5EE9A

Complex structure of osychf1 with gmp-pnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
374
structure length
357
Chain Sequence
b'ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 111
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee9A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee9A01
4Q7JB 3I92A 2JLVA 1ZMXA 4JSYA 2C95A 3AVTA 4QJ4A 1FMAD 2QMUA 4NZYA 1NENB 1G3RA 3A1VA 3K9LA 2CMKA 4GDFA 4BECA 4DDUA 2VHQA 1F6BA 5CLLA 3A58B 4HLDA 1ZVQA 4TYQA 1S1MA 4A9AA 4IOMA 2CE7A 3C15C 3DZ8A 4N0EA 4S35A 4X8MA 4DDVA 3EPKA 4BGDA 1U0JA 2NZ8A 4XD7A 2WKQA 4ABYA 1Q3TA 3CH5A 5EQTA 1OXSC 4PC7A 1KI2A 4BZPA 2OBMA 1N0UA 1VIYA 4EUNA 3NBFA 3LXXA 1KAOA 3PJRA 5EZ6B 4QNRA 5FOTA 1XMVA 2PCJA 2WDRB 4Q7KA 2A9KA 1YHNA 2VH5R 2XEXA 3WHKA 1GNPA 4ASUA 4NYJQ 3U7EB 4BZXA 1S1CA 2F1IA 2UZIR 1DVRA 5GVRA 1C9KA 1H8ED 2D74A 3DDCA 4LJAA 4UNPA 1LF5A 2VSOA 3B1XA 3WHLA 1QF9A 5AR1A 3LQQA 4BLOA 1P4SA 2XXAB 2GAOA 1MO5A 3QEJA 3P20A 4B73A 1XCPA 1SVLA 3AEFB 1LV7A 3B60A 3TBKA 1QG4A 5C46F 1SXJE 3IPYA 3GLIB 2RH5A 1L6VA 2BOVA 2H1LA 2HJVA 5J4YA 1E1RA 3LX5A 2GXUA 4B3DA 2EVWX 2CJNA 4NYIQ 1T3SA 3KKQA 4G5GA 4OKSA 2LKCA 4UQOA 3EPLA 2ATVA 4LHWA 5GJCA 1FFHA 1OHHA 2GK6A 3BFKA 3WNDA 1MO6A 2CLCX 2I4IA 4JL8A 4YXDB 5KDOA 3R8FA 4OI0A 3I8SA 4HSEA 4JJZA 1SZPA 4Q5IA 1M74A 3AECB 2JEOA 1XLOA 4Q1BA 2QQEA 5BN3A 4TZ6A 1WQ1R 4LBWA 2WJVA 2A5DA 3KQHA 5F2EA 1K8RA 2H57A 2C77A 5KPJA 4JVMA 1NVUQ 2WV9A 2YOGA 1HY3A 1S0UA 1IM2A 1G4AE 1VKJA 4FWIB 2J7KA 4NTZA 4URWR 1U9IA 3CPHA 4BLSA 4KFUA 3DL0A 4ZO4A 1YR8A 2BCJQ 2HCBA 2HXSA 1AK2A 2VP6A 3K0SA 2V54A 3SFZA 3S1AB 1WCV1 2W6IA 2QP4A 2WWFA 4MDEA 1T0JB 1UEIA 3BS4A 3K9GA 5IF9A 1OW3B 2BMDA 1SXJB 1YZUA 1IQPA 4V0ME 4B44A 2AWNA 1OB2A 1Z0FA 4MKGA 5TDHA 4U7DA 1TTTA 4NMMA 3LQRA 3K8YA 2JLRA 4HB4A 1OH5A 2FGKA 2AD5A 3AVPA 2FSGA 2J7PA 4RFSA 4G1UC 1IJEA 4LPSA 4WZAE 4NDZA 1FRRA 3LV8A 3EIQA 4POAA 4RZXA 2GXAA 1KKLA 1YZQA 3TJZA 1OQRA 1QLBB 4AKHA 5B2ZA 5LB4A 2O8DA 1QZXA 5HPYB 1L6UA 3FWYA 4Q47A 4RD6A 1U9IC 2Q5WD 4D0NA 3PUWA 1VYVA 3LD9A 2W3SA 2CLSA 1FZQA 1SVSA 2WJHA 3UMSA 2GEDA 5EXPA 3DKVA 3P1MA 1T3HA 4D2IA 1IN7A 1G64A 2OV2A 4MDFA 1ZNWA 4L9WA 4YSZB 4OL0A 1E79A 4MUAA 1OLOA 2VQSA 2NGRA 4Y0AA 1EX6A 1CXZA 3SQXA 1E9MA 1N63A 4PO1A 1IAQA 2C98A 4TMVA 3EA0A 1NRJB 2D2FA 3TSZA 1RFKA 1E0SA 2XZOA 2EFHB 1LS6A 4TT3D 1HQCA 3RS5A 2WQYB 1AS2A 4P4SA 4B3GA 2C9OA 1TF7A 3BAFA 5BXQC 2JLYA 4B6EA 3E5HA 1N61A 1AKYA 3BGWA 4C0BA 2GWHA 4P6VF 1KMHA 2NOAA 621PA 1QDEA 2FSHA 2WTUA 2F3TA 1II9A 2JJ2D 1DO0A 4AYXA 1N0VC 1ZC4A 2QRZA 1R0ZA 1VYUA 3U2QA 1RRCA 2NMVA 1R8SA 2P3SA 2H89B 1BMFA 1QOBA 2BBOA 5C1BA 2HCJB 1GRQA 5B30A 2VEDA 2ZRNA 1XCMA 1YR6A 1G8PA 4IDHA 4LWZA 5HKKD 1KAGA 2J0UB 4MGKR 1XF9A 2BDTA 2CL0X 3VR2A 1NKSA 4YT0B 1S96A 2ZJYA 3DMDA 3KKMA 2BMFA 1XWIA 4QHTA 4MRRA 2M56B 2R6AA 4NH0A 4XTCS 1SGWA 1NVID 1JPNA 3A4MA 4DC9A 4LJ6A 3U3OA 2O8CB 2QL6A 4ZDWA 1FPMA 2R6GA 3QI2A 2RGGA 3VR3A 521PA 3AVVA 1KK2A 2XNSA 5JWOA 1UPTA 3GLFE 5DYIA 4OHWA 1FFVA 2IYLD 3W6PA 5J4LA 1OXXK 2L52A 4WOPA 1GZSA 4OQLA 5DHFA 2FPLA 3VR6A 3UATA 2XSZA 3HVZA 4QBGB 4OI2A 3LLMA 3EC1A 3CF0A 4PSAA 2DBYA 1CULC 2GJAA 1Q1EA 3C41J 4HRSA 2B8WA 3U61B 2IUSA 2OAP1 1XTQA 2X1VA 1HT1E 3SU8A 4PC3A 4TLDA 2FH5B 4UXJA 1DELA 5L3SA 4CZ2A 1P62B 4KVAA 4L5BA 3W34A 1D2MA 1TF5A 2ZR0A 3X1XA 4B3FX 4CW7A 4TYWA 4KX6B 3I32A 3NHAA 4ZIRB 4RY2A 4WA7A 2HYIC 1E2DA 1SXJD 2FEMA 3SJZA 4GL2A 2IEYA 1FIQA 3L0OA 3WBKA 4YSYB 3RDPA 5FTLA 3EW9A 3IHLA 1MOZA 1NLFA 2QSZA 3WXMA 4MH0R 5DLQC 5K8LA 1PV4A 1WE2A 2QBYA 2WIAA 5KNCA 1XTSA 3NBYC 1AQYA 4UXHA 2VBCA 2H17A 1SVOA 3C16C 3QXJA 1A1VA 3NBXX 1CTQA 4W7SA 3RLFA 3GLFB 3GLGE 2ZE8A 1FTSA 1YZGA 2O0JA 2MSEB 4RFVA 3T35A 2ZS9A 4QBHA 1X6VA 5HZKA 2XITA 1ZD1A 3ZJYA 3UKDA 4RD3A 1AA9A 4R2HA 3NEYA 2RGXA 2W2VA 4RZ3A 4A1FA 4EIWA 3AM1A 2FU5C 1CJTC 2AL7A 1N6NA 1S3SA 4PC6A 2GESA 1PFDA 2OXCA 1RRGA 3RPFC 4OK5A 4DT1B 3PFIA 4EPTA 1Z29A 1E0KA 4HDOB 1C1YA 2UKDA 3DWMA 4EPWA 1ESNA 1G8FA 2PVOD 4OJQA 1W4RA 1NJFA 4CEJB 2F1HA 1FNNA 4WQMA 2HEIA 4DCNA 2CHQA 4M9ZA 2JJ1D 5JCPA 5D3MA 3W5UB 3ZVLA 1E2PA 1J7BA 1E1QA 3E1SA 3K0FB 3L0IB 2PJZA 2IW3A 1R2QA 2MJDA 4XWAA 1W44A 2R65A 4C0HA 4BZQA 2A5FA 4A8JB 2JCSA 2CK3A 4PQFA 3GLGB 3DEFA 3AEGB 4IKEA 1RRFA 3ZIAA 4I1VA 1DOAA 2QSYA 3ZH9B 1T8TA 1UBFA 2OILA 1UKYA 1QRAA 1ZOYB 1CR1A 4IRUB 3VKGA 1W5TA 1YJ5A 3CWQA 3OEHD 1VLBA 3PEUA 1U8AA 4RD2A 4BLPA 1KI3A 3AV0B 1ZU5A 3IPXA 3ZZ0A 1SHKA 1TJEA 1HT2E 1DE0A 2JIZA 4G5SA 4KBGA 4RCYA 4URXR 1R5BA 3GQBA 1UWMA 4JLJA 1RYHA 4KXFB 1E9SA 4QGHA 3TAHA 3QKSA 1ANKA 1KFYB 1KSHA 4BFYA 2NQ2C 1WBDA 2W0MA 1KSFX 4JIMA 1NLZA 1E98A 4PZLA 1F2TB 1ZNZA 4Z8XA 1G6OA 5TB5A 5J5CA 3FKSA 3KKNA 1US8B 3RS2A 4NCHA 3PQCA 2EWVA 4URYR 5SZHB 3WP1B 5KPDA 4DZZA 4PAOA 3I5YA 4LGMA 4OK6A 3IILA 4Q4HA 4LCBA 1CZPA 3HUIA 1AGRA 2ZRGA 5SZJA 1AYFA 4A0GA 5L3RA 4LX0A 2ZSAA 4IOJA 5FBVB 1ZIOA 4P4TA 5KSPA 3U4QB 5FBWB 1G6HA 4ZCIA 1NBME 2I3BA 6Q21A 3RS3A 3AVQA 3F8TA 3SYLA 3B9JA 2OG2A 3H4MA 3A1UA 4KU4A 5JEEA 3ZVMA 2N0SB 3AE6B 1FRDA 1VMAA 1XP8A 2OBLA 2QE7D 3KB2A 4JT4A 4R71A 2O8FA 3NVVA 4FMDB 3EZ7A 4C2UA 1E2IA 4YONB 3CNOA 1G8GA 4C80A 