4QIWC

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
380
structure length
369
Chain Sequence
IKSMVSKAELPDNIKEELYAKLIEYNEKYKLKKDEIQAIIDETVREYQKALIEPGEAVGTVAAQSIGEPSTQMTINVTLGLPRIIEIVDARKNPSTPIMTVYLDEEHRYDRDKALEVARRIEGTTLENLAREETIDILNMEYVVEIDPERLEKAGLDMEKVVRKLTGSFKSAEFEAEGYTLVVRPKKVTKLSDLRKIAEKVKKHRLKGLSGVGKTIIRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIWEIAEVLGIEAARNAIIDEIVSTMREQGLEVDVRHIMLVADMMTLDGVIRPIGRHGIVGEKASVLARAAFEITTQHLFAAAERGEVDPLNGVVENVLIGQPVPVGTGIVKLAMSLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 61
structure length 369
sequence length 380
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwC02
4AYBC 3HKZC 2PMZC 2WB1C 4QIWC 2WAQC 2Y0SC
chains in the Genus database with same CATH superfamily
2K4PA 1LB2B 3V6JA 8ICTA 2DWQA 4AYBF 2P6UA 1ZJMA 2WF7A 4O3QA 2F1IA 3C5GA 2WFAA 5KAFU 4IR1A 1S97A 2RDIA 2C28A 5AK6A 4OD0A 4I2FA 4OJPA 4C4TA 1KRPA 5AI8A 2NRZA 3F53A 7ICHA 5AKYA 5DDMA 4JV2A 4Y2UA 1Z4OA 4F91B 1KW4A 3AU6A 1KTQA 4MHVA 2LBOA 4YD2A 3M1YA 8ICAA 9ICXA 5JRTA 5AKZA 2V4QA 2Y1IA 1PVPA 4OJ5A 3WK8A 5J8YA 2W04A 4Z6CA 1UA0A 1WWUA 3ZDCA 4RQ1A 3H8MA 5EWFA 5ALKA 1L8OA 5ALNA 1K5OA 1X42A 3EZ5A 4JWMA 2QKQA 4DSJA 4F4ZA 2B21A 2KHVA 3D6JA 3SD7A 4PZNA 2W55A 4DCCA 2UVWA 2EDUA 2ODGA 5ALDA 2HHXA 2V9WA 2EZYA 1NK5A 4C8KA 4US9A 2DBYA 4BWJA 2EAMA 1XSLA 3Q8QB 2C2EA 2DFLA 4FZNA 4J9NA 4JMUA 4IS7A 1XS9D 4Y2VA 2OYYA 3KTQA 3JPQA 7ICEA 2F1JA 3PW4A 2ES6A 1NOMA 3QU5A 3LVWA 1V9PA 4P0PA 1Z4NA 5AK3A 5A0LA 3PV8A 4NL9C 4YR0A 3BQ2A 4B9UA 1VLBA 4O3PA 2NYVA 3KHHA 3ZDBA 4C0ZA 4QWCA 4I2AA 5J2DA 5AI0A 9ICNA 4DL6A 4ECWA 3FDSA 3UMCA 4I2CA 4DSFA 2KOBA 3HT3A 4F4XA 2G5HB 1J2MA 5JU5A 3T79A 2KEYA 5ALTA 4Z6DA 4DFMA 5FP0A 2BHNA 3ZI4A 3M9OB 4EZ9A 2Y0SC 3K4GA 4EELA 2NV3A 4PGYA 2HHVA 4EBEA 2YMLA 3H8SA 5KG7A 4RNMA 1T8EA 1LV5A 3L4PA 1SKSA 1DRGA 2E3TA 5AM3A 4ECXA 5KG1A 9ICCA 2RRDA 2EQYA 4QZEA 1NKBA 2KTQA 3RJGA 1D8BA 2L5YA 