GA 4MUBA 2RGCA 3AVXA 5AUIA 3LXXA 4KCGA 4V0OA 5G40A 2C9CA 2ZJ5A 3KTAB 4TZ6A 3CH5A 3BE4A 3BBPA 4PO9A 3DKPA 2I1QA 3I4LA 2XX3A 3TKLA 4URXR 4PSAA 3RLFA 2YNMA 2ZE6A 5JJLA 2OEPA 1ZM9A 4A1FA 1KO5A 2K9XA 1LY1A 4R71A 5CITA 2H8KA 2V1XA 3VNVA 3QBTA 1CR0A 3VX3A 4YSZB 2DYKA 1E10A 3K8YA 4A0HA 2GBLA 4OHVA 4OHWA 2AD5A 1GITA 3ZS9A 1UFQA 5CM9C 2KAJA 2V7QA 4LOAA 5FBRB 1G3UA 4JLJA 2FFAA 1SVIA 5SZIA 2ZR0A 2QZ4A 4N6EB 2GXAA 1ZC4A 3IEUA 4P31A 4S2EA 4TL7A 5EP3A 2IS4A 4Q00A 2WJIA 2IS2A 4JWUC 1HEIA 1XLOA 3REGA 1P60A 1IXZA 2GEUA 1TKEA 1T4GA 2IA5A 2IYUA 2JGNA 4NBSA 3BJIC 4B74A 2QL6A 3Q9LA 3P63A 5EUQB 4B3FX 1P2TA 1MH1A 2OZEA 2MH7A 5UKDA 2EQBA 4C0LA 1NLYA 4AKGA 4Z54A 3AKDA 3BK7A 3GLGA 4Y0VA 4XD7D 2QE7A 4OJKA 2Q9CA 5FUXA 5JECA 4KHZA 2YC4C 2B76B 3GLHA 1N0UA 3GEEA 4KLZA 5JRJA 2ZS9A 3CF0A 3CIRB 2IWHA 4ERNA 2NGRA 5KTYA 3THYA 4QM6A 5HKKA 1NY6A 2HT1A 1QF6A 2OXCA 5FOVA 2FFHA 2BS4B 2IL1A 3FFBA 4LCBA 1XMVA 4OQFA 4P4TA 4E09A 4YQFA 3P27A 2XGJA 4P6VF 4OQNA 4HLUA 1CJVC 3GJ8A 4G1UC 4MGKR 4ZCLA 1MKYA 1ZCBA 2CE2X 4N1AA 1DBSA 2ZE7A 3LW8A 5IT5A 1Q44A 1IJEA 4KBFA 4URUR 3WYAA 5EP4A 4HZUB 4AYTA 2FSIA 3OAAD 3K0CC 2FZ4A 1XDBA 2GCNA 1NSFA 3B8HA 2W6IA 4TWZA 4JVNA 1G64A 1O3YA 4I1VA 1E0JA 3V00A 2REOA 2W55A 2XNSA 1E0AA 2J0SA 1HQYE 4CEJB 4M1SA 4DB2A 3C4JA 1CLUA 1NJGA 4BLQA 1FM0D 2MMCA 121PA 4WOPA 5B64A 1BYUA 1N6LA 2EWWA 4DCNA 5FTLA 4AI6A 1OFHA 1RYFA 2YWEA 4OQXA 4UNSA 4EUNA 1M7HA 4TT3A 5CLLA 1Z83A 4PHTA 4N3NA 1D9XA 1JW9D 3H84A 1NIJA 4PANA 5FPKA 2EKIA 1EXMA 5DGXA 3GJ6A 2BVNA 4XWKA 1KTVA 1QT9A 2QRZA 4DEYA 4C7OB 5H1YA 1LVGA 1W0JA 1KDOA 2RGAA 1R7RA 3X1YA 1XEWY 3QPVA 4D2IA 4FCWA 3PG5A 3I8SA 1DAMA 1DO2A 5LD2B 3I72A 1QDEA 3ADBA 3AGPA 4TYNA 3QUSA 2QGNA 3THXA 2GCOB 1KJWA 3IUYA 3KZ1E 3TIFA 3CONA 3EW9A 3PEWA 2CK3A 3KKMA 2WSSD 5DI3A 4XVUA 3CR8A 4US8A 3RAPR 4PQRA 2IK8A 1C1YA 1AQUA 1G5RA 4D0GA 3H2YA 4DCSA 2O8BA 3LD9A 2R62A 4FW9A 4D4MA 1NMXA 4L9SA 2EFDB 4YONB 4JLDA 4RD6A 4MKGA 2Q5WD 1IUEA 3C15C 5TVKA 1U8AA 4DLSA 5BN5A 1XCPA 2YVUA 2OAQ1 3LVQE 3NBYC 4GOJA 3I73A 4U7DA 3JZAA 3CZQA 2BBTA 4DUGA 3MCAA 4O3MA 4CGZA 5EE9A 3OEEA 4L4UA 4NZYA 1G7RA 3NHBA 3SR0A 2JJ2A 5L3RA 5AR1A 3EPHA 3WP1B 4C0HA 1GDDA 2BHRA 3T06B 2EWVA 3QVUA 3CPJB 4AKIA 3QKRA 2QQEA 1G8PA 1ZM7A 2J45A 3QJYA 4NKRA 5EE5B 3AUYA 1J7KA 2CU3A 4OK5A 4JL5A 3PUZA 5DHFA 4AKHA 4DLYA 4F93B 1NBMA 3T1VA 5JMTA 3NVZA 3WYGA 3EAQA 4CZ2A 2GXSA 1B9RA 1TEVA 4JLNA 1OIXA 4DLTA 2GRJA 2IXEA 1KMHA 3C8UA 4G3XA 4B3DA 2WKQA 2K5PA 4PX9A 4NCJA 5GJWC 1XX6A 3CWZA 3BH0A 5JCPA 3BORA 3P32A 2WWXA 4NONA 2PJZA 1Z5ZA 5CLQA 3MRSA 1G8GA 4IDNA 5C3JB 1N6NA 1WP9A 2YJTD 4QGGA 5G3YA 2BWJA 2C04A 4IOJA 5HTKA 3AP2A 4AC9A 1EG7A 1VG1A 2C77A 2VP4A 1Q1ZA 1E2KA 3KFVA 1DELA 1BS1A 4M22A 1SZPA 2QEQA 3PITA 1U90A 2F3TA 2VHUA 2B6HA 3PCRB 1Q22A 4JLBA 1OE0A 1NEKB 2F9MA 2GAAA 3KKNA 1XFAA 3PEUA 5LB4A 4B75A 4E5UA 2IEZA 2CXXA 2JLSA 1S9DA 2RGNA 2BMFA 3ASZA 1XLNA 4MUAA 3AVUA 2XNDA 4D0LB 4F4IA 1ZXIA 4GP7A 1CRQA 3JVUA 4JYBA 4TMVA 1SF0A 3HPQA 1RFKA 4FINA 3I61A 3AV8A 1Q1EA 1GG2A 2WLBA 4I99A 4QRHA 4I1OA 5H68A 3U3OA 2ONKA 4LC0A 4RD4A 1QHHB 