4QIWC

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
380
structure length
369
Chain Sequence
IKSMVSKAELPDNIKEELYAKLIEYNEKYKLKKDEIQAIIDETVREYQKALIEPGEAVGTVAAQSIGEPSTQMTINVTLGLPRIIEIVDARKNPSTPIMTVYLDEEHRYDRDKALEVARRIEGTTLENLAREETIDILNMEYVVEIDPERLEKAGLDMEKVVRKLTGSFKSAEFEAEGYTLVVRPKKVTKLSDLRKIAEKVKKHRLKGLSGVGKTIIRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIWEIAEVLGIEAARNAIIDEIVSTMREQGLEVDVRHIMLVADMMTLDGVIRPIGRHGIVGEKASVLARAAFEITTQHLFAAAERGEVDPLNGVVENVLIGQPVPVGTGIVKLAMSLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
total genus 61
structure length 369
sequence length 380
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwC02
4QIWC 2Y0SC 4AYBC 2WAQC 2WB1C 2PMZC 3HKZC
chains in the Genus database with same CATH superfamily
3G6VA 1Z4NA 3TARA 4QZBA 1NK7A 4NLZA 1B4FA 1ZQKA 2ZG6A 1MC8A 4NL9C 5DKWA 4F2SA 3PNCA 2K60A 1UA0A 4LZGA 1TFRA 4C8NA 4QWBA 8ICGA 1TKDA 5J0OA 4DQQA 2E3TA 5KG7A 4MEXA 2KK0A 1ZXIA 5AI4A 2N1RA 2XY7A 3ORYA 4O3OA 1KLNA 4PHEA 4O5CA 4GC7A 3UPQA 2KTQA 8ICFA 2G07A 1SWVA 2VJ4A 8ICOA 1U45A 5AI6A 2QARB 5EE0A 9ICWA 8ICQA 4TQRA 3BZCA 3C28A 5J2EA 3ZDDA 4PH5A 4IRKA 4F4YA 2JEGA 3IG8A 4E0DA 4BX9C 2C2EA 3KHHA 1L5UA 4Z6CA 4EX7A 2J6SA 2JR5A 2H3FA 4DSJA 1UT8A 1NK9A 2IOHA 3EWAA 1MN8A 5ALXA 4CF5A 5KFVA 1N63A 3LWLA 2VJ5A 2JEFA 2HHWA 4BDPA 4YQWA 1URJA 3MR3A 2WTFA 4KLUA 4EX6A 3UMGA 5ALKA 2C2DA 3MGVA 5KFDA 5CHGA 1AROP 4F5NA 5JTIA 3BDPA 3MDAA 3T5LA 5IINA 4CF3A 4F4WA 3J81j 1COKA 1FFUA 1KL9A 3QUTA 3RJEA 4F4KA 4J9OA 9ICCA 4YXMA 4Q8EA 3ZDBA 3FAHA 3ZD8A 3IG5A 1DRGA 5ALYA 2V4QA 2VA8A 5KFYA 3RF9A 2BGWA 2BKEA 1JXLA 4RQ0A 1TV9A 4F71A 4EYHB 2KVSA 2XIDA 1ZQAA 4BXOB 2VA3A 1IG6A 5ALJA 5D46A 5KFZA 4FE3A 2Q0ZX 2WF7A 1O08A 5KFQA 3UMCA 4JV1A 1DGJA 1S0VA 1A76A 4UB1A 3PSPA 4R8UB 2DBYA 1NK6A 3GU3A 1JI7A 4IL6U 1JXEA 5KT3A 2HOFA 3T79A 4KN7A 4Y2XA 1XSPA 2HCFA 5ALGA 1Q8KA 4UARA 3IN5A 5KNIA 1SL2A 1SZPA 1S97A 2V9WA 3RBDA 9ICEA 3QU7A 2W8KA 4TUSA 4DL7A 9ICIA 2B0CA 4F5RA 4Q44A 2W55A 1QSSA 2WHEA 1L3SA 2BQ3A 1OUQA 1QQ7A 4RQNA 5J0XA 4QWAA 4I2FA 3AU2A 4ZOHC 3QUQA 4MHVA 1L7OA 2KE7A 4PGXA 3QEAZ 2AGOA 4UAUA 3AQFA 2E5SA 4YP3A 1AQ6A 1ZQLA 1TVAA 4LZDA 1COOA 1BPZA 3TAQA 3QX7A 1K5OA 5KT4A 3GV8B 4DS5A 1FIQA 2MA1A 3LDAA 4DL4A 2G09A 2KP7A 4PPXA 1X42A 3ZD9A 3JPOA 3K75D 4ECRA 4PL1A 5J0YA 2W04A 4DCCA 3HT3A 8ICWA 1BVSA 3KBBA 4NV0A 5KFTA 3AL0B 4KX3A 4UAZA 4XRHA 5ALHA 2KIWA 5ALMA 2FMPA 1ZQYA 2WAQF 5EE3A 3UMBA 2OCEA 3SAHA 3NVYA 3AEVA 2ES6A 2HMXA 2WB1F 4KLIA 2KFNA 9ICJA 3QXGA 2C22A 2D6FC 2CN1A 4HAIA 7ICQA 4QZHA 1K1QA 4DQPA 4I2IA 1ECWA 1HUOA 5AK5A 4EZ6A 3QE9Y 3PSTA 8ICRA 5AK6A 8ICLA 3JPRA 3C5GA 1L3UA 4CGZA 5AI8A 4DF4A 1NZPA 2HBKA 2KKPA 5AI5A 4BXOA 4ECXA 1ZQVA 2ZJAA 3G6XA 3C5FA 5J2DA 2HBMA 3OHAA 2QKQA 5B66U 2ZIUB 1X6IA 4UATA 3PO4A 4A8EA 4R8UA 1NK8A 2PFOA 2OEHA 4OJ6A 1ZQUA 3GIKA 1O03A 3MR6A 4MFCA 3Q8KA 5ALPA 3BS7A 5CJ7A 2QB1A 2YMLA 4KLDA 5KG6A 3AQEA 3GDXA 3BZKA 4M9LA 1WG8A 2HHQA 5BPCA 3QEBZ 2OWOA 1Q3VA 4J9PA 1PVRA 2K89A 3CW2C 1ZQWA 4DL6A 2ODGA 2I9GA 5KFMA 2NRXA 2R8KA 4M6WB 4R66A 1RYRA 3MFHA 2E1EA 3CYMA 3D2QA 2WFAA 5ALIA 1V38A 8ICPA 3K4GA 3TFSA 3H0RB 4UAVA 1S76D 3LK9A 4KMOB 3MBYA 3NTUA 5J0TA 1U49A 2HHTA 4Y2YA 5J2FA 5HR7A 1FEZA 3H8SA 3SV3A 2HVHA 2Q4TA 3H7IA 4LJXA 2KSOB 4C8MA 3NRWA 4B9UA 2AQ4A 4ELVA 4FBTA 2DGZA 1B0XA 5IIMA 3GFKB 9ICTA 4J9MA 5ALUA 4UB8U 5AKGA 4ED1A 3C1YA 4J9SA 2EANA 2J6UA 1ZETA 5CRXA 1PZNA 4PZNA 5C5JA 4F8RA 4F5QA 4Q43A 2PFNA 4LVSA 5AIAA 3KKAC 3TADA 5KFAA 7ICNA 1V97A 4Y2UA 4RT2A 3DEEA 2AH5A 2ZUBA 3TAPA 1BPYA 1N5XA 3N28A 3HWTA 2NRTA 1D8LA 3C2LA 4OO1J 1NKCA 2D3DA 9ICNA 3BQ0A 3NVWA 3QU9A 2MU2A 1NJXA 1B22A 7ICMA 2WF5A 2ZTCA 1A6SA 4DL5A 1HJPA 2AU0A 2L5YA 3CP8A 3MFIA 2EZYA 2H3VA 3SENA 4DFPA 3Q8MA 4IRCA 8ICYA 5KFKA 3UQ2A 2KKVA 2LPEA 3EPGA 2ZIUA 3C21A 3KZIU 2ZXIA 3BQTA 2W43A 5HHHA 1SL0A 1IXRA 4RQ2A 4TUQA 2W9MA 1N61A 2KJ5A 2HBJA 4DFDA 4B9SA 1ZQHA 2G06A 4US8A 3G6YA 5KFEA 4K4HA 3ONNA 5TISU 4KLFA 2EAOA 3OSNA 3EUB2 5KG3A 1DOQA 1SB3C 2KG5A 5IIKA 2BCUA 1MSWD 2XVTA 4Y2QA 4QWDA 4O3PA 2EZZA 4FZNA 1UHUA 4M6WA 4YN4A 1C20A 1H38A 1RG6A 2IHMA 5J2AA 5DLGA 4I27A 4DSIA 4QZDA 4FFDA 1FFVA 4RQ4A 7ICTA 1N5WA 7ICOA 5H2FU 4J9RA 4KTQA 3I76A 5IIJA 3OSPA 2HW3A 4GIBA 4F92B 2HHVA 3V7KA 3B9JA 2P6UA 1XSLA 2KV2A 