4DLTA 2G0NA 5DN6D 5KTYA 1GKIA 1YQ4B 2X8AA 4FD2A 2AFIE 2GZDA 3GEIA 4Q1EA 5SZKB 4FXCA 3L82B 3OIUA 1CEEA 2VIIA 3VNUA 2F55A 5FTMA 1ZAKA 1DG3A 4AC9A 2P6UA 4CF7A 1XTJA 2H5EA 2NPIA 3WCQA 3B7GA 3QJYA 4HB2A 4Z8YA 5TMPA 1G19A 1NJGA 2FEOA 4JBXA 3C7KA 1HUQA 5FPHA 1PLJA 2G3YA 2E1RA 3OAAA 2WOJA 4ACAA 4AYWA 2JASA 3R7WA 4ZV4A 2M19A 2GAAA 4TMWA 3SOPA 2RGCA 1G1MA 1GITA 4DKXA 3AEDB 2JLZA 2GZHA 1SVIA 2AKYA 4JYBA 4LV5B 1XEWY 1KO5A 3NS1A 5IK2A 1Z07A 1VDZA 4ESHA 3KXIA 3N2EA 5FUVA 2ZQ5A 1W0JD 4XVRA 1UADA 3AGQA 1TYGB 2WSSD 4D81A 3NC0C 2EYQA 3GEHA 2X19A 3AV8A 2WM9B 3MLEA 3LVQE 3CW2A 3H84A 2BKUA 4NKRA 2Z6VA 3FGNA 5UKDA 1ZNXA 1J7AA 1HTWA 2ZI3A 4BEBA 1II8A 3I1FA 2KB0A 4QGFA 3OE7A 5A4JA 3SEAA 4AG6A 1N5LA 3AE4B 3U6KA 3ND8A 3FMOB 1F0ZA 1WA5A 2YWGA 4PPNA 3EWAA 1KDOA 4TMZA 4OYHA 4Q02A 5CK4A 2IUUA 1T8UA 3B1WA 3PXGA 2XOKA 3BH7A 1V43A 3QIAA 1MABA 1VYTA 1ZM7A 3B1VA 3G82C 1L4UA 1SIJA 2EKIA 5TARA 4V02A 4EFLA 3VX4A 1ZC3A 3P4PB 4HAZA 4KYIB 3B2GA 5FTKA 3NH6A 4NP6A 3ADCA 2HF9A 5EZ5A 2O8BA 5C4MA 3THXB 4B43A 3ICEA 2PJRA 2CCKA 1AKEA 2R6DA 3QG1A 2XNDD 1DADA 2ORWA 2FZLA 5EP4A 1W0KD 1IHUA 5A0FA 4UXIA 1J2JA 3FC4A 1J90A 2G88A 1U99A 4TQ9A 4V0KA 4X8HA 1UBEA 2BKEA 4YQFA 2W6JA 2ONKA 2QUZA 1DAIA 5L3QA 2P5TB 4DEYA 2G1JA 2Q3HA 2QAJA 3BB4A 4TSFD 4AIIA 2OM2A 4PC1A 2GJ8A 4OBEA 4KAXA 2WICA 2LWIA 2P5SA 4HROA 4A2QA 3MG9A 4DSTA 2J46A 2C99A 2BJWA 4X8LA 2KWIA 3KZ1E 3SNHA 2PMKA 3C5CA 4QKQA 4WZ6A 5KOYA 5JEDA 3RABA 4BFVA 3GEEA 4URZR 1J8YF 1V5WA 2PVGC 5GXGB 2YOHA 4I1SA 3V00A 3AH7A 1XXHA 1UKVY 1XEXA 2CL6X 2ONJA 1QOAA 3JVUA 4M1MA 3SS8A 1AQUA 4NYMR 3IBYA 121PA 3CUEF 2V7QD 2VHJA 4LRWA 4D6PA 3TAUA 2HLDD 4E03A 3SI7A 4ON9A 3CM0A 4Q9HA 3SHFA 3AMZA 2GBLA 1E9FA 3I3SR 1TEVA 5FI1B 3OFND 1DOIA 1M6NA 1Q22A 2ZYTX 3QBVA 4WW0A 3UWOA 2ODNA 2C78A 4FMDF 4C7OA 4TTRA 1PUJA 2A30A 3MUFA 4GSYA 2ZITA 3GJ5A 3KTAB 4B48A 5JJIA 2W0SA 1Z6AA 2IF0A 1E9RA 4CIDA 4DWJA 2OFWA 2JJ8A 1W2GA 4Q4JA 3RHFA 1VG9B 2ASEA 4Q48A 2Z83A 4RD0A 1TPZA 3FDIA 1GKYA 2PIAA 3MD0A 4H1VA 2A3RA 4JBYA 3G5UA 1EFRD 2EQBA 1NBMD 4Q4AA 4DDTA 1B9RA 3GFTA 2F43A 1P61B 4RFSB 4ITRC 2AHOA 3SYNA 3QQ5A 2GBLC 2R2AA 3NHBA 3TSWA 1GRRA 2OAQ1 1S8FA 1N6OA 4Z51A 2JATA 1PDXA 5JS7A 1D6JA 1GAJA 2WKRA 3HJNA 2GCOA 4URUR 3QKRB 4F93B 3IHWA 1XEFA 2VP4A 5JI3E 1P2UA 4MKFA 3H1TA 2AD1A 1ZM4A 1ZINA 4P31A 1G3MA 2Q3FA 4ZKDA 5B57C 1JEDA 2ZJOA 3VNVA 1BYUA 1SULA 4V0NA 1UDXA 1Z3IX 2ZUCA 2YWFA 4RSGA 1P9NA 1NVVR 4B3BA 4IDPA 3UG6A 1LY1A 2B92A 3Q8XB 2D4HA 3L43A 4JVNA 2BS3B 3KWLA 1X1SA 3ETLA 3VX3A 3SJCA 4ARZA 2J59A 2WWXA 4OHZA 1MRNA 3DKPA 1RE0A 1KJYA 2QN6A 3CF6R 3MWLA 4ZKEA 5E3HA 4HDQB 4HI0E 3CKLA 3GP8A 2AN9A 2DFNA 2ZSDA 2PT5A 2PX0A 4RZUA 4XD7D 2FF7A 1ZRHA 4KI0A 4NU0A 2LCFA 1DS6A 3LDAA 4ACBA 1NNEA 4HB0A 2CEAA 1C4OA 2FBWB 2Q6TA 1XJCA 2R62A 2ANBA 2QI9C 1J7KA 3VHXA 4WIAA 2AXPA 4ASUD 2EFDB 2DHRA 1P60A 1F5NA 2ZRKA 5EP2A 2Z5FA 2BS2B 3TR5A 2C04A 1UFQA 4C0AC 1DG1G 2ZI6A 1WRIA 1KTVA 3D7MA 5IHPA 2BBWA 3U6BA 1KO7A 1OT3A 3BFVA 2Z4SA 3P1JA 3B13B 3B1YA 4LJ5A 4S2EA 1ZJ6A 3DOFA 4BWYA 1CR0A 1VHLA 3U3JA 3LBNA 1L0VB 1ZYUA 1IUEA 4O3MA 1JJ7A 1E1RD 1S3GA 5AJYA 4ZOHC 4B32A 2YVUA 1RRPA 4Y0VA 5BWMA 3KB1A 2O0HA 1EFUA 1KI9A 4XJXA 3SZRA 1OHHD 1IONA 2R8RA 1Z0IA 3QE0A 2CVHA 2QM7A 1AIPA 4D25A 3KKOA 1D9ZA 1YQTA 1TL7C 5DI9A 3LA6A 1TF2A 3CZQA 2ZRDA 2VSFA 3NEJA 5FH9A 2W2XA 4GPTA 3WBJA 4AD8A 4PHHA 3PV0A 1FQJA 1Q21A 3BB3A 5TXGA 4QM7A 3AVUA 4WXRA 1KDPA 2D2EA 2DFTA 3GJ3A 3E70C 2MMGA 3CR7A 4E22A 5GJBA 1OPXA 4GT1A 3RYTC 4BRWA 1LTQA 2C96A 3QEOA 4G5RA 3AE7B 1XTRA 4QJ5A 3VR1A 1G21E 3AUXA 4B2IA 1E4YA 1NMYA 5J4VA 1X86B 5EP3A 2W6ID 2ZTSA 2DFLA 4IDQA 4D4MA 1J7CA 1GAQB 1U98A 2G1KA 2CVFA 1AZSC 2DY1A 2QPAA 3TVDA 5HE8A 2ZR9A 1GUAA 4HAWA 3L4PA 2J7PD 5LDDC 4X8OA 4IVQA 1AS3A 4BUJA 1WRBA 3LNCA 1TKYA 4TLAA 1E2KA 2WSMA 4BFUA 1EFHA 1G7RA 2PL3A 4YTMB 4MGIR 2GHIA 2QQ0A 1A2KC 3TUJC 3I61A 4DB2A 1X3SA 2QAGA 2WZQA 4LBVA 1M7BA 4EJSB 5HCIA 5IT5A 4XSGA 3TR0A 2DYKA 3CRW1 3THYA 1YZLA 2F1RA 2ZU0C 2ODWA 4HYYA 3D6TB 5LPNA 5IRCD 1KO1A 5DGXA 2OO7A 1E79D 4E5UA 2CBZA 4MGZR 4MA4A 2QMHA 4IXMA 2RKOA 2QZ4A 4NCIA 1Z6YA 3ZVRA 4JBWA 3TUZC 2IYTA 3CWIA 2ZRLA 4LBZA 1OB5A 2RHMA 1IY0A 1JAIA 1RYFA 2HYDA 3ZD6A 5AK0A 2G83A 3BJIC 4JSTA 4GOJA 5E7MA 4KFTA 4JKYA 1JQLB 1SHZA 5D3MB 1KSJA 3EXAA 3WYAA 2QAGC 4QJ3A 5GADl 5F9FA 3GMTA 1E6EB 3AKCA 1NKTA 4C0JA 1XTKA 1N0WA 1WWTA 3BORA 4G5OA 3EUB2 1E94E 1R5OA 1Z8FA 4D4KA 3KFXA 3W3ZB 2BMJA 1I7HA 1G17A 4C0QC 3U7FB 4JL6A 1BMFD 2RGDA 1IXZA 5EUMA 5GJVC 4DLYA 1DGJA 1T5IA 4G01B 4I99A 3RC8A 1YJJA 1NG9A 2WPDA 4AURA 1ZNYA 3HU3A 1DOXA 5HE9A 3SBDA 3VQTA 4WZBE 4G3XA 3PEYA 1R7RA 2ZJ5A 4WBSA 1E0JA 4DSOA 3TQCA 4MRPA 2AR7A 1ZUHA 4OQMA 4B3XA 1W5SA 4QL3A 4W5WA 2IK8A 3QKSB 2ZRCA 5H8YE 1P3JA 3CZPA 4C2TA 1CF4A 1BS1A 1D2EA 3NRZA 4TYNA 1EG7A 3SDZA 1CBUA 2IXGA 4BLTA 5C4GB 4DVGA 1ZCBA 5ANRB 1KI7A 4EFMA 1NG1A 1B23P 1K6MA 4C4PA 2R9VA 5FBLB 2CLDX 2DCUA 1W36C 4F4JA 4QBFA 2ZUBA 2AK2A 4LHVA 3NC1C 3DVLA 2WKPA 4O0MA 1XPOA 2XSZD 2WOOA 3SQWA 4Q4HB 2DPXA 1KJZA 3K9HA 4D80A 3PEWA 1E10A 4NE2A 2ODEA 3B9QA 4US9A 1P9WA 3W8RA 3GFOA 2V6JA 2ZETA 3UMRA 4YDHB 4M8NE 5EXSA 