2IHYA 2JLRA 1E98A 1Z6YA 4JVLA 5DIFA 4LX0A 5BW8A 1YE8A 4JS0A 5G5HA 2QTVB 4HAXA 4YTMB 3AE1B 1TQDA 3AH7A 5G53C 4PAQA 3BIFA 1RRGA 4NCNA 5LD2C 4DDUA 2BEKA 4DDTA 1MV5A 3UWOA 3L8ZA 4AIIA 3EIHA 2R6FA 3K70D 2GZDA 1YZKA 1T0JB 2OILA 1OXUA 2ZYTX 4PQYA 1KSGA 1HT2E 3DWGC 4RVCA 1IN8A 3AVWA 1QLBB 4XSHA 3U44A 2DFTA 1US8A 3O8CA 2WU2B 1JEDA 2W6ID 4BLPA 2ZI9A 3LVRE 4TYYA 4JLMA 3FGNA 4EKDA 1QHGA 5B58C 4KV9A 2MSEB 3N5CA 5KDLA 1D2NA 1N3BA 2C2HA 2AFIE 4HUTA 1UF9A 2GXQA 1GKUB 3PUWA 4N0EA 3NDBB 1V8CA 3W9CB 1WRBA 4LV6A 1IHUA 3AP3A 3GJXC 4X8HA 1ZINA 2ZU0C 4V0LA 2HYDA 1VYTA 1QHXA 1Z8FA 2WDQB 1CJKC 2WQYB 4IOKA 1PZNA 2V1UA 5BN4A 2ZR7A 3G0HA 3ZYCA 1OYYA 2G0NA 3FHTA 5FL3A 1DE0A 1NIPA 3NXSA 1ETUA 2FV8A 3R9XA 3LH5A 2QTHA 3DM5A 1TQ2A 2GHIA 4TLDA 2FWRA 3SEAA 2ORVA 2Q6TA 4JX1C 4XTRA 1NP6A 1P61B 2C78A 1TYGB 3RRYA 2VTKA 2PT7A 3EC1A 1L2TA 2D2FA 3CNOA 4PHHA 1FFHA 4WW0A 4F92B 4BEBA 3OFND 1E79A 1NMZA 4OK6A 2D4HA 1W2HA 3AGQA 3TE6A 1S96A 4ZHOA 1OSNA 3QBVA 2G0TA 3SJBA 4GBMA 5GADl 2D7DA 4OYHA 2QAGC 1N6HA 3CX8A 3PXGA 4EPWA 5JLJA 1R5NA 3FE2A 2H1LA 2P5TB 4PR0A 2FFBA 4H9GA 4BZQA 1FO4A 4MDEA 2VLIA 3H1TA 1H8HD 4WQMA 1OLOA 2QM8A 3JVVA 4P4UA 4HAYA 3DDCA 1MOZA 2N46A 5FPHA 4BFSA 1E2NA 2ZRHA 1ZUIA 4WVFA 4XIGS 1UEIA 4XVRA 3KB1A 5E95A 2BJWA 5FPSA 1FMJA 4GT1A 3ADKA 2IXGA 3GLHB 1JR3D 4LUCA 1NVUQ 1VMAA 3GLFB 3HVZA 2GTPA 1QHNA 4OL0A 3HR8A 3VFDA 4ZDKA 3GPLA 3ASYA 4P33A 4Q18A 3PENA 3P26A 1JEEA 1E79D 2WICA 1GL6A 2FH5B 1TX4B 4A0GA 4B48A 3K0SA 5TV2A 1RWSA 2WZQA 3K0EA 3TMKA 3W6PA 3VTKA 2ECKA 3QF4A 3KQKA 3CR7A 3FFAA 1D5CA 2L52A 1LS6A 6Q21A 3HRDD 1UBCA 4LHXA 2XB2A 1DOYA 3U3MA 4XSGA 2ZSAA 3EASA 1U0HC 1ZU5A 4USAA 2OT3B 3PV0A 4F38A 3G5UA 2VF8A 3NWJA 3QENA 2AX5A 4HB2A 3M1IA 3RS3A 1F60A 4WXRA 3DOEA 3RS7A 4NCKA 1E96A 2WOJA 2I3BA 2A5FA 1EWYC 4Q1FA 3ADCA 1E2IA 2VL7A 4QGFA 3A4LA 3CPEA 3SBEA 1XMJA 4B2LA 5K8LA 3LBHA 4AK9A 4YSYB 4NTZA 1IONA 2C98A 2R9VA 3AUXA 2FPLA 2VH5R 3DO6A 1E9CA 3K70C 2XTZA 2GXUA 3VHLB 2YHSA 3CB4A 1ODFA 3SZRA 4QG7A 4M8NE 4MGIR 2FSGA 3EZ2A 1DAEA 3K0FA 3KJHA 1KF6B 4D80A 2CE7A 5EP2A 1N6PA 4FN5A 2HYIC 2O8CA 1E99A 1CJMA 1PLKA 1R8SA 5L3SB 2HV8A 2F9LA 4V0ME 2J87A 4PSVA 2P2LA 1JXOA 3C5CA 4Q47A 2PVGC 1GP2A 4Q7KA 1KKLA 1TNDA 3AF4A 1G7CA 3MWJA 4JVSB 2IX3A 3U60B 3WXMA 3NBZC 5EZ5A 2VP2A 3AV0B 4XWAA 4D82A 1QVRA 1B0UA 1UKVY 4KITB 4RCZA 2IC5A 4QHYA 2ZJBA 3CRVA 2UVQA 2PZEA 2AWOA 1ZUNB 2RGBA 3QXCA 1FNNA 2BJVA 3VQTA 2B21A 1U98A 1DAIA 4JBWA 2IYTA 3ZVNA 3LV8A 1N5JA 4JYCA 4EQ6B 3T15A 1TKYA 2CJNA 1G9XA 1DPFA 1TEXA 3P4QB 5D3MB 3AE7B 4WXPA 2WDVB 3K1JA 2JEOA 2WMNB 4HAZA 1P2SA 4TQ9A 4YMVA 4WZBE 4XTCS 3U4QA 2IYQA 4LJYA 3QSYA 1SVLA 4JJZA 3L8YA 4I1SA 4B3GA 1OXTA 3S1AB 3B1XA 5E3HA 1PVOA 2BDTA 3MAAC 5DLQC 1AWDA 1TADA 2W2XA 1M8PA 1W0KD 1FFUA 1RRPA 3AQ4A 5FH9A 1FTNA 2J9RA 3ZQJA 3T5GA 2JLWA 5HPYB 1SVWA 2W6JD 2O8FA 2RGNC 2NIPA 5FOXA 4Q9LA 2AHOA 3NH6A 3CRMA 2VSOA 3QG1A 4O25A 2AL7A 3V9PA 3WY9A 1E9SA 3R20A 1WBDA 1EESA 4NPHA 1E0SA 5DSZA 4LPKA 3Q7PA 5P21A 1PUTA 4UNRA 3P4SB 3SJZA 1E9EA 1SVMA 5FUVA 4Q4LA 1YR9A 1E6CA 2CVFA 1JJVA 4UNNA 4IDPA 4EQ6A 