4QIWC

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
380
structure length
369
Chain Sequence
IKSMVSKAELPDNIKEELYAKLIEYNEKYKLKKDEIQAIIDETVREYQKALIEPGEAVGTVAAQSIGEPSTQMTINVTLGLPRIIEIVDARKNPSTPIMTVYLDEEHRYDRDKALEVARRIEGTTLENLAREETIDILNMEYVVEIDPERLEKAGLDMEKVVRKLTGSFKSAEFEAEGYTLVVRPKKVTKLSDLRKIAEKVKKHRLKGLSGVGKTIIRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIWEIAEVLGIEAARNAIIDEIVSTMREQGLEVDVRHIMLVADMMTLDGVIRPIGRHGIVGEKASVLARAAFEITTQHLFAAAERGEVDPLNGVVENVLIGQPVPVGTGIVKLAMSLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 61
structure length 369
sequence length 380
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwC02
4AYBC 4QIWC 2WAQC 3HKZC 2Y0SC 2PMZC 2WB1C
chains in the Genus database with same CATH superfamily
3RB3A 8ICUA 4KLOA 3K1ZA 1B0XA 4UAWA 2A3VA 5J2JA 2NV3A 4UBCA 1TFRA 4ECVA 3G6VA 5J2FA 2K8AA 4I28A 2OHFA 5DQGA 4YFKA 5IINA 8ICPA 3JPQA 3MBYA 2LYAA 5JTIA 3RR8A 3FM9A 3ISDA 9ICIA 3NTUA 3IN5A 1D9FA 5FP0A 4O9MA 4QZIA 1KFSA 4UB3A 2J6SA 4DQPA 4KLLA 5KFWA 3TADA 5HMLA 3DV9A 2F76X 3HWTA 2DUYA 1MSWD 2JH1A 5IIJA 3C1YA 3IP4B 1UHUA 2H5XA 4BWMA 5F3XB 3NGDA 2W55A 3I28A 4R64A 4K4GA 4DOAA 3O0FA 2HHVA 5DQIA 5ALHA 1IV8A 1NJZA 2KZZA 2IOHA 1TAMA 5J2KA 4BX9C 9ICTA 4O3MA 4OD0A 4C4RA 2AXTU 2ZTCA 2WF5A 3GV8B 3OJUA 4P0QA 3ISCA 4UB5A 2H3IA 2VANA 2QLTA 2KJ9A 3SYZA 5ALNA 5KFFA 5EE1A 1L5UA 5KG4A 4NLNA 4U6PA 4TUSA 2BCSA 5AI9A 3B0YA 5AIAA 5AI8A 4QWAA 4RQMA 1X9XA 4BXOB 2KHVA 3L5KA 2EAPA 1BVSA 3AU2A 1V85A 1J97A 1RDFA 1X9SA 8ICHA 1LKYB 2W9MA 2H3FA 1AQ6A 2G5HB 3RJFA 2XC9A 5ALQA 1NZBA 3NVVA 3SZ2A 4FFDA 2A1JA 5KFRA 3V7JA 2OEHA 3Q8KA 4JUZA 4DSKA 3NVYA 2Z7JA 5DGBA 2E8MA 1HUOA 1RXWA 1S10A 5EE3A 4M9HA 2KFZA 5B66U 3C2MA 3GV7B 3RH4A 2ZG6A 3MFHA 1XWLA 4NL9A 3SAGA 1C20A 3ZI4A 3RAQA 1ED1A 1UT5A 1AROP 3WKCA 4MHVA 2JV3A 4F4XA 2BGWA 2J6TA 3G6XA 2K8CB 2VA8A 1URJA 3AQEA 5AKZA 4OJ6A 5AKIA 5KFDA 3FC4A 3TACB 4UATA 5KTQA 3MR5A 2VA3A 4ED3A 4B6JA 3GIMA 3F2BA 4RZRA 4F8RA 1VLBA 2EAOA 1JI7A 2I1QA 1ZJNA 4QIWC 1Z1BA 2Y1IA 3TAQA 2Q0ZX 1BNOA 2ZUBA 3UM9A 2LPEA 1ZQOA 3PX0A 4RNNA 3BQTA 3GIKA 3C28A 1RYUA 4R8UB 2B0CA 1O08A 1ZQKA 1EXNA 4B9MA 3TFRA 5D4BA 1JXEA 9ICSA 1MQ2A 4YXMA 3SV4A 2HOIA 4DOCA 2MA1A 2KK0A 4XRHA 2ZIWB 2BDUA 1FEZA 2R8JA 2ALZA 4DSLA 2DL0A 1D8BA 2KN7A 1X2IA 1XO0A 4FBTA 5J8YC 3V6JA 4KN4A 2G07A 3AUOA 3QX7A 4XUSA 2DF4B 5EE0A 2W03A 3RAXA 2BR0A 2K4HA 1L7OA 4PHDA 2IOFA 1F44A 2JXJA 4YCXA 1BNPA 1A6SA 2BKEA 3OJSA 2WAQC 3BS5A 5TISU 1TAQA 5J2DA 4ELTA 4KLUA 2UVRA 2HDOA 2XY5A 1HJPA 3SD7A 4GC7A 9ICCA 4NWIA 2W54A 4F4YA 3N7RC 5AM4A 3TANA 1XU4A 4M2YA 2JZBA 4IRCA 1L3UA 3J81j 4YMNA 3PX6A 3QXGA 1HEKA 4IR9A 5JRTA 1QSLA 2W9CA 3OSPA 2KP7A 4M9LA 1ZQYA 1ZQBA 3OHBA 7ICEA 4DQQA 2HBLA 4GXJA 3Q8LA 5J2CA 7ICQA 1T3NA 2MUTA 2DKXA 1N63A 3AM9A 7ICPA 4NLZA 1BPEA 4O3SA 4DWIA 2HMXA 2KFNA 1FO4A 5AKJA 4RUCA 3EYZA 5KFLA 2RHFA 1JN3A 2DWQA 3H7IA 1Z19A 3Q8RB 9ICVA 2ZJ8A 2WAQF 1P7DA 4RQ1A 1PVPA 4RPYA 2OWOA 2E8NA 4DFJA 2EQYA 3RJIA 4KTQA 3PO5A 4NLKA 4RPZA 2HBJA 4ZOHC 3OGUA 2XY7A 2YMQA 4C7YA 1ZJMA 4J9NA 1N56A 4FZLA 4C8NA 3KFUF 2BPFA 3BQ7A 4F2RA 5J0PA 2V4QA 1IXRA 1COOA 3D6JA 5KAFU 2CN1A 5DGAA 2XO7A 2BDPA 2K4IA 1X9WA 4LZDA 3QU4A 3H4DA 3UPQA 3EUB2 2L5YA 1XC9A 2E8PA 5ALYA 2KKPA 3SENA 4DL5A 5ALUA 1CI4A 4U7CA 3OSNA 5KL8B 4KLFA 3DDHA 5KG6A 4O5CA 5AKXA 8ICNA 2LM4A 3TADC 5EWFA 5ALRA 2D3DA 2W3SA 4KLJA 1X40A 1ZQVA 2RP5A 4YN4A 3PNCA 7ICFA 3A0HU 3L3FX 5DG9A 4M9GA 2GWSA 3MC1A 4M47A 1ZQCA 2F77X 3WKAA 3NVZA 4US8A 2IBKA 2UVUA 3N97B 4DFKA 1S0MA 2OCEA 4Z6FA 2GOLA 4OJPA 4M9NA 2KZ3A 4RNOA 3LWLA 4CGZA 1UA1A 2PFOA 2XGQA 2UVWA 2KE7A 3WK9A 2IHMA 3FAHA 4O3NA 4AYBC 3NVWA 3GZFA 1XSNA 3RJGA 1COKA 5EWEA 1X6IA 2HBMA 2W9BB 5HP4A 5IIIA 1YZ6A 4C7ZA 5AM2A 5KFBA 4UAYA 1NI3A 2RDJA 1F0MA 4JK1A 2KMDA 3Q8PB 3D2SA 3VCBA 4PH5A 1QSSA 1WWUA 2W43A 4KLTA 4R65A 4FZNA 4DQRA 1Z3EB 3RBDA 1J2MA 1SL2A 1ZQEA 3F53A 1B4FA 3ICXA 2HHUA 4CDGA 3QYPA 3KZXA 7ICVA 4IQVA 2HHWA 4I29A 2ES6A 2ODGA 4M04A 4JWMA 1ZQAA 3T5LA 1U48A 3L4PA 2BCUA 1PK3A 5L1JA 5L1IA 4IQWA 4AYBF 2DKZA 4NL9C 1IG6A 4LJXA 4ED7A 4O0IA 8ICSA 2IHNA 9ICRA 2G09A 5KT5A 2NRVA 4BXOA 3MFIA 3K75D 2NYVA 4MEXA 3M6ZA 4BUGA 4R66A 1SGGA 3IG5A 3MGHA 2P6RA 1LKYA 3LVWA 5EOZA 5L1LA 1TK5A 4R63A 2AGOA 1BPYA 2WF7A 5KFUA 2Y9TA 4QNLA 