1TE2A 2KSOA 2NO5A 3QU4A 3I28A 3D2NA 4C0ZA 3BQ2A 3T3FA 1T3QA 4I2CA 1SZHA 3D6JA 3Q8RB 1S9FA 1ZD3A 4FZLA 9ICQA 2G5IB 4F2RA 3ETLA 2W11A 2ZTEA 4B9NA 5AKEA 9ICBA 3IDWA 5DQHA 1ZQGA 4EELA 4EEKA 5J2HA 1Z1BA 4IRDA 3WKCA 2XGQA 4EEYA 4QZ8A 1GO3F 4NLKA 7ICIA 1RYUA 1YZ7A 1UT5A 5KT2A 1QH9A 2HOIA 2R8HA 1D9DA 3ISDA 5DG8A 3WK8A 1DK3A 4UAWA 1J2NA 4KLOA 2DL0A 2XCPA 7ICSA 2KHVA 1QQ6A 2Y9UA 4CCHA 4O3QA 4P4PA 3KFUF 3A0BU 2W03A 3HP6A 4BJQA 5HMMA 4IC9A 2KFZA 3M1YA 3FC4A 4DFJA 1SV0A 4JV2A 5FP0A 3HPOA 4J9LA 3IRUA 2JV3A 4RQ1A 3UXPA 4PZOA 2P66A 3KD3A 5CR0A 1NJYA 3SYZA 4YD1A 7ICFA 1ED1A 5L1JA 3PX0A 4F4XA 1F5SA 4UW9A 4C80A 3KHRA 1X40A 5L9XA 2LKYA 3RAQA 4OJOA 4I2BA 2A3VA 1L3VA 5AM2A 3HW8A 2Y0SC 1UQVA 2OYYA 4O0IA 4JUZA 4ECZA 4PHAA 2ATLA 4ECSA 4DLEA 4Z6FA 1BNOA 5KAIU 5KL1B 4DO9A 2W9CB 1QQ5A 2K8CB 4YCXA 2W9BB 1JUDA 1IV8A 1ZRNA 1BPXA 1D8BA 4MF2A 5KG1A 4RQ6A 5J8YA 4QZCA 3SZ2A 1NJZA 4DQIA 3KOOA 4ICAA 1DXSA 3NS1A 2KOBA 1RM6C 1QSYA 1OXJA 4YMOA 5J0UA 2K8AA 5AK3A 2ALZA 1ZQNA 1U9LA 5ALSA 4O5EA 1XO1A 5DDYA 1V9PA 4DSLA 9ICAA 1T4GA 3F53A 2YB4A 2OXOA 2XY5A 5DB7A 5IIOA 3WU2U 5C0YA 5KFWA 5DBBA 4P2HA 3PX4A 3RTVA 2EZXA 3ZDAA 4KX5A 4DL2A 4NJ8A 4B9LA 2B21A 3WKBA 2FE9A 2Y9TA 1K1SA 4RUCA 3NUQA 2XGPA 4CDGA 1RXVA 1A77A 3RJHA 1FO4A 5K4LA 3GIIA 1S77D 2FI1A 4R63A 1ZQFA 3N97B 7ICPA 2P6RA 5KL8B 2JZBA 4QZIA 4RQ3A 1NK0A 1PK3A 1S10A 1JROA 5IILA 2I6XA 3M9MB 3IP4B 2DKXA 3IV6A 1NK4A 2IBKA 2YN4A 1L7PA 2MUTB 5EE1A 5J0WA 5J2IA 4F5PA 3H8WA 4JB3A 2QB0B 4GXKA 3NVVA 2Y1JA 3M9OB 4QIWF 4TUPA 2AGPA 4G3IA 3H40A 2A1JA 2DFLA 5J0SA 4RU9A 4ED2A 3QZ7A 1ZQJA 5ALLA 5KFBA 4QJFB 2M0NA 4PHPA 4YD2A 4U7CA 4ECYA 3V6KA 3THVA 3ISCA 1WYGA 3RH6A 4CNQA 3GIJA 4J9QA 1QLNA 2UVVA 3H0MB 2W9CA 3RB6A 5J0RA 5JU5A 2W9BA 4UBBA 3C2MA 4WJ3B 1P7DA 3E0FA 4F93B 4Y2JA 4EYIB 2EQYA 2AXTU 5DG7A 4UB4A 2UVUA 3RH5A 1KDHA 2XCAA 1QTMA 2Y1IA 4ECWA 4B9VA 5J2BA 1KKXA 1NNLA 2JH1A 4QZFA 3BQ7A 1D9FA 1OW5A 4Y2PA 2VANA 2LBOA 2GLEA 2MRLA 3E2EA 3CRXA 2F8KA 1JMSA 2NO4A 5HMLA 2ZJ8A 2LYBA 3RJGA 4ECVA 3RRGA 3M8RA 1ZQQA 5AKXA 1ZQZA 3RB0A 3NASA 4G9BA 2W9AA 3M9NB 4EBCA 4TURA 3N7PD 5ALFA 4OD0A 2RHFA 2LYHA 3ZI4A 1KRPA 5HNKA 4PHDA 3Q8QB 2D8CA 4C4SA 3RJJA 2F1IA 2DWQA 4ELUA 3UQ0A 3BJYA 5EWFA 4YMMA 9ICOA 1SXEA 4O3NA 5HR6A 2CRXA 3R9KA 4KLTA 2AGQA 2PI5A 2ZTDA 4M2YA 2O6KA 4YMNA 4F91B 2NRZA 3M7DA 4KLGA 4DOCA 2MUTA 3L3FX 8ICXA 4KLJA 3SR6A 4HYKA 5DGAA 5ALZA 5AI0A 2QB0A 2EH9A 4M9GA 1Z00B 3PSFA 1JRPA 1XS9D 3K1RB 5J2KA 1L7MA 4NLCA 5F3XB 1NOMA 8ICMA 1ZQBA 8ICTA 4RUAA 2NYVA 2WF9A 2MSNA 4BUGA 1KBUA 4P0PB 3U26A 4Y2SA 1NK5A 5ALOA 1F44A 1RQLA 4C7ZA 4KLLA 2Y0SF 1PVPA 3TADC 4B6JA 2HVIA 1SGGA 3F2CA 3RJIA 4ZH4A 3WKEA 2BQRA 4IR9A 3OHBA 4FS2A 4GLXA 1XNSA 2J6TA 4OJ5A 5B5EU 1LV5A 2HHSA 4FZMA 2YMQA 2ZIWB 3EW9A 2ESEA 2W7OA 5D49A 4FO6A 4C8KA 5J0PA 1ZQXA 2F3NA 4RQ8A 4RNMA 3SEIA 5KFGA 2RDIA 2FPMA 3MGIA 2BCQA 3N4MB 5KFSA 1KW4A 2YMMA 4MEYA 1U4BA 3FYHA 1T3NA 2H3ZA 3PW2A 5J2GA 4OJPA 2FLNA 3IM1A 4O5KA 3RH4A 2DUYA 4DS4A 3RRHA 4DEZA 3MDCA 5DQIA 2FPKA 2ISPA 2FMSA 3UXNA 5ALTA 3GIMA 1X66A 3ZDEA 4Y2RA 1TAQA 3WK7A 5AK4A 5KFRA 4M04A 1MA7A 1CUKA 2BPGA 5AM1A 4ED0A 5HHIA 2Z7JA 5AKZA 5IIIA 4QNLA 7ICRA 1KN5A 1KQQA 4O9MA 1TK8A 3RAXA 4UB5A 4IQTA 4P0QB 2H3IA 4DL3A 3KHGA 2YX8A 2BR0A 4UBCA 3TANA 2G5HB 5KFIA 4JK1A 1N62A 2PXIA 1Z00A 2I5HA 5ALQA 3EPIA 4PGQA 3F2BA 4B9MA 9ICSA 5CB1A 1J97A 4C8LA 9ICXA 2LMRA 2R8GA 1T8EA 5KAFU 3PW5A 5AKIA 5AKLA 3E58A 4P0PA 2LM4A 1YZ6A 8ICVA 3UXOA 2PKEA 1DGSA 1ZQSA 5ALRA 4CF4A 4XA5A 4EENA 2BCRA 2MAXA 3C23A 1XWLA 1NKBA 2GWSA 4UB6U 1XU4A 8ICAA 3I1YA 4DOAA 2R8IA 2FLLA 5ALNA 1KSPA 2ZIWA 4JWNA 2AHOB 3PW4A 3H8JA 1NI3A 3PY8A 1L8LA 1L8OA 4YR0A 4RT3A 2K4HA 1ZJMA 3EYZA 2LHTA 2EAPA 2IMWP 2K8BB 4QZAA 3KTQA 3OPXA 3PW7A 4USAA 1UCVA 4O3RA 2JMGA 3SV4A 1ZRMA 5EWEA 4M9JA 1IIPA 1XO0A 4P4MA 2F1JA 2CPRA 2YB1A 7ICGA 2FJ6A 2ZIVA 3QU5A 3C1ZA 4YFKA 4RQ7A 3DDHA 2BDPA 4CRXA 1X9MA 3TFRA 7ICKA 4US9A 8ICBA 5G5HA 5DBAA 5EE9A 1ZQEA 4QZEA 3RFAA 4NY8A 3N7SC 9ICRA 4PJ0U 3WK4A 5KG2A 2RQ5A 4ED6A 2DPIA 2W3SA 2F8LA 3V7LA 5CP2A 3AU6A 8ICSA 2FDRA 3OJUA 3LVWA 4QW8A 1BNPA 5J0QA 4YVZA 1X9WA 5HP4A 3V6HA 4EBDA 3WK9A 2IOFK 3L5KA 1JN3A 2JZBB 4RPYA 3CNHA 4P0QA 5EWGA 4Z6EA 3AM9A 3LYSA 4NXZA 5J8YC 4GFJA 1MQ2A 3V72A 2RP5A 1ZQOA 1HIWA 1X6JA 5CA7A 4TQSA 4DSKA 