4FWTA 2HT6A 1YZTA 4HAWA 1OH5A 2H88B 2ANBA 4Q21A 1MABB 3HU2A 2RHDA 2ZAOA 4LYFA 3ETLA 1CEEA 1DARA 5GJBA 3B9PA 1I2DA 1P72A 1SHZA 1IXSB 1KNQA 3T61A 2ODEA 2LEKA 3U6BA 2KE5A 3BAFA 4LJ4A 2J7PA 4US9A 2F1HA 3LWNA 1BKDR 3F3YA 3Q5DA 4FMCF 4RY2A 4B3BA 2OAP1 3ZGXA 1N5XA 1IBRA 4Q9HA 1W47A 4BE7B 4TT3D 1D8TA 3SC3A 4A8JA 5JI2E 5JS7A 5KDOA 1FMLA 3AEFB 1QG4A 2MSDB 2WJHA 5FTNA 5DISB 3LXRA 1UEJA 1Z2AA 1S3SA 5CB6A 4LY6A 1XJQA 2JCSA 4A0RA 1EWQA 1T3HA 2Z4RA 4ON9A 2G1EA 4QNRA 3K09A 3GLIA 3NRZA 5K8UA 2O0HA 1W0JD 4EPYA 5M04A 3EPJA 4M9SA 1NENB 3FTQA 3RSOA 4HLDA 1HQCA 1I4DD 4TMWA 3P4RB 1VPLA 3I8XA 4TQAA 3EPLA 2KB0A 1FRRA 4LJ8A 4IJMA 2UZ3A 3K09C 1Q20A 2R6AA 1VLBA 1NBMD 3BB4A 5F2EA 3CKLA 1CIPA 3P4YA 4DDVA 4BQSA 3AEBB 3PEVA 2OE2A 2H17A 5D3MA 5F9HA 3MLEA 3GCGA 2OUKA 5FUWA 4EDHA 2ZYVX 4AYWA 4YLGA 1US8B 1TUIA 2ZI4A 4PHGA 4OI1A 3GLIB 2WJVA 1QG2A 4Q4AA 2MJEA 2F1IA 4IFEA 4ZPXA 4ILEA 2VP6A 4PC7A 2C9OA 2BMDA 3T12A 2QAGA 1CU1A 1N2CE 4A6PA 8OHMA 3B1VA 1D9ZA 1ZD1A 3OF5A 4LYAA 1G3RA 5B57C 5FBLB 1XMSA 3RPFC 1U9IC 4P32A 1W7AA 5JJKA 1OF1A 5TY0A 2FX3A 1A2BA 1OFFA 5EQTA 1MO6A 4A82A 1QHIA 1KYIA 1P75A 4C9BA 1ZJ6A 2QQ0A 3AE4B 1JR6A 3ZD7A 4Z8YA 2IYXA 3AF2A 4DUGD 4EPTA 1LS1A 2BM0A 2VHTA 2CCJA 4PZZA 1AS2A 1VJKA 1D2MA 2XJ4A 2ZRBA 3TVTA 1V43A 3P1MA 1NN5A 1YVDA 3SOPA 3QPUA 5KSZA 1G7SA 4CT5A 3HPRA 2QE7D 3RC8A 3ZLJA 1ZIPA 1E2QA 1J2JA 3GJ7A 2C96A 621PA 2A78A 1E6EB 1Q57A 4YDSA 2OCPA 5DYGA 2GETA 2QM7A 3SBDA 2BMJA 2RGDA 1G17A 2J1LA 1YJJA 3QF7A 3THOA 1CBUA 4TTPA 2PVOD 2WKPA 1ESMA 2PBRA 3TSOA 4NCIA 2OG2A 4ZDJA 1SULA 2RKOA 4PPNA 1BO6A 2P5SA 4IEIA 5GJVC 2ORWA 3VR2A 2CVHA 4Q1CA 4WA7A 3X1XA 3IIMA 4DJTA 1WE2A 1N6OA 1XZQA 4OHZA 3B9JA 2Q21A 4Q01A 3RYTC 1ZOYB 3EIEA 1ZD8A 5E7IA 4TN1A 2OFXA 2VP9A 2JDID 2CL0X 3ETRA 4JIMA 1E4VA 4OJQA 3BFXA 1VHLA 1ONBA 1GNPA 2QA5A 1KZ7B 4QFMA 2ZUCA 4NYMR 5TDHA 3KJEA 2PH1A 2O8CB 1SXJD 1FPMA 4RFSB 1FQJA 2PL3A 2R65A 3W8RA 3A6PC 2GVZC 4IVRA 1GSIA 1U99A 1X8KA 2QP3A 5EXTA 3UXMA 5AJYA 2GCPA 4NE2A 4JVMA 4QGHA 1IAQA 4HLQB 4L9WA 1YRBA 1KSJA 3CWQA 5CIQA 3SQXA 1M34E 2L0XA 3ZVRA 2X2FA 1E2MA 1VECA 1U2RA 1R10A 3CLVA 2CNWA 3NC1C 3GEIA 3LAWA 5FTJA 3ZVLA 4Q4HA 4LJ6A 4S35A 3U4QB 2G83A 1IM2A 2FPMA 4N0DA 5EP1A 1XTSA 4PSKA 3NDPA 4LDJA 4GNKA 3IKJA 5H8YE 3L82B 4XVQA 3K0AB 2ZI5A 2EFCB 2SHKA 1T6NA 2A3RA 4RKEA 2V6IA 3K0CA 3OEHA
chains in the Genus database with same CATH superfamily
3H0LB 3KU1A 1FYXA 3HV2A 3GZNA 4MGYR 1Y3BE 4FMCB 1S2LA 1TTQB 2ECOA 3FPSA 4BRWA 2ZDGA 3RKSA 3IQWA 3K8ZA 4NMWA 1NR1A 4HPWA 4UVIA 4R83A 3U62A 4GMXA 4XIIA 4PPFA 1U28A 3K53A 4DWVA 2JEYA 2Q45A 3N2YA 2WZDA 1W8IA 1WUHS 2RMMA 2NUAA 4QUJA 3R7BA 5TMPA 1EJ0A 2WWFA 3KWLA 5KTSA 4FNGA 4RBNA 4P53A 2VDNB 5FPTA 1Q3TA 2AEEA 1A97A 4DA7A 2Y4OA 1O58A 3HCDA 3TBHA 2X3YA 3IHPC 1B14A 2ZUUA 4B73A 1PEKE 5ALYA 3ICVA 3B38A 2G1AA 3UB4A 2ADMA 1P6XA 4MVJD 2VJ4A 4LDAA 2ZRAA 5JQGB 5EXPA 3UHAA 3LDZE 1E7RA 5KWVA 5C51B 3B0XA 3AH8A 4L5AA 1NOKA 3DBRA 4F72A 5FLXA 1OB2A 1JHPA 1CUCA 4J4BA 2DQKA 4WLEA 4HL6A 4NMLA 4JCOA 4YJHB 4UCQA 4L8LA 2A33A 4G97A 4HPLB 3OQMA 2IU4A 3PKIA 1YRLA 4OHKA 