2W00A 1KK0A 2FN4A 4A6PA 1Q44A 3ZD7A 3DZDA 3OIVA 1JI0A 4KBFA 1A7JA 2IYXA 1XD2B 4D0GA 1YR9A 5ELXA 4LHXA 4DHEA 1E0ZA 3R8CA 1UJ2A 1QHIA 5G40A 3OIYA 2PEYA 1E2GA 1W7AA 4M53A 2O8FB 3EIHA 1M8PA 4OQFA 4B35A 1L7VC 4TTQA 2WWIA 4PHTA 1UBCA 3IIMA 4GZMA 4M21A 3CBQA 3FMPB 2IYYA 2QEQA 1SB3C 2EFCB 4Q1AA 221PA 1XMJA 2ERXA 2OHFA 1H8HA 1NMXA 1U2RA 3F0TA 1BKDR 1KRHA 4UKDA 3IDQA 3L2OB 1E9BA 4P4UA 5C2TB 1QOGA 1F2UB 4QHSA 5AJWA 4WWMA 1RFLA 3EASA 4URVR 1EWYC 1ZP0B 1UM8A 2JQRB 1F3OA 4TQAA 3RVBA 4IDOA 4YTPB 4F4IA 2ZS7A 4GRAA 3R7WB 2R44A 2WU2B 1NN5A 2FPKA 2WMNB 1GDDA 1LB1B 3QENA 4TMXA 2PLFA 2CDNA 3DOEA 3LW7A 3ASZA 1ETUA 4M2LA 1CKEA 1G3UA 2VHCA 3CWZA 4DUGA 2NO7A 3OZXA 1WB9A 2IYSA 2EYUA 1CP2A 1M34E 4L8GA 2IHBA 3C4JA 3F5FA 1Q1QA 3QF4A 4EQ6B 3THWB 1KO8A 4NYJR 2WDQB 1UF9A 1UBGA 3ADKA 4A6XA 3J81k 2FSIA 4ZI2A 1I2DA 4PAMA 2FFBA 2GVDC 1S2MA 1P75A 5CB8A 2H88B 2PX3A 2IYZA 3BB1A 5JWHA 2XGJA 2J45A 4P32A 4QG7A 2NO9A 1E1QD 4IFEA 4WXPA 1OKKA 2G6BA 1QHNA 2RGBA 3MWYW 4MITA 4AWXA 3H86A 1XTIA 1E0AA 4JLBA 3RS4A 2CK3D 2JLSA 1ZUD2 3WMFA 4NYIR 2QY9A 2GNOA 3AKDA 4YXWA 3R20A 3ZIAD 1NN3A 2HXYA 4YTNB 1MABB 4HUTA 4NONA 2REBA 1XXHE 1E9EA 4YMVA 2G1EA 1RW4A 2QJLA 4TYYA 3KJGA 4Q19A 1AWDA 3GD7A 4F92B 3K53A 3AM9A 4LJ9A 2JIZD 3U7HB 2O8BB 1UDWA 3WNBA 5K8TA 2BCGY 2BMEA 2B6HA 1GWNA 5JI2E 5DI3B 1NN0A 2PBRA 4AG5A 1TUIA 4AYTA 2C8VA 5JLJA 2ZRIA 2N1BA 3LFUA 2GF0A 3KL4A 2AX5A 3EARA 4KO8A 2FX3A 3FKSD 3GLHA 3LBIA 4HZUA 3K70C 4DLWA 3QXXA 5L3QB 1GOTA 4TYPA 1JECA 1O3YA 1E9DA 3BK7A 3P4RB 2AX4A 2Q9AA 3N70A 3OF5A 4G5QA 1NY5A 3DM9B 5G53C 4CRWB 1U8ZA 3TRFA 3FHOA 3K09A 3VHLB 3JZAA 3EX7C 4MYUA 5CM8B 1S9DA 4NPHA 2AKAB 4GMXA 2AWOA 3K1JA 2V55B 4LBYA 3ADBA 1WMSA 3QXHA 3T1QA 1A70A 3AF2A 3BE4A 3V4RA 2XXAA 2YZ2A 3KXKA 3GJ0A 3P63A 2KMMA 1FO4A 3VU9A 1FXIA 2W54A 1U94A 3MSXA 1XXHB 4GI7A 2JLXA 4P3YA 5J47A 2PH1A 1CLUA 3BIFA 1JR3A 1DO2A 1VECA 4JLPA 3LH5A 2OCAA 2QA5A 4OHVA 4A0HA 421PA 2OXRA 4GP6A 4KODA 1JQJC 3M0EA 2WLBA 3FB4A 5KU1A 2J9RA 3AN1A 3H2YA 5JHHB 3FMFA 1G16A 3HPRA 1A5TA 4MRSA 2J0SA 4MQBA 1NF3A 3RWMB 5FBQB 3B6EA 1FXAA 3WMEA 3WY9A 2O8EA 1XBTA 2ZRMA 2OCYC 4KYUA 1EFCA 4US0R 4C7OB 3OEEA 1E2HA 5F98A 2Y8EA 2L83A 1IN8A 2ZRHA 3NVYA 5SZIA 2QROA 3FMIA 1G20E 1N62A 1M7GA 1XD8A 3OAAD 1PLKA 5JS8A 4IVRA 1BH2A 4Q4JB 4NHOA 3D8BA 5DIFA 3A8TA 3TIFA 3PCRB 5FL7A 1UKZA 1Z47A 1SVKA 2XTNA 4Q4AB 5IK2D 4XWKA 3SC3A 4UNQA 2JDIA 3FE2A 4KFSA 1LS1A 4ITKA 2F43B 1QT9A 3A1SA 3DM5A 1JBKA 5JECA 2V1UA 1G5TA 3I62A 2OFXA 3CB4A 1BO6A 2ZSEA 2V8OA 1U81A 4IXNA 3EPHA 1E69A 4LJ4A 2A5JA 5E7JA 3MCAA 4QOSA 2NO0A 4BASA 4MRVA 3AGPA 4KFRA 1LNZA 1LFDB 5AJXA 3EG5A 2GCOB 3SE0A 4PTLA 2FA9A 3PUXA 2ZRBA 3CPEA 3HRDD 2YWEA 3KJIA 2XJ9A 3OE7D 4ZI3A 4FINA 4EFNA 5LD2C 4GP7A 2ZJBA 3RS0A 4DLUA 1PLLA 2VF8A 1GNQA 1OIWA 2E9SA 4NYMQ 1WYGA 4N1AA 2WP9B 2XOKD 4WAUA 1ZCAA 2UVQA 4FMBB 3SJBA 3A1TA 3ZZTA 1H65A 5JSZB 4EDHA 5BQ5A 2F3RA 3HPQA 2FWRA 4HUQA 5GVSA 2WAYA 3UK6A 1HQYE 4LJYA 1Y3AA 2KBEA 2P67A 4H9GA 4KSCA 3NKVA 4ARZB 3LXRA 1JROA 1Q0UA 1OJLA 4JS0A 2BHRA 4TLCA 4OI4A 3THOA 5EE3A 3DWGC 1BIFA 3M1IA 1Z08A 4TMTA 3VR5A 4B2LA 4E09A 4FWTA 4JLOA 2CJOA 2KAJA 1N2CE 3AVOA 3FKQA 1Q57A 2QTVB 5G41A 1N6RA 5B58C 3MRSA 5JFGA 2GCNA 2IYQA 3N2IA 5AJZA 2W6JD 3DPUA 5AWFC 3SR0A 1AS0A 3QG5A 1UKEA 1D2NA 3W6NA 1N5KA 2J0VA 4P33A 2KBFA 3AKYA 2WU5B 2F9MA 4TZ0A 1JAHA 3L0SA 1VCOA 1XPUA 3I5XA 1XX6A 4D26A 3A1WA 4Q18A 3CNNA 4RD4A 1TQ2A 1OFIA 3RSOA 4BFWA 3R9WA 1NI3A 2FSFA 2J0UA 3HYRA 4Q66C 5J4KA 1G4UR 1M2OB 3HU2A 2BEJA 4HAXA 3TNFA 4F38A 4F4CA 2FMXA 2REOA 4FCWA 1G8HA 4QBIA 2CL7X 4USAA 3AE8B 2C2HA 5FUXA 1T5LA 2NZJA 3P4YA 1QHHA 3TE6A 3M4YA 4JX1C 2Q9CA 4Q7LA 2J0QA 2MH7A 1R4AA 1W4CA 1XZQA 2ZI7A 1VIAA 3VRAB 2IUTA 1NSFA 4DCSA 1NVVQ 3B9PA 5H8WA 4IEIA 1RYJA 4GOKA 1CJEA 2D06A 1UEJA 2TMKA 3A37A 3UANA 4A0RA 3CRRA 1ZIPA 1QHXA 2F6RA 2NO1A 3I4LA 4TWZA 4Q00A 2XTMA 4HZIA 2Q21A 1DAFA 2BIFA 2AFHE 3NWJA 2D7CA 2RGEA 2ACZB 2VRWA 3P27A 4CGZA 2B76B 2OLKA 3ETRA 2OBNA 2ZSBA 1N6HA 2J87A 1NL3A 2KE5A 2WDVB 1Q3HA 4I81A 1KMQA 4WVFA 4JWUC 3PUYA 2QG6A 2I1VB 1XNJA 3CO5A 1R10A 3IIJA 1K5DA 3ZGXA 4RJLA 3BC1A 3LY5A 4FN5A 2QNRA 1PJRA 2YC4C 5FR1A 3VKWA 1ZUNB 5FUWA 3KJHA 4IOKA 4Q1CA 4R9UC 1YU9A 4HB3A 4AY2A 1TKGA 3BH6A 3EZ2A 5BN4A 1QBKC 4LV6A 1KOFA 3VTKA 3X1ZA 3B82A 2BJVA 5KUTA 1GTVA 2QAGB 4IOLA 3ADDA 3AUYA 4TLBA 4F91B 5DISB 3T12A 4TL7A 4QRHA 4K8OA 1TX4B 1YVDA 2W2TA 1S9HA 2FFQA 1GIAA 2ZJ2A 3W8NA 4A82A 3AQ4A 3AF1A 3TUIC 1PUTA 1TQ4A 1J99A 2X77A 4H1UA 4EKDA 1QHSA 2IEZA 2YWHA 2MJ3A 2O5VA 5JRZA 1FM0D 1J70A 1JEEA 2J3EA 1DAGA 4N0DA 1NEKB 5JHGB 1FL9A 4UNRA 1XO3A 1NIJA 1U0LA 1NVXQ 4DIEA 4CEJA 1E2MA 5H68A 2FNAA 1ZM3A 2J5XA 4PZYA 5EE5B 3U44A 1N6LA 3PUZA 1YE8A 3K0FA 3ICQB 1W36B 1BOFA 4YMSA 5KNDA 1KI4A 5FBRB 5FOSA 5FTJA 1SQ5A 2I1QA 3JZMA 1YR7A 1OFFA 4V0OA 4A8JA 1LF0A 1NN1A 4A36A 3HR8A 3QNUA 1RVDA 4C0SA 1OIXA 5HR5A 4TQUS 4AKEA 1W47A 2IS6A 1XB2A 4N6EB 5TV2A 5EE1A 3W3AA 4YLGA 4PQRA 1HEIA 1KNQA 2QMOA 4M0LA 3MMPA 1KIMA 4NL4H 1TQDA 1KI8A 1DARA 4DDWA 3REGA 1Z0JA 3SR6A 5G3YA 1FFUA 1L2TA 3NVWA 3T34A 4C30A 2O8DB 2NTYC 4LJ8A 2N42A 2F7SA 4M1OA 2WJJA 