5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
3W8NA 5CIWA 2F6RA 2ZR7A 2OCYC 2ZQ5A 2O0HA 3W6OA 4WAUA 2XJ4A 2C9OA 1Z0DA 4D0NA 4UQOA 3QG5A 4FWIB 3ETLA 4PR0A 3UWKA 4J0QA 5J4VA 4E22A 4Q5IA 5FR2A 3SFVA 2C77A 5TB5A 1XJQA 3K53A 1AKEA 2VBCA 1FUUA 5CJ2A 5DSZA 1YRBA 1WDTA 2B8TA 4H9GA 4B32A 3KQNA 1YKSA 1Z6TA 3L43A 2IF2A 5A0FA 1CRPA 3TUJC 1VCOA 3GLIB 1TNDA 4JBYA 3M6AA 4JL8A 4DT1B 1IONA 1R2QA 2EWVA 3X1ZA 1L7VC 2ZSFA 5FOWA 1VYTA 2EWWA 4Q9IA 1OXTA 3EZ2A 1K8RA 4Q4HA 3REGA 3CONA 1P60A 3CWQA 3AEFB 4HLCA 1Q57A 3D6TB 3LWNA 4Q9LA 3PV0A 1VJKA 3CBQA 1WRBA 1ZIOA 1XO3A 1NMXA 5KSPA 1VHLA 5GJWC 2HJGA 1NP6A 3GJ4A 3HDTA 2ZS7A 2JJ2A 3DZDA 2R8RA 3B78A 3WBJA 4IXMA 1JR3A 1HV8A 4B34A 4DLRA 2FSGA 3FE2A 4MYTA 5DE3A 2QJLA 4F4JA 3LQRA 1RFKA 1XMVA 2FFAA 3BH0A 2WP9B 4EJSC 1ZVQA 2OG2A 1I2MA 3GEEA 2DY1A 4P0TA 4RCYA 3KXIA 4NONA 4RVCA 3JZMA 4YTMB 4IDOA 2WSSD 2DCUA 3MJRA 1YJJA 4LV8B 1RC8A 4MKFA 5JI3E 2HYIC 1CKEA 4G5RA 2XB2A 5EQTA 4LJ6A 1ZCBA 4OI1A 2QTHA 2F1JA 5FPYA 3L0SA 4DDUA 4C80A 4E07A 3EA5A 4IHQA 5GJBA 2QN6A 1G7RA 4C0QC 4GSYA 4OQLA 3AVTA 4Q4HB 5EZ5A 1R5OA 5FPTA 2CL7X 5FR1A 4NYJR 4S2EA 3RNLA 2M19A 3K09C 4PSAA 4PHHA 1KI9A 1VTKA 4EJSA 3T61A 1RRPA 2WJIA 4YMVA 5J47A 1LFDB 3BFVA 4I1VA 5K8UA 1S3SA 3DO6A 3P1MA 1N6PA 4LC1A 5CJPA 4OJKA 3I73A 2QAJA 1TEXA 3NIBA 4Q1EA 3RYTC 4JYCA 1OFUX 2C5LA 2AX5A 4DSUA 3TMKA 5E7IA 2O8BA 3CR8A 3K1JA 1W36C 2R2AA 2Y8EA 4I4LA 4LYFA 3AP1A 4KJZA 1AZTA 3OE7D 3P27A 2ZIAA 3NEYA 5DNYB 3CWIA 2ZAOA 1ZM4A 1UADA 4AC9A 4CEJA 2VA8A 4NMMA 1S9DA 3TNFA 1KDPA 1OH5A 2BMFA 1FTNA 3SFDB 1N0VC 1XTSA 2FSIA 3CIRB 2OXCA 3AVXA 1NBMA 1XTIA 1NVVQ 1P2SA 3TR5A 3PEUA 5L3RA 4XD7D 4C0BA 4R98A 4WA7A 4D0LB 4DB2A 2JJ2D 2H88B 1JR3D 4YTNB 5C46F 4A6XA 3QPWA 1Z28A 2CHVA 1VPLA 3B1VA 3C16C 2GCNA 4JT4A 4P4TA 4B33A 1N61A 1M7BA 2B8WA 2GJKA 3OAAD 4JVMA 4MRNA 2Q9BA 2QM7A 1R8QA 2ZYWX 1SVWA 2J7PD 2O8CA 1QG2A 3NC1C 3FC4A 2SHKA 1T4GA 4IJMA 3GQBA 1OIWA 1FRRA 2ATXA 2WDVB 2AN9A 1GNPA 3CB4A 4KVAA 4KSCA 3FMIA 5DHFA 4CZ2A 5JRJA 1MRSA 3RS5A 4BUJA 1N6NA 4A8JC 4FMBB 4DVGA 4NH0A 1XTJA 1ZUNB 2BMDA 1SVMA 1XEWY 3X1DA 1Z5ZA 2WJVA 2C95A 2A5YB 1GPXA 3ZIAD 5CDFE 1JWAD 3SHFA 4MGYR 5FOUA 4V0NA 3NBYC 4PC7A 1QVRA 2JIZD 4PFSA 1CR4A 2ONJA 3K70C 5LD2B 1CZPA 2NO0A 2PEYA 1ZRHA 3VX4A 2BV3A 1T8UA 4CEJB 1G3IA 1ZJ6A 1JECA 2CJNA 5SZJA 2H5EA 3A1SA 1ZP0B 5C2JB 1RYHA 5GVRA 3QOFA 2A2ZA 4QBHA 2WWWA 3A6PC 4DLUA 1G7TA 1WRIA 1GRRA 3CF2A 2HV8A 2YV5A 5P21A 1HE1C 4NCKA 1G4UR 4AKIA 4Q48A 4Y0AA 3RSLA 1ANKA 4GOXA 4OHZA 3JZAA 2VP0A 2G9NA 3FOZA 3DWGC 1E1QA 1FIQA 4AWXA 1QF6A 1G291 2J87A 2OLJA 4ZDIA 4TN1A 2GESA 4D4JA 1FFVA 1I2DA 1DGJA 2CXXA 4M21A 1QRAA 4X8MA 3GLIE 4E09A 1II8B 3THXA 5EP3A 4UNSA 1M7HA 1YVDA 5H8WA 3BK7A 4FMCB 2J46A 4BRUA 1JWBD 1WYGA 3DMNA 4YMTA 4B71A 1FZQA 1HA3A 3EZ9A 2LWIA 3V4FA 2ZS9A 3WMEA 3IPXA 3GD7A 1NKTA 2HXYA 4BRWA 4MRPA 3VNVA 2HDNB 2G1EA 4ACBA 2YWFA 2OEPA 4FI3C 5EE1A 1F6BA 4US0R 1BOFA 4DDVA 4DCTA 1T3QA 3ZVLA 3VMFA 1X8LA 3MD0A 4QGHA 3LDAA 4YMUA 1W46A 2PJZA 2WWXA 3UMSA 5DH9A 2KSQA 2EFCB 3LFUA 1TUEA 2AKAB 2HF8A 3KJIA 4LBWA 1NJFA 2WJGA 4M22A 1G5PA 5FFMA 3RHFA 2G1KA 1GFIA 4LBYA 2KAJA 4HUQA 1W4BA 1DG1G 1OXUA 2X77A 2OFWA 3SI7A 3T1TA 1CJVC 2FSFA 1DO0A 2QE7A 4D2IA 2PT5A 4I1OA 2ZRAA 4URUR 2IX3A 2A5JA 3U7HB 4BASA 3OEHA 3C41J 3SR6A 2IYUA 4BLRA 3U3JA 1E32A 1R4AA 3I4LA 2WDQB 4K46A 1T6NA 5J5CA 3VR4A 3LXXA 1ZNXA 3SHWA 2W0MA 4GT1A 4C0JA 1YR9A 4DCUA 2QP3A 1J90A 4ZIRA 5JI2E 2Q3FA 2FEOA 3DM5A 4DRZA 4JJZA 3THXB 5JWRA 2ODWA 1G3MA 3HVZA 1UKEA 2P67A 4B3GA 2G83A 1XLNA 3LVRE 3ND8A 2P5SA 1KO8A 3Q7QA 1G16A 3KX2A 1UJ2A 5ELXA 5AUPB 4JLMA 1EFTA 1DARA 4LX0A 1TKEA 3WHKA 4M9QA 1JBKA 4G5SA 3SQWA 4FWTA 4US8A 3TVDA 3EZ6A 3E5HA 4JX1C 1IM2A 2FE4A 5F9HA 1KI6A 1R7RA 2ZRJA 1DTSA 4LI0A 4LV6A 1XEWX 4GBMA 1JR3E 1Q3TA 4M2LA 4POAA 3AKEA 1EWYC 1GSIA 1M2OB 2CJWA 3HRDD 1E9EA 4HUQB 4B3DA 1KKLA 4FN5A 1Z6AA 521PA 2ZREA 2F3RA 4C3ZA 4D82A 2KBFA 1YZTA 2IC5A 2WOJA 2WOOA 2XAUA 2ZJ8A 4Q1DA 1E0AA 4U02A 1ZM2A 5JECA 4URXR 5EP2A 3L2OB 2V7QA 2QMOA 3B1WA 3AKDA 3KTAB 3NVZA 3NC0C 4D26A 1UBFA 2FV8A 1OF1A 1KK0A 2OAP1 3FKSA 3AP2A 2AHOA 2F43A 3QXXA 1S4QA 2W2TA 1C9KA 1U8ZA 3GJ7A 4OK5A 1NVWQ 2ZSAA 2IYSA 2YNMA 5D3MA 3UG6A 4CEHA 2ZR0A 1KI4A 4Q9KA 4YMSA 4DDTA 1G5TA 1N63A 2E9SA 5DGXA 1ZP6A 4BFXA 5CITA 4JIMA 1W4CA 3TSOA 1UDXA 4D80A 1FL9A 1OSNA 2FFQA 1EK0A 3WY9A 3I72A 3MUFA 4JLDA 3W90A 1E7PB 1COWA 1QHYA 4LV5B 1SVIA 4JLKA 1BS1A 3UWOA 4ZV4A 4OK6A 4OQMA 2VPPA 2OT3B 2WPDD 1ESNA 1L4YA 1P73A 4JYBA 2QAGA 2IS6A 3AECB 4G0NA 1MO5A 4O25A 3WP1B 1S9HA 3HJNA 4BZPA 5B57C 1E0SA 1E2EA 3I61A 1E9BA 2QGNA 2R6AA 1NBME 3JVUA 3UK6A 2XXAB 4OHWA 1F2TB 1UAAA 3T12A 2HF9A 4GDFA 1UFQA 2Q9CA 1CJKC 2XTZA 4HLDA 4M1SA 4LSGA 1QHXA 1PUTA 4WIAA 3NS1A 5K8LA 5DISB 1KKMA 5F2EA 3P63A 2QTVB 4UKDA 4PC2A 3H0KA 621PA 4RY2A 2VSOA 1JRPA 1SVSA 4OHVA 1E4VA 1KDOA 1WXQA 4AK9A 4PAMA 1HT2E 2JLQA 2NIPA 3PIRA 3FDIA 2P5TB 1NI3A 1E0KA 4MGKR 2G88A 4C0SA 4LJYA 1OFFA 3VU9B 4ZO4A 4S35A 3R8CA 5FUXA 3GLHA 4PQFA 3VKWA 4NYIQ 4I1SA 4JVLA 4HAWA 1QLBB 4PPQA 2EFEB 3QXJA 1YQ3B 1P7CA 4MH0R 3FKSD 