2DCUA 3EH1A 1W30A 4OL9A 5A1TA 4Q9AA 2LVPA 2IV3A 3OQBA 5H70A 1YIOA 4N40A 1IZ8A 1TT5A 4IF6A 2PBLA 4X71A 3MFGA 2CVQA 3EUEA 3EZNA 3BKXA 1VB5A 1MQ3A 3VVBA 4F4WA 4X24A 5EHGA 5BO5A 4QC2A 1AKEA 3WV5A 3L13A 2AVNA 4KV2A 2R6ZA 5HW0A 2F2AB 3AT1A 2L76A 4OGKA 3AE3B 3CNHA 3QPBA 4CDMA 2Z7JA 2DHCA 1IZ0A 2OAEA 8ICEA 1JI3A 5FWXA 4LDNA 1DU4A 3RTCA 2EVWX 3NLLA 2H29A 5SY9A 2W6QA 1Z0JA 2P3LA 1GG5A 2VA2A 1D4AA 1Z6QA 3QG5A 1EK6A 2AWTA 4AJIA 1N36B 3OTIA 1PTJC 2DT5A 1WPGA 3UHJA 1OKKD 1CY7A 3AFOA 1JPJA 3JYLA 5IULC 5A4FS 3ZNQA 2FZEA 2W2TA 5BOLA 4JLAA 1RYRA 1G3MA 4NM2A 1VIVA 4BPBA 3TUJC 1QIIA 3SYNA 4K8OA 2PKXA 3MS7A 4C3ZA 5B3JC 4E13A 3OZEA 2G7ZA 1AGPA 4TYQA 1TKDA 3H6KA 3NYQA 2KZZA 1JH9A 2BD0A 3WOVA 3Q8PB 3GLGB 1KEKA 1CQJA 2V58A 3HEBA 1SXGA 4FOLA 3QYAA 1SUAA 1Z12A 4RT3A 4QO8A 5KWEA 2Q5QA 5DG8A 2CCKA 5CVDA 3V8RA 5DGIA 1D3ZA 2VK2A 3ANTA 1JG6A 1V11B 1SXQA 3LQRA 2GRAA 4PW0A 2QVLA 1A2QA 1S4QA 1HR0B 4RQ2A 4YUWA 1FUIA 3KS9A 4RX1A 3D2LA 1SU6A 4H17A 1OV4A 2CV1A 1KNXA 2EKLA 1K3UB 4BQRA 2ZU6A 3FPAA 1NNSA 5E4FA 2XUJA 2ATCA 2ZE8A 3ECIA 2IELA 4MIYA 2F64A 4B9TA 1HGXA 4RWZA 4F60A 2WU3A 3BD8A 5MN5A 2X4GA 4WL0A 3HGQA 1FJHA 1KJQA 1YA6A 2KN4A 4M0LA 3PEYA 4UCWA 1Q3UA 3OPMA 3HVJA 1FD6A 2QAGB 3KOYA 5CVUA 4KO8A 3IT6B 4B34A 1QE3A 2QJOA 2I1JA 1N2BA 1O9BA 4ESEA 5CDGA 3LYSA 3H5OA 1IHOA 5AVOA 3MCTA 2HBLA 1QNLA 2KQSA 1PZEA 3BM5A 3M8SA 1NNI1 4NMXB 1GG3A 1A4XA 1X15A 3AWDA 3BQ1A 2ROQA 1PQPA 3VPXA 1O08A 5BSTA 3NT5A 1BXRB 3IT1A 3MT0A 5JZMA 4QREA 1ZVMA 2HA3A 4D8WA 1WF3A 4ODIA 5F23A 3ZS8A 2ADFA 3PQ6A 1HTBA 4LDQA 2G1PA 3TS1A 3NJ8A 1M0WA 3VSBA 3TPZA 1M54A 4CF4A 4O2BB 1H9BA 9ICXA 3UHFA 4COOA 1U5BA 2Z8ZA 1KHTA 4K7JA 2LVQA 3OICA 1JG1A 4HNTA 4HY3A 2FW1A 4H6VA 4HJGE 4RGNA 5LXIB 1Q0RA 4H7HA 4M02A 4OOFA 4JT4A 1FFCA 4ED7A 4N18A 4D4GA 1EVZA 4OQZA 1SZJG 3MCUA 1JDJA 3RU2A 5F7OA 3TIVA 5LXHA 2V5UA 4XB2A 2J3JA 1QVZA 2MIIA 2HMUA 3SYLA 3B5IA 3A9KA 5E7QA 4D9FA 1P7VA 3KC2A 1MXHA 1APBA 3GMTA 5DV9A 3PX3A 2GGSA 3VNAA 5E6OA 5JZVA 2W6ZA 2JXJA 2H4ZA 4ER6A 3CMCO 2QLMA 4J94A 4P08A 2RH8A 2KFJA 1G1AA 4RLQA 3MMXA 1QSLA 2NV0A 4HWTA 3VUXA 3WLOA 3UMBA 1FDTA 4DV2B 2JATA 4XOIA 1ED1A 1T1EA 3UWMA 3P71T 1EHYA 4QVGA 4PLVA 2B30A 5LC1A 1IDOA 3QKSA 1DAHA 1TF7A 5BYSA 2OFOA 4CM8A 1WU8A 1Y9ZA 2H65A 5EIEA 1D1PA 1FS5A 2V4RA 3T8MA 2V74B 4IIEA 5BMVA 4BFWA 4KVZA 4X91A 1DOHA 3RJZA 4BX3A 1AROP 2G3QB 3DNMA 5I4IA 1TK9A 4F7ZA 3AEZA 2YWHA 1LEHA 2RB4A 2BN4A 1K6JA 1R6UA 4TMTA 3DPIA 2VEDA 4BOYA 3MBYA 4RTJA 1MJGA 4GI2A 1LQ2A 1FTQA 4CQMB 4MROA 1IG3A 4MP3A 1DXQA 3AUTA 3K6RA 1BMFD 2GPBA 4UW9A 2YWFA 5B3KA 2F43B 4I2DA 3HBMA 1M2OA 3D8NA 2CKDA 1AH2A 1LSUA 1MFWA 5HXAA 4MJSA 4LMBA 3HG7A 3JASA 3N6VA 3Q85A 2MBQA 1ZCAA 1RQ7A 5ALVA 1PJSA 2VPYA 2F43A 4QXOA 2RI6A 2HMSA 5JT1A 1W88B 1GGNA 3L92A 2C9WB 1NKVA 1T2CA 3K6SA 1AKUA 1H1DA 2JLXA 1XAIA 3ZZ0A 1KMQA 1OZGA 1Q7GA 3NRBA 4I7EA 1EP2B 3HDTA 5SZKB 4PLGA 3NG0A 3KZCA 2RFLA 3E4DA 3ISJA 3L5OA 2B8WA 2GBFA 4Q43A 3CEPB 2P9HA 1OLSB 2CLDX 4LNKA 4HDOB 1P1RA 3QEOA 3Q4GA 4FMBB 2YOHA 1WWTA 4BWYA 5JXHA 1UPAA 1S0OA 1KJNA 3N0TA 4ME6A 3UOWA 3RHFA 1VKNA 