1N60A 2B8TA 2CJWA 3CR8A 4G0NA 3K0CA 1KHTA 3CH4B 1P73A 3Q5DA 2ZAOA 3P32A 2A5YB 4AK9A 1QF6A 2EWWA 2WWHA 3B8HA 1W46A 2ZXUA 4AKGA 5KDDA 1P2VA 4A8JC 2P2LA 4CEHA 2REXB 5CYOA 1GM5A 2A78A 5E7IA 1WBBA 2H8KA 3MJRA 1Q1ZA 5FPSA 1ZW6A 1FUKA 3KJEA 2FFAA 1GPXA 5CJPA 3MAAC 4HDCA 2QIEB 1FP6A 5EXXA 2GDJA 1HYQA 1CS4C 3FVQA 4RZ2A 3VMFA 1E2JA 2GF9A 2BWJA 5AUNB 2RCNA 3U4QA 1SKYE 4M1SA 4MYHA 1ZP6A 2VF7A 2BM0A 4P4SB 3AEBB 1YKSA 3RSLA 2ZE7A 3K0CC 1VG1A 2EU8A 2V4ZA 4Q9IA 1IXRC 1MRSA 3AE5B 4JLDA 1KMHB 1DOYA 4GNKA 2GJKA 3K0AA 3SN6A 4BEJA 1DAKA 1Z0KA 2CHGA 2C9CA 1U90A 3EAQA 4LJ7A 1COWA 1YZNA 3AE1B 1KK3A 1RJ9A 3BIID 1D5CA 3NXSA 3WYFA 1CJKC 2ZUDA 1HV8A 2IC5A 2QPTA 2BVNA 1XLQA 2PZEA 2IYUA 5G5HA 4LZZA 3PUVA 1KDTA 1KGDA 2RGAA 4HEJA 3U5ZB 2ZRFA 4YDSA 2CCJA 2JLQA 1OFUX 1DPFA 1RC8A 2J41A 4K46A 1TMKA 4YMUA 2YV5A 3V9PA 5HZHA 1Z0DA 2H18A 3B2EA 1GVNB 3OIWA 2OFOA 2FG5A 3LW8A 5DHAA 4LYAA 1HH4A 4PFSA 2CNWA 4O25A 1SKYB 3QF4B 1JWAD 3H0KA 3K0EA 4EPVA 2WJYA 3ZQ6A 4ZCLA 1T4GA 1VG0B 2W83A 4IHQA 4PPFA 1ELOA 1N6KA 3C8UA 1P2TA 3GLHE 3BERA 4N59A 1FMLA 2RMKA 3Q72A 3CX7A 2YHSA 4BRUA 3D31A 4U02A 1JNYA 4II7A 3BD9A 3W5JA 4M1WA 4JLVA 4RCZA 3QY0A 3REFA 3X1DA 4C0LA 1XCGB 1W4AA 4DSNA 5L3SB 3K70B 1W36D 1VCNA 2W3RA 3Q9LA 1W48A 3CNLA 3X1YA 2L0XA 5F9HA 2HF8A 4ESVA 2MSDB 4IVPA 2WVJA 3R9IA 3TW8B 1NYQA 2WPDD 8OHMA 1FP7A 4US1R 3LVRE 3VRBB 4YSXB 1KY3A 1XRJA 4US2R 1QHYA 2WJIA 2QBYB 3HYTA 2FV8A 2EFGA 1JR3E 1NLYA 4HAUA 1JRPA 3RRYA 4C3ZA 2BV3A 1N5JA 4JKIA 4GFDA 1BYIA 4M1TA 3PITA 4O2LA 3L0PA 1XD9A 4HAYA 2H92A 1JXMA 1R8QA 2ZS8A 1G7CA 4E07A 3THXA 4HLQB 3B5JA 4KVGA 2Y5CA 2BT6A 4C0KA 2Z4RA 2VP9A 3M6AA 3GLHB 4HZUB 1FX0A 4CT4B 1TUEA 1LVGA 2IXEA 2Z0MA 1E3MA 3ZDQA 4BPBA 4AKIA 2DR3A 4PAQA 4LTUA 3N5CA 2JGNA 2QRNA 2NO6A 3TKLA 2OLJA 4BFTA 5FOUA 1OFTA 4Q9LA 2IBMA 3O8DA 1OYWA 2VTKA 3UMFA 2PKOA 2FFHA 3U60B 4QHYA 3W9YA 1Z2CA 1SKQA 5TVKA 5LB2A 3LAWA 3WP0A 3A4LA 5L8VA 1ZM9A 3JVVA 5FOVA 3WYGA 1PUIA 4DJTA 3R9XA 3VU9B 3A36A 3UWKA 2ZRAA 4IJMA 4PXAA 4Z1MA 1EK0A 2XZPA 3LX8A 1Z5ZA 5L3VA 3ZVNA 3P26A 4V0LA 5DO9A 3VAAA 1Z83A 1B0UA 2LKDA 4LSGA 4MRNA 1G3IA 2ZJZA 1XMSA 2GILA 2O0KA 2ZROA 2KSQA 4CEIA 4M9XA 4JJKA 2AXNA 2YOFA 4GMDA 4MGYR 4QXAA 3RC3A 1Y63A 1U0HC 3T5DA 3TLXA 1VG8A 2GTPA 2V9PA 1H8HD 3Q85A 4B2PA 2RHDA 4HLCA 4M4SA 1XMIA 2O8EB 1X1RA 4GBMA 4QM6A 3LLUA 4A0FA 3IO3A 1KI6A 3NBZC 2VP2A 3V4FA 2W58A 3IBGA 5DYGA 4B71A 1ROEA 1JB1A 2IYVA 5LD2B 1II0A 1ZXIA 1E2LA 4DCTA 5FOWA 4BLQA 2BC9A 2RB4A 2NPFA 1EWQA 3KTAA 4ILEA 1E2QA 5FR2A 2H7VA 2OT3B 2P65A 5DNYB 5CM9C 4ERNA 3UPUA 1IOZA 2VP0A 2MMCA 2ORIA 4B3CA 4DUGD 1AGPA 4B34A 1HE8B 1YRBA 4B75A 2VP5A 3SFEB 1F48A 4LHZA 4Z54A 2ZAMA 4JL5A 1KK1A 2Z43A 4OJKA 2DFKB 1CJUC 1XDBA 2GK7A 3ZYCA 4B74A 4DXAA 4XWOA 2JAQA 2WBLC 3EWSA 2C9YA 3T15A 1XJQA 4ZCMA 3CRMA 5JZVA 3U7GA 3EA5A 4D82A 3UXMA 3QPWA 1R7SA 1CRPA 3FHCB 3DO6A 4KHZA 1IY2A 1T91A 2EFEB 3FPAA 3WNCA 1H8EA 1OKKD 2NIPA 4TN1A 3QKRA 2FE4A 3QF7A 4XSHA 3K70D 4F7WA 4ZHPA 1RPZA 1U8YA 2R6CA 5H92C 1GL6A 4YXWD 5B64A 3NVZA 3PR1A 4LK2A 3AEZA 3ECCA 2DB3A 3B78A 1FW6A 1TQ6A 2OESA 2XJ4A 2PEZA 1G7TA 2VLIA 4NBSA 3BBPA 4HUQB 3KQUA 4Q1FA 2FPMA 2ZREA 2ZU6A 1XZPA 4A2PA 3CLVA 4I4LA 4RD1A 1CIPA 1WDTA 3SHWA 4D4LA 1T6NA 4MYCA 4L15A 3CIOA 4LI0A 2K5PA 5FPKA 4LUCA 4XVUA 5IDVA 2K22A 3UG7A 1OH6A 2QP9X 2GJSA 1IY1A 3L8ZA 3WRYC 3NTUA 3O8RA 1KF6B 5EJEA 1N5WA 1VDVA 1X8JA 4U5XA 2P6RA 1TU3A 3HR7A 4UJ5A 2GKSA 1VTKA 5KSOA 2WWYA 1W2HA 2FOLA 3AEEB 3KXLA 4L16A 5E4FA 3ASYA 3Q7PA 2WWWA 1Q20A 1HE1C 3A6PC 2DWPA 1Z2AA 2ZPTX 1N6IA 1OXTA 2WWGA 2PZGA 2XX3A 2Q0HA 4XTRA 2YKGA 5FOXA 4DCVA 1TEXA 4I1OA 2OUKA 3C5HA 2DWOA 1TU4A 3PG5A 4Q21A 4QGGA 5FI0B 1W1WA 5DE3A 1HA3A 3P4XA 5K8UA 1JR3D 1P72A 1GP2A 1II8B 2X2EA 2ZYVX 1QHHB 3AF0A 2SHKA 4RKEA 2QT1A 1WXQA 1W49A 3Q7QA 3MWKA 4O2RA 3LO5A 2MJEA 2QTHA 1GG2A 3BWDD 3U3RA 4QFMA 2AK3A 5CDFE 2YYZA 3W90A 5CYPA 3RAPR 1JW9D 1CJMA 5DSZA 1KO4A 3OEED 5FPTA 2B21A 1K5GA 2ECKA 2GEVA 3AF3A 1RZ3A 2YC2C 4FIDA 1G41A 1SVMA 3AVXA 2MSCB 1KKMA 3AVWA 2J1LA 4CT5A 2CXXA 3SBEA 5KSYA 1OQQA 3QKTA 2QPOA 1IBRA 2IXFA 2IYRA 3CONA 4LHYA 4N3NA 3KX2A 3SFDB 5FL7D 3EZFA 3QSYA 4AI6A 1V97A 3FFAA 3EZ6A 3L8YA 1ZD8A 4TT3A 4EPYA 2JDID 4W5JA 1R0YA 3U3KA 1T3QA 1F60A 2A2ZA 5CLQA 3LB8C 5EUQB 2QGNA 4LC0A 1E99A 3FOZA 4V03A 3HU1A 1Z22A 2D62A 3QKUA 2JJ2A 5TY0A 3O47A 1T3LA 5H70A 1EX7A 2VA8A 3WMGA 1ZBDA 1OSNA 1VCIA 2ZI9A 2RAPA 2W55A 2ZJ8A 1SVWA 4M1YA 4MUBA 5KSZA 2F9LA 3TMKA 4DLSA 1OH7A 4JMPA 4PSVA 2ZANA 4MKIA 5H1YA 3T06B 5HKKA 4ZDIA 3FTQA 2VYFA 3BH0A 3RRNA 1EWRA 2VHUA 1ZU4A 2YINC 4KV9A 2ZE5A 5A5GA 4EJSA 4OHXA 1G3QA 4KCGA 1XEXB 4A2WA 3NH9A 3GLIA 4PX9A 2ZYWX 2K9XA 1AJEA 3FFBA 5JCZA 2GCPA 2HT6A 1CU1A 1G5PA 1WF3A 3ZLJA 1I4LD 4IW3B 4LDJA 3ZYYX 1TKEA 4HAVA 3MWJA 3TH5A 2LEKA 2BM1A 3GLIE 1YZKA 4YMWA 2JLUA 3K09C 3BRWD 1Z63A 3QPUA 5EXTA 2IS4A 4JT2A 1N5IA 1A2BA 1G18A 3LRPA 3GJ6A 3RS7A 2IWRA 4JLAA 3Q5EA 1P9RA 1FOEB 4FI3C 3U44B 4ZDJA 2GXSA 4LYFA 4EJSC 5KYKA 4ZPXA 1G7SA 1OF1A 4UJ3A 5G5GA 3AP2A 2X2FA 3X1WA 1WGKA 3IO5A 2ATXA 3QVVA 4PPGA 1V8CA 2ZSFA 4NCNA 3S1AA 3RANA 3SYKA 3CRVA 1CR2A 1SXJA 4TL6A 3T1TA 3G0HA 