8ICKA 2HBKA 5KL1B 2F3NA 9ICEA 4J9PA 4NXZA 3ETLA 4PPXA 4ECTA 1XSLA 2DQNB 9ICMA 3TARA 4O3RA 3HPOA 1K1QA 5J0OA 3JPTA 2W04A 1B43A 3PSIA 3C5FA 4EYHB 4QWCA 3GILA 4ELUA 3RR7A 5GTHU 4QZ8A 4RPXA 1TKDA 4ACOA 3BZKA 5A0LA 4I2IA 5DG7A 5DKWA 1S0NA 2PMZF 2Y0SF 3QUCA 4O3PA 4Z6DA 3T5HA 2OM6A 3F2DA 8ICAA 3NASA 4DF8A 4DL7A 1S97A 4FE3A 2PI5A 4DL6A 2ZUCA 3H8SA 4QJFB 3ETRA 9ICXA 2E1FA 1QQ7A 4G9BA 3ZD8A 2LHTA 1SL1A 3WK7A 4QZBA 2GLEA 9ICLA 4J9LA 1ZYQA 3LWMA 4ECUA 1ZOLA 4DL2A 4Y2XA 4J9MA 3NS1A 8ICFA 2W7OA 3F2CA 4OJ5A 4R8UA 5AKHA 1RYSA 3RJEA 1NJWA 3WK6A 3PZPA 3GU3A 3N28A 3IV6A 1U4BA 3QEBZ 3CNHA 1CUKA 2JR5A 3BS7A 4RQ2A 2GO7A 2RLTA 2ZIWA 1HUZA 3HT3A 2F8KA 2CXYA 2KSOB 7ICMA 2G5IB 5D46A 3SAFA 4F93B 5KG1A 4ECQA 3H4BA 2LYHA 1ZQWA 4KLMA 2M0NA 4FZMA 1KW4A 1V38A 2KOBA 4UASA 3HKZC 4I27A 2ISPA 1DXSA 5KFKA 1L3SA 2FPLA 5J0UA 1RZTA 1SV4A 3M8SA 4DQSA 3BQ2A 4NJ8A 4KX5A 3M9MB 2JEIA 3T5JA 1JALA 5AKGA 4B9TA 5KFXA 4F3OA 2CPRA 4UAUA 1V97A 1FFUA 4F91B 2EZYA 5CB1A 5IIMA 4M9JA 5G5HA 4DSJA 3G6YA 4US9A 4EEYA 5ALMA 4DS4A 5AICA 2PXIA 2ATLA 4PGYA 3V72A 2P35A 1KFDA 3CRXA 3MDAA 4J9OA 2AQ4A 3KBBA 2FLNA 2HCFA 2LBOA 1JXLA 9ICBA 4I2FA 5DQHA 1JMSA 1O03A 4Q8EA 4UB8U 5HR7A 4YMMA 1D8YA 3M1YA 1B22A 3RFAA 2WB1C 1SWWA 4C4TA 1MA7A 5KFNA 4TUQA 2KZMA 2A19A 2DFLA 4O5KA 1C7YA 5ALTA 4RU9A 2YMLA 3OTQA 3K4GA 3QUBA 2NRTA 3LDAA 2G0AA 2GH1A 4JB3A 2KIVA 7ICOA 5KT4A 4GXKA 1T94A 1N5XA 3GIJA 4ECZA 1N5WA 2C2EA 3PW0A 2NO5A 1QCKA 2P66A 3CYMA 1UQVA 4UAZA 4O3OA 2AGPA 1N62A 4DLEA 2M9NA 1LV5A 1JRPA 2W11A 3KOOA 3F5EA 4P4MA 4TQSA 2I6XA 4EZ9A 3OPXA 3PW7A 1H38A 2EANA 7ICGA 5J0RA 1Q3UA 5HNKA 1S77D 2WB1F 4J9KA 1D9DA 3V7LA 3V6HA 5AKYA 1S5LU 4EBDA 1ZQLA 3TI0A 4DCCA 4UBBA 1NJXA 2BPGA 2ZIUB 2HHXA 1TVAA 1Z00B 2ZTDA 5KFAA 1SKWA 3SQIA 1KTQA 3T79A 5AK4A 2XGPA 1HIWA 4UB2A 2ESEA 4B9UA 5KFVA 4GIBA 2A1AA 3BZCA 4FS1A 5ALZA 4F2SA 5AI6A 4KLQA 1V9PA 1NK7A 2CRXA 5AM1A 4IS7A 3MABA 4QIWF 2KVSA 1BGXT 2BPCA 2BCQA 5CA7A 4RNMA 1SKRA 5J2GA 2OYYA 2W9BA 4KLSA 5IIOA 4RQ0A 2VJ4A 4IQTA 4MFAA 1OXJA 9ICAA 9ICJA 2MSNA 3V6KA 1NNLA 2ZTEA 4RQ7A 3GDXA 4JV2A 1NJYA 1T4GA 5DDYA 5KFIA 5KFCA 2ZUDA 3TQ1A 1ZQQA 2HVHA 1UCVA 2EH9A 2QB0B 4ELVA 2XVTA 3UXNA 3M8RA 4IL6U 2XCPA 8ICCA 1JIHA 5JUMA 4FS2A 5IIKA 2BQUA 3QU5A 5DBBA 4IC9A 5KFQA 3D2QA 1FFVA 5J0QA 2BZFA 2VA2A 1CEZA 4IRKA 2ASJA 2XICA 2W8KA 5AKKA 1RQNA 2DPIA 4NM2A 4F5RA 2XCAA 3RH6A 3PW4A 1L3VA 2W9AA 1S9FA 2XIDA 3QU7A 1RYRA 1DGJA 3IHQB 4RQ6A 4GLXA 4F4ZA 1XNSA 4GFJA 4NLCA 4ED0A 5ALOA 1WCLA 5KG5A 3ZDAA 3AQFA 1ZRNA 1KBUA 1SV0A 1Q46A 1SXEA 3PY8A 4KMUA 4O5EA 2Y9UA 4C4SA 1MN8A 4YR3A 5AKLA 4P0PB 3WKDA 2KKVA 1SXDA 1SIJA 3AN1A 4EEKA 4UW9A 1CRXA 1X6JA 3OHAA 2F2AB 4YQWA 1L7PA 2Y1JA 3PSFA 3HW8A 3UMBA 2AQ0A 8ICTA 2PFPA 2ZIVB 2HOQA 3RH5A 8ICGA 2YMMA 5L1MA 2KIWA 1XO1A 5ALIA 2ISOA 4MFFA 4QZFA 1Q8KA 4UQGA 4DOBA 2YQEA 2G06A 2BCRA 5D49A 2DBYA 4JMUA 3E58A 4CCHA 5J0XA 3EW9A 2H3QA 2FMPA 3RRHA 3MGVA 3IDWA 4PHEA 4DL3A 3LVVA 1GO3F 2ZXIA 5T14A 4NM1A 4B9NA 4F4WA 3HILA 3K1RB 1S0OA 2HW3A 4M6WB 3ISBA 4Q8FA 4F5QA 4TUPA 2BCVA 2VKQA 1L7NA 2FDRA 2FJ6A 3NRWA 4EX7A 2QKQA 4Y2RA 1NKCA 4CE6A 4FO6A 4NLGA 1DGSA 2IA6A 5KFJA 1TV9A 9ICHA 1K1SA 2NRZA 4PJ0U 1WG8A 3IG8A 4YG2A 4XA5A 2KSOA 2FPKA 4RUAA 2KG5A 4ICAA 1WCNA 1ZD2P 1NK0A 3AU6A 5AIBA 1QSYA 2K4EA 4KMOB 2V4RA 7ICLA 3HJEA 2N1RA 4AP9A 1L8OA 8ICMA 1DRGA 2BHNA 1ZQHA 4PL2A 5J2HA 2W8LA 3T3FA 2JRZA 3JPNA 5ALFA 4BWJA 4PHAA 4YD2A 4C0ZA 4MF8A 4OCZA 5J0YA 1ZD5A 4QWEA 3HP6A 4Q44A 1U9LA 2NRWA 3TAPA 5B5EU 3EZ5A 1L7MA 5AK6A 2ASLA 4I2CA 3PW5A 4UB4A 4QW8A 1TK8A 3B9JA 5AKEA 2JEFA 2G08A 4J9QA 1U49A 1A76A 2MAXA 1ZQTA 4KLGA 2ZXHA 3QUQA 3LYSA 1SB3C 5J0WA 3SEIA 3CP8A 4YMOA 2FLPA 2JEGA 2HSZA 3ZDCA 4MF2A 3H0MB 3EPGA 3ZDDA 5KFEA 1Z4NA 3RJKA 4J9RA 2I5HA 8ICIA 4I2JA 2K60A 2KNJA 2W3RA 4UARA 4C80A 4A8EA 1XSPA 4GXIA 3KHGA 4C8OA 1S8OA 2JMGA 4F92B 2QB1A 1QLNA 2JHDA 5BPCA 9ICWA 5DB6A 4QZAA 4YR2A 4DFPA 4USAA 5AM5A 4RQ8A 4P4PA 2NRXA 2HHSA 4KLEA 4ZH4A 4F5OA 2K8BB 5J2BA 2FI1A 4YR0A 1WWVA 2HHQA 1SZPA 3SV3A 1T7PA 4ED6A 1RPLA 4QZEA 2PFNA 4Y2YA 1KFTA 5ALLA 5KFOA 3ORYA 4TQRA 5ALEA 3PO4A 2HVIA 2WFAA 2VJ5A 2FMSA 1PK1B 1ZQIA 5CRXA 1T8EA 2E8OA 2ZIUA 1Q3VA 4F72A 1Z00A 2KJ8A 4ECSA 4OO1J 2LKYA 1ZQXA 2ZJAA 4Y2TA 2DPJA 3AEVA 2QARB 1UPHA 4Z6CA 4KN7A 4K4IA 5DBCA 2C2DA 5DBAA 