5KT7A 2ZJ8A 3C5FA 1MA7A 4BXOB 2KKPA 1HEKA 4J9OA 4A8EA 3OHBA 4O9MA 1ED1A 4NV0A 3IG5A 4F4KA 4O3MA 2ZIWB 4PPXA 3K1RB 5DB6A 3JPTA 2XICA 2HHTA 4Y2RA 2I6XA 3BQ1A 2J6SA 9ICPA 9ICEA 4RT2A 3TFRA 1ZQYA 2OH2A 4RQ2A 4OJ6A 4C8NA 4MFFA 4IL6U 5ALWA 5KFEA 1ZD5A 3C1YA 2KSOB 2M9NA 4QZIA 2F8LA 1ZQSA 4UAYA 4M9LA 4QIWC 4BXOA 8ICOA 4KLHA 1A0PA 1JIHA 1JXEA 2W9AA 1JMSA 2KJ8A 8ICHA 1MSWD 7ICIA 4LVSA 4I27A 4MFAA 2HI0A 1RYUA 1TVAA 5CRXA 2JXJA 3WKEA 1DGJA 1TV9A 3RR7A 4R63A 3EW9A 1NZBA 2JRZA 1ZQWA 9ICKA 4NJ8A 3NRWA 5KFXA 3H0RB 4I2DA 5AHXA 4XA5A 1COKA 4UB3A 2UVVA 5KT3A 4P0QA 2G0AA 3UXNA 5HP4A 2FPMA 4F5PA 1UHUA 1NJZA 2ZIWA 1UT5A 1ZQCA 3AMZA 2Q4TA 4CRXA 2C2DA 4Y2XA 2ZTCA 2AQ4A 4M04A 4DS5A 3OSPA 2OEHA 5KFMA 8ICJA 7ICRA 3GDXA 1TK0A 3MFHA 4DQSA 3F2DA 4YN4A 8ICEA 3TKAA 2HVHA 9ICJA 1IIPA 2OCEA 4FZMA 1ZQAA 3VCBA 5KFQA 1BPYA 4IQVA 4DQQA 1IV8A 1KSPA 2VJ4A 3D2QA 1N5XA 7ICLA 9ICHA 4DSLA 5TZVA 2WB1C 3MC1A 3J81j 3RH5A 3N4MB 1KBUA 2FPKA 5KNIA 3MGVA 2PMZC 3LDAA 3TACB 1ZETA 2XCAA 3HP6A 4ECYA 5KL1B 3M6KA 5IIOA 2HBMA 3C2KA 1N61A 3N7PD 1KFSA 5KFRA 2IOFK 4NLBA 2V4RA 5C5JA 3T5LA 3IDWA 4F71A 2AU0A 3K75D 4DSKA 1UCVA 1U47A 1GO3F 2ISOA 2KJ5A 3QEBZ 2QARB 1DOQA 2LHTA 3EWAA 3FC4A 5B66U 1X9SA 4Y2SA 5AKJA 3B0YA 1MQ3A 4OO1J 4ED0A 1ZQBA 2KFNA 1AROP 2KD1A 4RUAA 5KG3A 2MUTA 1ECWA 2ALZA 4MEXA 1QQ5A 2MUTB 4EBDA 3V6KA 1RG6A 1C7YA 4UAUA 2BCRA 2IHMA 3CRXA 4PL2A 3ETLA 1SV4A 4ECZA 1QTMA 4O3RA 9ICUA 4IR9A 1NI3A 4DQPA 3TARA 1X6IA 4M9JA 1D9FA 1NZPA 2G5IB 2R8HA 9ICOA 5KFPA 1LVHA 4NM2A 5J0YA 1ZQXA 4O5EA 1B43A 2KIWA 5G5GA 1RZTA 1U49A 3IP4B 3F2BA 2OM6A 2F8KA 3C28A 5B5EU 3I1YA 2NRTA 1Q3UA 2ZIVB 2E8NA 2KHQA 2MAXA 1ZQPA 2ZXHA 4RQ7A 7ICUA 4FFDA 2BGWA 4M9GA 3KHLA 4UASA 1N63A 2HHQA 1MC8A 3F2CA 1ZQKA 3GV5B 3KKAC 2I1QA 4HYKA 1RYRA 3NRZA 4YMNA 1TK8A 4UAZA 3OTQA 2PI4A 3MFIA 2E1EA 3CYMA 4P0PB 4RUCA 3MR2A 3WKBA 2ATLA 4B6JA 5J0PA 4TQRA 5KFKA 1S0MA 1SKWA 9ICAA 3Q8PB 5AM1A 4R64A 3RAXA 2K4IA 