4YXWA 1HYBA 5BXQC 1S3GA 1L7QA 4HPXB 4HPMB 2KQ4X 1RXYA 1P62B 2JY6A 2QSZA 2DFNA 4G0XA 1DC3A 1U5CA 3FI0A 4CV2A 2O3SA 2WWGA 5A0LA 1B4DA 2VAPA 3MLAA 2XKKA 3GIIA 1Z29A 3B1YA 3EN0A 4TGLA 1L5QA 2MSNA 3DBRB 8ICOA 2AYZA 2JJ8A 3OKPA 3D6UA 4OREX 1ZLXA 2XUAA 3EXHB 3WIOA 2DP4E 3UXPA 4OXXA 4V0QA 5C35A 4RK0A 4QOEA 2D5IA 1FIUA 5EC8A 4GD3Q 3ID6C 4EG6A 5K1ZA 2QRUA 1Q50A 5IF3A 2GRIA 4HAUA 3WNDA 5D7GA 4BMDA 3BL6A 5BYKA 4ZARA 3TQHA 2D13A 3R7LA 1CZLA 4K9SA 5ADUS 3R5JA 1YUBA 2A1TS 1Z0FA 4BP8A 2BIFA 2NO9A 2YZGA 2BDUA 1LPPA 4Y2PA 1SXJE 4I2AA 1WX7A 1E1RA 4P3PA 3K9NA 1QCZA 2Q99A 4A9AA 2FAZA 5J2UF 1UPXA 2OOSA 1RQNA 4UB4A 5THKA 2ECQA 3K35A 1NVWQ 1W1WA 1R9GA 2GK7A 2VPQA 3K2EA 2A5GA 5TXGA 3QLJA 1B0AA 4DIEA 3GRCA 1NK7A 1SIFA 1ZN8A 3SKXA 1I4XA 1AMNA 1JLRA 1I2AA 3ZPXA 2P0YA 1SHKA 4JJIA 4W7SA 4BKRA 2XNKA 5CA7A 1C7RA 1L3TA 4JL9A 3HCEA 4TYMA 5K3EA 2XJ9A 4CR6A 1KZHA 2GMIC 1D2CA 5FWNA 2CXYA 2BPFA 1LJLA 2WXQA 2GUWA 2A59A 3ZZ1A 3I6IA 3GEDA 2FSHA 3VYSB 4MKRA 1P91A 5M34A 3IKTA 1I33A 3T3HA 5LNK6 2VN8A 1A95A 4UHKA 2IYSA 4ER0A 2Q0HA 5CT9A 1B8VA 1I4LD 1ZM2A 3RD5A 3A1QA 3H1GA 3L04A 4C76A 1LI4A 4HFMA 3JQDA 4BC0A 2P62A 4Z9FA 4QASA 1Z7GA 1E2GA 4FD2A 4C4PA 1S2IA 3FDZB 4E2WA 1DYQA 2I54A 4PNPA 1E69A 2K87A 1ADGA 2C95A 3R7WB 2YUTA 3FMPB 1O96B 2OJWA 1ABFA 3EDCA 1BPDA 4RO0A 1S1QB 3TVDA 1CQIA 1Z7WA 3W5VB 1JHXA 4DCMA 5EPOA 2C60A 1XNQB 4QOIA 1TU0A 1N9ZA 2F7SA 3UXOA 4GQIA 4IKEA 3I9V6 3TZBA 1UBUS 4KQGA 1WFYA 3FYTA 1SQ6A 2RPQA 1TGVA 4ZCQA 3DZGA 4TWRA 5CH8A 1GT6A 2L05A 3LUKA 2O8EA 2C03A 5I48A 4MV7A 2KJRA 1QH8A 2WU0A 3EPKA 3MHTA 2JLUA 1KR5A 4FS8A 4AMVA 1IUKA 1NKBA 1SQ5A 3VO2A 4BEJA 5L9XA 4XOUA 2QG6A 5DHQA 1QHHA 1RWXA 1E2FA 5DN6A 4W5TA 4K9QA 3UQAA 4Q39A 5DM1A 1GVNB 1XXHE 2F1RA 4BWGA 3R44A 2KFNA 5BUQA 2PZFA 4KZPA 3DTVB 2ISOA 1QIEA 2XX3A 2CDRA 1RQ2A 3NHKA 4LDPA 1PT5A 4R71A 3T7RA 2CL5A 4LF4B 3K8YA 4BVLA 1E7QA 2QZ4A 1L5KA 4BNTA 3DLHA 3UQBA 1GLVA 2X6TA 3UQ0A 1XQQA 2IS4A 2JANA 4XLZA 3E18A 3MC0B 1QBGA 1FRQA 4ENWA 1C4AA 1R6TA 2WC1A 3K5WA 5KT3A 3NR2A 1XL0A 4KHZA 2HNBA 2H1HA 2X86A 4NK4A 5K0LA 5L1JA 5J0QA 3WYEA 4RNCA 5FOVA 1CQXA 4ZCLA 4D9JA 4N1AA 1EX1A 1LNQA 3LW8A 1Q44A 3A7EA 3OSNA 2BRUA 2NTVA 2ZT7A 2LTAA 4PZ9A 3VZQA 1VYHA 3UJHA 1I7LA 3PHXB 3NEAA 1RC0A 4KLFA 5CNKA 2JJYA 5FTLA 1JE1A 2YHIB 1QF7A 4HFJA 3LHFA 2FZKA 3U8ZA 1ZHHA 1XKQA 1Z18A 2GF2A 2KK8A 2FWBA 4PFJA 1LVGA 3H3JA 3J81j 2LASA 4AY5A 3PL1A 3ZHVA 5C52B 3QEMA 3EODA 3BJRA 6ABPA 1QDEA 4MUNA 4RF2A 3HKDA 1KARA 1AQUA 4DDID 2WIFA 4WCVA 3IP6A 2VDKB 4RD6A 3MTIA 2RG7A 4BYGA 1U8AA 1Z74A 1V6EA 3QCAA 1DJNA 3Q11A 2BBTA 4DUGA 4O3MA 3C8HA 1JFFA 5F51A 3NVMB 2XVZA 5AR1A 3WP1B 3USES 3TANA 2EWVA 5DNVA 3WK8A 4NWIA 1JHRA 3H5VA 2E55A 1HZJA 4OAOA 1NBMA 3EQ8A 1S5PA 4IZHA 5JMTA 3OQNA 3S2GA 3H1UA 1OIXA 4JLNA 4PHDA 3Q8LA 2JFVA 1JXAA 1EBFA 3D1JA 2K4HA 5CLQA 4QGGA 3KPVA 1Z5GA 3OCWA 4ZEOA 1TD9A 2R8GA 1RZUA 4DYHA 4HBZA 1WGYA 4BNYA 5KOJA 1HK7A 1ZQNA 1ZYQA 4LGCA 2PMEA 4EATA 3HLTA 2I5PO 3TADC 4I99A 3GCZA 5H68A 3LUCA 2X0NA 4RD4A 4ZAGA 1E98A 2BDEA 1UZMA 4LX0A 3GN2A 1YE8A 4PAQA 1RRGA 1ISSA 2BEKA 4IO1A 