3BBPA 2F1RA 3KXKA 1N60A 2QQ0A 1XEXA 1CR0A 4HLUC 4KSBA 4G5QA 5FI1B 3TUIC 3FAHA 5L3VA 3THWA 2QBYB 1RW4A 1W0KA 3PCRB 3AM9A 1CP2A 5DHAA 2W58A 4DXAA 3N70A 1I4TD 1TQDA 4QHSA 3P4SB 2ODNA 2AD5A 4C9BA 2GCOB 2A9KA 3BE4A 4C0KA 1PJRA 5F98A 2YHSA 3JVVA 1KGDA 1ZINA 2DFKB 3ZYYX 1KMHA 1AZSC 1E79A 2CNWD 2YOGA 4LDJA 1TKGA 2Z43A 3CZPA 3P4RB 4IRUB 4DLVA 1W5SA 4US9A 2GJ9A 5BYJA 4YT0B 2MJ3A 4Q66C 1FO4A 2Z83A 1BH2A 2O8DA 3B2GA 1GOTA 3DDCA 1G9XA 1X1SA 1GKUB 2AK3A 3W5UB 2D06A 4IOLA 4PHTA 2BM0A 3RRNA 1SQ5A 1Q44A 1KJWA 4KYUA 4AKHA 4TMKA 3G0HA 1XBTA 1CR2A 1KIMA 1U98A 2H92A 1E2LA 4Q00A 2GAAA 3DM9B 3WNDA 2IBMA 3AUXA 4JLOA 4PO9A 5KNCA 1HURA 1OIVA 1NVVR 4M1TA 1G64A 3K8YA 5GXGB 2X2FA 3U4QA 1RPZA 5JJIA 2OBNA 3CX7A 3AH8A 3O8DA 3CF0A 4LUCA 1VIAA 3CW2A 4JLJA 2VLIA 3PUZA 3VR8B 3CRVA 4XTRA 1E9DA 1OHHD 1OE0A 2RGXA 4LJ8A 1XWIA 3CNLA 3L8YA 3WYGA 1G21E 3HR7A 1J2JA 2QRZA 3GPLA 1ROEA 2N1BA 1AS2A 2IXFA 3RS3A 2EQBA 4MKHA 3SJAA 3NDBB 2WAXA 3SN6A 5IRCD 4AYTA 2OZEA 1NN1A 5E7JA 4N3NA 2D62A 4OYHA 1DVRA 3K9HA 4KBGA 1W1WA 4IW3B 3PEYA 1GILA 2BJWA 1NN3A 4CIDA 4MKGA 4BZXA 2H8KA 2VEDA 1RRGA 2F9MA 1E10A 1N25A 5AJWA 5IT5A 3ECCA 3W3ZB 3IGFA 2YWEA 2WWYA 4QNMA 1W0KD 2ASEA 2WBLC 5H92C 5M04A 3EPJA 3GP8A 1XPRA 2JLUA 1Q1BA 2IXGA 2ONKA 4Y0VA 3RC3A 1DEKA 2HLDA 2ZI9A 4ITKA 1Q0UA 4D4MA 3KL4A 4TSFA 2D7DA 1KAOA 2K22A 2ZRGA 1E79D 2O8FA 2DFNA 1F3OA 3BH6A 1KAGA 3A4LA 2IW3A 2ZEJA 3U4QB 1W48A 2ZJBA 2VP4A 4Z51A 4U00A 2W2XA 1VECA 3D7MA 5H68A 3QEJA 4CF7A 1KO4A 3S1AA 1OXSC 2UKDA 1N2CE 3T35A 2PH1A 1QOAA 1E0ZA 2WHXA 1NG9A 1KNXA 1VCNA 4HZIA 5EXXA 3AV8A 1X1RA 4ZHOA 2B7BA 2NO6A 2QA5A 1D6JA 2CHQA 1NG1A 2UZIR 3LX5A 3NVAA 2GXQA 1KDRA 4RFVA 5LPNA 5DLQC 5D3QA 3SZRA 2IS2A 3AEBB 1CS4C 4GL2A 4OI4A 4P6VF 1XD2A 3VX3A 4NDZA 1PFDA 3TSWA 5FTNA 2FJUA 1K6MA 4AYXA 1DAIA 1TUIA 1Z2CA 1N0UA 2X8AA 1S3GA 3GJ3A 1NVXQ 2V1XA 5AJVB 5FPHA 3BJIC 1P75A 3GFPA 2IYTA 3NKVA 5FOVA 4Z1MA 4DLYA 2V3CC 5IK2D 3O8CA 1EFRA 1N62A 1E2PA 1G6OA 3ASZA 1G41A 2VHUA 3MRSA 1QHSA 3CUEF 3VKGA 2IT1A 1N5KA 1GL7A 3X1WA 1NVUQ 3U44A 1OT3A 3MWLA 1A82A 3CO5A 4MRSA 3U3RA 2WWGA 3AUYA 4HB2A 2CBZA 4NTZA 3F5FA 1E2NA 2VP9A 4KCGA 2XEXA 5DN6D 3MJHA 3WHLA 2FGJA 1DOXA 4DSNA 5HCIA 5TY0A 2Q21A 4JZKA 1W7AA 4KFSA 4CVNA 5G5GA 3A4NA 4TWZA 2PL3A 3B60A 3I8SA 5FH9A 2P6RA 4PHGA 3MGCA 3PQCA 4WBSA 3AF0A 1ZU5A 2ZYTX 4UXJA 2ZI4A 2XNDA 3OZXA 5JFGA 3MFYA 2R65A 4LJ7A 4TSFD 4HSEA 3AE7B 4MITA 3X1YA 4DSOA 2IEZA 2IWRA 3B13B 3CH4B 1T5LA 1XD2B 1P2UA 1Y3AA 1AWDA 2ZJOA 4Q21A 1GKYA 2GF0A 3GCGA 3PFIA 4BFUA 1D9XA 4O0MA 3AV0B 2GILA 4BWYA 2CMKA 3CZQA 4B76A 4QXAA 1QOFA 1CULC 1T3SA 4X8HA 3WRXC 1OH6A 2QTFA 4HATA 3A1WA 2CU3A 4JS0A 4HB0A 3AMZA 2E3TA 2JJ1D 5CLQA 4KVGA 4IKEA 1Q3HA 4A6PA 1E69A 4HDOB 3U3MA 2D4HA 3C15C 4E03A 1P4SA 4MRVA 2PZFA 4Z8XA 2G77B 1UWMA 1KY2A 1SHZA 2PEZA 2JDID 3THYB 1N5XA 5KNBA 1E94E 2P2LA 4H1UA 3TE6A 3B8HA 3HYRA 1IOZA 2A3RA 2X1VA 3K9LA 4TMVA 3GLGB 1KI8A 1NF3A 1YR7A 2CLCX 2RAPA 3C8UA 3UPUA 4TT3A 4EKDA 1EFRD 1LS6A 4KAXA 4A0RA 2QI9C 3QKRB 3QBTA 4IDIA 4XVQA 4NCHA 1O87A 4ZOHC 3C14C 1ZUD2 2VIIA 4V03A 1NENB 2WQYB 3K0FB 3W8RA 2KB0A 3PVSA 1XCGB 2A7QA 5G40A 2QT0A 2ATVA 1BYIA 1CR1A 1KMQA 2QPTA 2RGDA 3GLHE 4GOKA 4Q02A 1S96A 1GAJA 1Z0FA 4KYIB 5G3YA 1WB9A 4RFSA 1CJTC 2Q3HA 2W6IA 1XJCA 1SXJA 1XDBA 4RSGA 1E1RA 1VG8A 2PZEA 4RJLA 5KHOC 5A5GA 2I1QA 3HWSA 1I4LD 1XMIA 2VH5R 4M1MA 3CH5A 2N0SB 3GMTA 1BKDR 4HZUA 3RABA 1ZXIA 1NYRA 1GP2A 2WIBA 2L83A 3BS4A 1FMLA 5JHHB 5JLJA 1PLJA 3Q5DA 4GOJA 1DELA 1M7GA 2AFHE 5AWFC 2ZUDA 2WJJA 2ZJZA 2B92A 4JSTA 3W5VB 3RS7A 4KO8A 1I4DD 3ZD6A 3C4JA 1CJEA 2WIAA 3KB1A 1FNNA 1E9AA 2C8VA 2XZPA 2GRJA 5EXPA 2BBOA 3AVYA 3K0AA 5C4GB 3FKQA 2J0SA 1W4AA 2GA8A 2H18A 4W5JA 3FVQA 3TAHA 3QXHA 1IXSB 1KSFX 1SVKA 4NYMQ 3HR8A 4USAA 2QSYA 4FIDA 4EPRA 5G53C 3NXSA 5LB4A 2A5FA 1PVOA 3ICQB 1L6VA 1XTRA 4UNNA 1YQTA 4YXWA 4CT5A 2PKOA 4YC7A 1OH7A 1T3LA 4RKEA 1LNZA 2BVNA 3QJYA 4D6PA 2YJTD 3KB2A 2OAQ1 4RZ2A 3IBYA 3DOFA 3ZZUA 3BIFA 4AI6A 2DFTA 5CIQA 1K5DA 1H8ED 1Z0KA 2WWFA 3F8TA 3RDPA 4A4DA 5HZHA 4QM6A 1AA9A 4GZLA 2JCSA 2C99A 4N0DA 3UKDA 1EXMA 5J40A 4CEIA 2AWNA 4TYYA 1DG3A 5KNDA 2N46A 4PZZA 4LWZA 4OHXA 2JLZA 1IHUA 4XSGA 4ESVA 1MO6A 1W44A 2D2EA 1J8MF 3LA6A 3ZVMA 5JCPA 1Z22A 5EE0A 1UM8A 3G82C 5TMPA 2IYYA 2W6ID 3O47A 4NYIR 3PR1A 5B64A 3AF3A 3P4PB 1O3YA 5FTLA 2QENA 2FFBA 1F2UA 4B6EA 3VHXA 1HQYE 2PCJA 4GPTA 4PTLA 4HEJA 5KSYA 1G3RA 1W47A 4NBSA 1GWNA 4ZI3A 2RGNC 4WZBE 4PZLA 2H1LA 1ZC4A 1ZIPA 3MAAC 3OIYA 4JLBA 3PITA 2XGJA 4HLQB 2A30A 1Z6GA 3ZS9A 4IXNA 5FUVA 2BT6A 3K09A 3L0PA 3KUCA 2ZETA 1WA5A 4P4UA 3WBKA 1KK1A 3TW4A 1G18A 1TPZA 3VTKA 2DHRA 1P62B 1FNMA 4CEIB 1Q1EA 3LBHA 3W6NA 1ZM3A 4IDQA 2RH5A 4EDHA 5HE9A 1JJVA 2WU5B 2EU8A 1QDEA 1J70A 4YXWD 3EUB2 4A2WA 5KDDA 4MKIA 3LO5A 1RRFA 2Q5WD 2HT1A 4ZDWA 3TGPA 5CYPA 2WS3B 2CDNA 4GRAA 4RD2A 5HTKA 3EARA 5JRZA 4WVFA 1IJFA 4EJSB 4DWJA 1F2UB 2IUUA 4K8OA 4N59A 3CWZA 4LYJA 4WW0A 2B6HA 2PVGC 1S8FA 2IYQA 3MWKA 1P61B 2BMEA 2JA1A 4AG5A 1YQ4B 1HTWA 3AM1A 1FQJA 3NEJA 5LB2A 3QG1A 2O8BB 2HCJB 1ZD9A 1XRJA 2H57A 3B82A 4YSZB 5E7MA 2FPKA 