4DSIA 1F5SA 4F71A 4J03A 3BQ0A 1KQQA 2MU2A 4PL1A 1NK9A 5ALGA 5H2FU 7ICNA 8ICJA 1QQ6A 1X9MA 3MR3A 2ZJ5A 5AK5A 5KT6A 3QE9Y 1KRPA 3KKAA 2D6FC 1J2NA 5J0TA 5ALKA 4CNQA 3RB4A 4YP3A 2QB0A 1BPBA 5C0YA 4LVSA 1ZQUA 5G5GA 5KFTA 4BGDA 1KKXA 4MFCA 1KSPA 4NY8A 3M9NB 3Q8QB 2WF6A 4PZOA 1SV0C 5HHHA 4EYIB 3DEEA 4DSEA 3PMLA 4E0DA 3H8MA 5CHGA 1N2XA 3PR4A 1U45A 1ZQMA 3HKZF 1ZQ1C 1DK2A 4RT2A 2D8CA 2YB4A 1OW5A 3QEAZ 2J6UA 8ICYA 3RJHA 4MEYA 3ONNA 3SR6A 1UT8A 1TAUA 3RBEA 1S76D 3HX0A 2YB1A 1Z4OA 4OJOA 2RDIA 3VC8A 2B6GA 3LK9A 4EZ6A 3UXPA 3MR2A 1ZQGA 4ECRA 3A0BU 4JV0A 3QUTA 3H40A 2HI0A 2HOFA 8ICLA 1ZQZA 1JROA 1VDVA 2ZIXB 3PR5B 8ICZA 3H0LB 2IMWP 2PFQA 3GIIA 4F50A 5ALVA 2ASDA 4P0PA 4PHPA 7ICTA 4DL4A 5CEHA 5KFSA 5C5JA 4YD1A 4NV0A 3GQCA 2WHEA 2KICA 1SWVA 1MC8A 1N60A 3CW2C 5J2EA 1JUDA 4XQ8A 3WK5A 3C29A 4B9SA 5KFHA 5AI0A 2KEYA 2AU0A 1FIQA 1NOMA 2E3TA 4CF5A 2ZIVA 4YXJA 3UMGA 3AL0B 3THVA 3WK8A 5KFYA 3C5GA 2AJQA 8ICQA 7ICUA 1RXVA 1Z1VA 8ICRA 2RRDA 3QZ8A 2E1EA 5KG3A 4K4HA 3R9KA 4ED1A 1N61A 5HMMA 4Y2JA 4YVZA 3PV8A 3ZD9A 2LYBA 3ED5A 9ICPA 2KHQA 2WF9A 5L9XA 3M9OB 4UAVA 3FDSA 5L1KA 1S0VA 8ICWA 7ICKA 3C1ZA 4M6WA 2KVCA 9ICNA 1ZRMA 3PW2A 1BPZA 1KL9A 7ICJA 2AGQA 1NKEA 1VJ5A 3C21A 8ICBA 4C8MA 1L3TA 3U26A 1SKSA 1KEJA 3QU2A 2YMPA 3H0RB 1QH9A 4DFMA 3M7DA 2I9GA 4KX3A 3PX4A 4DS5A 2F1IA 2YTUA 4PGXA 5K4LA 4DSFA 4Q43A 3N4MB 1RM6C 2LMRA 4P0QB 3WU2U 4QZ9A 3GV5B 2EZXA 4RQ3A 4JV1A 4Y2UA 3C2KA 3WKEA 3B0XA 2PKEA 4KLDA 4HYKA 1T3QA 3MR6A 1LVHA 2EDUA 4KLIA 1JX4A 1ZQFA 1U47A 2F1JA 5DLGA 2F1HA 2R8HA 4QZCA 4FBUA 2V9WA 5JU5A 2UVVA 4Y2SA 1M6YA 3JPPA 4F5PA 3SI8A 3QU9A 3IM1A 2BQ3A 4F4KA 5ALPA 4LZGA 2FE9A 1LB2B 2OXOA 3N7SC 3SMVA 8ICOA 3UQ0A 2HHTA 4G3IA 4DLGA 3WK4A 2BQRA 1K5OA 4PZNA 2WF8A 5BOLA 2EAMA 4Z6EA 2A1JB 2XY6A 4Y2QA 9ICGA 2B21A 3N7PD 5AHXA 4C8LA 4NLBA 4Y2VA 3KD3A 4TURA 3QZ7A 2KTQA 4RQ4A 5KFZA 4Q45A 3JPOA 2XI9A 5KT2A 5KT3A 1ZD3A 2K4PA 2R8KA 1KN5A 3Q8MA 4RQ5A 4DFDA 3T5KA 2Q4TA 4ECXA 4RQNA 3ZDBA 1NK4A 2AHOB 5ALDA 3FYHA 1ZQSA 2F8LA 5ALJA 1ZQJA 1NZPA 3UMCA 1WUDA 5J0SA 3ALRA 4GC6A 1PUZA 4QZGA 3IRUA 5F9NA 1TK0A 1L8LA 9ICQA 5J2IA 2H3VA 2F44A 5HR6A 3KZIU 2C2RA 2R8GA 1YT3A 4KLHA 3RB6A 2W7PA 1L6NA 3JPRA 5ALSA 3BQ1A 5BOMA 4EBCA 5KFGA 5KG0A 3RRGA 3MGIA 1MQ3A 4IRDA 3Q8SB 3C23A 9ICUA 2K89A 3C2LA 4UB6U 3KHRA 3H8JA 5KG2A 2IOFK 4DO9A 4Y2PA 4C8KA 3TKAA 9ICKA 2RQ5A 2YN4A 2FPMA 1KLNA 4JWNA 1ZQPA 4I2AA 4EELA 1Y88A 2P6UA 1XS9D 3RJJA 1IM4A 7ICIA 8ICXA 5ALWA 3KHHA 1BPDA 3PSPA 3HRDD 5J29A 1NK6A 5KNIA 1TE2A 2JH7A 3RF9A 4CRXA 4CF3A 2C28A 1PK1A 3ZDEA 1YZ7A 5EWGA 4QWDA 3KKAC 3EWAA 2C22A 1ZQNA 2R18A 5EE9A 5DB8A 5AI5A 2EZZA 3BS5B 3NUQA 1NK8A 1ECWA 4RT3A 2AH5A 1OUQA 5ALXA 4B9LA 2YY6A 3BJYA 5TZVA 3MDCA 4P4OA 2QARA 5AM0A 2OH2A 4I2GA 2JZBB 1NK5A 3PSTA 1BPXA 4J9SA 3S6JA 3V7KA 2DGZA 5DB7A 4QW9A 2LI6A 1X42A 2W9CB 1PVRA 2KV2A 4BDPA 4BJQA 4KITB 1D8LA 5CR0A 1N48A 1PZNA 2KD1A 1QTMA 3PMNA 2WTFA 4HAIA 5AI4A 2JEJA 5J8YA 3TFSA 1A0PA 2MUTB 1WYGA 1RQLA 1SL0A 2FMQA 3M6KA 2R8IA 5DDMA 3UXOA 2VIXA 4ECYA 5KFMA 4O3QA 4ECWA 1ZXIA 1QQ5A 5KT7A 4ED8A 5GTIU 4I2EA 5KFPA 7ICSA 1SZHA 2E5SA 4F5NA 1NKBA 3EPIA 9ICOA 4QWBA 3KTQA 2PMZC 2Y0SC 3NRZA 4EENA 2PI4A 2FLLA 3KHLA 5J2AA 3I76A 4CF4A 1ZD4A 3RB0A 4DEZA 3AMZA 4QZDA 4DQIA 3WKBA 5KAIU 5DG8A 5CWRA 5KG7A 4X5VA 1A77A 2NO4A 4I2DA 2H3ZA 5DLFA 3GFKB 1ZETA 2O6KA 4OJLA 2KJ5A 4B9VA 1DOQA 3E2EA 5E79U 7ICHA 4ED2A 1IIPA 3BDPA 7ICRA 1DK3A 3QNMA 1ZQDA 2JGAA 2YX8A 8ICEA 1ZQRA 8ICVA 4I2HA 3I1YA 3RTVA 4IR1A 5CP2A 3E0FA 2LM1A 1UA0A 3D2NA 5DB9A 9ICFA 3JPSA 4WJ3B 5IILA 4EX6A 4DF4A 3H8WA 5HHIA 5CJ7A 5AK3A 2MRLA 3F5AA 2ZIXA 4P2HA 1X66A 1RG6A 4EBEA 1KDHA 4UB1A 3SAHA 4I2BA 1PVQA 5AM3A 3UQ2A 4M0AA 4IQUA 4PGQA 4QZHA 5F9LA 3PVXA
chains in the Genus database with same CATH topology