1UFOA 3SD7A 4UCXA 2C8LA 1JE0A 2PANA 3I3OA 2H9IA 3U44A 2KDBA 3WO0A 1WM3A 4PGQA 3PVZA 3W1SC 4MQ4A 5GONA 1PK1B 2X8BA 1B0XA 2VTBB 1EK1A 1WB5A 4AP4C 1BVSA 3IG8A 1LRJA 2WFAA 4BWFB 1S8OA 3WBBA 1FFHA 4O4JF 4M99A 4ECSA 4WECA 1E79A 1WY8A 4DCOA 3HFGA 3PXGA 4QTZA 1WEKA 4BUCA 3OSZA 4H6PA 1GLGA 4RVDA 2C4KA 1FO4A 3QELA 1OLOA 2E4XA 3ZYZA 1UOOA 3ZUPA 4W5QA 4EF5A 1A2OA 3KB1A 5CJJA 2CLFB 2WT8A 3VFDA 3V60A 4WI1A 1CZKA 3QU4A 4RA9A 3N2NA 3K0SA 4BKTA 3AIIA 4CQNA 2C42A 3PQ5A 1CWUA 3FJOA 2EGUA 2XNCA 1XZHA 1T1GA 2NVUB 3ZY4A 2MP2B 3PXAA 3OO0A 1NUHA 3LT2A 4MR7A 3WZ2A 1LSJA 8ICNA 1KYWA 5GWXA 5AKZA 1DO8A 1H2EA 2FLLA 1EDEA 1C9NA 1GJZA 3IP9A 2YWDA 1ECLA 3JR7A 2KFZA 4OXRA 4NENB 5DYTA 2C1XA 3ZNPA 3MWJA 1C9JA 1QVRA 1UKVY 2B98A 4DEZA 1IM8A 2DWUA 2VAWA 1FNNA 4O1NA 5DPMA 4GIBA 1QYWA 3LV8A 1QTIA 3VYRB 1Z0SA 5KAMA 4LNOA 1T34A 4MQMA 3SV3A 4PX3A 1SMKA 1NI5A 3NATA 4UE2A 4OU5A 1V25A 3E03A 1OXTA 3W5BA 1DUSA 1QC5A 4K3BA 4L5CA 1SCIA 1E1DA 4EABA 5F76A 4AICA 2ZAYA 1MC1A 4Z4GA 1BE1A 3BCHA 1AARA 2ZUTA 4AWJA 3DTVD 1V2YA 3K92A 4PYLA 3DE4X 2OAP1 2DQYA 1UIMA 5F5LA 1AE1A 5DPSA 5JI2E 3ICPA 2YYYA 5DM60 4FYKA 4ZYLA 1QFZA 2GD0A 3RC1A 3DDHA 2WD9A 5K8UA 1W0JD 4ZANA 1DZIA 2IDKA 2JHPA 2KB0A 2JWUA 1Q0SA 1ZNQO 3S2YA 2C54A 3A9SA 2LHEA 3VYUB 1CJSA 3GCGA 4J7UA 1QG0A 2X8XX 4ILEA 2ZIXA 2C5HA 4UB5A 1D9ZA 3QLUA 3C6KA 1IWBB 5CLJA 3GZ4A 3O2QB 1GU7A 2XEWA 3EBLA 3JSXA 3D2QA 3MRXA 3NOVA 3G6WA 4I46A 1W25A 3DBIA 1QHIA 1DIHA 5KFDA 3OWHA 5BRJA 2ZJ1A 3ZD7A 5BSRA 8ICFA 5K8VA 1FZTA 4GC5A 4LN1A 3TVTA 2VJYA 1YVDA 3QLVA 2QE7D 4HCJA 1RC1A 1E6EB 2WGSA 2GETA 3KKKA 1RMQA 1VA4A 4IKPA 3TIXB 1WZNA 4AMBA 3LKVA 3RV4A 3THSA 1UM9B 1UZLA 3U5TA 5G4LA 7ICJA 2CL0X 4W5OA 4RFBA 2Z57A 2MBBB 4LLGM 4EEYA 5C5JA 1U9JA 4CKBA 3QMPA 5FF9A 4UQLA 1W94A 4KPEC 2PL3A 2YVLA 3ISTA 2WE8A 4TZTA 1T0PA 2WYVA 4IVRA 1GSIA 3DLBA 5BV7A 5B5EU 2IY1B 2XGMA 3L7IA 1HYGA 4PSKA 3PU6A 1M34B 4QEDA 5LMCA 1VJRA 2EFCB 2IUYA 4LFAB 3FRIA 4XX0A 3B89A 2V9PA 1PJ2A 4GYWA 4FKBA 1KAGA 1PGJA 2IIPA 1OVGA 2PX0A 5KQGA 3DAFA 4WQOB 4BNWA 5MN4A 4AY3A 1QWOA 3FCYA 2C7HA 1P7EA 3BWCA 3K0AA 3TZ6A 5BYAA 2BUAA 2PCLA 4L85A 1N60A 5JV5A 4MSUA 4RJKA 3Q14C 3NXKA 3L7LA 3KR9A 4Z86A 3TYXA 3UKJA 3VDMA 1ESEA 3LQFA 3FOZA 4K9KA 1QTQA 4HI0E 4E2FA 3V1LA 1OXSC 1GCOA 1W6UA 2VTVA 4QSHA 5KAPA 2ZB8A 3ZV3A 4O02B 3NWOA 1SB9A 1A5TA 1RAAA 5IVHA 2GN1A 3T94A 2NP7A 1M6YA 2FPXA 3AQEA 5A3VA 3LX8A 5F77A 3QKSB 4W6QA 4CMJA 1BE8A 4JQSA 2V0NA 3QU2A 4NENA 3ZNGC 4ZVMA 2WV9A 3OT4A 3UMCA 4RFVA 2D3TA 3D32A 3CJTA 1KI6B 1U9CA 4QJIA 1A0PA 4AROA 4MRSA 2WTAA 1LDGA 1YMQA 2ERCA 4BCBA 2F1JA 1NPTO 4MV9A 2HFJA 4XIFA 1OAOA 3ZDAA 1TM7E 4RYDA 1CJTC 1U2PA 1EUCA 3P9NA 1KRHA 5JWHA 2YTZA 4X54A 4JKIA 4MYSA 4N3BA 3ZJYA 2GBNA 2VP5A 3V1TC 3GLFA 3I3TB 1FYFA 2GEDA 5AOBA 2WY2D 2QMQA 2AJBA 4L2IB 1MEJA 3RLIA 1MG5A 3TSWA 3ROQA 2GK4A 1JZSA 5HIIA 4EG1A 4GLSC 4QUKA 4ZRNA 3ED5A 3U40A 4NE9A 1LLDA 2QBYB 1T15A 1W35A 3I6YA 4BP3A 1T2AA 1PR2A 4U7CA 2MA9B 3OVMA 2DU8A 3JD1A 1KIMA 1TJ5A 5JG7A 4C20A 1N2GA 5G55A 4TTRA 1T0IA 1EJ6A 4CVNA 4LTMA 1PJQA 3QW2A 4W9NC 2Y9PB 1MAHA 3HYTA 3MT8A 