2F76X 5DB6A 3TKAA 2XICA 5F9LA 2XY6A 1N56A 4XQ8A 5DB9A 2JEIA 2KIVA 4I2GA 3WK6A 2F77X 2A1JB 1RDFA 4C4RA 5AKJA 3RB4A 1ZQRA 3B0YA 2KZ3A 3HRDD 1SV4A 3GZFA 2PFQA 3WKDA 4ELTA 9ICVA 4DLGA 2AJQA 5CWRA 4I2EA 2KN7A 3HJEA 1KFDA 2KNJA 8ICNA 4IQWA 2XI9A 3LVVA 1JIHA 5KT6A 4AP9A 2IOFA 1Q3UA 3F5AA 2HHUA 5DGBA 3TQ1A 4J03A 5JUMA 4PL2A 4JV0A 1SXDA 5T14A 5DG9A 5KFNA 3Q8PB 4RPXA 4KMUA 2RLTA 5CEHA 5DDMA 4FS1A 3D2SA 3ETRA 4K4GA 4MF8A 3VC8A 2W7PA 9ICMA 2ASJA 1S8OA 8ICJA 4NL9A 3EZ5A 1TAUA 5KFHA 4GXJA 5DB8A 3HX0A 3GQCA 2IA6A 4DF8A 5ALEA 3MGHA 2NV3A 8ICHA 2QLTA 4I2AA 5KT5A 4YR3A 1ZQCA 1VDVA 4I29A 2BPFA 3RR8A 1ZD4A 1WUDA 5L1KA 2PMZC 5F9NA 3RJFA 5AICA 4M9HA 4MFFA 3PO5A 2W8LA 4DWIA 4BWMA 4UB2A 3Q8SB 2VA2A 2LM1A 2E8PA 4X5VA 3DV9A 1WCLA 5KFCA 4MFAA 4EBEA 1ZQPA 5KTQA 1KTQA 3WKAA 3JPSA 1LVHA 1JALA 1NZBA 2F1HA 1TK5A 1NJWA 3H0LB 5J2CA 4RZRA 9ICFA 2DKZA 5KG4A 4Q8FA 8ICZA 4R64A 3UM9A 4Z6DA 1WCNA 3QU2A 1LB2B 8ICIA 8ICEA 9ICKA 3M6KA 3V7JA 2IHNA 2F2AB 1RXWA 4J9KA 1HEKA 3SMVA 2NRWA 1L3TA 3L4PA 1SL1A 3FM9A 3F2DA 2VIXA 1PVQA 4KLHA 4UASA 5A0LA 5AM4A 4DFMA 1RPLA 4M47A 1N2XA 1WWVA 2KJ8A 1CEZA 5KFLA 3ISBA 4IR1A 1BPBA 3PX6A 5G5GA 1U47A 3M8SA 1CI4A 1SKSA 5KFPA 3Q8LA 2QARA 1RQNA 5L1LA 4O3SA 4IQVA 2FMQA 2ZUDA 2PFPA 1F0MA 2E8NA 5J2JA 3PR5B 1QCKA 1ZYQA 9ICUA 1U48A 4I2HA 2ZIXB 4Y2VA 4GC6A 3QZ8A 3SQIA 2KMDA 4AYBC 2OH2A 5AKHA 2E8OA 2LI6A 5L1IA 2P35A 2H5XA 2B6GA 4P4OA 4NM2A 3HKZC 5D4BA 4ECTA 1IM4A 4J9NA 3QYPA 4QWCA 1DK2A 3QUCA 1SKWA 5TZVA 4DSFA 3SI8A 1T7PA 3NVZA 3OTQA 3SAFA 3JPNA 3S6JA 1S0MA 3PW0A 1Z3EB 4DQRA 7ICHA 4RPZA 2GOLA 1MQ3A 2HOQA 3PMNA 4NWIA 5KFFA 3GILA 3VCBA 2K4EA 4UQGA 1C7YA 1S0OA 2BHNA 1LKYB 3QNMA 4IS7A 5KFJA 3RJKA 2ZUCA 4XUSA 2ZJ5A 2KZZA 1VJ5A 1SIJA 2JXJA 2KJ9A 2FLPA 7ICVA 2RDJA 1JX4A 2EDUA 1X9XA 1N48A 1KFSA 2DQNB 4YR2A 1WWUA 3ICXA 2JRZA 1BGXT 3MABA 2ASDA 1HUZA 4NLNA 8ICCA 4QW9A 2G0AA 4Y2TA 3ZDCA 3H8MA 1KFTA 2KVCA 4UB3A 4K4IA 2YQEA 2BPCA 4ECUA 3GV5B 1D8YA 3BQ1A 2H3QA 3BS5B 3JPQA 2UVWA 2YTUA 2PI4A 1RZTA 3KHLA 3HILA 4F3OA 2A19A 2XC9A 2A1AA 3AN1A 7ICUA 2XO7A 3RBEA 2LYAA 1J2MA 3NGDA 1Z1VA 4RNNA 1Q46A 2YY6A 1ZD2P 2ZIXA 3IHQB 4GXIA 3OJSA 2W54A 1X2IA 9ICLA 4OCZA 1ZOLA 4KLSA 2ZIVB 5AHXA 3T5JA 3JPPA 5GTIU 3N7RC 4CE6A 1PK1B 1A0PA 1SKRA 2I1QA 3RR7A 3MR2A 3OGUA 1BPDA 4I2JA 4DQSA 1PUZA 3PZPA 2EAMA 2R18A 5KFUA 4NM1A 2OHFA 2WF6A 8ICUA 5AIBA 3SAGA 5KFXA 4FBUA 3C2KA 1KEJA 2PMZF 9ICPA 8ICKA 4EZ9A 3NRZA 3ED5A 4U6PA 2W3RA 2ZXHA 4KITB 1ZQDA 5KT7A 1ZQ1C 1EXNA 2R8JA 4RQMA 1LKYA 4YXJA 1XSNA 2UVRA 3AMZA 4QWEA 5GTHU 1V85A 5AKKA 3PVXA 2KICA 1ZQIA 5AM3A 5AI9A 2KEYA 1CRXA 4BGDA 1ZD5A 1VLBA 2BDUA 1YT3A 4DSEA 2DPJA 2WF8A 5KG5A 2G08A 4F50A 4NLBA 2AQ0A 1X9SA 5BOLA 2VKQA 3V6JA 4RQ5A 5DQGA 3AUOA 2F44A 5EOZA 1S5LU 3F5EA 7ICEA 4QIWC 3RB3A 4PGYA 4UAYA 4ECQA 4Q45A 3ALRA 2ASLA 5KFOA 3KKAA 3O0FA 2HSZA 4M0AA 4ED8A 4B9TA 4IQUA 2KD1A 5ALVA 3BS5A 1TK0A 3C29A 2HI0A 4RNOA 2HBLA 2V4RA 2JGAA 1TAMA 2KZMA 7ICLA 1S0NA 1ZQTA 4I2DA 5JRTA 4ED7A 2GO7A 2GH1A 2DF4B 3JPTA 4QZ9A 4YG2A 4ACOA 1NKEA 4R65A 3T5HA 2C2RA 3H4BA 4M9NA 1SV0C 2ISOA 7ICJA 1UPHA 5DBCA 4NLGA 4KLQA 4F4ZA 3MR5A 5BOMA 4DFKA 4C4TA 9ICGA 2BCSA 3K1ZA 1PK1A 3M6ZA 4C7YA 1XC9A 3T5KA 4BWJA 4OJLA 3TI0A 1L7NA 3PSIA 3PV8A 2K4IA 4AYBF 1T94A 5J29A 4JWMA 2JEJA 1SWWA 1ZJNA 4C8OA 4O3MA 2C28A 3WK5A 3HKZF 4JMUA 2WAQC 4DOBA 1N60A 9ICHA 2HHXA 4F72A 3A0HU 2JH7A 3TACB 2WB1C 4KLEA 2YMPA 2BQUA 2FPLA 1L6NA 3H4DA 1Z4OA 5AKYA 3LWMA 3FDSA 4QZGA 3MC1A 3PR4A 1UA1A 5ALWA 2NRVA 2E1FA 5DLFA 2K4PA 2BCVA 4F5OA 4KLMA 4ED3A 5KG0A 3GV7B 2OM6A 1B43A 1ZQMA 2HDOA 2BZFA 5ALDA 1RYSA 1BPEA 1M6YA 3PMLA 4KN4A 2RRDA 3SD7A 3B0XA 2E8MA 5AM0A 5AM5A 4I28A 5E79U 1QSLA 2CXYA 1Z19A 2M9NA 3QUBA 2JHDA 5L1MA 2KHQA 3KZXA 1Y88A
chains in the Genus database with same CATH topology