4JMUA 4IC9A 4OJOA 2HBMA 2KHVA 3VC8A 3K1ZA 2HOIA 2KJ8A 5HR6A 3D2QA 4OO1J 2A3VA 1A0PA 2HBJA 2LKYA 2MA1A 3H0RB 1YT3A 2ZIWB 2BDUA 2W7PA 3M7DA 2H3QA 4KX3A 1L6NA 3F5EA 4ACOA 2NV3A 3MGVA 4FZLA 5A0LA 1D8BA 3OPXA 3KFUF 2ZXHA 2H3FA 1UPHA 2K8AA 3M6KA 4P0QB 3LVVA 1GO3F 1XO0A 2XICA 2ZXIA 2G5HB 3LYSA 5T14A 1Q3UA 2PMZF 2Y0SF 3CP8A 2VIXA 2CN1A 2WB1F 4KX5A 2G07A 2HOFA 3D2SA 2K4IA 3VCBA 2LYAA 2ZIXB 1NZBA 3H0LB 2DF4B 2K89A 2OM6A 2CPRA 4FZNA 3IN5A 3F2DA 3H0MB 2W03A 4FE3A 4P0PA 1SZHA 2E5SA 3F53A 4PL1A 3ICXA 2K4HA 2VKQA 2Z7JA 4NV0A 3NRWA 1F44A 2KICA 2ZIUB 4CDGA 4QJFB 1A6SA 2KKPA 2WAQC 2PMZC 2Y0SC 2E1FA 2F76X 4U7CA 2KNJA 3C29A 5KL8B 3KZXA 4A8EA 2XIDA 2LHTA 3SQIA 2KEYA 2ZG6A 3T79A 2JMGA 4NWIA 3N7RC 3SAGA 1HIWA 3IG8A 3CRXA 1XNSA 2ZIVA 4GFJA 4NLCA 2JHDA 2D6FC 1ED1A 4ICAA 3AL0B 3PSPA 2JH1A 4AYBF 1HEKA 3AQFA 2RP5A 3IP4B 2OXOA 3N7SC 2LBOA 2JH7A 1KBUA 3RF9A 3SMVA 2H3ZA 4CRXA 3L3FX 5C0YA 2W7OA 2CRXA 2K4EA 4KMOB 3F2CA 4OJ5A 2RRDA 4OJLA 4QIWF 2N1RA 2KJ5A 5HR7A 3O0FA 2K8CB 2E1EA 2F77X 3AQEA 1URJA 3PZPA 3RFAA 2WB1C 4P0PB 2R18A 1DRGA 2K8BB 4OJ6A 3GU3A 1IIPA 2KKVA 2HBLA 3N7PD 2G09A 1MA7A 4NLBA 4PL2A 1TAMA 2JGAA 2OYYA 2YX8A 3M6ZA 3NUQA 3DEEA 4BUGA 1CRXA 2ZIWA 1ECWA 2VJ4A 3IG5A 2F2AB 2LYBA 2XI9A 4BX9C 1OUQA 4O3MA 3E0FA 3F2BA 3D2NA 2GOLA 4OJPA 4WJ3B 2KHQA 4C0ZA 4QIWC 3PSFA 2G0AA 3LVWA 2GH1A 2OH2A 1Z1BA 3HKZF 2YB1A 4P0QA 2Q4TA 2H3IA 2G5IB 2ZIVB 1ZQ1C 2HMXA 3SAFA 2HOQA 2MRLA 4CGZA 2KJ9A 4QNLA 2YB4A 3F5AA 2HBKA 3PSTA 5KL1B 1T94A 2ZIXA 2F8LA 2RHFA 2KIWA 2VJ5A 2DGZA 3ONNA 1Z19A 2M0NA 2XVTA 2WAQF 1PVRA 2DQNB 2KVCA 3CYMA 1WUDA 2KV2A 3C28A 1P7DA 3ALRA 4FZMA 4BJQA 3SAHA 4U6PA 1PVPA 2KOBA 5CRXA 4AYBC 2KD1A 3GZFA 1PVQA 2W04A 2G06A 3HKZC 2ZIUA 3PSIA 1Q3VA 2G08A 2H3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB C;  4QIW C;  2WAQ C;  3HKZ C;  2Y0S C;  2PMZ C;  2WB1 C; 
#chains in the Genus database with same CATH topology
 3RB3 A;  8ICU A;  4KLO A;  3K1Z A;  1B0X A;  4UAW A;  2A3V A;  5J2J A;  2NV3 A;  4UBC A;  1TFR A;  4ECV A;  3G6V A;  5J2F A;  2K8A A;  4I28 A;  2OHF A;  5DQG A;  4YFK A;  5IIN A;  8ICP A;  3JPQ A;  3MBY A;  2LYA A;  5JTI A;  3RR8 A;  3FM9 A;  3ISD A;  9ICI A;  3NTU A;  3IN5 A;  1D9F A;  5FP0 A;  4O9M A;  4QZI A;  1KFS A;  4UB3 A;  2J6S A;  4DQP A;  4KLL A;  5KFW A;  3TAD A;  5HML A;  3DV9 A;  2F76 X;  3HWT A;  2DUY A;  1MSW D;  2JH1 A;  5IIJ A;  3C1Y A;  3IP4 B;  1UHU A;  2H5X A;  4BWM A;  5F3X B;  3NGD A;  2W55 A;  3I28 A;  4R64 A;  4K4G A;  4DOA A;  3O0F A;  2HHV A;  5DQI A;  5ALH A;  1IV8 A;  1NJZ A;  2KZZ A;  2IOH A;  1TAM A;  5J2K A;  4BX9 C;  9ICT A;  4O3M A;  4OD0 A;  4C4R A;  2AXT U;  2ZTC A;  2WF5 A;  3GV8 B;  3OJU A;  4P0Q A;  3ISC A;  4UB5 A;  2H3I A;  2VAN A;  2QLT A;  2KJ9 A;  3SYZ A;  5ALN A;  5KFF A;  5EE1 A;  1L5U A;  5KG4 A;  4NLN A;  4U6P A;  4TUS A;  2BCS A;  5AI9 A;  3B0Y A;  5AIA A;  5AI8 A;  4QWA A;  4RQM A;  1X9X A;  4BXO B;  2KHV A;  3L5K A;  2EAP A;  1BVS A;  3AU2 A;  1V85 A;  1J97 A;  1RDF A;  1X9S A;  8ICH A;  1LKY B;  2W9M A;  2H3F A;  1AQ6 A;  2G5H B;  3RJF A;  2XC9 A;  5ALQ A;  1NZB A;  3NVV A;  3SZ2 A;  4FFD A;  2A1J A;  5KFR A;  3V7J A;  2OEH A;  3Q8K A;  4JUZ A;  4DSK A;  3NVY A;  2Z7J A;  5DGB A;  2E8M A;  1HUO A;  1RXW A;  1S10 A;  5EE3 A;  4M9H A;  2KFZ A;  5B66 U;  3C2M A;  3GV7 B;  3RH4 A;  2ZG6 A;  3MFH A;  1XWL A;  4NL9 A;  3SAG A;  1C20 A;  3ZI4 A;  3RAQ A;  1ED1 A;  1UT5 A;  1ARO P;  3WKC A;  4MHV A;  2JV3 A;  4F4X A;  2BGW A;  2J6T A;  3G6X A;  2K8C B;  2VA8 A;  1URJ A;  3AQE A;  5AKZ A;  4OJ6 A;  5AKI A;  5KFD A;  3FC4 A;  3TAC B;  4UAT A;  5KTQ A;  3MR5 A;  2VA3 A;  4ED3 A;  4B6J A;  3GIM A;  3F2B A;  4RZR A;  4F8R A;  1VLB A;  2EAO A;  1JI7 A;  2I1Q A;  1ZJN A;  4QIW C;  1Z1B A;  2Y1I A;  3TAQ A;  2Q0Z X;  1BNO A;  2ZUB A;  3UM9 A;  2LPE A;  1ZQO A;  3PX0 A;  4RNN A;  3BQT A;  3GIK A;  3C28 A;  1RYU A;  4R8U B;  2B0C A;  1O08 A;  1ZQK A;  1EXN A;  4B9M A;  3TFR A;  5D4B A;  1JXE A;  9ICS A;  1MQ2 A;  4YXM A;  3SV4 A;  2HOI A;  4DOC A;  2MA1 A;  2KK0 A;  4XRH A;  2ZIW B;  2BDU A;  1FEZ A;  2R8J A;  2ALZ A;  4DSL A;  2DL0 A;  1D8B A;  2KN7 A;  1X2I A;  1XO0 A;  4FBT A;  5J8Y C;  3V6J A;  4KN4 A;  2G07 A;  3AUO A;  3QX7 A;  4XUS A;  2DF4 B;  5EE0 A;  2W03 A;  3RAX A;  2BR0 A;  2K4H A;  1L7O A;  4PHD A;  2IOF A;  1F44 A;  2JXJ A;  4YCX A;  1BNP A;  1A6S A;  2BKE A;  3OJS A;  2WAQ C;  3BS5 A;  5TIS U;  1TAQ A;  5J2D A;  4ELT A;  4KLU A;  2UVR A;  2HDO A;  2XY5 A;  1HJP A;  3SD7 A;  4GC7 A;  9ICC A;  4NWI A;  2W54 A;  4F4Y A;  3N7R C;  5AM4 A;  3TAN A;  1XU4 A;  4M2Y A;  2JZB A;  4IRC A;  1L3U A;  3J81 j;  4YMN A;  3PX6 A;  3QXG A;  1HEK A;  4IR9 A;  5JRT A;  1QSL A;  2W9C A;  3OSP A;  2KP7 