2J6CA 2O52A 1QFSA 5BNIA 3HE3A 4V0KA 5KFCA 4X64B 5AJWA 4C7OA 1CUWA 3ESXA 4ICIA 1K1EA 2VPPA 4CMIA 3VNRA 3V7NA 4EUEA 2ZVPX 4D9GA 2KYWA 4MGZR 5IIIA 1DAGA 4PN3A 1IZZA 5D87A 2F3NA 1Z28A 3IPYA 3G0OA 1SL0A 4BFZA 3QA3E 1U45A 3QXJA 3RRZA 5IG2A 1MNQA 3OO1A 3N8DA 1NXQA 4DSUA 4J9MA 1FPYA 2XNHA 4YIHA 1AK1A 3PD7A 1TEZA 3D3NA 3U0VA 3F71A 1GEEA 2GJ8A 4QZCA 1KH1A 4YAJA 5HHDG 4BOSC 4Q02A 3ZDXB 1U2GA 3U48A 2WZCA 2YWXA 3SPXA 4MWEA 5HCIA 4B40A 1SC4A 4ELVA 1J33A 3L3BA 3HBNA 1WU7A 1ZOPA 3FAZA 1PDWA 3FLEA 3SBXA 4QU0A 3LC7O 1ZQOA 2O06A 2A88A 2OVBA 3K9QO 3W5UA 4NH0A 2FEAA 4NZZA 1TCUA 3GMSA 3UAWA 2BPSA 1KBOA 1G6OA 4Z51A 3HACA 2H3EA 2XKAA 4KACA 4FT4A 5I7RA 1JYSA 2YMLA 2HMAA 2GNPA 1QLHA 3AULA 5K0EA 1NBOA 2KJ5A 4MB2A 1I36A 3HC7A 2H1RA 3WNBA 5AW9A 1G21A 2CHGA 3W2HA 4Q4HB 3NP7A 4ARCA 1Z2EA 1AU9A 3A9JA 3LCMA 4R8LA 2JFPA 2DBVO 2V4ZA 1FNUA 5E1OA 3KEMA 3T6KA 4JLKA 4GGOA 4H27A 4J9NA 3ZD9A 2SNIE 1OA1A 4UPEA 4BAZA 3ZV6A 1F2DA 1ZQUA 2EBUA 3REFA 3QFFA 4HDAA 4LXQA 2Q5OA 2ZZPB 5FV7A 1S2MA 1FDSA 1V1OA 2ZSDA 3AF0A 3EDRA 5GZ1A 1Z36A 1M0SA 5KHLB 2AN3A 3FHCB 1R4MA 2Q4OA 3OE7A 3GWGA 3U16A 3RUAA 4FCTA 3VR4D 1C1DB 5CXUA 4KRGA 4AF6A 4XFDA 3HM2A 1WMFA 5FTKA 3CF6R 1TUBA 4GMVA 5FP0A 1TZBA 1TLTA 4B4VA 2WF8A 3BIID 1E7PB 1GTZA 2JH8A 4GZLA 1VHTA 1JTFA 1DQSA 1U3FA 3OZFA 1PS0A 1KS2A 4QU9A 3HUIA 1TK3A 3CSUA 2IYVA 1IUPA 3MSXA 4EVQA 1T26A 5EMHA 2R4UA 4MRAA 4D5EA 4B9EA 1R6AA 1S6YA 3OTHA 2IHNA 2J0UB 1K6MA 1XNJA 2Q6LA 1PGXA 1P2BA 2A5JA 3TLBA 2YV5A 4E4RA 3BAZA 1V1PB 4KFUA 2CL7X 2AOTA 4DLRA 4G8BA 2XN9C 2WT9A 2WAYA 2GN9A 4H15A 4GZ6A 2FGJA 4ML3A 4ZI7B 1SIUA 3TFSA 5F1PA 2X15A 4BV9A 4XM1A 4WAUA 1U3UA 2HO4A 4RK5A 2NQ2C 2O23A 1A5RA 2JLVA 2IHBA 3GQVA 3V3XA 1HT0A 2OO7A 4MK4A 4OU4A 4BGIA 3HB5X 2QTBA 2QBYA 1D8YA 1W19A 3IP1A 1MHPA 3ACCA 4EA9A 4XX1A 1OLXA 4B71A 1ADFA 4I1UA 2FPGB 2QR5A 3COPA 3FMFA 4RNOA 1E1QD 4HWOA 1JIKA 2BGKA 5DK6A 2Q5CA 3S5JA 4U4AA 3IDZA 2XCQA 5DASA 1DI0A 2HA5A 2CS4A 1YULA 1M8KA 4QNMA 3SZ3A 1Y8ZA 1U0GA 1CUSA 1K7XB 1Z8HA 1ZKHA 1MC8A 4R9UC 4QZVA 2D0DA 4OI2A 2RRDA 5KSOA 1WX1A 3CIFA 3LCCA 4KAAA 4BMPB 2CFIA 3I2GA 4D5GA 1C3JA 3NM5A 3ES9A 5EE1A 3VTZA 4BRZA 1L7VC 4CF6A 1F0ZA 1R5BA 4EJ0A 2CR5A 4P0PA 2W6CX 3AVTA 2H00A 4OHPA 4IYJA 1ZPSA 2IU3A 2H4XA 3PTZA 4F4DA 3BMNB 1M1YA 1YASA 4NAMA 2OCBA 2GM4A 1JFTA 5A0VA 1FPQA 2GCEA 3OZXA 2H1IA 1XP8A 4P1BC 5BYRA 3IRVA 4OKIA 3IJEB 3HHPA 1ENOA 3MWFA 4QULA 4ISBA 1L6NA 5C1ZA 3AB8A 3RFCA 2VRCA 3IAM1 3A14A 1K6IA 3TRJA 4QBFA 3P2JA 4RQ3A 1ZXHA 2L17A 2AIRA 2GJ9A 5DPRA 1FFBA 4JUDX 1IAVA 2ID4A 5LN1A 1Z6GA 3N3AC 2R8ZA 2WNSA 3PLAE 2HAEA 5FWXB 1M72A 5LZ5A 1V3VA 5AKEA 4O0LA 5LUBA 1W5TA 4A2PA 3LFUA 4DFPA 3S2EA 3OIYA 2WTXA 3RO7A 4M46A 4KLQA 3AXSA 5REQA 2JFWA 1L5HA 3DMNA 4Z6EA 3PGA1 2QD1A 2W2NA 4DSFA 2Q3CA 3TEFA 4IVPA 4K0RA 3UGKA 3STWA 3LK6A 3WGHA 1Z82A 2FCRA 3SF0A 4ECVA 3EA6A 2JHAA 3MM4A 3NTUA 1FTGA 1V1JA 1U80A 4FFLA 1CD5A 4WE3A 5GTDA 3A1UA 4CIVA 4YAKA 1T5DX 4TMXA 1BWPA 1CUKA 5ECWA 3IPLA 4XASA 5LP6A 1NW4A 2YJ4A 2VHEA 3Q8XB 3A9CA 3WWCA 4MWCA 1GNQA 4F3RA 8MHTA 4G0QA 4MGHA 5J4YA 1O2DA 1OILA 2M9MA 