3N7RC 4NLCA 3E0FA 2GOLA 2Z7JA 1Q3UA 1A0PA 4CRXA 4PL1A 2E1EA 2HOQA 2KHVA 2GH1A 2DF4B 2W04A 4NWIA 2ZG6A 3CYMA 4QNLA 3D2QA 5C0YA 3F5AA 3VCBA 2KJ5A 2HBJA 2K4EA 4NV0A 4ACOA 3KFUF 3IG5A 3AL0B 4KX3A 4BUGA 3PZPA 2W03A 1KBUA 3M6KA 2R18A 4PL2A 2KIWA 3H0RB 2F2AB 4BJQA 4IC9A 2G06A 1DRGA 4P0PB 5T14A 4P0QB 1HEKA 2H3IA 4KMOB 3ONNA 2JH1A 3RF9A 3RFAA 1UPHA 3N7SC 2YX8A 2WAQF 4KX5A 1F44A 3SMVA 3SAGA 3SAHA 3F2DA 2G5HB 2VIXA 2N1RA 2Y0SF 1PVQA 5HR7A 2LBOA 5A0LA 1PVPA 2HMXA 3D2SA 2PMZF 2WB1F 2F8LA 2MRLA 2Q4TA 2XIDA 2XVTA 3NUQA 3K1ZA 2KJ9A 3F2BA 2G07A 4CDGA 2D6FC 3VC8A 4FZNA 3CRXA 3LVWA 2W7PA 3F2CA 2CN1A 2VJ4A 3M6ZA 3NRWA 4U6PA 2KJ8A 4OJLA 3PSIA 2ZXHA 2K4IA 1ECWA 1ED1A 2DGZA 4FE3A 4AYBF 1ZQ1C 1T94A 2LYBA 2DQNB 1XNSA 3ICXA 4OJ5A 4P0PA 5KL8B 3PSTA 4FZMA 4P0QA 2ZIWB 3PSPA 4O3MA 3GU3A 3C28A 2W7OA 5CRXA 3LYSA 3HKZF 4JMUA 2LKYA 2NV3A 2HOFA 2WAQC 3N7PD 4OJOA 2G0AA 2A3VA 2RHFA 4GFJA 3T79A 2KICA 2RP5A 3IG8A 4CGZA 4BX9C 2Y0SC 2KEYA 1HIWA 2KVCA 3IP4B 2HBKA 2KKPA 1WUDA 1CRXA 2OYYA 2JH7A 2BDUA 2KV2A 1YT3A 2PMZC 2WB1C 3IN5A 3D2NA 4C0ZA 2H3FA 2ZIXB 2H3QA 1L6NA 2F76X 3DEEA 2HBMA 2XICA 3SQIA 2G08A 4NLBA 4AYBC 2OH2A 1SZHA 5KL1B 4OO1J 2ZIUB 2K8CB 4A8EA 4FZLA 2E1FA 2ZIWA 2VKQA 5HR6A 2G5IB 2H3ZA 1OUQA 1P7DA 4QIWF 2LYAA 1D8BA 4OJ6A 2CRXA 3F5EA 2VJ5A 2F77X 3HKZC 4QIWC 2OM6A 4OJPA 1URJA 3AQFA 3ALRA 4ICAA 2K4HA 2KOBA 2E5SA 3O0FA 1A6SA 3M7DA 2LHTA 2K8BB 3AQEA 3CP8A 2K8AA 2H3VA 4QJFB 2M0NA 3OPXA 2RRDA 2JMGA 2KD1A 3GZFA 2ZIXA 3L3FX 1Z1BA 4U7CA 3C29A 1NZBA 2KKVA 1Q3VA 1IIPA 3MGVA 1PVRA 1GO3F 2HBLA 3H0MB 1Z19A 1XO0A 2JGAA 2K89A 2MA1A 2ZIUA 1TAMA 2CPRA 2JHDA 3H0LB 2KNJA 2HOIA 2YB1A 3PSFA 2KHQA 3KZXA 2G09A 2ZIVB 3SAFA 2XI9A 2ZIVA 2ZXIA 3F53A 1MA7A 3LVVA 2YB4A 4WJ3B 2OXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW C;  2Y0S C;  4AYB C;  2WAQ C;  2WB1 C;  2PMZ C;  3HKZ C; 
#chains in the Genus database with same CATH topology
 3G6V A;  1Z4N A;  3TAR A;  4QZB A;  1NK7 A;  4NLZ A;  1B4F A;  1ZQK A;  2ZG6 A;  1MC8 A;  4NL9 C;  5DKW A;  4F2S A;  3PNC A;  2K60 A;  1UA0 A;  4LZG A;  1TFR A;  4C8N A;  4QWB A;  8ICG A;  1TKD A;  5J0O A;  4DQQ A;  2E3T A;  5KG7 A;  4MEX A;  2KK0 A;  1ZXI A;  5AI4 A;  2N1R A;  2XY7 A;  3ORY A;  4O3O A;  1KLN A;  4PHE A;  4O5C A;  4GC7 A;  3UPQ A;  2KTQ A;  8ICF A;  2G07 A;  1SWV A;  2VJ4 A;  8ICO A;  1U45 A;  5AI6 A;  2QAR B;  5EE0 A;  9ICW A;  8ICQ A;  4TQR A;  3BZC A;  3C28 A;  5J2E A;  3ZDD A;  4PH5 A;  4IRK A;  4F4Y A;  2JEG A;  3IG8 A;  4E0D A;  4BX9 C;  2C2E A;  3KHH A;  1L5U A;  4Z6C A;  4EX7 A;  2J6S A;  2JR5 A;  2H3F A;  4DSJ A;  1UT8 A;  1NK9 A;  2IOH A;  3EWA A;  1MN8 A;  5ALX A;  4CF5 A;  5KFV A;  1N63 A;  3LWL A;  2VJ5 A;  2JEF A;  2HHW A;  4BDP A;  4YQW A;  1URJ A;  3MR3 A;  2WTF A;  4KLU A;  4EX6 A;  3UMG A;  5ALK A;  2C2D A;  3MGV A;  5KFD A;  5CHG A;  1ARO P;  4F5N A;  5JTI A;  3BDP A;  3MDA A;  3T5L A;  5IIN A;  4CF3 A;  4F4W A;  3J81 j;  1COK A;  1FFU A;  1KL9 A;  3QUT A;  3RJE A;  4F4K A;  4J9O A;  9ICC A;  4YXM A;  4Q8E A;  3ZDB A;  3FAH A;  3ZD8 A;  3IG5 A;  1DRG A;  5ALY A;  2V4Q A;  2VA8 A;  5KFY A;  3RF9 A;  2BGW A;  2BKE A;  1JXL A;  4RQ0 A;  1TV9 A;  4F71 A;  4EYH B;  2KVS A;  2XID A;  1ZQA A;  4BXO B;  2VA3 A;  1IG6 A;  5ALJ A;  5D46 A;  5KFZ A;  4FE3 A;  2Q0Z X;  2WF7 A;  1O08 A;  5KFQ A;  3UMC A;  4JV1 A;  1DGJ A;  1S0V A;  1A76 A;  4UB1 A;  3PSP A;  4R8U B;  2DBY A;  1NK6 A;  3GU3 A;  1JI7 A;  4IL6 U;  1JXE A;  5KT3 A;  2HOF A;  3T79 A;  4KN7 A;  4Y2X A;  1XSP A;  2HCF A;  5ALG A;  1Q8K A;  4UAR A;  3IN5 A;  5KNI A;  1SL2 A;  1SZP A;  1S97 A;  2V9W A;  3RBD A;  9ICE A;  3QU7 A;  2W8K A;  4TUS A;  4DL7 A;  9ICI A;  2B0C A;  4F5R A;  4Q44 A;  2W55 A;  1QSS A;  2WHE A;  1L3S A;  2BQ3 A;  1OUQ A;  1QQ7 A;  4RQN A;  5J0X A;  4QWA A;  4I2F A;  3AU2 A;  4ZOH C;  3QUQ A;  4MHV A;  1L7O A;  2KE7 A;  4PGX A;  3QEA Z;  2AGO A;  4UAU A;  3AQF A;  2E5S A;  4YP3 A;  1AQ6 A;  1ZQL A;  1TVA A;  4LZD A;  1COO A;  1BPZ A;  3TAQ A;  3QX7 A;  1K5O A;  5KT4 A;  3GV8 B;  4DS5 A;  1FIQ A;  2MA1 A;  3LDA A;  4DL4 A;  2G09 A;  2KP7 A;  4PPX A;  1X42 A;  3ZD9 A;  3JPO A;  3K75 D;  4ECR A;  4PL1 A;  5J0Y A;  2W04 A;  4DCC A;  3HT3 A;  8ICW A;  1BVS A;  3KBB A;  4NV0 A;  5KFT A;  3AL0 B;  4KX3 A;  4UAZ A;  4XRH A;  5ALH A;  2KIW A;  5ALM A;  2FMP A;  1ZQY A;  2WAQ F;  5EE3 A;  3UMB A;  2OCE A;  3SAH A;  3NVY A;  3AEV A;  2ES6 A;  2HMX A;  2WB1 F;  4KLI A;  2KFN A;  9ICJ A;  3QXG A;  2C22 A;  2D6F C;  2CN1 A;  4HAI A;  7ICQ A;  4QZH A;  1K1Q A;  4DQP A;  4I2I A;  1ECW A;  1HUO A;  5AK5 A;  4EZ6 A;  3QE9 Y;  3PST A;  8ICR A;  5AK6 A;  8ICL A;  3JPR A;  3C5G A;  1L3U A;  4CGZ A;  5AI8 A;  4DF4 A;  1NZP A;  2HBK A;  2KKP