4QHYA 4DCNA 1V97A 4B3CA 4EFMA 1QHGA 4PAOA 3DWMA 3RRZA 4LK2A 2VL7A 4KLZA 3MWJA 1CBUA 1BMFA 3AEGB 2YZ2A 3GFTA 3GLGE 4OK3A 1XMJA 5AJYA 1EWRA 2C96A 4YDSA 3CR7A 2GJ8A 4KFRA 2OM2A 3UANA 4C7OA 1KI7A 2AXNA 4URZR 2ACZB 3B9QA 1JB1A 4OI2A 3LBIA 5JJKA 4Q1AA 3K0SA 3U3KA 1KFYB 3REFA 4A8JA 3OEEA 1A7JA 1FTSA 4EPXA 4Q7LA 3QF4A 3OIWA 3AB5A 4NCJA 1G7CA 1XTKA 4M4SA 5JWOA 3A58B 1B9RA 4EUNA 4JKYA 1U9IC 1KF6B 3PG5A 4YDHB 4IVPA 2O8CB 1NBMD 1P9RA 3N2EA 1E2KA 3QQ5A 4UNPA 4A0GA 4TQAA 1YJIA 2FF7A 1VMAA 2G3YA 4AY2A 2IYZA 4ON9A 5A4JA 4MDEA 2DB3A 2ZSBA 2ZRPA 5HKKA 1TU4A 2AXPA 3B9JA 1Q21A 2FG5A 3UXMA 4A9AA 1U0LA 1XCPA 3BRWD 2ZANA 1DAFA 1DAHA 2YWHA 1FFHA 1W36D 2L0XA 2RHDA 1U2RA 3SYKA 2R6GA 3I62A 2CL6X 3BXZA 1XFAA 1AN0A 2JLSA 3W5JA 3B2FA 1R8SA 1GL6A 5DIFA 2QG6A 1TQ6A 1V43A 3MG9A 3F0TA 1K5GA 5DYGA 2CE7A 4LRWA 4D25A 2XSZA 1TF2A 2HJVA 2R6CA 2GCPA 4JJKA 4DB4A 1F0ZA 3VRAB 2ZRDA 3I3SR 1RJ9A 5E4FA 3OIUA 1IJEA 4HDCA 4PC1A 2I4IA 3A36A 1C4OA 1FOEB 1XMSA 3E1SA 2P65A 3CPJB 1UF9A 4B2IA 4TTRA 5C4MA 2V8OA 3SR0A 2ERYA 1GIAA 1BMFD 4Q4AA 3BWDD 4QHTA 4B3XA 4DLZA 4UXIA 1SXJE 4TQUS 4V0MA 2PIAA 3QBVA 1ZD1A 4G01B 1HYQA 3X2SA 1OKKA 1M34E 1P6XA 4PC6A 4Q47A 3D3QA 3KWLA 1U8AA 4D81A 1A2BA 2VP5A 2EKIA 1HEIA 3AE6B 2OLKA 3M0EA 2F55A 2BIFA 3BFKA 3OIVA 2GWHA 1XNJA 1KI1A 1E1QD 3ZDQA 3I8XA 2QNRA 3K70D 1YZKA 1PDXA 2JLRA 4L5BA 1D2EA 5B58C 3BOSA 1W0JA 3QUSA 4TL7A 4DIDA 1II9A 2QY9A 3GJ5A 3P1JA 4CW7A 2BBTA 2CEAA 1A5TA 2PLFA 4QJ5A 2IUTA 4B48A 4BFSA 3QSYA 4ZI2A 1DPFA 4A82A 1GNRA 4KBFA 1L2TA 4C7ZA 3TK1A 3H86A 1OQRA 4DHEA 4OBEA 4MYHA 4IDNA 2ZUBA 5L3QA 3RWMB 3KQHA 1OW3B 3Q9LA 3SJZA 4MYCA 1Z3IX 3ZS8A 2ZS8A 2BJVA 5CK5A 2MSDB 2FPMA 2YC4C 4PPFA 2WJYA 3IDQA 4A0FA 3H2YA 1E9CA 1T9HA 4MQBA 3SBDA 1CU1A 4LHXA 1KK3A 1MOZA 4ZIRB 3BB3A 4LJ9A 3ABVB 5BW8A 4OQNA 1VKJA 3B5JA 2GK7A 2W00A 1MABA 2BMJA 2QE7D 4B43A 1TU3A 3B7GA 4CYMA 4HAXA 1VYUA 2ZJ5A 4EPVA 3BERA 4TL9A 2J0VA 1OLOA 3HP1A 3OEHD 4RD6A 1ZM9A 2JX5A 2J0UA 1NEKB 3AEAB 2OSBA 2ZRKA 3R20A 2XZOA 2B7CA 4LPSA 1GUAA 4GNKA 3ZQ6A 1JXOA 3D31A 5JCZA 1EWQA 1T91A 1GM5A 2AWOA 1KI6B 1D2NA 1KSHA 1M1YE 1DAGA 4LBZA 1JQ4A 4K81B 3TW8B 2WMNB 4TYNA 1BIFA 1NN0A 4DLXA 2VQSA 2XX3A 4AIIA 2DWOA 3VR9B 2BOVA 1G3UA 1P2TA 2CJWB 1B23P 1RWSA 4ZDKA 4R7ZA 2DWPA 2XJ9A 1UEIA 2CVFA 3PUWA 4P31A 3AQ4A 1PUIA 4D0GA 4TZ6A 1R7SA 1N5WA 1EFUA 3EZ7A 2ZM5A 1C1YA 1GNQA 2KMMA 1GVNB 2IYXA 3N2IA 5GJCA 1W0JD 4NPHA 2OE2A 1GZSA 5TARA 2X2EA 3OESA 2NMVA 5AUNB 3HUIA 1MR3F 3KJHA 1OFHA 4NYMR 3L8ZA 5IHPA 4PO1A 2BCGY 3SC3A 3QI2A 4NKRA 1LVGA 3IHWA 2FDCA 1EESA 1L0VB 1JEDA 3CRRA 2F43B 4LJ4A 4V02A 2CCJA 2FX3A 1SGWA 2RGAA 1MABB 2DFLA 4IOMA 1SVOA 2W2VA 1XLOA 1RYFA 2QIEB 1G8FA 5CB6A 5D3MB 3IHLA 4F91B 4CEHB 4QGGA 5B30A 6Q21A 4NCNA 3NBXX 2V7QD 2VP2A 4C0LA 3ONWA 2ZU0C 2WTUA 1HY3A 1ZAKA 1G8PA 2IYRA 4AKEA 3GJXC 3I5XA 4BFYA 2ZRBA 2VRWA 2E87A 5GADl 4CDGA 1U81A 1LB1B 4WZAE 2ZJAA 3VR2A 5AR1A 4EPTA 2ZI3A 5B2ZA 4JWSC 1AS0A 1D9ZA 3U3OA 3NRZA 2QAGB 2JJ8A 2ORIA 3KJGA 5EXSA 3VRBB 2D2FA 5KDLA 2FN4A 3HYTA 2AR7A 3OF5A 1E96A 2ZYUX 5J4KA 2C98A 1KTVA 2VSXA 1YHNA 5CK4A 4GI7A 2JLXA 3T5DA 1FP7A 1COWD 4HI0E 2CLSA 1II0A 2A5GA 2ZROA 2JEOA 5IDVA 3SJCA 1ETUA 1KI2A 3DL0A 2PX3A 5E3HA 2IS1A 3NHAA 1W2GA 3AN1A 5FTMA 4B2LA 1J7BA 1AQUA 1Q12A 3QXCA 1ZNZA 3AF4A 4HLUA 3FTQA 1MO3A 1L4UA 2Q9AA 4TLEA 3KKMA 3T5GA 3QXSA 4XJXA 1VG0B 2Q0HA 5JEEA 4I81A 5JWHA 2XOKA 3M4YA 3WP0A 4W7SA 3T06B 2YWGA 2XTMA 2PZGA 1JPJA 3EPLA 3LLMA 2LEKA 2WICA 3NH6A 1DBSA 3U7FB 1V8CA 3GLHB 3AVPA 1Z07A 1CJMA 1NSFA 4TZ0A 2ZUCA 2DYKA 2IXEA 1NL3A 2GK6A 2VSFA 1YZLA 1TX4B 3AE1B 1UEJA 2AX4A 1XEXB 421PA 3THWB 3KXLA 1LY1A 1N3BA 2N42A 2NO1A 4ZKDA 4BFWA 2PCLA 1KJZA 2QEQA 3CM0A 4M1OA 2QU8A 4NHOA 2GAOA 3BH7A 1DAMA 4ERNA 2OCBA 2BEKA 4KFTA 1EX6A 1OXVA 4JBWA 1WQ1R 1E4YA 2D3WA 1XCMA 2HCBA 2C03A 1JAIA 1KMHB 1XLQA 2EFHB 2ANCA 4M8NE 5FUWA 4URWR 5AUKA 3GJ0A 4B75A 2LCFA 4QBGB 4IVQA 2ZITA 3G5UA 4O2LA 1FP6A 3BGWA 4PPGA 4PSKA 1DAEA 1QHHA 2NOAA 1WCV1 4FW9A 4RZXA 1UDWA 3L4PA 1OYWA 2O8DB 3R7WA 3ZVRA 3OFNA 2JLVA 1Y63A 4EFNA 2QORA 4LCBA 4BLOA 2K9XA 3IQWA 1N5IA 2IK8A 1FM0D 4TLCA 4ARZA 1OQQA 2IEYA 2NGRA 4OHYA 1U0HC 2Z5FA 3A37A 2VHTA 2GNOA 1GRNA 2G0TA 2Q3MA 2W3SA 4RZUA 1VLBA 3KQKA 3SQXA 3AE9B 3BB1A 5HR5A 5C3JB 2V6IA 5FPKA 3ETRA 2VHJA 3LXFA 2WMOB 4A15A 1SB3C 4OI0A 4IOKA 4EQ6A 2CL0X 3TRFA 4O3MA 2V54A 1N6HA 4B35A 2J9RA 5HCNA 1N6OA 2NQ2C 5CYOA 3ZZTA 1W49A 4P32A 5FTKA 4F93B 3ADKA 2M56B 4PAQA 3P4YA 4MGZR 2C9YA 3SFEB 4JBXA 1U0JA 2QQEA 1J7AA 3W6PA 3W9YA 3FFBA 1LV7A 3AP3A 3CRW1 4AKGA 3Q3JB 1RYJA 2ZVPX 3IO5A 2GJSA 3EWSA 5KUTA 1WBDA 2WKQA 4QNRA 2V4ZA 4N58A 1TL7C 2K5UA 1TQ4A 3EZFA 1YJ5A 3ZJYA 2D7CA 5FOXA 1IUEA 2ODEA 3E70C 2AFIE 2ZSEA 3A8TA 4XVRA 4C0HA 3ZLJA 1NN5A 2VHCA 1DAKA 3ASYA 3NHBA 4LJ5A 1FX0A 2ZR9A 4KHZA 4YTPB 2V55B 4A92A 1Z63A 2BS3B 3B1ZA 3UIEA 721PA 1KO7A 2O8FB 5C18A 1XF9A 4FCVA 4ASUA 5LDDC 1TJEA 4A1FA 4JSYA 1YR8A 2GXUA 2ZE7A 3I5YA 1Q20A 4Q1CA 2VO1A 1S1CA 4GMXA 3NTUA 3QPVA 2CE2X 2ZYVX 3S1AB 4WQMA 3RAPR 3Q85A 2DBYA 2ZRMA 2F3TA 1U94A 2H17A 2QP4A 2ZRNA 2HLDD 4KI0A 2BS4B 1JNYA 1HUQA 