A;  4M9L A;  1ZQY A;  1ZQB A;  3OHB A;  7ICE A;  4DQQ A;  2HBL A;  4GXJ A;  3Q8L A;  5J2C A;  7ICQ A;  1T3N A;  2MUT A;  2DKX A;  1N63 A;  3AM9 A;  7ICP A;  4NLZ A;  1BPE A;  4O3S A;  4DWI A;  2HMX A;  2KFN A;  1FO4 A;  5AKJ A;  4RUC A;  3EYZ A;  5KFL A;  2RHF A;  1JN3 A;  2DWQ A;  3H7I A;  1Z19 A;  3Q8R B;  9ICV A;  2ZJ8 A;  2WAQ F;  1P7D A;  4RQ1 A;  1PVP A;  4RPY A;  2OWO A;  2E8N A;  4DFJ A;  2EQY A;  3RJI A;  4KTQ A;  3PO5 A;  4NLK A;  4RPZ A;  2HBJ A;  4ZOH C;  3OGU A;  2XY7 A;  2YMQ A;  4C7Y A;  1ZJM A;  4J9N A;  1N56 A;  4FZL A;  4C8N A;  3KFU F;  2BPF A;  3BQ7 A;  4F2R A;  5J0P A;  2V4Q A;  1IXR A;  1COO A;  3D6J A;  5KAF U;  2CN1 A;  5DGA A;  2XO7 A;  2BDP A;  2K4I A;  1X9W A;  4LZD A;  3QU4 A;  3H4D A;  3UPQ A;  3EUB 2;  2L5Y A;  1XC9 A;  2E8P A;  5ALY A;  2KKP A;  3SEN A;  4DL5 A;  5ALU A;  1CI4 A;  4U7C A;  3OSN A;  5KL8 B;  4KLF A;  3DDH A;  5KG6 A;  4O5C A;  5AKX A;  8ICN A;  2LM4 A;  3TAD C;  5EWF A;  5ALR A;  2D3D A;  2W3S A;  4KLJ A;  1X40 A;  1ZQV A;  2RP5 A;  4YN4 A;  3PNC A;  7ICF A;  3A0H U;  3L3F X;  5DG9 A;  4M9G A;  2GWS A;  3MC1 A;  4M47 A;  1ZQC A;  2F77 X;  3WKA A;  3NVZ A;  4US8 A;  2IBK A;  2UVU A;  3N97 B;  4DFK A;  1S0M A;  2OCE A;  4Z6F A;  2GOL A;  4OJP A;  4M9N A;  2KZ3 A;  4RNO A;  3LWL A;  4CGZ A;  1UA1 A;  2PFO A;  2XGQ A;  2UVW A;  2KE7 A;  3WK9 A;  2IHM A;  3FAH A;  4O3N A;  4AYB C;  3NVW A;  3GZF A;  1XSN A;  3RJG A;  1COK A;  5EWE A;  1X6I A;  2HBM A;  2W9B B;  5HP4 A;  5III A;  1YZ6 A;  4C7Z A;  5AM2 A;  5KFB A;  4UAY A;  1NI3 A;  2RDJ A;  1F0M A;  4JK1 A;  2KMD A;  3Q8P B;  3D2S A;  3VCB A;  4PH5 A;  1QSS A;  1WWU A;  2W43 A;  4KLT A;  4R65 A;  4FZN A;  4DQR A;  1Z3E B;  3RBD A;  1J2M A;  1SL2 A;  1ZQE A;  3F53 A;  1B4F A;  3ICX A;  2HHU A;  4CDG A;  3QYP A;  3KZX A;  7ICV A;  4IQV A;  2HHW A;  4I29 A;  2ES6 A;  2ODG A;  4M04 A;  4JWM A;  1ZQA A;  3T5L A;  1U48 A;  3L4P A;  2BCU A;  1PK3 A;  5L1J A;  5L1I A;  4IQW A;  4AYB F;  2DKZ A;  4NL9 C;  1IG6 A;  4LJX A;  4ED7 A;  4O0I A;  8ICS A;  2IHN A;  9ICR A;  2G09 A;  5KT5 A;  2NRV A;  4BXO A;  3MFI A;  3K75 D;  2NYV A;  4MEX A;  3M6Z A;  4BUG A;  4R66 A;  1SGG A;  3IG5 A;  3MGH A;  2P6R A;  1LKY A;  3LVW A;  5EOZ A;  5L1L A;  1TK5 A;  4R63 A;  2AGO A;  1BPY A;  2WF7 A;  5KFU A;  2Y9T A;  4QNL A;  8ICK A;  2HBK A;  5KL1 B;  2F3N A;  9ICE A;  4J9P A;  4NXZ A;  3ETL A;  4PPX A;  4ECT A;  1XSL A;  2DQN B;  9ICM A;  3TAR A;  4O3R A;  3HPO A;  1K1Q A;  5J0O A;  3JPT A;  2W04 A;  1B43 A;  3PSI A;  3C5F A;  4EYH B;  4QWC A;  3GIL A;  4ELU A;  3RR7 A;  5GTH U;  4QZ8 A;  4RPX A;  1TKD A;  4ACO A;  3BZK A;  5A0L A;  4I2I A;  5DG7 A;  5DKW A;  1S0N A;  2PMZ F;  2Y0S F;  3QUC A;  4O3P A;  4Z6D A;  3T5H A;  2OM6 A;  3F2D A;  8ICA A;  3NAS A;  4DF8 A;  4DL7 A;  1S97 A;  4FE3 A;  2PI5 A;  4DL6 A;  2ZUC A;  3H8S A;  4QJF B;  3ETR A;  9ICX A;  2E1F A;  1QQ7 A;  4G9B A;  3ZD8 A;  2LHT A;  1SL1 A;  3WK7 A;  4QZB A;  2GLE A;  9ICL A;  4J9L A;  1ZYQ A;  3LWM A;  4ECU A;  1ZOL A;  4DL2 A;  4Y2X A;  4J9M A;  3NS1 A;  8ICF A;  2W7O A;  3F2C A;  4OJ5 A;  4R8U A;  5AKH A;  1RYS A;  3RJE A;  1NJW A;  3WK6 A;  3PZP A;  3GU3 A;  3N28 A;  3IV6 A;  1U4B A;  3QEB Z;  3CNH A;  1CUK A;  2JR5 A;  3BS7 A;  4RQ2 A;  2GO7 A;  2RLT A;  2ZIW A;  1HUZ A;  3HT3 A;  2F8K A;  2CXY A;  2KSO B;  7ICM A;  2G5I B;  5D46 A;  3SAF A;  4F93 B;  5KG1 A;  4ECQ A;  3H4B A;  2LYH A;  1ZQW A;  4KLM A;  2M0N A;  4FZM A;  1KW4 A;  1V38 A;  2KOB A;  4UAS A;  3HKZ C;  4I27 A;  2ISP A;  1DXS A;  5KFK A;  1L3S A;  2FPL A;  5J0U A;  1RZT A;  1SV4 A;  3M8S A;  4DQS A;  3BQ2 A;  4NJ8 A;  4KX5 A;  3M9M B;  2JEI A;  3T5J A;  1JAL A;  5AKG A;  4B9T A;  5KFX A;  4F3O A;  2CPR A;  4UAU A;  1V97 A;  1FFU A;  4F91 B;  2EZY A;  5CB1 A;  5IIM A;  4M9J A;  5G5H A;  4DSJ A;  3G6Y A;  4US9 A;  4EEY A;  5ALM A;  4DS4 A;  5AIC A;  2PXI A;  2ATL A;  4PGY A;  3V72 A;  2P35 A;  1KFD A;  3CRX A;  3MDA A;  4J9O A;  2AQ4 A;  3KBB A;  2FLN A;  2HCF A;  2LBO A;  1JXL A;  9ICB A;  4I2F A;  5DQH A;  1JMS A;  1O03 A;  4Q8E A;  4UB8 U;  5HR7 A;  4YMM A;  1D8Y A;  3M1Y A;  1B22 A;  3RFA A;  2WB1 C;  1SWW A;  4C4T A;  1MA7 A;  5KFN A;  