A;  5AI5 A;  4BXO A;  4ECX A;  1ZQV A;  2ZJA A;  3G6X A;  3C5F A;  5J2D A;  2HBM A;  3OHA A;  2QKQ A;  5B66 U;  2ZIU B;  1X6I A;  4UAT A;  3PO4 A;  4A8E A;  4R8U A;  1NK8 A;  2PFO A;  2OEH A;  4OJ6 A;  1ZQU A;  3GIK A;  1O03 A;  3MR6 A;  4MFC A;  3Q8K A;  5ALP A;  3BS7 A;  5CJ7 A;  2QB1 A;  2YML A;  4KLD A;  5KG6 A;  3AQE A;  3GDX A;  3BZK A;  4M9L A;  1WG8 A;  2HHQ A;  5BPC A;  3QEB Z;  2OWO A;  1Q3V A;  4J9P A;  1PVR A;  2K89 A;  3CW2 C;  1ZQW A;  4DL6 A;  2ODG A;  2I9G A;  5KFM A;  2NRX A;  2R8K A;  4M6W B;  4R66 A;  1RYR A;  3MFH A;  2E1E A;  3CYM A;  3D2Q A;  2WFA A;  5ALI A;  1V38 A;  8ICP A;  3K4G A;  3TFS A;  3H0R B;  4UAV A;  1S76 D;  3LK9 A;  4KMO B;  3MBY A;  3NTU A;  5J0T A;  1U49 A;  2HHT A;  4Y2Y A;  5J2F A;  5HR7 A;  1FEZ A;  3H8S A;  3SV3 A;  2HVH A;  2Q4T A;  3H7I A;  4LJX A;  2KSO B;  4C8M A;  3NRW A;  4B9U A;  2AQ4 A;  4ELV A;  4FBT A;  2DGZ A;  1B0X A;  5IIM A;  3GFK B;  9ICT A;  4J9M A;  5ALU A;  4UB8 U;  5AKG A;  4ED1 A;  3C1Y A;  4J9S A;  2EAN A;  2J6U A;  1ZET A;  5CRX A;  1PZN A;  4PZN A;  5C5J A;  4F8R A;  4F5Q A;  4Q43 A;  2PFN A;  4LVS A;  5AIA A;  3KKA C;  3TAD A;  5KFA A;  7ICN A;  1V97 A;  4Y2U A;  4RT2 A;  3DEE A;  2AH5 A;  2ZUB A;  3TAP A;  1BPY A;  1N5X A;  3N28 A;  3HWT A;  2NRT A;  1D8L A;  3C2L A;  4OO1 J;  1NKC A;  2D3D A;  9ICN A;  3BQ0 A;  3NVW A;  3QU9 A;  2MU2 A;  1NJX A;  1B22 A;  7ICM A;  2WF5 A;  2ZTC A;  1A6S A;  4DL5 A;  1HJP A;  2AU0 A;  2L5Y A;  3CP8 A;  3MFI A;  2EZY A;  2H3V A;  3SEN A;  4DFP A;  3Q8M A;  4IRC A;  8ICY A;  5KFK A;  3UQ2 A;  2KKV A;  2LPE A;  3EPG A;  2ZIU A;  3C21 A;  3KZI U;  2ZXI A;  3BQT A;  2W43 A;  5HHH A;  1SL0 A;  1IXR A;  4RQ2 A;  4TUQ A;  2W9M A;  1N61 A;  2KJ5 A;  2HBJ A;  4DFD A;  4B9S A;  1ZQH A;  2G06 A;  4US8 A;  3G6Y A;  5KFE A;  4K4H A;  3ONN A;  5TIS U;  4KLF A;  2EAO A;  3OSN A;  3EUB 2;  5KG3 A;  1DOQ A;  1SB3 C;  2KG5 A;  5IIK A;  2BCU A;  1MSW D;  2XVT A;  4Y2Q A;  4QWD A;  4O3P A;  2EZZ A;  4FZN A;  1UHU A;  4M6W A;  4YN4 A;  1C20 A;  1H38 A;  1RG6 A;  2IHM A;  5J2A A;  5DLG A;  4I27 A;  4DSI A;  4QZD A;  4FFD A;  1FFV A;  4RQ4 A;  7ICT A;  1N5W A;  7ICO A;  5H2F U;  4J9R A;  4KTQ A;  3I76 A;  5IIJ A;  3OSP A;  2HW3 A;  4GIB A;  4F92 B;  2HHV A;  3V7K A;  3B9J A;  2P6U A;  1XSL A;  2KV2 A;  1TE2 A;  2KSO A;  2NO5 A;  3QU4 A;  3I28 A;  3D2N A;  4C0Z A;  3BQ2 A;  3T3F A;  1T3Q A;  4I2C A;  1SZH A;  3D6J A;  3Q8R B;  1S9F A;  1ZD3 A;  4FZL A;  9ICQ A;  2G5I B;  4F2R A;  3ETL A;  2W11 A;  2ZTE A;  4B9N A;  5AKE A;  9ICB A;  3IDW A;  5DQH A;  1ZQG A;  4EEL A;  4EEK A;  5J2H A;  1Z1B A;  4IRD A;  3WKC A;  2XGQ A;  4EEY A;  4QZ8 A;  1GO3 F;  4NLK A;  7ICI A;  1RYU A;  1YZ7 A;  1UT5 A;  5KT2 A;  1QH9 A;  2HOI A;  2R8H A;  1D9D A;  3ISD A;  5DG8 A;  3WK8 A;  1DK3 A;  4UAW A;  1J2N A;  4KLO A;  2DL0 A;  2XCP A;  7ICS A;  2KHV A;  1QQ6 A;  2Y9U A;  4CCH A;  4O3Q A;  4P4P A;  3KFU F;  3A0B U;  2W03 A;  3HP6 A;  4BJQ A;  5HMM A;  4IC9 A;  2KFZ A;  3M1Y A;  3FC4 A;  4DFJ A;  1SV0 A;  4JV2 A;  5FP0 A;  3HPO A;  4J9L A;  3IRU A;  2JV3 A;  4RQ1 A;  3UXP A;  4PZO A;  2P66 A;  3KD3 A;  5CR0 A;  1NJY A;  3SYZ A;  4YD1 A;  7ICF A;  1ED1 A;  5L1J A;  3PX0 A;  4F4X A;  1F5S A;  4UW9 A;  4C80 A;  3KHR A;  1X40 A;  5L9X A;  2LKY A;  3RAQ A;  4OJO A;  4I2B A;  2A3V A;  1L3V A;  5AM2 A;  3HW8 A;  2Y0S C;  1UQV A;  2OYY A;  4O0I A;  4JUZ A;  4ECZ A;  4PHA A;  2ATL A;  4ECS A;  4DLE A;  4Z6F A;  1BNO A;  5KAI U;  5KL1 B;  4DO9 A;  2W9C B;  1QQ5 A;  2K8C B;  4YCX A;  2W9B B;  1JUD A;  1IV8 A;  1ZRN A;  1BPX A;  1D8B A;  4MF2 A;  5KG1 A;  4RQ6 A;  5J8Y A;  4QZC A;  3SZ2 A;  1NJZ A;  4DQI A;  3KOO A;  4ICA A;  1DXS A;  3NS1 A;  2KOB A;  1RM6 C;  1QSY A;  1OXJ A;  4YMO A;  5J0U A;  2K8A A;  5AK3 A;  2ALZ A;  1ZQN A;  1U9L A;  5ALS A;  4O5E A;  1XO1 A;  5DDY A;  1V9P A;  4DSL A;  9ICA A;  1T4G A;  3F53 A;  2YB4 A;  2OXO A;  2XY5 A;  5DB7 A;  5IIO A;  3WU2 U;  5C0Y A;  5KFW A;  5DBB A;  4P2H A;  3PX4 A;  3RTV A;  2EZX A;  3ZDA A;  4KX5 A;  4DL2 A;  4NJ8 A;  4B9L A;  2B21 A;  3WKB A;  2FE9 A;  2Y9T A;  1K1S A;  4RUC A;  3NUQ A;  2XGP A;  4CDG A;  1RXV A;  1A77 A;  3RJH A;  1FO4 A;  5K4L