3PENA 4DJTA 1FFUA 2QPAA 2JASA 1W4RA 4WWMA 5JZVA 1XPOA 2XTNA 4JVNA 1MO4A 1E2QA 2PLRA 1TTTA 2BKUA 2GBLC 1BO6A 5KU1A 4V0KA 3UG7A 1QHIA 4YXDB 5FBLB 3QKUA 1IN8A 5EJEA 1VYVA 2VYFA 2IL1A 3U7EB 1M74A 3K0CC 4BE7B 4R2HA 4DUGA 2R6DA 1XZPA 3H4MA 2WSMA 3QPUA 4LPKA 3PUXA 3SE0A 2JLYA 1T0JB 4B44A 4QM7A 1Z6YA 2CCKA 2JAQA 1Z0AA 5FL7D 5G3ZA 1P9NA 2RGGA 3FB4A 5G41A 4B3BA 5EE5B 4FXPA 3U44B 4TYWA 1YE8A 3TQCA 3UMFA 1E2FA 3ICEA 3AGPA 4Q4LA 1IN4A 3CNOA 5EZ6B 4ACAA 1FX0B 4BFVA 4XH9B 4AD8A 3AF1A 1T3HA 3L0OA 3LRPA 2IYWA 4HB4A 4Q01A 5EP1A 1FW6A 4XSHA 1HE8B 2GBLA 4L9WA 4EFLA 1OPXA 4DT1A 4Z1MD 2A5DA 3AGQA 2C78A 2CHGA 3KZ1E 1TYGB 1S1MA 2FSHA 3QIAA 4II7A 5BWMA 1MH1A 2Y5CA 4JLNA 3LXRA 4YMWA 2KWIA 4TTPA 2K5PA 3A1TA 2ZSDA 4BLSA 1A70A 4TLAA 3UMRA 1KI3A 4BPBA 3WXMA 4XWOA 2ERXA 3HU1A 2CLDX 4AG6A 1OV4A 2V6JA 2I3BA 3U5ZB 3FGNA 4ASUD 2QM8A 1Z08A 2C04A 2W3RA 1KK2A 1QOGA 3A1VA 3I32A 3IUYA 3GLFA 2ZJYA 2ZE5A 1WWTA 4N1AA 1QF9A 2IYVA 2Z4SA 2OCAA 4G1UC 1M6NA 3EW9A 1HT1E 4M53A 3SS8A 2NO7A 2XNDD 4MUAA 1G3QA 3QNUA 1QHNA 2RGEA 3IQXA 1UKZA 1Q1QA 3F3YA 4CT4B 3LLUA 4DLWA 3QVVA 4TMWA 1Z0IA 1CLUA 3EIEA 2OCPA 2ZAMA 3QKTA 3NG1A 5FL7A 1CF4A 3KUDA 3LNCA 2QROA 4A0HA 1FUKA 3CPHA 2D74A 4ZHPA 1HQCA 1XJ0A 3CPEA 4DUGD 5GVSA 3VNUA 2GTPA 4B47A 1T0HB 3H84A 1UBGA 2WM9B 3OE7A 1DO2A 1NSTA 2J7KA 5SZIA 2WV9A 3TBKA 1ODFA 2BKEA 2GKSA 4TQ9A 3R9IA 1T8TA 4YONB 5JMTA 1MKYA 3P26A 1QZXA 4QJ4A 1F5NA 3FFAA 5KYKA 1WMSA 1G8HA 4RFSB 4XD7A 2HXSA 2OUKA 1WF3A 1SXJB 2G6BA 4I99A 3LW7A 3T1VA 4Q7JB 4EPYA 2DR3A 2O0JA 5BN3A 4TT3D 1MRNA 1N6KA 2AD1A 2UZ3A 1ZD8A 4JKIA 3GLFB 1TF5A 4HZUB 1A1VA 3AVWA 3RS2A 4LTUA 4GZMA 2J0QA 1JI0A 2CCGA 1N5JA 3FPAA 5K8TA 3OAAA 4BLTA 3I92A 1YR6A 3TIFA 4X8OA 3CNNA 1JAHA 2J7PA 4OKSA 1E2DA 1ZNWA 3LX8A 3ZGXA 2NPFA 4YSXB 1J7KA 2OXRA 1NVID 1Z6XA 4PPNA 1ELOA 1ZW6A 1SXJD 4IVRA 4LC0A 1SHKA 1X6VA 1E1RD 2EVWX 4MGIR 2RGCA 4Q9HA 3AVQA 3K0AB 3PO0A 1TF7A 1DOYA 1GKIA 1ZUIA 1XPUA 2OV2A 1G5RA 2ZPTX 1FXIA 4M1KA 4XIGS 4RD4A 2NPIA 1ZYUA 1OH8A 4TMXA 1E2MA 1J7CA 3SYNA 2OFXA 1XX6A 5LD2C 3TKLA 3BFXA 3EG5A 1AIPA 4MUBA 3ZIAA 5JEDA 2YKGA 4KFUA 4KXFB 3MCAA 2ZTSA 4KV9A 5KTYA 4DZZA 2O52A 3DVLA 1GL9B 2JIZA 1U90A 4R2IA 2MSCB 1N6IA 4KX6B 1W5TA 2OHFA 4EIWA 4JMPA 3R8FA 2REXB 4NE2A 4GFDA 4R71A 2RGBA 3J81k 5BN5A 821PA 2VP6A 4W9MC 4F92B 5BQ5A 3WYAA 1IY2A 1MT0A 1R0ZA 3E2IA 4ZCLA 5F3WB 2HYDA 2IHBA 3GEIA 4NU0A 4Z8YA 2RGNA 3EXAA 2FZLA 3MWYW 2ZI6A 5EP4A 1FQKA 2W0SA 5GJVC 3THOA 3LY5A 3ZZ0A 1NMZA 1IY1A 1ESMA 2FZ4A 2JLWA 5CM9C 3IIJA 3T1OA 1WBBA 5FBQB 4RKFA 2WLBA 2PMKA 1QOBA 2MJDA 4IFEA 3IEVA 3LQQA 1OFTA 1VDZA 4HUTA 2ANBA 2V9PA 5SZKB 1RRCA 1JXMA 2H16A 3PEWA 2HUPA 4O2RA 5FBWB 5HPYB 1KO1A 5IF9A 3AE5B 2NG1A 4AYWA 2R62A 3QY0A 1AQYA 2QT1A 1KHTA 1XLPA 3RS0A 5FPSA 4V0OA 1PUJA 1UPTA 5DYIA 3ZD7A 1G8YA 1Z29A 3QENA 1NIJA 4P4SA 4QOSA 5J4HA 4PXAA 2FH5B 4QG7A 1E2IA 1R5NA 1I7HA 1ZUHA 2ZRHA 3EC2A 1II8A 2QZ4A 1KJYA 4QRHA 4BLQA 3RPFC 1X8KA 4DCSA 1G17A 4PHFA 5F9FA 1NMYA 2C9CA 3AE3B 1E6CA 1DOAA 3KKPA 2VTKA 1R0YA 1AKYA 2OBMA 4C4PA 5TXGA 4G3XA 2DWQA 1G1MA 4LHYA 2UVQA 1GG2A 221PA 2A78A 4FD2A 1Z06A 3KFVA 4DDWA 1XD8A 1CRQA 2ZRCA 1W36B 3RSOA 4DSTA 3P4QB 4YQFA 3SFZA 2G0NA 3RWOA 5DO9A 1L5PA 2GF9A 4ESHA 3P32A 4D4LA 1ZCAA 2OBLA 4U5XA 4LZZA 2LKDA 3EWAA 1OXXK 3KKQA 1EFCA 2REOA 1E2JA 1IXRC 2TMKA 2Z4RA 3Q5EA 1LW7A 1IXZA 4PQYA 1SF0A 2ZRLA 1XU4A 1JEEA 1PLLA 4HYYA 5H8YE 2XB4A 2G1JA 1L6UA 2OFOA 1A2KC 1JR6A 3RRYA 2REBA 4JL6A 3CRQA 3RRMA 3CLVA 1XEFA 3AKCA 3QF7A 3L82B 1NJGA 4A2QA 1KSGA 1H8HA 3C7KA 5KPDA 1NLYA 5TV2A 4P4SB 2ZE8A 3SBEA 3RC8A 1U9IA 2FGKA 4FMDF 4IDPA 4FCWA 4JL5A 2KI5A 4Q4JA 3DHWC 3AE4B 1ZOYB 4IEEA 2WKRA 4JT2A 2XZLA 1XXHA 2GETA 4ILEA 2YVUA 3TJZA 1ZNYA 2R9VA 4RD3A 2C2HA 4DBLC 4XVUA 4C7OB 2RKOA 4ZPXA 1KSJA 2XITA 4TTQA 2WKPA 4BECA 3RLFA 4A8JB 1KRHA 3KJEA 3NDPA 1RFLA 3FYHA 4GP6A 1IN7A 3AKYA 4HAVA 2NZJA 4GP7A 3QF4B 1LF5A 4PC3A 2RCNA 5AUOB 4JLPA 1E9FA 3M1IA 3EASA 1AM4D 2WAYA 3K70B 2J5XA 2F1HA 1ONBA 1Q22A 3FWYA 2ZRIA 3LAWA 3GLFE 3PUYA 5G5HA 3O8RA 5MPOA 1RVDA 1YU9A 2AK2A 2JATA 3WNBA 4DEXA 1Z2AA 4NCIA 4WOPA 1P5ZB 3RS4A 4Q1FA 5FBRB 3OEED 2F9LA 1YZGA 3U60B 1RZ3A 2IS4A 3QVUA 2RMKA 5EUMA 2NO9A 2P6UA 2IYLD 3B1YA 1DE0A 2ZI7A 4B74A 1KYIA 3QEOA 3NBFA 3NH9A 1KNQA 3AEEB 1G8GA 2KBEA 4QBIA 3ADBA 4V0LA 2IWHA 4Q7MB 3VQTA 4B6FA 1SKYB 4DIEA 3U7GA 4OQXA 5C1BA 2BBSA 2IUSA 3A4MA 4WXRA 1GRQA 3KTAA 1JQLB 3IILA 3LW8A 1UBCA 1KO5A 4JLVA 5FOTA 5FUYA 2P3SA 5L8VA 1IAQA 3ZYCA 3SJBA 2HTME 2BWJA 4TLDA 5HKKD 2NZ8A 3KKOA 4Q4JB 4WXPA 2I1VB 2W55A 1YZUA 2Z6VA 2ZE6A 1SIJA 1XXHB 3GJ6A 3SDZA 1VDVA 1RJ9B 2IA5A 4Q19A 1QVAA 4TL6A 2WPDA 2GEUA 2H89B 4F4CA 3KQUA 3SOPA 3A1UA 3WNCA 1GDDA 1H8HD 2EYUA 5CLLA 3LV8A 5JBQA 1CJUC 3GFOA 4YSYB 4Q4AB 2QRNA 2XSZD 1FRDA 2HT6A 5EE9A 4F38A 1KDTA 1KOFA 4IDHA 1X8JA 2ZJ2A 1R0WA 2BS2B 1JROA 1PV4A 5FBVB 3BD9A 4L8GA 4LGMA 3L0IB 3C5CA 3TVTA 4UJ3A 4UNRA 1G4AE 2OO7A 1LF0A 1NLFA 4TL8A 3B85A 4RZ3A 2GXSA 3LBNA 1ZU4A 4L4UA 3U61B 3HU3A 1VCIA 3V00A 3TLXA 2FEMA 2ZRFA 2XXAA 1PLKA 1F2TA 4AURA 1X3SA 2QGZA 2MMGA 4QBFA 3AE2B 2W6JA 5KSZA 3RVBA 