4BLRA 2Q9BA 2G77B 2PCLA 4QNMA 3EZ9A 1QHGA 2R6FA 3AP1A 3EC2A 1JR6A 1CRQA 1P7CA 2BBSA 1YJIA 2HTME 3TQFA 3B1ZA 3PVSA 2YNMA 2CJWB 1KNXA 1XEWX 3IQWA 3QXSA 5JJLA 4B6FA 3FAHA 2ZVPX 2WIBA 4FCTA 5FTNA 1IN6A 1EESA 2OE2A 4US8A 4JVLA 1ESMA 2IYWA 4LC1A 2IF2A 4P0TA 3T61A 4CEHB 1JALA 4ZHOA 5D3QA 1AN0A 1GL7A 1TNDA 2GXQA 2NG1A 1QVAA 3E2IA 3IEVA 4BFXA 4MKHA 1SXJC 1E7PB 2E3TA 4C7ZA 2OZEA 5EP1A 5JMTA 4NCJA 2ANCA 1FNMA 2IWHA 2ERYA 3QPVA 1VHTA 1E2FA 2JLWA 1XU4A 3T5GA 2GVZC 2V3CC 2IT1A 4Q9KA 4IDNA 5K8IA 4V0MA 1MH1A 1ZM2A 5C2JB 1XD2A 4LV8B 2P0EA 4KLZA 5AUIA 1OXUA 5CJ2A 4DSUA 5HTKA 2JJ1A 1P5ZB 3K0AB 1D9XA 2UZ3A 3OESA 1RIFA 4W5HA 1KDRA 2OEPA 3AP3A 1LW7A 5AJVB 5JWRA 1T9HA 3Q3JB 3HP1A 2ZI4A 3VR4A 1GILA 1L5PA 3IKJA 1GRNA 2ZRJA 5AUOB 1RJ9B 1YQ3B 1FTNA 4A15A 2OCPA 2QM8A 3LXFA 3O8BA 3ONWA 1G291 1L4YA 1NIPA 4EPRA 2JA1A 2K5UA 4BFZA 2ZE6A 3KDSE 3BXZA 3P4QB 3VR9B 3TSOA 3KQNA 1EXMA 3ZQJA 1Z6GA 1F2UA 1Q12A 1VCMA 2IHYA 4LOAA 3PEVA 2ZJAA 1GSIA 3D3QA 4DLXA 2ZIAA 1I4TD 1RWSA 3OEHA 1VJKA 2PMDA 3IGFA 1DEKA 2HUPA 1QG2A 1GNRA 4HLUA 1RM6C 4PSKA 3QUSA 3NIBA 3P4SB 1MR3F 2D3WA 2O8CA 1MKYA 1GKUB 4DEXA 3EPJA 2A7QA 4R98A 1N3BA 3B2FA 4IDIA 1R0XA 1IJFA 4QC2A 3PENA 1OH8A 3AE9B 4MYTA 2IX3A 3THWA 4RKFA 4EQ6A 2G0TA 3CRQA 2CCGA 4M22A 5C18A 2QENA 4C7YA 3W9CB 1D8TA 5BN5A 3KUCA 4CYMA 4DRZA 2GETA 1R0WA 1CJVC 3AE3B 5BYKA 2ZRPA 4HLUC 4B76A 1G9XA 3LWNA 4IFBA 4KLNA 4TL8A 4DLRA 3IEUA 5MPOA 1KY2A 2ZI5A 1CR4A 4PO9A 2CU3A 4ZIRA 2QGZA 1EGAA 2XTZA 2QE7A 2XAUA 4GOXA 2VSXA 3SJAA 1JXOA 3MGCA 3PO0A 3RNLA 3QXCA 2CE2X 2C5LA 3W5IA 3X2SA 4Q03A 1Z6TA 4OI1A 1O87A 4YC7A 2ORVA 3C14C 5DN6A 4HATA 1XFAA 1AM4D 3DMNA 3CIRB 1TAGA 2O52A 1JWBD 4OK3A 2BS4B 1VPLA 1I2MA 3MFYA 5DI3A 1FX0B 3GLFA 4K81B 5CDFA 1KI1A 1SF0A 2XB4A 4L4UA 3THYB 2HT1A 4DLVA 1M7HA 2P6NA 5P21A 4JLNA 5CITA 1FUUA 4OHYA 4OQXA 3WRXC 3BFXA 1IXSB 5BYJA 2QU8A 4XOIA 4LY6A 5EE9A 4R2IA 3TVTA 2GRJA 4PANA 1E32A 1Z06A 3QBTA 3QOFA 1I4DD 4Q4LA 2QTFA 1OV4A 4EAQA 2JX5A 4FW9A 5F3WB 3MJHA 2V6IA 4DT1A 2ODBA 1JQ4A 4JWSC 2A5GA 3AKEA 1W0JA 2OCBA 1E6CA 4A4DA 4BE7B 5JBQA 1NSTA 3OHMA 5AUKA 2WSSA 4FCVA 1YZTA 4PHGA 3BOSA 5BW8A 4FXPA 3SFVA 1X8KA 4FMCB 1QOFA 5EE0A 4JLMA 1ONBA 3AVYA 1Z28A 2IS2A 2ZR7A 4PC2A 1X8LA 4PHFA 4DLZA 4CEIB 2VO1A 4UNNA 1ODFA 1MT0A 2PLRA 2VL7A 1COWD 3IQXA 4JYCA 1A82A 1PZNA 1MO3A 4LYJA 3GLGA 5KDLA 2FDCA 4DIDA 4I1UA 2Q3MA 4EPXA 4PPQA 1QVRA 1KI6B 3ZS8A 4JLKA 2V1XA 3GPLA 2QT0A 3GJXC 1JJVA 2RGNA 3AB5A 4C9BA 5AUPB 5JRJA 1NVWQ 4Q9JA 3AE2B 3CF2A 4BQSA 3KQKA 3TK1A 2PZFA 3TGPA 2IS1A 4PR0A 4LYHA 1OYYA 2FJUA 5FFMA 3KQLA 3HDTA 5M04A 4A92A 3RRZA 2ZEJA 2HDNB 1E96A 1W4BA 2KJQA 2G9NA 2E87A 4BFSA 5JJKA 2BBTA 5HCNA 1P2SA 2XNDA 2CNWD 3NDPA 5G3ZA 3TW4A 2VPPA 1W0KA 1PVOA 2BEKA 3B85A 3W5VB 1F2TA 1OIVA 4CDGA 4M1KA 4XIGS 1MV5A 1XLPA 3AH8A 5LBIA 5CB6A 1DBSA 4XH9B 2B7CA 1EFTA 2DWQA 1US8A 4M9SA 4R7ZA 5CK5A 1HURA 4NCKA 3EIEA 3GJ4A 3QVUA 4TSFA 4Q01A 5FPYA 4B47A 2RGNC 3CPJB 4DB4A 5FUYA 1OE0A 4PQYA 1FMJA 3U3MA 3AEAB 1IN5A 4KITB 1Z0AA 2CHVA 1G8YA 3RWOA 1NMZA 4CVNA 3IUYA 4D4JA 4DCUA 3KKPA 4M9QA 4W9MC 2GEUA 1S4QA 4TL9A 3GJ8A 4TLEA 5E95A 4KSBA 2ZVQX 1OXVA 5CIWA 4UNSA 1N6PA 1MO4A 4Q7MB 1R5NA 2WJGA 5JSZA 1ZD9A 4JZKA 5GJWC 1AZTA 1FQKA 1RKBA 5KO2A 2XB2A 1E9AA 3LBHA 4GZLA 5C3JB 4KJZA 3W6OA 1N5XA 1KZ7B 3AF4A 2FGJA 2V7QA 2WAXA 2WS3B 3PIRA 2EW1A 1Q1BA 2HLDA 5DH9A 1NYRA 1WP9A 1J8MF 4PZZA 1NP6A 821PA 2H16A 3GFPA 2HJGA 4TMKA 5KHOC 3NVAA 3OFNA 1JPJA 1ZUIA 3FYHA 2GJ9A 1DAHA 4DBLC 1A4RA 1T0HB 4D0LB 4B33A 1YRAA 1E9CA 4L9SA 2C03A 3GCGA 3AB3A 3T1VA 2XZLA 2WHXA 2GA8A 4OQNA 2B7BA 3O8CA 3DHWC 1KJWA 2IL1A 3T1OA 1KSGA 2QORA 3A4NA 3ZS9A 1DTSA 3K9NA 3HWSA 721PA 4N58A 1GFIA 1Z6XA 1L8QA 4XVQA 2VHTA 3KUDA 4Q1DA 1EFRA 4IEEA 1NBMA 5J40A 3CX6A 2ZYUX 1XJ0A 3FHTA 1KZGB 4LPKA 3RRMA 3VKHA 1GL9B 4Z1MD 4TTPA 3I72A 1OFHA 3ABVB 2HV8A 3UIEA 1DAMA 2GZAA 3GJ7A 1NY6A 4J0QA 4PO8A 1E4VA 5CIQA 4QGAA 3ZZUA 3KFVA 2D7DA 1E2EA 3CX8A 4U00A 2OSBA 2PT7A 5KNBA 2F1JA 3ND9A 1P6XA 3F3YA 2ZM5A 1XPRA 1M1YE 3VR8B 1G5RA 4ZDKA 2FZ4A 5J4HA 1DAEA 3NG1A 1XLNA 5AUQA 2IA5A 2QMEA 2WMOB 4RVCA 3I8XA 1N25A 3VFDA 3I73A 4JVSB 1R6BX 1UAAA 1IN4A 4FMCF 2YJTD 2QP3A 5FL3A 3NDBB 2KI5A 4YMTA 1KYIA 3IIKA 2N46A 1TADA 1E2NA
chains in the Genus database with same CATH superfamily
5KX5F 1ZMXA 3RIHA 1CQJA 1W85A 1Z73A 1F6BA 4XQCA 3RVNA 3SSMA 4MKXA 2ZBVA 3G89A 1QSLA 1U0JA 5BT9A 2PZAA 2WT8A 4DV3B 2QUAA 1ZQAA 4D99A 4IXDA 4NYJQ 1QANA 3PDHA 2H1OA 4Y6GB 2GAOA 4CG2A 4B73A 2Q5JA 1YS6A 4AJ2A 3VH2A 1BDMA 5CVJA 3GLIB 2RH5A 3EWNA 3PB3A 5AKEA 4IM3A 3BDPA 1XP5A 4YJHA 2GK6A 2NT4A 1TPYA 5J2UB 1MO6A 2I4IA 4ZEMA 2ZBDA 3BKXA 3DQPA 4EAAA 4Q1BA 1BJKA 4G4GA 5F2EA 2H57A 2EIXA 1RBQA 4HAOA 4F4UA 1AQJA 2BR3A 4W7HA 4NBUA 3BS4A 2BMDA 2RDHA 1RI2A 3GE3C 2LVPA 1BMQA 5THKA 4EITA 3A9KA 5DCUA 3RADC 2YMMA 3LV8A 4RZXA 1OQRA 1C9YA 2QTAA 3VSDA 4MTCA 3FWYA 3F5SA 1VFNA 2EBHX 3OJCA 3Q3OC 1WKCA 3ND6A 4J0CA 4LRSB 1WV0A 2NGRA 5J63A 4DQ0A 4KC0A 1JG6A 5H5JA 4DSZA 4WFIA 2YBEA 2VPWA 1NRJB 1JNXX 3PX0A 2HPVA 2X0KA 4I2NA 3MXTA 2AN3A 4P6VF 4MX8A 2P2SA 1N0VC 1YT5A 3N2ZB 3VZSA 3C85A 3JD4A 4LWZA 5K1ZA 