1C7EA 4ZV4A 2VQ6A 1BAPA 5JO0A 2LP4Y 4B09A 4PGMA 3TWOA 3AKYA 5K0ZA 3GV0A 3F46A 4DWJA 2C92A 2CHFA 4FDTA 4MVCA 2G63A 4MKZA 3MMSA 1ETHA 1XZJA 4M9UA 4FEEA 4G1MB 1J99A 2BMWA 4YRLA 4C5AA 1MEEA 1M10A 1MDFA 4I55F 1SEVA 2HIGA 1MP0A 3CX7A 2JH3A 5B30A 2FK7A 1V5FA 1JXEA 3SICE 4AMUA 3B51X 4HVLA 4EI8A 2Y5CA 3AESA 1XRNA 5JZEB 1X3LA 1UDCA 4DYDA 4CLOB 4EEZA 3AEUB 3BF7A 3P7MA 3FDIA 4EJFA 3AHCA 3KETA 4A3SA 4BBPA 5EG5A 1YU9A 3RNCC 2QTCA 3O9MA 2EHDA 2WUWE 2LHTA 3R77A 3LF2A 1OUMA 2KJ9A 2V6FA 1PFGA 5J59A 2QZZA 4PIMA 4O3PA 3L0ZA 4RJTA 2D7CA 2GYUA 2WHRA 2MUTA 3HM6X 4E0BA 2ZQZA 4U2EA 4UU0A 4TTIA 2L32A 1U9YA 2FSPA 2H7VA 2OECA 1Z0AA 1OZAA 1D8BA 2Z5FA 2LCQA 2B92A 1J1ZA 1MRSA 4I9UA 3DFZA 4OG2A 2RAVA 1L5VA 3P9QA 4EA8A 4L0QA 3S44A 3H9QA 1JHZA 1V8BA 4I4CA 3O4HA 1IN5A 4P2BA 2ZWPA 1EVJA 4Q19A 2H2GA 3GUVA 5AVJA 2B6NA 3E3NA 1X3SA 1NDQA 1WZ0A 1AN0A 5JSQA 2GM3A 2KMMA 2R6JA 3L6BA 3KLMX 5EEHA 4JBXA 4HQFA 5C1OA 1W4CA 4M9NA 1QX3A 1O95C 5D3QA 4PC2A 3G9ZA 4EGQA 4REQB 1FSGA 2GB4A 5DBFA 3W2GA 4UPVA 3CZPA 1K0UA 2FETA 3Q3JA 1K51A 4GPAA 1I7PA 1RZTA 2QPTA 2A4MA 3OP1A 9ICCA 3ZHXA 2COKA 4HDCA 1AXEA 5A4KA 4HDMA 4PN7A 5ITSA 5C5IA 1QSGA 5CX4A 2E7ZA 3QLTA 3WLKX 4DC9A 2ZAIA 1WAMA 1UH5A 1ESNA 3VO1A 2PYDA 1AD2A 1O9HA 4XVCA 2AHRA 5AK3A 3AEEB 9ICOA 4B5LA 1N0HA 2C4HA 3CH5A 3KSBC 4IDDA 1YUMA 4PPXA 4YREA 3FLBA 5ECDA 2P9GA 4OHVA 5E2AA 4MVJA 4TOIA 5FBRB 5BMIA 8ICQA 1J8QA 2J3DA 3MJTA 1MGPA 3Q8QB 4TL7A 3F7TA 2WJIA 9ICTA 1AY0A 3FHLA 1T4GA 3ZCVA 4DDHA 1B16A 4B3FX 1T1JA 4WLOA 2HBZA 1LXCA 2SCUB 1PR9A 4M0DA 1OFGA 1FXWF 4RGOS 4INJA 2WIKA 2QN8A 4MS4A 2CBGA 1FJGB 4ATNA 1DX4A 1Q6YA 2ECFA 4P4TA 5AICA 4P54A 1XMVA 4E09A 3MGVA 1GT91 1NVTA 2NU6A 4MGKR 1SXHA 1U0RA 2V6GA 4QWDA 3WYAA 3RB8A 3K0CC 3WADA 3MGKA 2LIVA 1UBMS 3RAXA 1G64A 2PV7A 1O89A 5LQCA 2MMCA 2CUNA 3GDWA 2CF5A 3FY4A 4MVYA 5FKJA 3IV9A 4AX8A 1A7AA 4L50A 1D6SA 2RGAA 3RJTA 1PX0A 4LS3A 4KQWA 4EB0A 1KFKB 2HR1A 1DAMA 5F35A 1SZDA 3QUSA 1XO0A 4DV1B 2QKQA 4PQRA 3ZWQA 3JYOA 4F4KA 3ZCXA 4GU2A 4B87A 3UV3A 5TVKA 3Q8KA 3RS8A 2V4LA 1W9HA 5FA5A 3F6CA 4CG3A 1XO1A 3SR0A 3ISCA 1WP4A 3E8XA 3EGDB 5KOIA 4FHJA 2XQKA 2AW3A 2IPOA 1VHDA 2BZ0A 2DMRA 3SSAA 4KIJA 3U1TA 2IXEA 3WL7A 1H3EA 1TIFA 3H9UA 3C39A 3T4XA 4TX1A 1J2NA 4AECA 2X5OA 2AJLI 5C3JB 4R51A 2BFFA 4FOOA 2I7XA 3L4EA 4M22A 3KFVA 1YZ7A 1VGRA 3RRHA 1SZPA 3PITA 5TEWA 2PQMA 4XARA 3LDFA 4ZVLA 5JZOA 2ZYGA 3KJXA 4RW0A 2OVFA 1J1IA 1R00A 2QT9A 2FPOA 5HVNA 3ONDA 1R37A 2JRCA 1GG2A 1QHHB 2JLRA 5DIFA 4JA0A 4ARUA 4C14A 2FP4B 2QB0A 3AH7A 3NUZA 2BF4A 2PKRA 1G5FA 2X5NA 2CJFA 2MDTA 1WXGA 3WLEA 2XI9A 2WU2B 1ACCA 2AQIA 4JBHA 3OY2A 2X7XA 9ICIA 3UQZA 4ICVA 5EIWA 3NDBB 1WRBA 4BMVA 4LV6A 2VKQA 3UUEA 5DLFA 4V0LA 4CODB 1Z8FA 1CJKC 3AERB 4F1KA 3EHDA 2H5IA 2G0NA 2QVBA 2O5RA 3HM9A 3O4FA 4KI7A 2ORVA 5ERXA 4PZEA 1F8XA 4L08A 3ZNHB 4MACA 1OMOA 5K3FA 3INYA 4NNOA 3I05A 3GZFA 4PRLA 5GADl 1W8DA 4ZGWA 4HGRA 3BTVA 3Q88A 4ZEXA 5CT5A 5BXYA 4DMFA 2JFOA 4DREA 4K8RB 1KORA 1C4CA 4RTNA 4BZQA 3H1TA 2QM8A 5DU2A 4IJUA 4FQ5A 1IC6A 4K03A 2ZRHA 1ZUIA 3WRYA 2MRPA 1ZSVA 2PMBA 1NVUQ 1PJ8A 1RAHA