4TUQ A;  2KZM A;  2A19 A;  2DFL A;  4O5K A;  1C7Y A;  5ALT A;  4RU9 A;  2YML A;  3OTQ A;  3K4G A;  3QUB A;  2NRT A;  3LDA A;  2G0A A;  2GH1 A;  4JB3 A;  2KIV A;  7ICO A;  5KT4 A;  4GXK A;  1T94 A;  1N5X A;  3GIJ A;  4ECZ A;  1N5W A;  2C2E A;  3PW0 A;  2NO5 A;  1QCK A;  2P66 A;  3CYM A;  1UQV A;  4UAZ A;  4O3O A;  2AGP A;  1N62 A;  4DLE A;  2M9N A;  1LV5 A;  1JRP A;  2W11 A;  3KOO A;  3F5E A;  4P4M A;  4TQS A;  2I6X A;  4EZ9 A;  3OPX A;  3PW7 A;  1H38 A;  2EAN A;  7ICG A;  5J0R A;  1Q3U A;  5HNK A;  1S77 D;  2WB1 F;  4J9K A;  1D9D A;  3V7L A;  3V6H A;  5AKY A;  1S5L U;  4EBD A;  1ZQL A;  3TI0 A;  4DCC A;  4UBB A;  1NJX A;  2BPG A;  2ZIU B;  2HHX A;  1TVA A;  1Z00 B;  2ZTD A;  5KFA A;  1SKW A;  3SQI A;  1KTQ A;  3T79 A;  5AK4 A;  2XGP A;  1HIW A;  4UB2 A;  2ESE A;  4B9U A;  5KFV A;  4GIB A;  2A1A A;  3BZC A;  4FS1 A;  5ALZ A;  4F2S A;  5AI6 A;  4KLQ A;  1V9P A;  1NK7 A;  2CRX A;  5AM1 A;  4IS7 A;  3MAB A;  4QIW F;  2KVS A;  1BGX T;  2BPC A;  2BCQ A;  5CA7 A;  4RNM A;  1SKR A;  5J2G A;  2OYY A;  2W9B A;  4KLS A;  5IIO A;  4RQ0 A;  2VJ4 A;  4IQT A;  4MFA A;  1OXJ A;  9ICA A;  9ICJ A;  2MSN A;  3V6K A;  1NNL A;  2ZTE A;  4RQ7 A;  3GDX A;  4JV2 A;  1NJY A;  1T4G A;  5DDY A;  5KFI A;  5KFC A;  2ZUD A;  3TQ1 A;  1ZQQ A;  2HVH A;  1UCV A;  2EH9 A;  2QB0 B;  4ELV A;  2XVT A;  3UXN A;  3M8R A;  4IL6 U;  2XCP A;  8ICC A;  1JIH A;  5JUM A;  4FS2 A;  5IIK A;  2BQU A;  3QU5 A;  5DBB A;  4IC9 A;  5KFQ A;  3D2Q A;  1FFV A;  5J0Q A;  2BZF A;  2VA2 A;  1CEZ A;  4IRK A;  2ASJ A;  2XIC A;  2W8K A;  5AKK A;  1RQN A;  2DPI A;  4NM2 A;  4F5R A;  2XCA A;  3RH6 A;  3PW4 A;  1L3V A;  2W9A A;  1S9F A;  2XID A;  3QU7 A;  1RYR A;  1DGJ A;  3IHQ B;  4RQ6 A;  4GLX A;  4F4Z A;  1XNS A;  4GFJ A;  4NLC A;  4ED0 A;  5ALO A;  1WCL A;  5KG5 A;  3ZDA A;  3AQF A;  1ZRN A;  1KBU A;  1SV0 A;  1Q46 A;  1SXE A;  3PY8 A;  4KMU A;  4O5E A;  2Y9U A;  4C4S A;  1MN8 A;  4YR3 A;  5AKL A;  4P0P B;  3WKD A;  2KKV A;  1SXD A;  1SIJ A;  3AN1 A;  4EEK A;  4UW9 A;  1CRX A;  1X6J A;  3OHA A;  2F2A B;  4YQW A;  1L7P A;  2Y1J A;  3PSF A;  3HW8 A;  3UMB A;  2AQ0 A;  8ICT A;  2PFP A;  2ZIV B;  2HOQ A;  3RH5 A;  8ICG A;  2YMM A;  5L1M A;  2KIW A;  1XO1 A;  5ALI A;  2ISO A;  4MFF A;  4QZF A;  1Q8K A;  4UQG A;  4DOB A;  2YQE A;  2G06 A;  2BCR A;  5D49 A;  2DBY A;  4JMU A;  3E58 A;  4CCH A;  5J0X A;  3EW9 A;  2H3Q A;  2FMP A;  3RRH A;  3MGV A;  3IDW A;  4PHE A;  4DL3 A;  3LVV A;  1GO3 F;  2ZXI A;  5T14 A;  4NM1 A;  4B9N A;  4F4W A;  3HIL A;  3K1R B;  1S0O A;  2HW3 A;  4M6W B;  3ISB A;  4Q8F A;  4F5Q A;  4TUP A;  2BCV A;  2VKQ A;  1L7N A;  2FDR A;  2FJ6 A;  3NRW A;  4EX7 A;  2QKQ A;  4Y2R A;  1NKC A;  4CE6 A;  4FO6 A;  4NLG A;  1DGS A;  2IA6 A;  5KFJ A;  1TV9 A;  9ICH A;  1K1S A;  2NRZ A;  4PJ0 U;  1WG8 A;  3IG8 A;  4YG2 A;  4XA5 A;  2KSO A;  2FPK A;  4RUA A;  2KG5 A;  4ICA A;  1WCN A;  1ZD2 P;  1NK0 A;  3AU6 A;  5AIB A;  1QSY A;  2K4E A;  4KMO B;  2V4R A;  7ICL A;  3HJE A;  2N1R A;  4AP9 A;  1L8O A;  8ICM A;  1DRG A;  2BHN A;  1ZQH A;  4PL2 A;  5J2H A;  2W8L A;  3T3F A;  2JRZ A;  3JPN A;  5ALF A;  4BWJ A;  4PHA A;  4YD2 A;  4C0Z A;  4MF8 A;  4OCZ A;  5J0Y A;  1ZD5 A;  4QWE A;  3HP6 A;  4Q44 A;  1U9L A;  2NRW A;  3TAP A;  5B5E U;  3EZ5 A;  1L7M A;  5AK6 A;  2ASL A;  4I2C A;  3PW5 A;  4UB4 A;  4QW8 A;  1TK8 A;  3B9J A;  5AKE A;  2JEF A;  2G08 A;  4J9Q A;  1U49 A;  1A76 A;  2MAX A;  1ZQT A;  4KLG A;  2ZXH A;  3QUQ A;  3LYS A;  1SB3 C;  5J0W A;  3SEI A;  3CP8 A;  4YMO A;  2FLP A;  2JEG A;  2HSZ A;  3ZDC A;  4MF2 A;  3H0M B;  3EPG A;  3ZDD A;  5KFE A;  1Z4N A;  3RJK A;  4J9R A;  2I5H A;  8ICI A;  4I2J A;  2K60 A;  2KNJ A;  2W3R A;  4UAR A;  4C80 A;  4A8E A;  1XSP A;  4GXI A;  3KHG A;  4C8O A;  1S8O A;  2JMG A;  4F92 B;  2QB1 A;  1QLN A;  2JHD A;  5BPC A;  9ICW A;  5DB6 A;  4QZA A;  4YR2 A;  4DFP A;  4USA A;  5AM5 A;  4RQ8 A;  4P4P A;  2NRX A;  2HHS A;  4KLE A;  4ZH4 A;  4F5O A;  2K8B B;  5J2B A;  2FI1 A;  4YR0 A;  1WWV A;  2HHQ A;  1SZP A;  3SV3 A;  1T7P A;  4ED6 A;  1RPL A;  4QZE A;  2PFN A;  4Y2Y A;  1KFT A;  5ALL A;  5KFO A;  3ORY A;  4TQR A;  5ALE A;  3PO4 A;  2HVI A;  2WFA A;  2VJ5 A;  2FMS A;  1PK1 B;  