1BYUA 2VF7A 4KODA 4XWKA 1IY0A 5AUIA 5AJZA 4FXCA 3U2QA 1GTVA 3UATA 1OKKD 2EYQA 2FA9A 4Q7KA 1ZC3A 2BCJQ 2EFDB 3NBZC 4ITRC 2QAGC 2GZHA 5AK0A 1UKVY 1J8YF 1JQJC 4OL0A 2J41A 5ANRB 1NKSA 5LBIA 4BFZA 4QKQA 1UKYA 2F7SA 3VU9A 3IKJA 1RM6C 3K0EA 1YZQA 1Z83A 3KKNA 4PZYA 3AVUA 2WDRB 5L3QB 1EGAA 1PZNA 1R6BX 3IBGA 4C0AC 2IF0A 2QP9X 5KDOA 5JSZA 4PSVA 2CNWA 1V5WA 4JWUC 2QL6A 1P9WA 4IOJA 1GAQB 1XB2A 2W83A 2H7VA 4Z54A 2WVJA 4QGAA 4DEYA 2QBYA 4DLTA 1M8PA 2E1RA 3LVQE 3K9GA 1NRJB 3SEAA 1E9MA 3EIQA 4BEJA 4XTCS 5J4LA 1IN6A 5J4YA 2F1IA 1G6HA 1T5IA 3BIID 2GCOA 2GZDA 1NLZA 4UNQA 4ZCMA 1VCMA 3MSXA 5FOSA 1OFIA 3EX7C 1NY6A 4N6EB 2QMHA 4MA4A 5FTJA 2FOLA 4BEBA 4EPWA 1OYYA 1R5BA 2EFGA 2R44A 3DMDA 3VR6A 2J0UB 4F4IA 2WJHA 2Z0MA 1AGRA 4FINA 4PX9A 3FHCB 2CK3A 2HEIA 3NVWA 2GHIA 4RD0A 4L9SA 1WE2A 3B1XA 3TAUA 3D8BA 3AH7A 1NYQA 3AEDB 3X1XA 5BN4A 1TADA 3DPUA 4DCVA 3SYLA 1DADA 121PA 1JJ7A 2JGNA 1OHHA 5EXTA 3DOEA 3R9XA 3AE8B 2P0EA 2WZQA 1SULA 1OIXA 4X8LA 4Q9JA 3BC1A 3BORA 4MYUA 3V4RA 3MLEA 3H1TA 3ND9A 4HRSA 4NYJQ 3T15A 1FPMA 1Z8FA 2BDTA 4IEIA 5DI3A 2QUZA 2W6JD 1OB5A 1EG7A 3FMOB 4Q03A 1LTQA 3VKHA 4XOIA 4HROA 4Q1BA 3ADDA 5JSZB 1G7SA 2J59A 4US2R 3RANA 3CRMA 3I1FA 4HAYA 5KO2A 1TKYA 3WRYC 1US8A 2FFHA 3DEFA 2B76B 3LH5A 4KITB 1P3JA 4TYQA 1G20E 5L3SA 1KY3A 3CIOA 3FMPB 1P72A 4TMTA 4HB3A 3TUZC 2GZAA 1QT9A 3KFXA 2GDJA 2YOHA 1VHTA 2PVOD 4LOAA 2ECKA 3B6EA 1F48A 3CX8A 4FCTA 4ZCIA 3HPRA 3WMFA 2QMUA 2XNSA 3EPHA 3NVVA 1TMKA 4IFBA 4LY6A 1JPNA 1X86B 1E99A 1WP9A 2AKYA 2KE5A 4QJ3A 3PJRA 1SVLA 1NNEA 1CIPA 4UJ5A 1XD9A 2BBWA 4PANA 4C2TA 3BAFA 5HE8A 4RD1A 2ODBA 1NIPA 2R6FA 1S2MA 1ZBDA 1E6EB 3KDSE 1VG9B 4QFMA 4M9ZA 2ZVQX 4B73A 2JQRB 2EW1A 1E0JA 2GVZC 3CKLA 4C2UA 1HH4A 1D8TA 3CX6A 2X19A 4I1UA 1VG1A 1TQ2A 2RB4A 4BZQA 1SKYE 2FU5C 2GJAA 4LJAA 3WYFA 2YC2C 5JJLA 4KLNA 1CEEA 1AK2A 2GEVA 2MMCA 4TMZA 2MJEA 4LHWA 2WWHA 5DI3B 4UXHA 2CK3D 1E9SA 2KJQA 4Q18A 2V1UA 4G5GA 1KZGB 3VFDA 2O8EA 4D4KA 3ZH9B 3BB4A 1XXHE 3C5HA 2BEJA 5BXQC 3Q7PA 1E98A 2FBWB 2PBRA 4LHZA 3P4XA 4ABYA 3U6BA 1US8B 3IIMA 4W5HA 1Q1ZA 5IK2A 1H65A 2FWRA 5L3SB 4M9XA 1A4RA 4M9SA 4MRRA 4BLPA 5HZKA 3TH5A 2GXAA 1FMJA 2BM1A 4ZDJA 2CJOA 1U8YA 3IEUA 3ZVNA 2YYZA 2BC9A 3LD9A 1RE0A 5KOYA 4L15A 3SNHA 1TEVA 4C30A 3U6KA 2MH7A 4V0ME 4JVSB 3W5IA 4YLGA 3EAQA 2ZXUA 5DN6A 3IIKA 5JS7A 5DI9A 2BHRA 2AL7A 4NP6A 1R0XA 4CGZA 1AS3A 4FMDB 3Q72A 2QMEA 2QPOA 4M1YA 2FNAA 5KSOA 4QL3A 1N0WA 3DKPA 1IN5A 3B9PA 4P3YA 2Q6TA 4M0LA 1IBRA 3P20A 4OQFA 1AYFA 3FHTA 1FXAA 4F7WA 2B21A 1N6LA 1B0UA 2GVDC 4WZ6A 3VHLB 2FPLA 4DC9A 4LBVA 2XOKD 1XP8A 5K8IA 2FMXA 3B2EA 4LYAA 5TDHA 1FMAD 3VR1A 4LYHA 3R9WA 4URYR 3DKVA 3ZQJA 3VR3A 4W5WA 1JW9D 3NVYA 1IQPA 2O8EB 2NTYC 3AF2A 3WCQA 3FHOA 5CM8B 2PX0A 1CXZA 3QE0A 5KPJA 1KZ7B 2W54A 1E9RA 2DPXA 5EE3A 2WWIA 1QHHB 3AEZA 5JHGB 3EA0A 4TYPA 1E3MA 3SU8A 5C2TB 1E2GA 4URVR 4PO8A 4TLBA 3R7WB 1AJEA 3CF6R 1CTQA 1RKBA 2CVHA 2VF8A 2JJ1A 3O8BA 3QKSA 4HDQB 2YINC 1E2HA 3K9NA 4NZYA 2J3EA 4RCZA 4ZKEA 1WGKA 5JS8A 1R10A 4DKXA 4ARZB 3PEVA 3W34A 4CRWB 1SZPA 4QGFA 3N5CA 1S0UA 2JDIA 4OJQA 4A2PA 2YOFA 1XZQA 1Z0JA 1YRAA 1QG4A 4JLAA 4R9UC 5CB8A 2ORVA 5E95A 2OILA 1U99A 2IHYA 1D5CA 2LKCA 3LB8C 3W9CB 4E5UA 3IO3A 3OFND 4EQ6B 1DS6A 4A36A 2VHQA 5CDFA 3IPYA 4LHVA 1N6RA 1OB2A 4C7YA 2ZI5A 2PT7A 4US1R 4BQSA 3THYA 2J1LA 2PMDA 3VAAA 5AJXA 3Q8XB 4H1VA 4M1WA 4GMDA 4B3FX 3PUVA 2ZU6A 5SZHB 4PQRA 4FMCF 3OHMA 3GLGA 4HAZA 1ZMXA 5FI0B 1TAGA 5FL3A 3PXGA 4L16A 3VR5A 2WU2B 1J99A 1Z47A 3QKRA 3EIHA 1YZNA 1G19A 3NWJA 4MDFA 5UKDA 1D2MA 1GITA 3MMPA 3K0FA 1LS1A 3AVOA 1EFHA 3T1QA 5BYKA 3V9PA 2O0KA 3QKSB 3ADCA 3KQLA 4U7DA 1L8QA 4KU4A 5AUQA 4QC2A 4XWAA 2RHMA 1SKQA 3W3AA 4N0EA 1F60A 2PJRA 1AGPA 3DZ8A 2L52A 3T34A 3GLIA 4DLSA 4G5OA 1MV5A 2J45A 1DOIA 1XTQA 2O5VA 5TVKA 3TSZA 2ORWA 3GJ8A 5H1YA 1RIFA 3HU2A 1NY5A 4BFTA 2OESA 4HAUA 1N5LA 2P6NA 2QSZA 3K0CA 5EUQB 4P33A 4NL4H 1W2HA 3GEHA 3TQFA 2GEDA 1VIYA 8OHMA 1QBKC 3AB3A 3AVVA 3EC1A 1UBEA 2MSEB 1SXJC 5H70A 1ZM7A 3FMFA 1JALA 3TR0A 1P2VA 1OJLA 1H8EA 4EAQA 4BGDA 3WMGA 3EPKA 1EX7A 3HPQA 4B2PA 2WSSA
chains in the Genus database with same CATH superfamily
5B6JA 4HD8A 3PHCA 4IDGA 2R7KA 4KSYA 5FORA 1Q74A 1QTMA 3UFXA 1HYHA 1EDZA 4EMSA 1EUDA 1YKSA 1QGOA 3L43A 2IF2A 1SBQA 2HLHA 1LVUA 1C7FA 1P4GA 4J0GA 3JQBA 1X6JA 1R5JA 4P53A 1ZXHA 1XO3A 2EARA 3HDTA 1EG2A 3FCUB 1XIVA 1FJXA 3LYAA 5GPBA 1R6VA 3V8EA 3LQRA 2JKZA 1BE8A 1T2UA 4IWOA 1ZVQA 4YJ3B 1CFJA 1JG3A 1OGYA 4XYLA 4RVCA 4DW8A 4YTMB 4LHEA 4DADA 1TCUA 2HYIC 3KUDB 1CKEA 3O5AA 2Y9TA 4PLZA 2QTHA 3NJ4A 3INRA 5F7XA 3GT4A 3FNEA 3A6KA 1U2PA 2BZSA 5C81A 4NYJR 2GLUA 4EJSA 1QYRA 4H4DA 1CVIA 3V8MA 2OHHA 4OJKA 3DBHI 3HYLA 5E7IA 4AN1A 1E8DA 4QZEA 3ITEA 1CJSA 5CBKA 3OE7D 3Q10A 4NXZA 1AKTA 2BSXA 3C3JA 1WZIA 3TADA 1QTNA 1KDPA 4NOJA 4CTKA 4EYQA 1XTSA 1ZN9A 1JH8A 3V7YA 1T6BY 4MW0A 1IIRA 4P4TA 4LJKA 4XAQA 4TV8F 5A5EA 3M6ZA 3ZU6A 4YAOA 3C98A 1GPXA 3QNMA 4QDXA 5LD2B 1UZXB 4IO1A 5SZJA 3IS3A 4MWSA 3AM5A 2NM0A 3A9JB 3QOFA 3E7PA 3QHQA 3M33A 1WRIA 1LEHA 2HV8A 3SX0A 5AOCA 4ANVA 2A1TS 5A4AA 3NHSA 1DGJA 