A;  3GII A;  1S77 D;  2FI1 A;  4R63 A;  1ZQF A;  3N97 B;  7ICP A;  2P6R A;  5KL8 B;  2JZB A;  4QZI A;  4RQ3 A;  1NK0 A;  1PK3 A;  1S10 A;  1JRO A;  5IIL A;  2I6X A;  3M9M B;  3IP4 B;  2DKX A;  3IV6 A;  1NK4 A;  2IBK A;  2YN4 A;  1L7P A;  2MUT B;  5EE1 A;  5J0W A;  5J2I A;  4F5P A;  3H8W A;  4JB3 A;  2QB0 B;  4GXK A;  3NVV A;  2Y1J A;  3M9O B;  4QIW F;  4TUP A;  2AGP A;  4G3I A;  3H40 A;  2A1J A;  2DFL A;  5J0S A;  4RU9 A;  4ED2 A;  3QZ7 A;  1ZQJ A;  5ALL A;  5KFB A;  4QJF B;  2M0N A;  4PHP A;  4YD2 A;  4U7C A;  4ECY A;  3V6K A;  3THV A;  3ISC A;  1WYG A;  3RH6 A;  4CNQ A;  3GIJ A;  4J9Q A;  1QLN A;  2UVV A;  3H0M B;  2W9C A;  3RB6 A;  5J0R A;  5JU5 A;  2W9B A;  4UBB A;  3C2M A;  4WJ3 B;  1P7D A;  3E0F A;  4F93 B;  4Y2J A;  4EYI B;  2EQY A;  2AXT U;  5DG7 A;  4UB4 A;  2UVU A;  3RH5 A;  1KDH A;  2XCA A;  1QTM A;  2Y1I A;  4ECW A;  4B9V A;  5J2B A;  1KKX A;  1NNL A;  2JH1 A;  4QZF A;  3BQ7 A;  1D9F A;  1OW5 A;  4Y2P A;  2VAN A;  2LBO A;  2GLE A;  2MRL A;  3E2E A;  3CRX A;  2F8K A;  1JMS A;  2NO4 A;  5HML A;  2ZJ8 A;  2LYB A;  3RJG A;  4ECV A;  3RRG A;  3M8R A;  1ZQQ A;  5AKX A;  1ZQZ A;  3RB0 A;  3NAS A;  4G9B A;  2W9A A;  3M9N B;  4EBC A;  4TUR A;  3N7P D;  5ALF A;  4OD0 A;  2RHF A;  2LYH A;  3ZI4 A;  1KRP A;  5HNK A;  4PHD A;  3Q8Q B;  2D8C A;  4C4S A;  3RJJ A;  2F1I A;  2DWQ A;  4ELU A;  3UQ0 A;  3BJY A;  5EWF A;  4YMM A;  9ICO A;  1SXE A;  4O3N A;  5HR6 A;  2CRX A;  3R9K A;  4KLT A;  2AGQ A;  2PI5 A;  2ZTD A;  4M2Y A;  2O6K A;  4YMN A;  4F91 B;  2NRZ A;  3M7D A;  4KLG A;  4DOC A;  2MUT A;  3L3F X;  8ICX A;  4KLJ A;  3SR6 A;  4HYK A;  5DGA A;  5ALZ A;  5AI0 A;  2QB0 A;  2EH9 A;  4M9G A;  1Z00 B;  3PSF A;  1JRP A;  1XS9 D;  3K1R B;  5J2K A;  1L7M A;  4NLC A;  5F3X B;  1NOM A;  8ICM A;  1ZQB A;  8ICT A;  4RUA A;  2NYV A;  2WF9 A;  2MSN A;  4BUG A;  1KBU A;  4P0P B;  3U26 A;  4Y2S A;  1NK5 A;  5ALO A;  1F44 A;  1RQL A;  4C7Z A;  4KLL A;  2Y0S F;  1PVP A;  3TAD C;  4B6J A;  2HVI A;  1SGG A;  3F2C A;  3RJI A;  4ZH4 A;  3WKE A;  2BQR A;  4IR9 A;  3OHB A;  4FS2 A;  4GLX A;  1XNS A;  2J6T A;  4OJ5 A;  5B5E U;  1LV5 A;  2HHS A;  4FZM A;  2YMQ A;  2ZIW B;  3EW9 A;  2ESE A;  2W7O A;  5D49 A;  4FO6 A;  4C8K A;  5J0P A;  1ZQX A;  2F3N A;  4RQ8 A;  4RNM A;  3SEI A;  5KFG A;  2RDI A;  2FPM A;  3MGI A;  2BCQ A;  3N4M B;  5KFS A;  1KW4 A;  2YMM A;  4MEY A;  1U4B A;  3FYH A;  1T3N A;  2H3Z A;  3PW2 A;  5J2G A;  4OJP A;  2FLN A;  3IM1 A;  4O5K A;  3RH4 A;  2DUY A;  4DS4 A;  3RRH A;  4DEZ A;  3MDC A;  5DQI A;  2FPK A;  2ISP A;  2FMS A;  3UXN A;  5ALT A;  3GIM A;  1X66 A;  3ZDE A;  4Y2R A;  1TAQ A;  3WK7 A;  5AK4 A;  5KFR A;  4M04 A;  1MA7 A;  1CUK A;  2BPG A;  5AM1 A;  4ED0 A;  5HHI A;  2Z7J A;  5AKZ A;  5III A;  4QNL A;  7ICR A;  1KN5 A;  1KQQ A;  4O9M A;  1TK8 A;  3RAX A;  4UB5 A;  4IQT A;  4P0Q B;  2H3I A;  4DL3 A;  3KHG A;  2YX8 A;  2BR0 A;  4UBC A;  3TAN A;  2G5H B;  5KFI A;  4JK1 A;  1N62 A;  2PXI A;  1Z00 A;  2I5H A;  5ALQ A;  3EPI A;  4PGQ A;  3F2B A;  4B9M A;  9ICS A;  5CB1 A;  1J97 A;  4C8L A;  9ICX A;  2LMR A;  2R8G A;  1T8E A;  5KAF U;  3PW5 A;  5AKI A;  5AKL A;  3E58 A;  4P0P A;  2LM4 A;  1YZ6 A;  8ICV A;  3UXO A;  2PKE A;  1DGS A;  1ZQS A;  5ALR A;  4CF4 A;  4XA5 A;  4EEN A;  2BCR A;  2MAX A;  3C23 A;  1XWL A;  1NKB A;  2GWS A;  4UB6 U;  1XU4 A;  8ICA A;  3I1Y A;  4DOA A;  2R8I A;  2FLL A;  5ALN A;  1KSP A;  2ZIW A;  4JWN A;  2AHO B;  3PW4 A;  3H8J A;  1NI3 A;  3PY8 A;  1L8L A;  1L8O A;  4YR0 A;  4RT3 A;  2K4H A;  1ZJM A;  3EYZ A;  2LHT A;  2EAP A;  2IMW P;  2K8B B;  4QZA A;  3KTQ A;  3OPX A;  3PW7 A;  4USA A;  1UCV A;  4O3R A;  2JMG A;  3SV4 A;  1ZRM A;  5EWE A;  4M9J A;  1IIP A;  1XO0 A;  4P4M A;  2F1J A;  2CPR A;  2YB1 A;  7ICG A;  2FJ6 A;  2ZIV A;  3QU5 A;  3C1Z A;  4YFK A;  4RQ7 A;  3DDH A;  2BDP A;  4CRX A;  1X9M A;  3TFR A;  7ICK A;  4US9 A;  8ICB A;  5G5H A;  5DBA A;  5EE9 A;  1ZQE A;  4QZE A;  3RFA A;  4NY8 A;  3N7S C;  9ICR A;  4PJ0 U;  3WK4 A;  5KG2 A;  2RQ5 A;  4ED6 A;  2DPI A;  2W3S A;  2F8L A;  3V7L A;  5CP2 A;  3AU6 A;  8ICS A;  2FDR A;  3OJU A;  3LVW A;  4QW8 A;  1BNP A;  5J0Q A;  4YVZ A;  1X9W A;  5HP4 A;  3V6H A;  4EBD A;  3WK9 