1ZQI A;  5CRX A;  1T8E A;  2E8O A;  2ZIU A;  1Q3V A;  4F72 A;  1Z00 A;  2KJ8 A;  4ECS A;  4OO1 J;  2LKY A;  1ZQX A;  2ZJA A;  4Y2T A;  2DPJ A;  3AEV A;  2QAR B;  1UPH A;  4Z6C A;  4KN7 A;  4K4I A;  5DBC A;  2C2D A;  5DBA A;  4DSI A;  1F5S A;  4F71 A;  4J03 A;  3BQ0 A;  1KQQ A;  2MU2 A;  4PL1 A;  1NK9 A;  5ALG A;  5H2F U;  7ICN A;  8ICJ A;  1QQ6 A;  1X9M A;  3MR3 A;  2ZJ5 A;  5AK5 A;  5KT6 A;  3QE9 Y;  1KRP A;  3KKA A;  2D6F C;  1J2N A;  5J0T A;  5ALK A;  4CNQ A;  3RB4 A;  4YP3 A;  2QB0 A;  1BPB A;  5C0Y A;  4LVS A;  1ZQU A;  5G5G A;  5KFT A;  4BGD A;  1KKX A;  4MFC A;  1KSP A;  4NY8 A;  3M9N B;  3Q8Q B;  2WF6 A;  4PZO A;  1SV0 C;  5HHH A;  4EYI B;  3DEE A;  4DSE A;  3PML A;  4E0D A;  3H8M A;  5CHG A;  1N2X A;  3PR4 A;  1U45 A;  1ZQM A;  3HKZ F;  1ZQ1 C;  1DK2 A;  4RT2 A;  2D8C A;  2YB4 A;  1OW5 A;  3QEA Z;  2J6U A;  8ICY A;  3RJH A;  4MEY A;  3ONN A;  3SR6 A;  1UT8 A;  1TAU A;  3RBE A;  1S76 D;  3HX0 A;  2YB1 A;  1Z4O A;  4OJO A;  2RDI A;  3VC8 A;  2B6G A;  3LK9 A;  4EZ6 A;  3UXP A;  3MR2 A;  1ZQG A;  4ECR A;  3A0B U;  4JV0 A;  3QUT A;  3H40 A;  2HI0 A;  2HOF A;  8ICL A;  1ZQZ A;  1JRO A;  1VDV A;  2ZIX B;  3PR5 B;  8ICZ A;  3H0L B;  2IMW P;  2PFQ A;  3GII A;  4F50 A;  5ALV A;  2ASD A;  4P0P A;  4PHP A;  7ICT A;  4DL4 A;  5CEH A;  5KFS A;  5C5J A;  4YD1 A;  4NV0 A;  3GQC A;  2WHE A;  2KIC A;  1SWV A;  1MC8 A;  1N60 A;  3CW2 C;  5J2E A;  1JUD A;  4XQ8 A;  3WK5 A;  3C29 A;  4B9S A;  5KFH A;  5AI0 A;  2KEY A;  2AU0 A;  1FIQ A;  1NOM A;  2E3T A;  4CF5 A;  2ZIV A;  4YXJ A;  3UMG A;  3AL0 B;  3THV A;  3WK8 A;  5KFY A;  3C5G A;  2AJQ A;  8ICQ A;  7ICU A;  1RXV A;  1Z1V A;  8ICR A;  2RRD A;  3QZ8 A;  2E1E A;  5KG3 A;  4K4H A;  3R9K A;  4ED1 A;  1N61 A;  5HMM A;  4Y2J A;  4YVZ A;  3PV8 A;  3ZD9 A;  2LYB A;  3ED5 A;  9ICP A;  2KHQ A;  2WF9 A;  5L9X A;  3M9O B;  4UAV A;  3FDS A;  5L1K A;  1S0V A;  8ICW A;  7ICK A;  3C1Z A;  4M6W A;  2KVC A;  9ICN A;  1ZRM A;  3PW2 A;  1BPZ A;  1KL9 A;  7ICJ A;  2AGQ A;  1NKE A;  1VJ5 A;  3C21 A;  8ICB A;  4C8M A;  1L3T A;  3U26 A;  1SKS A;  1KEJ A;  3QU2 A;  2YMP A;  3H0R B;  1QH9 A;  4DFM A;  3M7D A;  2I9G A;  4KX3 A;  3PX4 A;  4DS5 A;  2F1I A;  2YTU A;  4PGX A;  5K4L A;  4DSF A;  4Q43 A;  3N4M B;  1RM6 C;  2LMR A;  4P0Q B;  3WU2 U;  4QZ9 A;  3GV5 B;  2EZX A;  4RQ3 A;  4JV1 A;  4Y2U A;  3C2K A;  3WKE A;  3B0X A;  2PKE A;  4KLD A;  4HYK A;  1T3Q A;  3MR6 A;  1LVH A;  2EDU A;  4KLI A;  1JX4 A;  1ZQF A;  1U47 A;  2F1J A;  5DLG A;  2F1H A;  2R8H A;  4QZC A;  4FBU A;  2V9W A;  5JU5 A;  2UVV A;  4Y2S A;  1M6Y A;  3JPP A;  4F5P A;  3SI8 A;  3QU9 A;  3IM1 A;  2BQ3 A;  4F4K A;  5ALP A;  4LZG A;  2FE9 A;  1LB2 B;  2OXO A;  3N7S C;  3SMV A;  8ICO A;  3UQ0 A;  2HHT A;  4G3I A;  4DLG A;  3WK4 A;  2BQR A;  1K5O A;  4PZN A;  2WF8 A;  5BOL A;  2EAM A;  4Z6E A;  2A1J B;  2XY6 A;  4Y2Q A;  9ICG A;  2B21 A;  3N7P D;  5AHX A;  4C8L A;  4NLB A;  4Y2V A;  3KD3 A;  4TUR A;  3QZ7 A;  2KTQ A;  4RQ4 A;  5KFZ A;  4Q45 A;  3JPO A;  2XI9 A;  5KT2 A;  5KT3 A;  1ZD3 A;  2K4P A;  2R8K A;  1KN5 A;  3Q8M A;  4RQ5 A;  4DFD A;  3T5K A;  2Q4T A;  4ECX A;  4RQN A;  3ZDB A;  1NK4 A;  2AHO B;  5ALD A;  3FYH A;  1ZQS A;  2F8L A;  5ALJ A;  1ZQJ A;  1NZP A;  3UMC A;  1WUD A;  5J0S A;  3ALR A;  4GC6 A;  1PUZ A;  4QZG A;  3IRU A;  5F9N A;  1TK0 A;  1L8L A;  9ICQ A;  5J2I A;  2H3V A;  2F44 A;  5HR6 A;  3KZI U;  2C2R A;  2R8G A;  1YT3 A;  4KLH A;  3RB6 A;  2W7P A;  1L6N A;  3JPR A;  5ALS A;  3BQ1 A;  5BOM A;  4EBC A;  5KFG A;  5KG0 A;  3RRG A;  3MGI A;  1MQ3 A;  4IRD A;  3Q8S B;  3C23 A;  9ICU A;  2K89 A;  3C2L A;  4UB6 U;  3KHR A;  3H8J A;  5KG2 A;  2IOF K;  4DO9 A;  4Y2P A;  4C8K A;  3TKA A;  9ICK A;  2RQ5 A;  2YN4 A;  2FPM A;  1KLN A;  4JWN A;  1ZQP A;  4I2A A;  4EEL A;  1Y88 A;  2P6U A;  1XS9 D;  3RJJ A;  1IM4 A;  7ICI A;  8ICX A;  5ALW A;  3KHH A;  1BPD A;  3PSP A;  3HRD D;  5J29 A;  1NK6 A;  5KNI A;  1TE2 A;  2JH7 A;  3RF9 A;  4CRX A;  4CF3 A;  2C28 A;  1PK1 A;  3ZDE A;  1YZ7 A;  5EWG A;  4QWD A;  3KKA C;  3EWA A;  2C22 A;  1ZQN A;  2R18 A;  5EE9 A;  5DB8 A;  5AI5 A;  2EZZ A;  3BS5 B;  3NUQ A;  1NK8 A;  1ECW A;  4RT3 A;  2AH5 A;  1OUQ A;  5ALX A;  4B9L A;  