1MPEA 3GUCA 1BCRB 5EP3A 4WASA 3TSAA 1U9LA 1N3IA 3WMEA 2X7XA 1MVOA 2HDNB 4CIXA 2WPNA 2XHEA 5IVIA 3MT9A 5CXXA 1OAOA 1WX9A 1LRKA 1NJFA 4M22A 1MZPA 3U7JA 1O77A 3PQ4A 1OXUA 1NVKA 4EFKA 2QE7A 1E32A 5J5CA 5AW1A 4DRZA 1PZEA 3COZA 4Y1RA 4W8GA 4YPOA 3DDSA 3IP1A 4ZYTA 5LQCA 1HXYD 3N2KA 4PGXA 4KLHA 5GV7A 1J06A 1FFSA 2YIDA 1JBKA 1F17A 1D7OA 5F9HA 2C2EA 3N7TA 1MQSA 1DC8A 3MB5A 2HHAA 3IUMA 1Q3VA 4B3DA 3M8KA 2V6GA 3RAJA 4DZTA 4G85A 3E9SA 2XAUA 2ZJ8A 1ZWKA 3T9AA 5D1NA 4XGKA 4RYLA 1ZGHA 3ZX5A 1M5TA 3N1XC 2F43A 2PN1A 5H3CA 3R44A 1DZIA 1NVWQ 4RY9A 5D3MA 5CA1F 3DVGX 2EFJA 3E9NA 5LCXA 3WY9A 1Q15A 2ZIUB 5SYAA 3FDZA 2PYDA 1HFKA 3AEQA 3MINB 4OG2A 3X1MA 1ESNA 1OWNA 2W4IA 3HJNA 2Q2NA 2B1QA 1B22A 2WNIA 2HFKA 1BFDA 1WZCA 4YCMA 1F2TB 3T1NA 4J9RA 3IOCA 1KKMA 1E4VA 4H6XA 4FHDA 2YV2A 3ESRA 3T0GA 1YSCA 4RPHA 5L6LB 5G4KA 4ZT3A 1S0OA 2CJYA 4FNMA 4I08A 4CCAA 5CVCA 4BZZA 1SC1A 1SE9A 1NV9A 4IQVA 4DJAA 1YJAA 1I4TD 1A9ZA 1QGYA 5CB4A 1DBVO 3RTVA 2DY0A 2OCEA 1WDKA 1IMJA 3LKDA 1ULBA 1Z12A 4MPJA 4TMAB 1SD5A 1KIMA 3WNDA 2JFVA 3RB8A 5GXGB 5DWVA 3INGA 3ETGA 2NZUG 4ZAYA 1OHHD 4LJ8A 1XWIA 2ZWVA 4CLRB 1K8YB 3DQVA 5E9AA 1LTHR 3ICOA 3WZMA 3NDBB 4EUFA 4TSKA 4DIBA 1PJTA 3KQOA 2ASEA 2VPZA 2HU5A 1SEPA 4DDID 3O9ZA 2XUZA 3PLNA 1W29A 5H83A 4F9GA 2LIPA 4ENVA 2DFNA 2WU3A 2ZEJA 3U4QB 2WC1A 3UBMA 2XWBF 1NG9A 2JV3A 2YS6A 2UZIR 2PUBA 4HXYA 2L1AA 4AY5A 3C1AA 3G2PA 1DC6A 1GPWB 4S2UA 4OU4A 2LM1A 3RT7A 2X8AA 1IPFA 1JQ3A 1NJ5A 5LYJA 3D59A 3LWZA 1UOOA 4OHBA 3AULA 4D02A 3RYHA 5A4IS 3PNKA 1D4FA 2NTNA 3F5FA 1P3DA 3GNTA 4DSNA 4YP7A 3N2NA 3OLXA 1KKUA 3OX2A 4RF3A 3AL3A 5FJIA 4O4HA 3VXWA 1XC7A 4QXPA 3PKZA 2K4HA 2PWAA 3FWZA 3D5QA 2VYQA 3S8MA 3A25A 2ZJOA 1MEEA 3F46A 2QY6A 2QX6A 1EH5A 2GI4A 4IKEA 3DUWA 4A16A 3AJ9A 4E03A 1P4SA 1D8BA 3MWEB 3THYB 2EIHA 2VFAA 1MEOA 3K9WA 2RAPA 3GGOA 2ZW9A 1RJDA 3KT8A 1JBQA 3IEIA 3WLRA 1S96A 3JQ8B 3FPLA 1KVTA 3RNOA 5I7EA 3HWSA 4CM8B 2FPRA 1IXYA 4CR7A 3L01A 4YV2A 4C07A 1U8XX 4YRJA 3C4JA 1UDCA 1SXTA 5C4GB 2IZVB 1ZQFA 3EQ8A 1RBYA 1Z2PX 2R61A 4OO3A 5ITVA 3T5TA 5KREA 1J0DA 3GRYA 4KZCA 3DTVB 5A0VA 1M34B 4AZ3A 4OKIA 3K30A 2BMWA 1W44A 1FP4B 4XB6B 3P2IA 1Z22A 3VTVA 4UVDA 1J2YA 5ESDA 4YQWA 2HIMA 4ZVNA 1LVHA 2JGFA 3VHXA 2E4WA 3IKLA 1FLAA 3AUAA 4LF6B 1DB3A 1UDBA 1SD2A 1UANA 3MS4A 3ENVA 4AULA 1VE7A 1WW8A 3J9CA 3LQKA 3G5MA 3KYIB 2Q1TA 4I1YA 4UBNA 1SJED 1AV7A 1GPKA 4JQCA 2Z4TA 1LSJA 1A4UA 5KDDA 4MKIA 4V1CB 3TGPA 3LQ1A 1C9MA 2FCAA 1KH2A 5JJBA 1P61B 1SOUA 1H2EA 2WB2A 2MBHA 2IY1B 2PWZA 4DCNA 2OB1A 1MSWD 4MM3B 2H11A 2YXLA 1S1QB 3RD2A 3KPJA 1FYWA 1U0RA 3GMSA 4WK6A 1TK9A 1F7UA 5IT9A 4PG8A 3SJ7A 4KTQA 1XZFA 4J94A 5HG2A 5HW0A 2I2WA 3PSIA 3ZHCA 4H7HA 4DXFA 2AMLA 4TQAA 4K5QA 1QLNA 4AY2A 2V9CA 1HDZA 1CRLA 4P1ZA 4BVEA 3A1FA 2VHYA 4AVYA 3BCUA 1Y5LA 4RK5A 4MWBA 1D2GA 2FW9A 3MG9A 2Q8PA 3AR7A 4M8NA 3I3SR 5BWBA 3D2QA 2VZLA 3CN7A 4GX0A 1KETA 1FRVA 2CGEA 4PC1A 4AKTA 1R4NI 1XMSA 2A1IA 3E48A 1STOA 4Y1GA 5KTMA 4KOAA 3L4BC 1SL1A 1JIHA 1OKKA 4PC6A 1YU6A 3SYMA 5JUMA 3KKKA 3AE6B 1SKUA 1XNJA 2RJNA 2O6VA 4R2KA 4K7UA 2P5YA 4EI8A 1FTYA 5BMHA 5J2EA 3LT2A 4YUVA 1H8CA 1L2TA 2O5EA 4C7ZA 5LJLA 2B8JA 3ENKA 1OW3B 1CQXA 1K7CA 4DG8A 1GOZA 4M60A 4M01A 1UMBA 1M2VA 3GH1A 2O05A 4MSUA 2WXMA 4B43A 4CM1A 4XZ4A 1UBHS 2AOTB 2G4CA 4RD6A 4E74A 2J5KA 4A23A 1JXOA 2WP0A 1UEXC 5D49A 3DLPX 4GSLA 2X38A 3TW8B 4TYNA 1BIFA 4DLXA 5KOJA 1GAWA 3ZNPA 1WUIS 1UEIA 2DKZA 1YFZA 1GVNB 4GVLA 4NPHA 3M2PA 3AUFA 3DDNA 5HJEA 5KG3A 4J29A 3SC3A 1K2WA 3LRTA 2O48X 2I6SA 3MAGA 2J9GA 3ILYA 1LJUA 4ALJA 4IG9A 1G8FA 1CRZA 1E1NA 4LXXA 3QI7A 4BFRA 1MNAA 1ZAKA 4AKEA 3K96A 4CCWA 4FX2A 1OWPA 4TTAA 4JLWA 4EUTA 3LBFA 2W7PA 2YNMD 1UBSB 2PMCA 4DWVA 1H6CA 5CH8A 3OWEB 1KTVA 3KTOA 4EHLA 4E33A 2CUNA 2CLSA 3OPYB 4YMHA 1OBFO 3SJCA 3WQBA 5IILA 4LJXA 2EOAA 1M76A 2Q9AA 1FFXB 4KGTA 4IH1A 3TG2A 4JX9A 2KSOA 4LSZA 4JXJA 2AQHA 3ZCRA 1V8CA 3FVVA 1YWGO 1CJMA 3MIIA 2Y1GA 4GIVA 4GO1A 1IULA 2HQRA 1IEWA 2PX8A 4DQUA 2D3WA 2LCFA 4FOTA 1GD1O 4RZXA 2XUGA 3SZMA 3GZJA 1GZ4A 4R31A 1XNSA 4OB8A 1NYLA 1L4MA 4OHYA 5EWMA 1L6RA 2HQOA 3E7FA 3O8QB 3TCKA 4MKZA 3E3AA 2V6IA 5ADVA 5CJJA 1L4FA 4DHWA 2XTAA 1UJ6A 1EZZA 1RKXA 1UHUA 1VD2A 5LWHA 4MGZR 3NX4A 1TMYA 4BUCA 2QQEA 1E5QA 1AZWA 2IIQA 1BD4A 4KP7A 1VZ6A 1IUEA 3A8TA 1DAKA 4XUSA 3ASYA 2BH2A 4C4SA 2K89A 2NQ8A 1XF9A 5CWRA 4Q1CA 1I6LA 3NHPA 2VPIA 1U94A 3JY6A 4FU0A 3KZCA 2AMJA 3PENA 2HLPA 1W4RA 3IUBA 5DHUA 1NQVA 4HH0A 1BO6A 1N92A 1IFXA 3KSMA 4EG8A 4Q93A 1IN8A 1PD1A 5DM60 4GI5A 5DULA 4QFCA 4RSHA 2VJOA 2VZ8A 4L6CA 5H3HA 2R66A 1FW6A 4IYJA 3OWOA 5AKKA 3I2IA 5BQPA 2XMGA 2K5PA 3FUWA 3ROTA 1YX6B 1J8FA 5CVVA 1UC5B 4LYYA 2ASJA 2YRWA 2AC4A 5JYBA 3CURA 4CM9A 4FD3A 1XWWA 1ZA1A 3C8MA 2R85A 2H31A 3GHHA 4KVGB 1YDHA 1RAIA 4O2AA 5TZVA 1BJKA 5KYUA 5CA0A 4DUGD 5KHOA 4R6WA 3H84A 2CNOA 1ML3A 1SL0A 5TQ2B 2BKEA 3VKUA 2R11A 3TVYA 3ETDA 3TTSA 1BNCA 1YB5A 2G6BA 3LW7A 1MRNA 5LLSA 4LK3A 5A62A 4HZUB 3RLIA 2V4MA 3MGKA 1HR0B 8ICRA 1NM5C 3LX8A 4Q3AA 5J2TA 1QQ5A 3AESA 2Z9CA 5BYAA 4KX3A 2WYOA 4HWIB 3PO0A 1E2MA 1JAXA 3SYNA 1AIPA 4L8WB 5KTYA 3CO0S 4MTCA 5JQWA 1DQZA 2VJNA 1ISNA 1YKFA 1W94A 3A2MA 5NULA 3A6GA 4F1KA 1VE6A 1P74A 3D4LA 4Q45A 4XM1A 4FYVA 2DTEA 1YVPA 1V1OA 1T8WA 2QRQA 1QO7A 3KW5B 4QSHA 1CY7A 1RRCA 4ND3A 3V1LA 2CDRA 3PDIB 2EGGA 4ARAA 1PF7E 4K40A 4A3OA 1Y3DE 1KQOA 4TTJA 2QYHA 2PKQO 2WG1A 4DQLA 1TUGA 1FRFS 1R0YA 1XNHA 4C4PA 1G20A 4XDZA 5TT0A 3NNNA 2A19A 2UVQA 1RVV1 1Z62A 1ZCAA 1SPBS 5JZOA 5GIOE 3VR6H 3PSEB 1QIIA 4DEZA 2JGDA 5EJ2A 1K27A 1C20A 3JQRA 4PLVA 5KPDA 2NSHA 3F2CA 4Q4JA 2XZLA 1XLWA 2W03A 1KSJA 2XITA 5DXFA 1UFKA 2KX3A 2HN9A 4NECA 4P3XA 4OBWA 3OM0A 2J5XA 2F1HA 2EBHX 3FWYA 5THQA 1LPAB 2HHUA 3A9KB 3SVZA 1Z2AA 2F3QA 3OFKA 2I91A 2G36A 2O1SA 2KWVB 4IM0A 1CR6A 2KBEA 5C8VA 3LT5A 1V1RB 3EXEB 4YP6A 3C1ZA 5BQFA 2P3SA 4BP3A 5CX1B 2I6FA 2W55A 2IA5A 4TL6A 3F6PA 1BNOA 4IMRA 3CKYA 3A1UA 1A8HA 1YTLA 4KN5A 4FHJA 4KV7A 4DSEA 3R4CA 4QG3A 3SX2A 4L8GA 1J0XO 4DHJD 1EVKA 1SC3A 4E3ZA 3GDGA 3OT4A 1VCIA 3V00A 1L4BA 4XDGA 2XXAA 3RRJA 4UUQA 2R8ZA 1P39A 4XRRA 4EKNB 1Z3CA 2QLFA 3EVFA 5I47A 4QO8A 2VJLA 5JAMA 2HA2A 3CN9A 4KLLA 2ASLA 4OM7A 5IUKC 1UKYA 4R8SA 3QE2A 3EOBI 2BP7B 1V5WA 4IOJA 4DK5A 2H7VA 5CHYA 3JQCA 3SF8A 1RD4A 4XWYA 4XIYA 1IN6A 2F1IA 2MYNA 4PF1A 4XGAB 1NY6A 3K73O 2GA9A 1OYYA 5KTKA 3PHHA 2WD9A 1U5BA 1ZCJA 3HP4A 4RD0A 3FBTA 5C1DA 3PRHA 4HQLA 1JJ7A 4HXGA 2GSDA 2PLAA 1I33A 1N7IA 2IVZA 4RTOA 4KQKA 3T15A 1Z8FA 2QUZA 6YASA 1C1YB 4O5OA 4HAYA 1B6GA 3LH5A 3CIOA 3AR4A 3WL4A 4UU0A 4YJ3F 4EF4A 1F48A 3HA3A 1P7FA 1TXGA 1JF8A 3GOHA 3HI4A 3GEPA 1X86B 3I63C 3PJRA 4UHCA 1RLJA 3BAFA 1NBIA 5D01A 4QFMA 2Q0ZX 4TM7A 3CKLA 2KLCA 2V9ZA 5JASA 3GV8B 1PNQA 2K25A 1AK2A 1JB9A 3RS8A 4F9TA 4TVKA 2AUNA 3C5HA 2E5WA 2FBWB 2PBRA 3N3KB 3P4XA 4ANUA 3ZCUA 5L3SB 4YNBA 3L10B 2CJOA 1U11A 3RAGA 2ZXUA 2KMCA 4ZVQA 2AL7A 4LLGM 5KAPA 1JW9B 1RRKA 4FMDB 3W2HA 4C1NA 3IV7A 2N1VA 2YWCA 4RVUA 1ZK3A 1T10A 1JT2A 4LYAA 5A4FS 2C00A 3ZQJA 3KTDA 2OLEA 1M83A 4N01A 5DASA 4D8YA 4PYNA 4W9FA 3KIPA 1X9GA 4TYPA 1UP7A 3WANA 1F14A 1T94A 4Y3UA 2PFQA 4IJ5A 4M7RA 1NKCA 2E1EA 5DF1A 3HFJA 4DQVA 2IPXA 2DBZA 2WYVA 4EB0A 3IXLA 1O8BA 1DJQA 2ZNVC 2ZQYA 1K7EB 1VCBA 2QF7A 3L08A 2CV1A 3LDUA 2P9ZA 4ENUA 3E7DA 5CGQB 3PUVA 2LYHA 1JMLA 1AXRA 2YQZA 4GD3Q 4PZNA 3OJOA 4HNGA 1YMUA 4G1CA 1NP7A 4V1CI 2H65A 4YRPA 3W3AA 1ONOA 3NEAA 1CUJA 2H3ZA 3OCYA 1EZ4A 3SJUA 3LC2O 2OESA 4ID3A 1SMKA 3HJTA 3Q9UA 2G5HB 3TQFA 5KTNA 2GEDA 5CD9A 3AB3A 2W9CB 1RRBA 3RUIA 1IJBA 4IBOA 1H8EA 4XGIA 4HEA1 4OVKA 1LFAA 4WAUA 5CT5A 1C77A 4CJXA 1WKBA 4YREA 4KXNA 1IM8A 2N75A 3LHDA 5BOSB 1VSQA 1E8MA 2BGLA 1O96B 1VRCA 4K2HA 1NI5A 4YP5A 4MJSB 4JL8A 4G8BA 1VYTA 5BWCA 3C2QA 3EZ2A 4Q4HA 3AEFB 3F6SA 3JQ9C 2XEWA 2WNHA 1ID1A 5CNKA 2V4QA 5DU2A 3B78A 1P19A 4IGFA 4AP6A 4JYZA 1KKXA 3EVGA 1RFKA 1N75A 3NVDA 2GEJA 4AJWA 4EVSA 3Q88A 4MA5A 2N3ZA 2WAQF 3WQSB 5AJTA 3ML9A 4IDOA 2GUWA 2VYCA 1FYXA 4MKXA 4NZNA 1J09A 3K2BA 3JTMA 1GGFA 3QH4A 4PHHA 3TKAA 3GA5A 3IG5A 4GPIB 4U7HA 4CLDA 4Q15A 3G02A 3F3SA 4PIPA 1JG2A 3H6NA 1KFKB 2R2AA 4I4LA 5IARA 3C1UA 3W9UA 1PZXA 1OH5A 4NDAA 3BMOA 3PB3A 4Q6WA 3RC1A 2DMRA 1JFSA 1XDDA 4R98A 5JCJA 3WFJA 5AKLA 5AOVA 3D6JA 4PYJA 1AOXA 4N6OA 2HRDA 1D2CA 1FS5A 1QOPB 4EYKA 2AE2A 3MTAA 2Q9BA 1A9XB 4FNOA 4KR3A 4RE6A 4UEJA 4PTZA 3CS3A 4UQGA 1ZN7A 3C85A 1QH8B 1YGYA 1N6NA 1X77A 4NH0A 2BMDA 1W4LA 3ZIAD 5CDFE 4RYDA 4MGYR 5D2MB 4FO6A 1BE1A 2ZBVA 4PFSA 2PDAA 5T8KA 4ECQA 2BV3A 1G3IA 2ASVA 1Y8RB 3DLTA 4R5HA 5GVRA 2HHVA 3GILA 4GS5A 4Q48A 4GOXA 3SEFA 5I4KA 2OLJA 1VL1A 2UYZB 3H5VA 3THXA 5C1IA 3C5VA 1PWEA 4ENRA 5JY1A 4XLLA 1CUYA 4KWTA 2HXYA 2QRVB 3E8XA 3TAXA 2G5IB 4CQMB 4EEWA 5IWAB 5JDIA 1EP2B 2K2WA 1K8QA 4DDVA 1W1IA 4C8NA 3IQZA 3D02A 2AJLI 3PJGA 4RQ8A 3RYCA 3T1TA 2O2YA 1P31A 3N7AA 4KGVA 2LRWA 3A10A 4JIGA 1T6NA 1Y5IA 1YRHA 5JI2E 3G0IA 4UB2A 1FEZA 4FC7A 5FNZA 4Q39A 3V62A 2EKDA 4N0MA 5DB7A 3ND8A 1CVLA 2HD5B 3O31A 1KJNA 4HJGE 3ZWQA 1Y6GA 2Z9BA 1TKEA 4F8EA 4QTTB 2XBUA 3TACB 3KP1A 1IM2A 1ZS9A 2VDMB 1OY1A 2CN1A 2H2WA 3DBHB 7YASA 1ZGUB 1EVIA 1LBHA 5HM8A 4EG5A 2EG5A 3AKDA 3NC0C 1O6CA 3T4EA 2XRZA 3WZLA 3C0RB 4ICIA 5AJHA 3PW5A 3VNSA 1H69A 4WXHA 1A98A 3WDLA 3QZUA 4PWYA 3KBBA 8ICEA 3H6KA 3HM9A 4DDTA 5JTTA 1OSNA 4W9CA 1XQ6A 4F5EA 5FD8A 1SVNA 4F4YA 2HA4A 2WPDD 1L4YA 3QXGA 1J49A 2XDYA 3E61A 4BZPA 1H9BA 3OICA 2OYCA 2G67A 4CM4A 5TPWB 5AI9A 5HS6A 4M1SA 1HLDA 3H0KA 1OLXA 4Q6BA 1WXQA 2NIPA 4TOIA 4O3NA 1E0KA 1L6IA 5E7QA 1OFFA 3PKJA 4ZJZA 3MN1A 4L8FA 1MQ3A 3RSSA 4A55A 3GF4A 1FXSA 5E6NA 4WOJA 1KC3A 2ZAGA 1L3TA 1UPUA 4ZC8A 1PVPA 1Z6PA 4C4TA 9ICVA 2LVOA 2D3DA 1I30A 2GJ9A 4X1YB 4UAUA 2Y1LA 2NYRA 1V9LA 3WRYA 1SQ5A 2KX7A 3D3KA 4F2PA 1U98A 3ISVA 2RGRA 1OIVA 1NVVR 2WD8A 3IEKA 1TVEA 3OKCA 1LRJA 4G0XA 2VLIA 3A0BU 3HNRA 1MB9A 4P16A 2J07A 5D3DA 2HVIA 1ISJA 1G21E 2N1BA 3RS3A 2EQ5A 4URHA 1DVRA 2PPLA 5BSRA 1JDTA 2DCMA 3L4JA 3OMLA 2HK7A 1MMFB 4CTNA 4Y2XA 1KJ9A 4D4MA 4TSFA 3N30A 4ZMRA 3PXAA 4GOMD 4NLBA 1NMEA 1W48A 2A9PA 3EDRA 4N5NA 2DZIA 1OXSC 4OAOA 1SIWA 1YFKA 3GZNA 3OZAA 4LRQA 4BZWA 1KFTA 3AERA 3D5TA 4QDJA 1ENFA 5D3ZA 3NRJA 3VZSA 2WXKA 3MUEA 4F1JA 3IAS6 1TUIA 1N0UA 1CQPA 3GFPA 2J67A 3F3MA 