3VR2A 2CL0X 2O6VD 3TQTA 2YJ5A 1XWIA 1U0RA 2JD2A 2JLBA 1NW4A 3OC0A 5CMLA 1OXJA 4ARVA 2GB4A 1DQRA 3M7IA 1T8RA 4ECZA 2ZT5A 2R68A 2BBCA 4WOPA 3OZ7A 3H8MA 2DZJA 3SZLA 2A94A 2O3QA 5F1OA 3WWZA 3L6OO 5DASA 4LSWA 3SU8A 1V9LA 1AGYA 1QVVA 3NTVA 1CG6A 2QD2A 1MHPA 5AOAA 4B4OA 4GL2A 3GH3A 5BSEA 4ARCA 3NP9A 1UOPA 1RWBA 3EFBA 5EIXA 1CW2B 5ALDA 2FUG6 4UZSA 1OI7A 2G5PA 4DV0B 5KT4A 1GTSA 4PYIA 3GEBA 3OECA 3EFEA 4NJOA 2UXCB 1WTCA 2FU5C 2I7VA 2AL7A 3K8ZA 5JSKA 3ZGNA 2WAAA 3PFIA 3D0RA 2LFIA 4UAJA 2ASLA 2PA3A 5IIKA 2K4IA 1TC1A 5COQA 1Z8DA 1KW4A 2C3UA 1BNPA 4XWAA 4C0HA 5G4LA 4ZRJA 3GLGB 4QFCA 4L74A 1ZN8A 2ZYSA 1S9FA 3ZH9B 2HWWA 3A0UA 1ZSYA 1U8AA 3EA4A 4URXR 4YREA 4DLPA 3GZNB 1KLUD 1ANKA 4BFYA 1D4OA 4QZIA 3CUWA 1GQSA 3FHLA 4HNAB 4M1QA 4PZLA 2QTLA 3TZBA 3BD6A 2PH5A 4URYR 2LNDA 4FYVA 3O13A 2AVDA 2LPMA 4UHEA 1C4KA 3SX4A 5G0WA 2ZBRA 3QU5A 1CWUA 4LX0A 1C0PA 2ACWA 1P81A 1PJ2A 1RR6A 1XWFA 1P7YA 1O08A 3FOEC 3JW0X 4D9JA 4YONB 2O1WA 3GQCA 2YJZA 1DG3A 4J7UA 1U28A 2M9NA 4H7JA 1R3DA 1AW7A 3EH1A 4TT8A 3EGXB 2QG9A 2HK6A 4CKEB 3NS1A 1QWSA 4KWIA 5A0VA 5REQB 3BCSA 2QDFA 2BISA 4JWMA 2A9QA 3TPZA 2VXYA 4HNSA 2E6KA 4MQFA 3IAM1 2HPHA 1KDOA 1T8UA 2H51A 5K8JB 1Y3BE 3HBJA 1CERA 3GGPA 3QWIA 3SAHA 1JL3A 4NM1A 2CXNA 2FEKA 2AEMA 1RKUA 1DTEA 4RADA 3UY4A 3OD1A 4AIIA 5EZQA 5AW3A 2AFVA 2JXTA 3WB9A 3AJDA 3OSNA 3R9XB 4RQAA 2QYTA 3ZHQA 2AOVA 1XXHA 1AUXA 1MW8X 1EPUA 3PD7A 3IDZA 2BQQA 3EVGA 4M1MA 1HX7A 2ZLBA 1FC0A 3O73A 1MG5A 3CUEF 4XIJA 3TAUA 1CQPA 4JELA 1DOIA 1E8NA 2B69A 3ZU6A 4FMDF 2BFFB 4MR7B 3K73O 1XWLA 2FPGB 4I19A 2JJ8A 1W2GA 3HKZC 2C2KA 1NBMD 7ICOA 4Q7EA 3EISA 5CCEA 3M81A 4BVKA 1VDMA 2FPIA 4AJ9A 3Q4GA 1P6QA 3X2EA 2XBMA 1XEFA 1U0FA 1KFSA 4KR7A 1DOHA 1YD8U 3UBTA 4Z2AA 4WADA 1W88A 1XQ1A 3GROA 4U7CA 3UG6A 3ZDCA 2D4HA 1MENA 4FYMA 2J52A 3P94A 2ZVOA 4Z6EA 5D5HA 3ILYA 1C14A 4RZUA 4KI0A 4G81A 4RM9A 2RB5A 4NU0A 2EEZA 5D6OA 1K4KA 3JW8A 3OJWA 4YMOA 4O5AA 3U8ZA 2QI9C 3MB5A 1F5NA 1IYZA 3RSCA 1LKYB 1KO7A 3BFVA 4LJ5A 2WU4A 3ACDA 3OPMA 3B9BA 3LHSA 4E12A 3ED5A 3KWMA 1IOLA 2Z57A 3V7WA 5HG2A 1WCXA 1X9GA 4C7KA 1IIRA 1RBZA 2ZRDA 4DAEA 3KJZA 4DN6A 4PBSA 3MWDB 2DTXA 2HHQA 2O3JA 1EFLA 4OQDA 4IWPA 4P1BC 1CB7A 2BTEA 4AJYB 4ND1A 3N39C 3FZNA 4LAFA 3L4PA 2MR5A 4X8OA 1T8YA 1AS3A 3O21A 5BMVA 1TFUA 4LGYA 4B45A 2RJNA 3EMDA 2OO5A 2HWXA 4BVLA 2NUTA 3S28A 2MYUA 4GI1A 3KFLA 3WZMA 4IW0A 1N33B 1LX6A 3WNQA 2ZT8A 4JSTA 3HJCA 2VXCA 4BEWA 1A4UA 4LGCA 4R2WA 1JDZA 1DXYA 3HJHA 2X9VA 3EXAA 3WYAA 3GMTA 3BWBA 4CL0A 5GOZA 3VZRA 3COVA 2BMJA 4JQYA 2FZKA 1F06A 4PPXA 5FT9A 5B6PA 1C0KA 2FY8A 1WETA 3D2CA 2A9JA 3ELDA 1EG7A 4MV8A 3L7OA 3TRJA 4EZ6A 3CCCA 1K6MA 1N48A 2G9QA 2NAPA 4LY3A 2R9VA 3X0DA 4QBFA 3N20C 5DOZA 1I94B 1MDFA 3E9NA 3PFHA 5BOSB 1HTQA 4M8NE 3M6WA 2WK1A 4L73A 4KBFA 3VPBA 4DBZA 1ML4A 3KQVA 4KK3A 2WAOA 3C5GA 1F17A 5CHWA 4GZMA 4E4TA 2QEQA 3RCBA 1SB3C 3B1JA 3L2OB 4UE2A 2WYQA 3DBLI 2WIKA 3LF1A 4IDOA 2R44A 2IPXA 4NMWA 3D8NA 2PLFA 4M2LA 1CKEA 4DUGA 5K09A 2RHWA 4O59O 3LOPA 1LM8B 2JH3A 4EQ6B 3O1JC 2FSIA 3GFFA 4R8RA 2NVUI 4H1HA 1Y4AE 2OG1A 2VKQA 3VJKA 4JI6B 2M17A 4AWXA 2J3KA 1X2IA 4RT3A 4PIPA 4DWIA 2NU8A 2WXMA 2VTDA 4TYYA 1OAOC 3KJGA 4QU8A 2BVCA 2QVYX 1T9GR 2WE7A 3FFWA 3EF1A 4R9SA 3LFUA 4XLTA 2A84A 2BR5A 2AX4A 2DFVA 1EKXA 1X74A 2ZZMA 2AW3A 5CNJA 2WX1A 2AKAB 4WQOB 4EZ9A 3U17A 5CB1A 1U3DA 5FJJA 2XKAA 5AHXA 2IOFK 2OXOA 2D11A 2B0CA 1QSYA 3R0VA 3FMFA 2HJRA 1XRSB 4KR6A 2V7BA 3ESYA 5AXCA 4UCXA 3MR2A 2LVOA 3DHVA 1UXJA 3ZU3A 3OEEA 5SZIA 3HEMA 1G20E 4KLGA 4XYMA 3B6MA 3A8TA 1Z13A 2QN1A 1UDBA 1QDLB 3P9CA 5K0SA 4ED1A 3A1SA 4PZCA 3CB4A 4QPDA 4WAFA 2KLGA 4BASA 4MRVA 5FLXA 1LNZA 2GCOB 4MV0A 5HM8A 2M98A 3L1UA 1OIWA 1WYGA 4I2JA 3EMKA 2JCBA 2INGX 1K7FB 4LJYA 3RGGA 1XZLA 1JROA 1KMMA 3M3DA 3EK2A 3FX2A 3EB9A 3PGXA 1U4NA 1RACA 3DAGA 3PWZA 3TTVA 4U7FA 5IS2A 1JYEA 3H5LA 3TG8A 5IWAB 2YN4A 2DKZA 2A1UB 4Z7NB 2PGAA 1XRRA 3QOXA 2EAMA 3KSBC 1TQ2A 1B8VA 3GYGA 3NFRA 4YIKA 1M6EX 2CL7X 4NJMB 5CFPA 3H16A 1F2VA 2IA6A 1KXJA 2C60A 1AURA 1OX5A 3DEAA 1LQUA 2FXVA 1ADFA 1W87A 2A19A 3OQ6A 4XPIB 4EKUA 3ENZA 1CF9A 4BNZA 1JSXA 4RGMA 1FU7A 1EB9A 3RF7A 2WFAA 2DF4B 1SO8A 3R40A 4I81A 1J5EB 2QG6A 4DIUA 2K8BB 3L6UA 1RLMA 4J76A 5KKNB 4LNUB 2V6BA 1E3TA 3VKWA 4LNNA 3FNBA 5U1PA 4QYMA 3GXBA 3RFZB 1GV1A 1U9YA 4PNHA 4F91B 4TLBA 5IC5A 2PQ0A 4P22A 2I6FA 1XI2A 1K97A 2X77A 2CUNA 2MJ3A 2MYPA 1VRAB 4K03A 4YJ2F 2BI4A 5EKTA 3IQGX 4CEJA 5H68A 2HXGA 3FYCA 4IGIA 1CZHA 4YAGA 5BVGB 3PUZA 5L6MB 3WBBA 1W36B 3URYA 2WHYA 3P9YA 4A36A 1CT9A 4O63O 4YLGA 1KNQA 3WQBA 4NFYA 4M6WA 5C9ZA 1QFXA 5JJ5A 3T34A 3WWEA 1WXEA 2BKXA 1KHTA 3IV6A 1P73A 1ULHA 4DMMA 3JQBA 1JILA 3G68A 3UT6A 2H2WA 3T7TA 1J20A 4PRZA 2REXB 2ACVA 4ECQA 1ST3A 5BRAA 1JG3A 4UE6A 4U7JA 6ABPA 3FVQA 1CS4C 1SV0C 5AUNB 3W7VA 3ZCVA 4P4SB 4BLPA 3MWFA 3F97A 1YKSA 3OURA 1JF8A 5CLHA 3OJLA 4BDSA 2EU8A 1IBSA 1XRNA 5ALVA 5FTWA 2IO3B 4RFLA 4ZO6A 1KWGA 1U9ZA 3NXSA 3RU9A 2J33A 2JXJA 4QD3A 4K88A 4ND8B 2V58A 4QYSA 5CXQA 3JX9A 4EPVA 3NTQA 2OENG 4E51A 3NUHB 3BK1A 4N59A 1U1EA 4MYRA 4IJKA 4BRUA 5CVCA 4KXLA 3H87A 4KQGA 1W4AA 1LBEA 2W3RA 2BFBA 