2YY6 A;  3BJY A;  5TZV A;  3MDC A;  4P4O A;  2QAR A;  5AM0 A;  2OH2 A;  4I2G A;  2JZB B;  1NK5 A;  3PST A;  1BPX A;  4J9S A;  3S6J A;  3V7K A;  2DGZ A;  5DB7 A;  4QW9 A;  2LI6 A;  1X42 A;  2W9C B;  1PVR A;  2KV2 A;  4BDP A;  4BJQ A;  4KIT B;  1D8L A;  5CR0 A;  1N48 A;  1PZN A;  2KD1 A;  1QTM A;  3PMN A;  2WTF A;  4HAI A;  5AI4 A;  2JEJ A;  5J8Y A;  3TFS A;  1A0P A;  2MUT B;  1WYG A;  1RQL A;  1SL0 A;  2FMQ A;  3M6K A;  2R8I A;  5DDM A;  3UXO A;  2VIX A;  4ECY A;  5KFM A;  4O3Q A;  4ECW A;  1ZXI A;  1QQ5 A;  5KT7 A;  4ED8 A;  5GTI U;  4I2E A;  5KFP A;  7ICS A;  1SZH A;  2E5S A;  4F5N A;  1NKB A;  3EPI A;  9ICO A;  4QWB A;  3KTQ A;  2PMZ C;  2Y0S C;  3NRZ A;  4EEN A;  2PI4 A;  2FLL A;  3KHL A;  5J2A A;  3I76 A;  4CF4 A;  1ZD4 A;  3RB0 A;  4DEZ A;  3AMZ A;  4QZD A;  4DQI A;  3WKB A;  5KAI U;  5DG8 A;  5CWR A;  5KG7 A;  4X5V A;  1A77 A;  2NO4 A;  4I2D A;  2H3Z A;  5DLF A;  3GFK B;  1ZET A;  2O6K A;  4OJL A;  2KJ5 A;  4B9V A;  1DOQ A;  3E2E A;  5E79 U;  7ICH A;  4ED2 A;  1IIP A;  3BDP A;  7ICR A;  1DK3 A;  3QNM A;  1ZQD A;  2JGA A;  2YX8 A;  8ICE A;  1ZQR A;  8ICV A;  4I2H A;  3I1Y A;  3RTV A;  4IR1 A;  5CP2 A;  3E0F A;  2LM1 A;  1UA0 A;  3D2N A;  5DB9 A;  9ICF A;  3JPS A;  4WJ3 B;  5IIL A;  4EX6 A;  4DF4 A;  3H8W A;  5HHI A;  5CJ7 A;  5AK3 A;  2MRL A;  3F5A A;  2ZIX A;  4P2H A;  1X66 A;  1RG6 A;  4EBE A;  1KDH A;  4UB1 A;  3SAH A;  4I2B A;  1PVQ A;  5AM3 A;  3UQ2 A;  4M0A A;  4IQU A;  4PGQ A;  4QZH A;  5F9L A;  3PVX A; 
#chains in the Genus database with same CATH homology
 4JMU A;  4IC9 A;  4OJO A;  2HBM A;  2KHV A;  3VC8 A;  3K1Z A;  2HOI A;  2KJ8 A;  5HR6 A;  3D2Q A;  4OO1 J;  2A3V A;  1A0P A;  2HBJ A;  2LKY A;  2MA1 A;  3H0R B;  1YT3 A;  2ZIW B;  2BDU A;  2W7P A;  3M7D A;  2H3Q A;  4KX3 A;  1L6N A;  3F5E A;  4ACO A;  2NV3 A;  3MGV A;  4FZL A;  5A0L A;  1D8B A;  3OPX A;  3KFU F;  2ZXH A;  2H3F A;  1UPH A;  2K8A A;  3M6K A;  4P0Q B;  3LVV A;  1GO3 F;  1XO0 A;  2XIC A;  2ZXI A;  2G5H B;  3LYS A;  5T14 A;  1Q3U A;  2PMZ F;  2Y0S F;  3CP8 A;  2VIX A;  2CN1 A;  2WB1 F;  4KX5 A;  2G07 A;  2HOF A;  3D2S A;  2K4I A;  3VCB A;  2LYA A;  2ZIX B;  1NZB A;  3H0L B;  2DF4 B;  2K89 A;  2OM6 A;  2CPR A;  4FZN A;  3IN5 A;  3F2D A;  3H0M B;  2W03 A;  4FE3 A;  4P0P A;  1SZH A;  2E5S A;  3F53 A;  4PL1 A;  3ICX A;  2K4H A;  2VKQ A;  2Z7J A;  4NV0 A;  3NRW A;  1F44 A;  2KIC A;  2ZIU B;  4CDG A;  4QJF B;  1A6S A;  2KKP A;  2WAQ C;  2PMZ C;  2Y0S C;  2E1F A;  2F76 X;  4U7C A;  2KNJ A;  3C29 A;  5KL8 B;  3KZX A;  4A8E A;  2XID A;  2LHT A;  3SQI A;  2KEY A;  2ZG6 A;  3T79 A;  2JMG A;  4NWI A;  3N7R C;  3SAG A;  1HIW A;  3IG8 A;  3CRX A;  1XNS A;  2ZIV A;  4GFJ A;  4NLC A;  2JHD A;  2D6F C;  1ED1 A;  4ICA A;  3AL0 B;  3PSP A;  2JH1 A;  4AYB F;  1HEK A;  3AQF A;  2RP5 A;  3IP4 B;  2OXO A;  3N7S C;  2LBO A;  2JH7 A;  1KBU A;  3RF9 A;  3SMV A;  2H3Z A;  4CRX A;  3L3F X;  5C0Y A;  2W7O A;  2CRX A;  2K4E A;  4KMO B;  3F2C A;  4OJ5 A;  2RRD A;  4OJL A;  4QIW F;  2N1R A;  2KJ5 A;  5HR7 A;  3O0F A;  2K8C B;  2E1E A;  2F77 X;  3AQE A;  1URJ A;  3PZP A;  3RFA A;  2WB1 C;  4P0P B;  2R18 A;  1DRG A;  2K8B B;  4OJ6 A;  3GU3 A;  1IIP A;  2KKV A;  2HBL A;  3N7P D;  2G09 A;  1MA7 A;  4NLB A;  4PL2 A;  1TAM A;  2JGA A;  2OYY A;  2YX8 A;  3M6Z A;  3NUQ A;  3DEE A;  4BUG A;  1CRX A;  2ZIW A;  1ECW A;  2VJ4 A;  3IG5 A;  2F2A B;  2LYB A;  2XI9 A;  4BX9 C;  1OUQ A;  4O3M A;  3E0F A;  3F2B A;  3D2N A;  2GOL A;  4OJP A;  4WJ3 B;  2KHQ A;  4C0Z A;  4QIW C;  3PSF A;  2G0A A;  3LVW A;  2GH1 A;  2OH2 A;  1Z1B A;  3HKZ F;  2YB1 A;  4P0Q A;  2Q4T A;  2H3I A;  2G5I B;  2ZIV B;  1ZQ1 C;  2HMX A;  3SAF A;  2HOQ A;  2MRL A;  4CGZ A;  2KJ9 A;  4QNL A;  2YB4 A;  3F5A A;  2HBK A;  3PST A;  5KL1 B;  1T94 A;  2ZIX A;  2F8L A;  2RHF A;  2KIW A;  2VJ5 A;  2DGZ A;  3ONN A;  1Z19 A;  2M0N A;  2XVT A;  2WAQ F;  1PVR A;  2DQN B;  2KVC A;  3CYM A;  1WUD A;  2KV2 A;  3C28 A;  1P7D A;  3ALR A;  4FZM A;  4BJQ A;  3SAH A;  4U6P A;  1PVP A;  2KOB A;  5CRX A;  4AYB C;  2KD1 A;  3GZF A;  1PVQ A;  2W04 A;  2G06 A;  3HKZ C;  2ZIU A;  3PSI A;  1Q3V A;  2G08 A;  2H3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...