2OVFA 1QFZA 3FMVA 1N5KA 2ZVDA 3MWLA 4RQ7A 4DF4A 4LDTB 2MSWA 3IC5A 4BVLA 1HE8A 4L2IB 5HCIA 5G5GA 1EA7A 3I8SA 2H1VA 4Z9FA 2CLMB 5KJEA 4YMLA 3KOXA 3MFYA 4OP1A 4P4GA 2PRKA 1D6NA 3NJTA 1XD2B 5CMLA 1S3SG 4WA8A 3HH8A 5ECDA 4XGNA 4O0MA 2DX7A 3E3NA 5DCUA 4KVFA 3HA2A 4MRVA 4K8RB 3TE6A 1M6VB 5A05A 2NTTA 1ZVJA 4AO8A 2A92A 4A0RA 4JQOA 2QI9C 4DXGA 1TGYA 4IDIA 3AR3A 3JYNA 4DA0A 2HJWA 4MDHA 3BWYA 2A7QA 1GRCA 2RGDA 4RNCA 3DE5X 4KYIB 4J4HA 1WB9A 3IH5A 2W6IA 1SXJA 4OXNA 4UVHA 2ZZNA 2H3VA 3VR5D 4HN4B 4CDNA 2LUMA 3HFSA 1D1TA 1DELA 2Z7JA 2UUPA 1LGRA 2PGDA 3AW9A 5IFKA 4KXLA 2GA8A 5CVJA 2J3DA 2AUMA 4LXQA 5G53C 3NXSA 4EKUA 1PVOA 3ZCSA 2NR2A 2HUNA 3BDAA 2PKOA 2NRTA 2DQYA 3IBYA 3RDPA 3RJKA 3JVEA 4W9KA 4YR7A 2VDKB 2NU9B 3AO0B 3W1EA 4RGTA 2I7VA 4EHBA 1MO6A 5BR4A 1AQ6A 4UDYX 2ZTDA 4DF3A 4G9GA 3EFOA 1L4HA 2PO5A 3AF3A 1TJNA 3R77A 2EP7A 1W47A 2OQVA 4QAYA 5C8XA 1UPHA 3LGXA 1NXWA 5KT3A 2GVNA 3D4PA 1KFDA 5F2KA 3B0XA 4ZH4A 3TFOA 2V3VA 5D87A 3TW4A 3V7NA 5A5DA 2R1TB 1I10A 3GEGA 3SQOA 5CT4A 5HEKA 5IYZB 2LYAA 3SVLA 2WU5B 4QQFA 1QDEA 3IBSA 1X0VA 4FFNA 2ACVA 4U7CA 5J1TB 1XP5A 4DWJA 4Q44A 1MJGM 2G72A 2JA1A 4IKOA 2H57A 4RGNA 2I9PA 4YSZB 3PIIA 4EFMA 4PAOA 3VTWA 3EEFA 2OHOA 3JD3A 1L0XB 2QW0X 1ITZA 4KC0A 3T38A 2DPHA 5K05A 1X39A 1TMOA 4YDHB 5FI5A 5KT5A 4KLJA 2B4QA 3PRKE 4MW2A 3M8RA 3T7EA 1Z0UA 4F1WA 1Z68A 1XLTA 2FQ1A 4GC7A 4LNUA 3IP4B 3DBLI 2IPAB 3LWBA 3KKAA 2R6CA 3L41A 3JV7A 1DSSG 3OX1A 3E1SA 3UAVA 4DM3A 2GBCA 3SR0A 4Q4AA 4QHTA 2VJQA 4B3XA 4UXIA 3AHJA 2H0QA 4P2HA 3ABQB 1UWLA 2OFFA 2JB9A 3M34A 2XCAA 4P4MA 3CTPA 3H0RB 1YA6A 3BTOA 4QECA 3OOSA 2BPOA 4KIGA 5B58C 1H4QA 3BM5A 5DDMA 1Y81A 3DHYA 5AM5A 2CEAA 4F4UA 5DSXA 4A82A 4IQFA 2YB4A 2VWPA 2FPMA 1MJFA 2C97A 2DAPA 2QU7A 2HW8A 1OFGA 1UAYA 4G0YA 3MTQA 2W00A 1T36B 2QE7D 3RUAA 5A3JA 4RKRA 3T3MB 3URMA 4OGGA 3A1QA 1HNZB 1U4BA 1K1QA 2DWPA 1H2RS 2KDBA 3RTGA 2B5VA 3AQ4A 1R7SA 3DNMA 4O1IA 1VMDA 1RI3A 1RBMA 1Q77A 2ZWAA 1WKCA 2HPHA 3ADPA 3HUIA 3KT6A 1BKSB 2AHOB 1LI5A 1TZMA 1SVOA 3IJRA 1D2RA 3PE4A 1Z4OA 3W6UA 2ZTEA 4HLEA 4MP8A 2Q5LA 1E6EA 4ZYLA 1DQNA 5EHGA 4GMHA 3CUVA 3PDJA 3FM9A 2AR7A 5FO1A 1YHNA 5A7FA 5K0TA 5A4MS 2ZROA 4KLRA 4WLUA 3CZ5A 2IPNA 2E4AA 3QJGA 3QXSA 1ULTA 4FLMA 4W7SA 3JYPA 5CX3A 1VQ1A 3P19A 1ZRNA 4R9SA 1ST3A 3AHHA 3BEDA 3BQ9A 1XEXB 421PA 3THWB 1AKWA 3BVZA 2V4RA 4HQFA 1PJ8A 4I5FA 3GD5A 4JBWA 2BF8B 3VH1A 3WDKA 2JH3A 1WQ4A 3MGIA 4B0PA 1Y5MA 1GG5A 3L4PA 1OYWA 2GZ1A 4PX3A 2QD2A 4HDQA 3WB1A 4HRXA 2Q28A 1WW3A 5BVHB 1ZK4A 1QDLB 2ID9A 2H59A 2W3SA 1WR1A 4KMUA 2XRYA 3TRFA 3LBYA 3GFQA 3AR2A 2J9RA 2CXYA 1O6ZA 2WTBA 2GHTA 1J1IA 3I6IA 3ZWYA 5KFMA 1J7AA 5D3IB 1JDPA 1WO8A 4I2JA 5ELLA 1S10A 3EWSA 2W2OA 2WKQA 3D6AA 5FOXA 4LF8B 4FHEA 1NN5A 4M9LA 4BQPA 1Y6RA 1ZQAA 3LU1A 2CMHA 1KO7A 3EFCA 3DEKA 3FZQA 2PZAA 3O91A 4GMXA 5H82A 3QLEA 2F59A 3NAMA 1Z6ZA 1HUQA 4RELA 3PD7A 4JVNA 5H16A 2KM1A 4YXDB 1LDNA 2J31A 1O58A 5FF9A 5LMNB 3CZMA 1TK0A 2R6DA 1XZPA 4QM7A 2CCKA 1OFUA 4B3BA 3FB4A 2FN9A 4KXXA 3V2GA 4M0AA 4B3MB 5EZ6B 4ANFA 1ZQSA 4L4YA 4QDZA 4K9PA 3LRPA 3C19A 4YT4A 1DKLA 1A1SA 1DMSA 4FKZA 3U49A 2JYEA 3SQLA 5GTHU 3KH0A 2ZSDA 3G59A 2GLTA 2P2SA 3C2MA 4BPBA 2BTOA 1XTPA 3HSYA 4L02A 4K9SA 4KQ1A 4WFJA 2QM8A 4MW9A 3H8JA 1U4AA 3E5RA 2AL6A 2DECA 5DYTA 1ZQZA 4N1AA 1M6NA 4OGKA 1ZR2A 3LG2A 3CLUD 4OQYA 1P29A 3LLUA 4C7BA 2NV3A 3NG1A 4BUGA 4R3DA 4HX5A 3B1LX 3NUGA 2GM9A 3SIPA 3VUWA 3L92A 3KR2A 5GIPE 3RRBA 1ODFA 1KN5A 5A3QA 3EMBA 3T1VA 2ET6A 1DKUA 1ZD8A 4A8HA 1UM9A 2WD7B 1FVXA 4MLZA 3I01A 1HL7A 3I92A 3CNNA 1E2DA 3JSXA 4PPNA 4IVRA 1JQAA 2P68A 1DOHA 3D4IA 3H0LB 2GPTA 2H5XA 1QAQA 2GLXA 2WKWA 1U90A 2YZKA 3PC2A 4MGHA 2REXB 5REQA 5CTAA 4MW1A 1IY2A 2C2RA 3UM9A 1Y56A 2I8AA 2FZLA 2XQGA 2ZI6A 2CMGA 5KQMA 4F11A 2FZ4A 4KW7A 3IIJA 3WGKA 1RE1A 3SMQA 5BSGA 1KO1A 5IF9A 1XRPA 3N59A 4BN0A 4ARSA 1ODCA 4X90A 3TXYA 2UV8A 4M1QA 4PXAA 1E2IA 2OQRA 2Q3CA 4G3IA 4FFSA 3PXXA 4WBNB 1Z06A 4YQFA 1FYVA 3L8DA 2JFYA 2OGUA 2BFOA 4CMGA 3Q8AA 1U80A 4H3HB 3TTVA 3CRQA 4A2QA 2J3LA 4OHFA 3H5AA 4FMDF 5LN1A 1HJPA 1N6ZA 4YAGA 2IITA 2V3SA 4N49A 2AOUB 1W5EA 1WL8A 4GP7A 4C4VB 1KEKA 3M1IA 2GRUA 3FOWA 4G89A 3AETA 2VWQA 4JX8A 2QUBA 3G6KA 3R6LA 1NBWB 4NOMA 1NVAA 3A4MA 2FMUA 1AKQA 3LDFA 3O1HB 1YOVB 1H0HA 1WUHS 4DLGA 2COEA 2NZ8A 2KTRA 1YZUA 5IKPA 3BJYA 2BHLA 3CVOA 2H3HA 4Z6EA 3F98A 1GDDA 1VLQA 4S05A 1QQ7A 5IAJA 2C4TA 9ICEA 4WLOA 4CF6A 4K1RB 1ZQIA 1UFOA 2VT3A 5GQSA 2JGEA 4HTAA 1Y8QB 2Q3LA 3X1KA 2YZ7A 3TVTA 2GAJA 4HHEA 2O2VB 2V0GA 4MIKA 4YGYA 4OMUA 3TLXA 1H6AA 1X3SA 5A02A 2QGZA 1QGUB 4ZQHA 2BRUA 4EEYA 3DWFA 2NO4A 1OKKD 2FA9A 3AC0A 4ITRC 2BVCA 3G2JA 4FJ0A 4V0QA 4BFZA 4OLHA 5INTA 5IJWA 5KFJA 5F23A 1EGAA 1R6BX 2EP5A 3B1KA 1LO5D 4D5GA 2CNWA 4MJLA 4AB1A 2KJ6A 2WVJA 2PMEA 2Y0PA 4BEJA 4OLAA 5J4YA 5EYPA 3CCBA 2VDWA 2IEAA 4MA4A 2J08A 1UK8A 1BHSA 2R44A 1LBSA 4PO3X 5TVGA 4HVBA 2E89A 4L9SA 4UAWA 3M9LA 2HHQA 5H4HA 1AUVA 2ILVA 4GLOA 2ZIWB 4XFKA 2PAFA 1M0TA 1E6UA 4FS2A 1G7SA 4PHAA 1XRNA 3RANA 1V5TA 1US8A 2RH4A 1I35A 4NE9A 4BWJA 4LXIA 3FMPB 5F5NA 1H0KA 4Z7JA 3HXKA 3RC2A 3UJ6A 4FCTA