4OSEA 2HF8A 2DL0A 8OHMA 4LZAA 2G04A 1EM8A 5AI6A 4HAUA 1H5UA 2B0JA 2PWYA 3AQIA 1O96B 3M6AA 3GLHB 3KK0A 4FE7A 4BPBA 1BGVA 3UMFA 2O57A 1JAXA 5LB2A 4QZAA 2P9ZA 2IHUA 2JEJA 3F74A 3FOBA 5JBNA 5G02A 2GAIA 4YJ3B 1QFMA 1W9MA 2YYAA 4JBGA 2O0KA 1S1QB 3PY8A 5JQGA 1V7QA 1IWPB 1DK3A 2J9YB 2B4RO 3V4FA 2RC5A 4X94A 4NZNA 4N48A 3QWFA 4RS3A 3OX3A 1GUYA 3R5HA 2X86A 3ROFA 4D9IA 2DFKB 2H1HA 4YRDA 3REOA 3QPWA 3HFJA 4RM8A 3LXUX 3DO6A 1IOWA 3NAGA 2IIVA 2VRCA 2VUSA 1RPZA 4PEVA 4DL5A 1ZQKA 2B78A 4HJXA 3OLWA 1TQ6A 3H7SA 1NK4A 4GLOA 4NCXA 3N4MB 2EL7A 4X97A 1Z82A 2NPTA 1X8JA 4NLKA 2A5LA 2GKSA 4N0MA 1P6UA 3AEEB 4H7PA 3ZCQA 3RC1A 3PMNA 4WKBA 3PJEA 1BEEA 3NZEA 1NVDA 4HDMB 2UU7A 4TKUA 2V5UA 3FAZA 1V6EA 2X2EA 1KBUA 1XEEA 1JHZA 3LUFA 2QT1A 3IM1A 2PLPA 2FQ1A 3DVAA 2MJEA 4P3OA 2VUUA 3RAPR 4IM7A 3DBHA 2OCXA 2CVZA 5IVPA 5FPTA 1YK1A 4ZV9A 1F8FA 1ULBA 4Y2GA 5EFZA 5A62A 4FDMA 4RNOA 1J8FA 4JR1A 2FMHA 4TMAB 1Z75A 3W4JA 3G23A 3K15A 1PQUA 3DE7X 4V03A 3FFTA 3GA0A 1QQRA 1AOXA 2OB1A 1D8LA 3F6CA 2W55A 1SVWA 1WGYA 2H1VA 4IIDA 3AG6A 2VYFA 4YP6A 4GX2A 3AQEA 4UB8U 1HFJA 1NJYA 4K9NA 1AUPA 3BQ7A 2NUAA 4K2HA 1EM6A 5KSWB 2JLUA 4CLHA 3K09C 2IS4A 4GKVA 4I1RA 3UOGA 1N7JA 1AKWA 1GA6A 2GXSA 1U7OA 1E64A 1WMHA 4EMBA 3O84A 2X2FA 3D59A 5B1DA 1OASA 3SYKA 4H6PA 3CRVA 4OJTA 2JJMA 3DOWA 2C92A 1B76A 3UCEA 1CRQA 3WL3A 4CU2A 3P97A 2XK5A 5F76A 2YNMA 1HO3A 2JC3A 2H5JA 3FR7A 5BUSA 3IT4B 1IN6A 5GTIU 4C56C 5IYZF 4F4YA 1KAHA 5DNCA 3E2IA 3GJRA 4FHZA 3GEGA 3JCZA 4JAVC 1Z62A 1ECGA 1UBOS 1QCCA 3WK7A 3IOMA 1ZDMA 4DUZB 4MEAA 5A71A 2G6TA 1RIFA 4W5HA 4AX8A 3DLHA 2NBVB 4X61A 4ECTA 2OCPA 2JA1A 3RF6A 2ZE6A 4CR6A 4M9JA 3TSOA 3IVFA 1E5LA 2ZNVB 4FB4A 2HUPA 2OV8A 5C31A 1YJ1A 1TVMA 4IG4A 3M4JA 1PGBA 1UDRA 1U2DC 3GWZA 1ET9A 2VHYA 3K9OB 5JRDS 3RB4A 3G2NA 3V7LA 3BF7A 4ZVKA 2B5VA 3CRQA 3G17A 5C18A 3DHIC 1P29A 4BKQA 1R0WA 4MI9A 3V8EA 4MP6A 3T0GA 2P4HX 1KY2A 1C3EA 1XSPA 3KEQA 3SJAA 4CXMA 1NPYA 4PICA 4ARUA 4FW8A 1U3TA 1STOA 2A1TR 1O87A 5DN6A 2W4QA 1EWTA 3NOQA 2XNAC 4AQ7A 1TE2A 4Q3KA 4LY6A 4W9DA 4QIWF 4I2AA 1E32A 2A1JB 4TV9A 3AY6A 2UVRA 3TMYA 4JKOA 1Q83A 5JBQA 1YNTE 3OU7A 4JVOA 3G8YA 3WA7A 1D04A 4YMMA 1CUJA 1XPJA 3GNQA 5AVQA 3DBOB 4BX0A 2Y6VA 1MC4A 1S8NA 2RDIA 1I8TA 3FPBA 4DL3A 4WPGA 2J53A 3F49S 5FQNA 1OYYA 2QRPA 5BSGA 3KQLA 3TG2A 3P9ZA 1W4BA 1R66A 2AW5A 2VPPA 1T1JA 3Q8LA 3W5VB 4H17A 3AH8A 1EFTA 2E4AA 5KC9A 3GJ4A 1WDMA 4H31A 5KJFA 1YIDA 4JC4A 3OCXA 3E0QA 1IUOA 2YIVX 1GYPA 2BUAA 4KZPA 4O5CA 2KW5A 4BFCA 1RKBA 4TRMA 4IUCS 2OR3A 2UYCA 5L51A 4OHJA 2FGJA 2V7QA 5GV8A 1VCBA 4YAIA 3OPVA 3KVFB 1RG6A 1SB8A 2CVOA 2ZOSA 4E5NA 4YRCA 4AMUA 2WXKA 3H2GA 1V5GA 1WUYA 1QWOA 3MERA 2Z9DA 3ZU5A 3KUDA 2GZAA 1ZSVA 1UQUA 4KLLA 4U00A 2ZM5A 4UM9B 4QDXA 1ISPA 2AFIA 1DAEA 1CUEA 2FMKA 4IIJF 3VDZA 3KEGA 4UEJA 1QZ3A 1PK1A 4LDZA 3OJSA 4PLCA 4IDGA 1E3JA 3EGEA 1UGMA 2XYPA 2QB5A 1G3RA 1V26A 5AVYA 4IOMA 3QLTA 4ABYA 4GR9A 4X1IB 2NXWA 1GB1A 4LY0A 5FOTA 2MEKA 4B87A 3U7EB 1S1CA 1HLPA 1WGDA 3IIEA 4G0YA 1J42A 3ZYZA 2FEAA 3VR4H 4YQWA 2KYRA 1ENZA 2H1LA 2AQIA 4J2OA 3F73A 1ZGJA 3ZJTA 4R05A 3RF9A 1E4EA 1FFHA 3WNDA 4JL8A 4I2FA 3LHDA 1SL2A 2NTTA 1XLOA 4TZ6A 2QEJC 1ZGUB 1K8RA 3RBZA 1Y8CA 2H59A 2B61A 1U9IA 2OJWA 5HUQA 2XVZA 4KNVA 1AK2A 3UUEA 4CFSA 1OD6A 4JC8A 5TIIA 4AF6A 3MQ4A 1XROA 1OOEA 5FD8A 3ELWA 1L1EA 4B44A 4ZK2A 1OH5A 1JYSA 1UT5A 5I8ZA 2OYRA 4RD6A 4EFOA 1VYVA 4LYDA 2Y1WA 3DKVA 1NPTO 4WUVA 3V1TC 4BCBA 4EEWA 3A10A 1CQXA 1S5PA 3DEHA 1ZUD1 2NW6A 1E9MA 2R6R1 4N12A 4DQRA 1ZQGA 3IAXA 3CYMA 2W7PA 1CIVA 3EXEA 4IQWA 3NPAA 3R3HA 2PW9A 2WQYB 1DTWB 1KS9A 3UV3A 3DMRA 4TV8A 3ZD9A 4F9FA 4RTJA 3VNQA 4EMTA 1SC1A 1II9A 5YASA 2BGIA 3AIMA 1IP9A 2FE9A 1K1SA 1ZFNA 4TPKA 3FUWA 1AKQA 3EEBA 2J3HA 3RNOA 5CFNA 1YCHA 2V97A 4LJ6A 1LDEA 3I3TB 4QUDA 4R16A 4MWGA 4F7ZA 4OHWA 3W6PA 2O2IA 4XFJA 2K0PA 3VR6A 4AXBA 2HHAA 3C41J 2UUPA 4BQOA 5DT2A 1T4CA 4PXSA 1DOZA 4GECA 3W34A 1AMNA 1TF5A 1E2DA 1R0RE 1SXJD 3K92A 1C4XA 3SJZA 2V7TA 1YRQA 4DV5B 1MOZA 1E0DA 1Z74A 3VVCA 4ZO9A 2AQ3B 2EBFX 5HRUA 3TE7A 1X6VA 4EM6A 1C78A 3Q3EA 3UKDA 3I83A 3EZLA 5LLIA 1Z39A 3UAWA 4DJFC 3FN4A 3V6CB 1G21A 4J9VA 3MCWA 1G8FA 2PVOD 4DSLA 4U2GA 1QIDA 1RP1A 1QQAA 2C7OA 1ZL2A 4DWFA 1I3KA 3VR4D 4BZQA 5CNKA 1DYQA 4QA9A 4QOHA 2BGFA 2BZFA 3WE7A 2QSYA 3NB0A 1LJUA 1ZU5A 3IPXA 4UUQA 1HT2E 2W6CX 3O9ZA 3RFAA 4ISBA 1HETA 5ICMA 3IHPC 3KVVA 4D4HA 5KREA 4MTLA 3B53X 1M5RA 1AU9A 2HDHA 1BC5A 3FKSA 3RS2A 3WGYA 2EWVA 3WP1B 5EMKA 2OBYA 3QAQA 3COJA 5SZJA 4REOA 5LA6F 2O7NA 1NV9A 3GJQA 2DU8A 3AE6B 2H2IA 3A31A 2BEWB 2K25A 5ULLA 1GKIA 1IQ0A 4FXCA 3FGZA 1JTFA 3DC2A 2WHPA 3LPAA 4KLCA 2G63A 2C8JA 1TYDE 3CBGA 4AYWA 4HKZE 1R4ZA 3I45A 4M98A 3KXIA 4RIFA 4DGSA 4OB6A 2XMSA 2X19A 1NKVA 3MHTA 1M67A 3VPDA 2XCSB 1N1EA 2EFJA 3D7RA 2PBLA 1F0ZA 4UB2A 1SURA 4Q02A 2CNKA 3O2JA 2AG5A 3G82C 3K9QO 1SIJA 1FSGA 1JDUA 1M34A 4RE6A 1ZD3A 3NIDB 5A0FA 4O2AF 1J90A 3CLTC 1U99A 4ZMSA 5JAHA 1JH9A 4KPGA 2BGRA 1A3CA 4RJJA 4BQQA 2KWIA 2Z8ZA 4F5NA 1KFTA 4LIPD 1PNTA 4DQKA 5GONF 1F0YA 3EIFA 2W22A 2ZIFA 3DPIA 4Q9HA 1PRYA 3JVDA 2VDMB 1SE4A 1X14A 3OFND 4MVJA 3V4OA 4GLLA 2Q4DA 2XI9A 