A;  2IOF K;  3L5K A;  1JN3 A;  2JZB B;  4RPY A;  3CNH A;  4P0Q A;  5EWG A;  4Z6E A;  3AM9 A;  3LYS A;  4NXZ A;  5J8Y C;  4GFJ A;  1MQ2 A;  3V72 A;  2RP5 A;  1ZQO A;  1HIW A;  1X6J A;  5CA7 A;  4TQS A;  4DSK A;  2F76 X;  5DB6 A;  3TKA A;  2XIC A;  5F9L A;  2XY6 A;  1N56 A;  4XQ8 A;  5DB9 A;  2JEI A;  2KIV A;  4I2G A;  3WK6 A;  2F77 X;  2A1J B;  1RDF A;  4C4R A;  5AKJ A;  3RB4 A;  1ZQR A;  3B0Y A;  2KZ3 A;  3HRD D;  1SV4 A;  3GZF A;  2PFQ A;  3WKD A;  4ELT A;  9ICV A;  4DLG A;  2AJQ A;  5CWR A;  4I2E A;  2KN7 A;  3HJE A;  1KFD A;  2KNJ A;  8ICN A;  4IQW A;  2XI9 A;  3LVV A;  1JIH A;  5KT6 A;  4AP9 A;  2IOF A;  1Q3U A;  3F5A A;  2HHU A;  5DGB A;  3TQ1 A;  4J03 A;  5JUM A;  4PL2 A;  4JV0 A;  1SXD A;  5T14 A;  5DG9 A;  5KFN A;  3Q8P B;  4RPX A;  4KMU A;  2RLT A;  5CEH A;  5DDM A;  4FS1 A;  3D2S A;  3ETR A;  4K4G A;  4MF8 A;  3VC8 A;  2W7P A;  9ICM A;  2ASJ A;  1S8O A;  8ICJ A;  4NL9 A;  3EZ5 A;  1TAU A;  5KFH A;  4GXJ A;  5DB8 A;  3HX0 A;  3GQC A;  2IA6 A;  4DF8 A;  5ALE A;  3MGH A;  2NV3 A;  8ICH A;  2QLT A;  4I2A A;  5KT5 A;  4YR3 A;  1ZQC A;  1VDV A;  4I29 A;  2BPF A;  3RR8 A;  1ZD4 A;  1WUD A;  5L1K A;  2PMZ C;  5F9N A;  3RJF A;  5AIC A;  4M9H A;  4MFF A;  3PO5 A;  2W8L A;  4DWI A;  4BWM A;  4UB2 A;  3Q8S B;  2VA2 A;  2LM1 A;  2E8P A;  4X5V A;  3DV9 A;  1WCL A;  5KFC A;  4MFA A;  4EBE A;  1ZQP A;  5KTQ A;  1KTQ A;  3WKA A;  3JPS A;  1LVH A;  1JAL A;  1NZB A;  2F1H A;  1TK5 A;  1NJW A;  3H0L B;  5J2C A;  4RZR A;  9ICF A;  2DKZ A;  5KG4 A;  4Q8F A;  8ICZ A;  4R64 A;  3UM9 A;  4Z6D A;  1WCN A;  3QU2 A;  1LB2 B;  8ICI A;  8ICE A;  9ICK A;  3M6K A;  3V7J A;  2IHN A;  2F2A B;  1RXW A;  4J9K A;  1HEK A;  3SMV A;  2NRW A;  1L3T A;  3L4P A;  1SL1 A;  3FM9 A;  3F2D A;  2VIX A;  1PVQ A;  4KLH A;  4UAS A;  5A0L A;  5AM4 A;  4DFM A;  1RPL A;  4M47 A;  1N2X A;  1WWV A;  2KJ8 A;  1CEZ A;  5KFL A;  3ISB A;  4IR1 A;  1BPB A;  3PX6 A;  5G5G A;  1U47 A;  3M8S A;  1CI4 A;  1SKS A;  5KFP A;  3Q8L A;  2QAR A;  1RQN A;  5L1L A;  4O3S A;  4IQV A;  2FMQ A;  2ZUD A;  2PFP A;  1F0M A;  2E8N A;  5J2J A;  3PR5 B;  1QCK A;  1ZYQ A;  9ICU A;  1U48 A;  4I2H A;  2ZIX B;  4Y2V A;  4GC6 A;  3QZ8 A;  3SQI A;  2KMD A;  4AYB C;  2OH2 A;  5AKH A;  2E8O A;  2LI6 A;  5L1I A;  2P35 A;  2H5X A;  2B6G A;  4P4O A;  4NM2 A;  3HKZ C;  5D4B A;  4ECT A;  1IM4 A;  4J9N A;  3QYP A;  4QWC A;  1DK2 A;  3QUC A;  1SKW A;  5TZV A;  4DSF A;  3SI8 A;  1T7P A;  3NVZ A;  3OTQ A;  3SAF A;  3JPN A;  3S6J A;  1S0M A;  3PW0 A;  1Z3E B;  4DQR A;  7ICH A;  4RPZ A;  2GOL A;  1MQ3 A;  2HOQ A;  3PMN A;  4NWI A;  5KFF A;  3GIL A;  3VCB A;  2K4E A;  4UQG A;  1C7Y A;  1S0O A;  2BHN A;  1LKY B;  3QNM A;  4IS7 A;  5KFJ A;  3RJK A;  2ZUC A;  4XUS A;  2ZJ5 A;  2KZZ A;  1VJ5 A;  1SIJ A;  2JXJ A;  2KJ9 A;  2FLP A;  7ICV A;  2RDJ A;  1JX4 A;  2EDU A;  1X9X A;  1N48 A;  1KFS A;  2DQN B;  4YR2 A;  1WWU A;  3ICX A;  2JRZ A;  1BGX T;  3MAB A;  2ASD A;  1HUZ A;  4NLN A;  8ICC A;  4QW9 A;  2G0A A;  4Y2T A;  3ZDC A;  3H8M A;  1KFT A;  2KVC A;  4UB3 A;  4K4I A;  2YQE A;  2BPC A;  4ECU A;  3GV5 B;  1D8Y A;  3BQ1 A;  2H3Q A;  3BS5 B;  3JPQ A;  2UVW A;  2YTU A;  2PI4 A;  1RZT A;  3KHL A;  3HIL A;  4F3O A;  2A19 A;  2XC9 A;  2A1A A;  3AN1 A;  7ICU A;  2XO7 A;  3RBE A;  2LYA A;  1J2M A;  3NGD A;  1Z1V A;  4RNN A;  1Q46 A;  2YY6 A;  1ZD2 P;  2ZIX A;  3IHQ B;  4GXI A;  3OJS A;  2W54 A;  1X2I A;  9ICL A;  4OCZ A;  1ZOL A;  4KLS A;  2ZIV B;  5AHX A;  3T5J A;  3JPP A;  5GTI U;  3N7R C;  4CE6 A;  1PK1 B;  1A0P A;  1SKR A;  2I1Q A;  3RR7 A;  3MR2 A;  3OGU A;  1BPD A;  4I2J A;  4DQS A;  1PUZ A;  3PZP A;  2EAM A;  2R18 A;  5KFU A;  4NM1 A;  2OHF A;  2WF6 A;  8ICU A;  5AIB A;  3SAG A;  5KFX A;  4FBU A;  3C2K A;  1KEJ A;  2PMZ F;  9ICP A;  8ICK A;  4EZ9 A;  3NRZ A;  3ED5 A;  4U6P A;  2W3R A;  2ZXH A;  4KIT B;  1ZQD A;  5KT7 A;  1ZQ1 C;  1EXN A;  2R8J A;  4RQM A;  1LKY A;  4YXJ A;  1XSN A;  2UVR A;  3AMZ A;  4QWE A;  5GTH U;  1V85 A;  5AKK A;  3PVX A;  2KIC A;  1ZQI A;  5AM3 A;  5AI9 A;  2KEY A;  1CRX A;  4BGD A;  1ZD5 A;  1VLB A;  2BDU A;  1YT3 A;  4DSE A;  2DPJ A;  2WF8 A;  5KG5 A;  2G08 A;  4F50 A;  4NLB A;  2AQ0 A;  1X9S A;  5BOL A;  2VKQ A;  3V6J A;  4RQ5 A;  5DQG A;  3AUO A;  2F44 A;  5EOZ A;  1S5L U;  3F5E A;  7ICE A;  4QIW C;  3RB3 A;  4PGY A;  4UAY A;  4ECQ A;  4Q45 A;  3ALR A;  2ASL A;  5KFO A;  3KKA A;  3O0F A;  2HSZ A;  4M0A A;  4ED8 A;  4B9T A;  4IQU A;  2KD1 A;  5ALV A;  3BS5 A;  1TK0 A;  3C29 A;  2HI0 A;  4RNO A;  2HBL A;  2V4R A;  2JGA A;  1TAM A;  2KZM A;  7ICL A;  1S0N A;  1ZQT A;  4I2D A;  5JRT A;  4ED7 A;  2GO7 A;  2GH1 A;  2DF4 B;  3JPT A;  4QZ9 A;  4YG2 A;  4ACO A;  1NKE A;  4R65 A;  3T5H A;  2C2R A;  3H4B A;  4M9N A;  1SV0 C;  2ISO A;  7ICJ A;  1UPH A;  5DBC A;  4NLG A;  4KLQ A;  4F4Z A;  3MR5 A;  5BOM A;  4DFK A;  4C4T A;  9ICG A;  2BCS A;  3K1Z A;  1PK1 A;  3M6Z A;  4C7Y A;  1XC9 A;  3T5K A;  4BWJ A;  4OJL A;  3TI0 A;  1L7N A;  3PSI A;  3PV8 A;  2K4I A;  4AYB F;  1T94 A;  5J29 A;  4JWM A;  2JEJ A;  1SWW A;  1ZJN A;  4C8O A;  4O3M A;  2C28 A;  3WK5 A;  3HKZ F;  4JMU A;  2WAQ C;  4DOB A;  1N60 A;  9ICH A;  2HHX A;  4F72 A;  3A0H U;  2JH7 A;  3TAC B;  2WB1 C;  4KLE A;  2YMP A;  2BQU A;  2FPL A;  1L6N A;  3H4D A;  1Z4O A;  5AKY A;  3LWM A;  3FDS A;  4QZG A;  3MC1 A;  3PR4 A;  1UA1 A;  5ALW A;  2NRV A;  2E1F A;  5DLF A;  2K4P A;  2BCV A;  4F5O A;  4KLM A;  4ED3 A;  5KG0 A;  3GV7 B;  2OM6 A;  1B43 A;  1ZQM A;  2HDO A;  2BZF A;  5ALD A;  1RYS A;  1BPE A;  1M6Y A;  3PML A;  4KN4 A;  2RRD A;  3SD7 A;  3B0X A;  2E8M A;  5AM0 A;  5AM5 A;  4I28 A;  5E79 U;  1QSL A;  2CXY A;  1Z19 A;  2M9N A;  3QUB A;  2JHD A;  5L1M A;  2KHQ A;  3KZX A;  1Y88 A; 
#chains in the Genus database with same CATH homology
 3N7R C;  4NLC A;  3E0F A;  2GOL A;  2Z7J A;  1Q3U A;  1A0P A;  4CRX A;  4PL1 A;  2E1E A;  2HOQ A;  2KHV A;  2GH1 A;  2DF4 B;  2W04 A;  4NWI A;  2ZG6 A;  3CYM A;  4QNL A;  3D2Q A;  5C0Y A;  3F5A A;  3VCB A;  2KJ5 A;  2HBJ A;  2K4E A;  4NV0 A;  4ACO A;  3KFU F;  3IG5 A;  3AL0 B;  4KX3 A;  4BUG A;  3PZP A;  2W03 A;  1KBU A;  3M6K A;  2R18 A;  4PL2 A;  2KIW A;  3H0R B;  2F2A B;  4BJQ A;  4IC9 A;  2G06 A;  1DRG A;  4P0P B;  5T14 A;  4P0Q B;  1HEK A;  2H3I A;  4KMO B;  3ONN A;  2JH1 A;  3RF9 A;  3RFA A;  1UPH A;  3N7S C;  2YX8 A;  2WAQ F;  4KX5 A;  1F44 A;  3SMV A;  3SAG A;  3SAH A;  3F2D A;  2G5H B;  2VIX A;  2N1R A;  2Y0S F;  1PVQ A;  5HR7 A;  2LBO A;  5A0L A;  1PVP A;  2HMX A;  3D2S A;  2PMZ F;  2WB1 F;  2F8L A;  2MRL A;  2Q4T A;  2XID A;  2XVT A;  3NUQ A;  3K1Z A;  2KJ9 A;  3F2B A;  2G07 A;  4CDG A;  2D6F C;  3VC8 A;  4FZN A;  3CRX A;  3LVW A;  2W7P A;  3F2C A;  2CN1 A;  2VJ4 A;  3M6Z A;  3NRW A;  4U6P A;  2KJ8 A;  4OJL A;  3PSI A;  2ZXH A;  2K4I A;  1ECW A;  1ED1 A;  2DGZ A;  4FE3 A;  4AYB F;  1ZQ1 C;  1T94 A;  2LYB A;  2DQN B;  1XNS A;  3ICX A;  4OJ5 A;  4P0P A;  5KL8 B;  3PST A;  4FZM A;  4P0Q A;  2ZIW B;  3PSP A;  4O3M A;  3GU3 A;  3C28 A;  2W7O A;  5CRX A;  3LYS A;  3HKZ F;  4JMU A;  2LKY A;  2NV3 A;  2HOF A;  2WAQ C;  3N7P D;  4OJO A;  2G0A A;  2A3V A;  2RHF A;  4GFJ A;  3T79 A;  2KIC A;  2RP5 A;  3IG8 A;  4CGZ A;  4BX9 C;  2Y0S C;  2KEY A;  1HIW A;  2KVC A;  3IP4 B;  2HBK A;  2KKP A;  1WUD A;  1CRX A;  2OYY A;  2JH7 A;  2BDU A;  2KV2 A;  1YT3 A;  2PMZ C;  2WB1 C;  3IN5 A;  3D2N A;  4C0Z A;  2H3F A;  2ZIX B;  2H3Q A;  1L6N A;  2F76 X;  3DEE A;  2HBM A;  2XIC A;  3SQI A;  2G08 A;  4NLB A;  4AYB C;  2OH2 A;  1SZH A;  5KL1 B;  4OO1 J;  2ZIU B;  2K8C B;  4A8E A;  4FZL A;  2E1F A;  2ZIW A;  2VKQ A;  5HR6 A;  2G5I B;  2H3Z A;  1OUQ A;  1P7D A;  4QIW F;  2LYA A;  1D8B A;  4OJ6 A;  2CRX A;  3F5E A;  2VJ5 A;  2F77 X;  3HKZ C;  4QIW C;  2OM6 A;  4OJP A;  1URJ A;  3AQF A;  3ALR A;  4ICA A;  2K4H A;  2KOB A;  2E5S A;  3O0F A;  1A6S A;  3M7D A;  2LHT A;  2K8B B;  3AQE A;  3CP8 A;  2K8A A;  2H3V A;  4QJF B;  2M0N A;  3OPX A;  2RRD A;  2JMG A;  2KD1 A;  3GZF A;  2ZIX A;  3L3F X;  1Z1B A;  4U7C A;  3C29 A;  1NZB A;  2KKV A;  1Q3V A;  1IIP A;  3MGV A;  1PVR A;  1GO3 F;  2HBL A;  3H0M B;  1Z19 A;  1XO0 A;  2JGA A;  2K89 A;  2MA1 A;  2ZIU A;  1TAM A;  2CPR A;  2JHD A;  3H0L B;  2KNJ A;  2HOI A;  2YB1 A;  3PSF A;  2KHQ A;  3KZX A;  2G09 A;  2ZIV B;  3SAF A;  2XI9 A;  2ZIV A;  2ZXI A;  3F53 A;  1MA7 A;  3LVV A;  2YB4 A;  4WJ3 B;  2OXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...