3LG2A 4TTRA 2ZITA 1YJXA 1BCRB 3TTYA 2D3DA 1RWNA 4ZALA 3JXEA 1LV5A 4EYOA 4CN8A 4BBPA 5I9LA 1YXMA 1B9RA 4E13A 2QZJA 4ZAYA 3QJGA 1DIBA 2EMTA 4C4SA 5IM5A 3W8EA 2XQFA 2OAQ1 2JATA 1GAJA 1HFEL 4DGQA 4DV7B 1LFDA 4JBLA 5E9WA 3IHWA 1ZGAA 5JI3E 2JKZA 3VH1A 2QX9A 3JAWB 1Q6YA 4CM9A 2GD1O 1HXYD 4FQ5A 1THGA 1UPXA 4K9MA 2CMGA 3J9CA 2JW5A 2WXJA 3GPCA 4ARBA 1XXGA 3TCNA 4X1KA 3IVGA 3SJCA 2RD2A 3DKPA 3CLRD 2O3UA 2QN6A 3VAWA 2PT5A 4XD7D 3LDAA 1KERA 2W2LD 4WLOA 3D32A 3IDOA 1P1BA 5F2OA 4ASUD 3FLBA 5L7YA 4H15A 2BS2B 1UFQA 1J09A 3ZLBA 3TQIA 4GR5A 5IHPA 1CQWA 4PHAA 1FXWA 5I3CA 2W6NA 1IUEA 1VLJA 2EAPA 2JEGA 1WI0A 2C1ZA 1SJED 3ZEIA 1DQZA 2BGLA 4D25A 1D9ZA 2LUOA 2XYVA 1Y5RA 1YULA 1DT5A 2GHQA 3CZQA 3NEJA 4BNUA 1EVKA 9ICPA 2H2DA 2CR5A 4MLZA 1J2RA 3M82A 5T57A 1E4YA 4C5AA 3FSRA 4LOJA 4BOYA 4Y2JA 3R5TA 4RPCA 2PXAA 1FPYA 2CVFA 2DY1A 4GD3Q 1T13A 1KEVA 4A8HA 3LNCA 2EMSA 3TQOA 4FA6A 2AR0A 3REQA 1F77A 1ITZA 1X1TA 3RUIB 3JWJA 2CBZA 4FSHA 3IE2A 2RKOA 5DYNA 1FFYA 5EHQA 4LBZA 4YCBA 3NT2A 1M75A 1ISNA 3U56A 1FEZA 2OO5C 4YJFA 3KFXA 5DOVA 1LWNA 1GPDG 1JP7A 4N5MA 4YMIA 2A0YA 4YWHA 5DM1A 4LCEA 2XQIA 2G9UA 2Q6OA 3HADA 1E0JA 2C7RA 3IP1A 3IT6B 4BMPB 3GQBB 4I7EA 2ZRCA 1LC0A 5C4GB 5ANRB 1KI7A 1NG1A 3EEIA 4GM1A 3IAEA 2ZJ1A 4BX8A 2WOOA 2AZXA 5B58T 5JNWA 4D80A 3PEWA 2FN8A 4AW9A 3MZ0A 4Z6CA 5IAAC 5CGQB 3LT4A 4NFLA 2DVMA 1OLXA 2OOBB 1SQGA 3VPSA 4KQEA 2A9OA 1BA3A 3HJTA 2NVWA 2NRTA 2JZBB 3NLLA 3JR3A 3V7KA 3D2AA 2WFLB 3T3EA 2OVFA 5C2TB 1PEDA 3M9WA 1CP3A 5BQ3A 3HCEA 1ETUA 1BXRA 3SQNA 4ZHQB 1F4LA 3WIEA 3THWB 3N9YC 3ADKA 2J4XA 2PLWA 5ALXA 1XO1A 1U1GA 1JLHA 4QVKA 2HWYA 4KH1A 1FY2A 2IZ6A 2J45A 4MXDA 1CETA 4MEJA 2G17A 3NBUA 2CK3D 1NVFA 4WJQA 4I28A 2A0XA 3NO4A 4HUTA 4UB5A 4BATA 1KZ1A 4NLNA 4B9MA 2BW2A 2EX1A 2K60A 5LMCA 2PBRA 4NICA 4YVZA 3E9QA 3G02A 4OGGA 5K3OA 4M49A 3K70C 5L3QB 5IHXA 1NK5A 5GPBA 1C9EA 3LKZA 1UZMA 3JYQA 4GVXA 5HF9A 3H1UA 3K09A 2R2QA 4GP9A 6REQB 1A97A 1S7CA 3ROPA 4BGEA 4WVLA 2G9HD 3ONFA 2D2IA 1FXIA 1QBGA 4NFHA 1Y7HA 3CLUC 3LBYA 2Y5PA 1TA4A 1HDXA 2C3OA 2J0SA 5ADVA 4CR8A 4C4VB 1F2DA 3HCOA 3WY9A 4CT0A 3P9KA 1E2HA 1FYEA 1IN8A 4M7RA 3L9WA 4ZC1A 4RVSA 1K86A 4ZZ1A 5A0TA 4HZGA 4N5IX 3DBIA 2JDIA 3JQ7A 3G0IA 4KL8S 1P1JA 2XTJA 4LJ4A 2NO0A 4WERA 4MI6A 2ZRBA 2XJ9A 4O4IA 1OXKB 1GQYA 3E7XA 4WLFA 3Q9SA 1Q95A 5KFCA 4INAA 2Q9UA 1W76A 4WAUA 1I3CA 1YT3A 5BQ5A 3KXDA 5BYBA 4A6EA 1U5AA 2MX2A 1HQYE 4IMIB 4H9GA 3SEZA 4UUAA 2D1TA 3HT3A 4TMTA 5DRYA 2KAJA 4I5FA 2QTVB 2PDAA 4CM5A 2FLKA 4HD8A 3SR0A 4U6NA 5U4QA 2X0RA 3L5OA 1I4PA 1E9VA 5JATA 4D26A 4BNHA 3RSOA 1QQBA 4XQ0A 3HNPA 4XGNA 5J4KA 4QDZA 3SIRA 2ASQA 2CDAA 4CM4A 2EJWA 3VC2A 1MQ9A 4X65B 3DZHA 4MGYE 2PMEA 5LQCA 1PFYA 1ODIA 1DAFA 3RUHA 1O0BA 2CZQA 3TO5A 1XVVA 3ANYB 3CO5A 3UIPB 3UQBA 3LCCA 4CM8B 4WKCA 4FFBA 1HYEA 4Q1CA 3R8XA 1KFCB 2J4CA 5I5EA 5AI8A 5BN4A 3B82A 3BQ1A 4WFQA 2FWJA 4GWLA 5EEHA 1RI5A 1AARA 2BSQA 3TUIC 4MPJA 1Z5SB 4LDRA 5KG1A 4EKDA 3T5BA 1OEYJ 4HVBA 1LRKA 2VZ9A 4B7XA 5BN3B 1PVDA 4N0DA 1EK2A 1N5MA 5EIOA 1VOTA 1NIJA 2D8MA 2JR5A 3OP1A 1YB1A 2GLSA 1E1DA 1N6LA 1SM4A 3CE9A 3WXBA 4WLVA 2I3ZA 1SV4A 2ONQA 3E5NA 3L7LA 5JT1A 1TQ8A 2VPZA 4XXHA 3NVWA 4PTZA 3RR8A 5GP1A 1ABFA 3GLVA 1ZK1A 2TYSB 2W04A 4BVBA 2MYTA 3B8HA 1M6HA 4WY2A 4HTAA 5CYOA 3MJRA 3TX2A 1FUKA 2VK8A 2CKMA 1JFFA 3VKFA 8ICXA 1UBHS 4RZ2A 5CB4A 1C7YA 3U4QA 2E4UA 2JIPA 3DLTA 4AJ4A 1L5SA 3QJZA 3JQBC 3L6DA 5SY9A 3K0AA 2XPCA 2AGOA 1IDN1 2A6PA 3QE4A 2HSEA 2E48A 4GMGA 5G5HA 3W7BA 1J2NA 3PNVA 3L54A 1H2FA 3WWOA 1X9SA 2H18A 3FVRA 4UHJA 5CNMA 2XYRA 4K2AA 1B4DA 4K6KA 5E6RB 5KFIA 4PFSA 5JV5A 3ZQ6A 4AKTA 1N6KA 1P2TA 3WFZA 3HY3A 4WBNF 4QDUA 4L07A 4C06A 4DSNA 3ROKA 1IB6A 4K6OA 3D6VA 4AZTA 4QZBA 4KACA 1EX9A 1KIAA 4LF7B 1JKJA 4H16A 2FQWA 3LQ2A 3AU9A 3UYKA 4GFDA 3PITA 3TQHA 3K9PB 2V96A 4PFJA 4ECSA 4R66A 4KVGA 2GN8A 1TK5A 5EIHA 3HZHA 3TKAA 3WYNA 2BFNA 4X3PA 3N8DA 3QVSA 1YJQA 2VTKA 4BQFA 3MRVA 3PFNA 4NX2A 1CYEA 2LDXA 3D5TA 4EJ2A 2CYAA 3PGA1 3UN1A 3I28A 3TFSA 3A6FA 4C08A 5BPCA 3VAAA 1G3IA 1XMSA 2GILA 4DAOA 4PG7A 3IR7A 4JJKA 1PDWA 5BOMA 1EK1A 1H8HD 3DBRB 4HLCA 4MUYA 4GBMA 3LLUA 4HEA1 1PZXA 2W58A 2YZMA 3P8ZA 1E8WA 5F7XA 1YB4A 1UBTS 3Q3NC 4FZ5A 4ZEWA 3WIUA 3TEZA 3VGPA 5G0SA 1WH3A 3GRAA 1CJUC 3LC7O 1OZHA 4DXAA 1CY0A 5EMMA 2PV0A 1F7UA 4HNQA 3JQ9A 3WO1A 2O23A 4X1YB 2GYVA 3I30X 2IGBA 2R6CA 4YXWD 3RYIA 1NBWB 1OPRA 3MC9A 4C04A 3AEXA 3KQUA 1BU5A 3P71T 4MMXB 2WXLA 2B6GA 1XK6A 1Z26A 2N9KA 1Z7GA 2PVCA 3O8RA 2IHKA 4R2MA 2SICE 1TU3A 3G13A 4RHCA 3CH7A 5D51S 4EJMA 1TC2A 4OLJA 2EG9A 1PE0A 4KX3A 3V8BA 3PHCA 1GC7A 4RDIA 1ET6A 1A96A 5JNUA 1JSRA 3GGGA 4ZZ2A 1WXQA 2LR0A 4C8KA 1COZA 1FFWA 1DCTA 2CNBA 3W90A 2JH7A 1R0SA 1VL8A 3KETA 4MV7A 4HRYA 1XA3A 2QN8A 2OTCA 1KZ9A 4DJ5X 2I3DA 4LHYA 1IBRA 3VUFA 4WH4A 3MUOA 4UB3A 1ILWA 2NACA 3EZ6A 2I5HA 1T0IA 4J3JA 3LB8C 4LTNA 4BUZA 3N7UA 1JFLA 4HPXB 3WB0A 4UU7A 3TMKA 3S5JA 2ZANA 3OCVA 4ZDIA 3DNMA 3KPWA 3KQPA 3QITA 4ZCSA 4Z9YA 3AR9A 3P0RA 4ND2A 4ND5A 2JZZA 1AJEA 3L02A 2HT6A 2J0JA 2W2PA 4Q6BA 2YZNA 2WJ3A 3C3DA 2AQ0A 1CRWG 1Z63A 2IE0A 4O9MA 1Y9DA 3QW2A 1ZAYA 1NHGA 2CD9A 4ZPXA 4J9LA