2ZJAA 4UATA 3IV6A 3ALRA 4WJ3B 1QSLA 4MF2A 4ELUA 3RBDA 8ICFA 4KMUA 1JI7A 1SKRA 4J03A 2IA6A 2IOHA 2CN1A 1RYSA 1ZRNA 4DF8A 4TURA 2M0NA 2A1JB 3BQTA 3QNMA 2ZUCA 4NXZA 3SEIA 4DS4A 1TKDA 3QE9Y 2Y9TA 3PO4A 2FMSA 1L6NA 5CA7A 5KG6A 4RPXA 4IC9A 3BDPA 1WCNA 3BS5B 5F3XB 1T3NA 3FM9A 5ALLA 1SWVA 1ZJNA 4J9MA 3DDHA 5BOMA 3RH6A 4CDGA 1UPHA 3E0FA 1ZQRA 2F44A 9ICVA 1PK3A 2XIDA 3BZKA 4DL4A 5KL8B 3T5JA 3KOOA 1N48A 4B9SA 3MGIA 3NVYA 5EOZA 5HMMA 4ECTA 3RF9A 5TISU 1O08A 4UARA 5L1KA 4QZ9A 3PSFA 5AICA 4IRDA 1ZQTA 2Y1JA 4J9PA 3T3FA 2PFQA 1J2NA 4HAIA 2GLEA 2A1JA 5J2JA 2YQEA 4JWNA 1ZOLA 1TAUA 5CWRA 4KLFA 3WK7A 2LM4A 4KLLA 2ZXIA 4ELTA 1NKEA 4KX5A 1ZRMA 2ASLA 2BDPA 5KT5A 3KFUF 2YB4A 1RQLA 8ICCA 4Q43A 8ICGA 4DLEA 3H8WA 5G5HA 1JROA 2QB0A 3UXPA 2IHNA 4F4WA 2W7OA 2HBLA 1T4GA 3JPPA 2F2AB 2WF8A 4UW9A 4KLIA 2QLTA 1WCLA 2XGQA 4FO6A 5HMLA 2K89A 2BQ3A 4UB1A 4XRHA 2BQRA 4PZOA 9ICRA 5KFZA 5KTQA 2GO7A 4RQ5A 4KLQA 3GILA 1ZYQA 1NNLA 4QZGA 2BR0A 1ZQUA 8ICUA 5JTIA 3RJHA 4F5RA 4FS2A 1ZQMA 2BKEA 1ZD4A 3QYPA 4F92B 3NS1A 5BOLA 2HOIA 4QIWF 8ICZA 2DKXA 2F3NA 3MGHA 1LKYA 2ISPA 5K4LA 5L1IA 4M9NA 4IRCA 2E8MA 3HWTA 4I2GA 4ED8A 2JR5A 3SAHA 4EYHB 4KLDA 1QH9A 2KSOA 5ALGA 1BPDA 1ZQ1C 2JH7A 3GZFA 1S0OA 3HKZC 4C4RA 2KN7A 3PVXA 1BNPA 1YZ6A 2RHFA 2H3IA 4G9BA 3DEEA 5DBAA 4TQSA 4GIBA 2BCSA 5AI4A 5L1MA 2K8BB 2W8LA 5F9LA 2ZG6A 4MF8A 1A76A 5DDYA 4DEZA 3AQEA 5DKWA 1N60A 1L7PA 5KT6A 1X2IA 1L3UA 2R8IA 5EE1A 3WKCA 4PHEA 1DGSA 2YMPA 2ZTDA 3RTVA 9ICWA 1JN3A 5L1LA 2ZUDA 5AM0A 1XC9A 8ICQA 2LYHA 1U9LA 4ED7A 2FI1A 5F9NA 4P4PA 2W9CA 2E5SA 3D2NA 3QXGA 1ZQZA 2RDJA 1L3VA 2EANA 5DB9A 3PSTA 5KFLA 5KFBA 4PHDA 3RJKA 2B0CA 2VIXA 4RT3A 2NRWA 2XY5A 1JALA 2Y9UA 4JUZA 3E2EA 3N28A 2XGPA 1J97A 4LZDA 1SZPA 1L7NA 5L9XA 4OJLA 2HOQA 4FZLA 4RNNA 5EE0A 3M9NB 1ZQHA 2KFZA 2D3DA 3H4DA 2FMPA 2JHDA 4YR3A 3ZDDA 9ICLA 2W9MA 5DLFA 5CJ7A 5KFGA 1SIJA 2KV2A 4KLMA 4E0DA 3IN5A 3UM9A 3ZD9A 4FS1A 8ICXA 4M6WA 2KMDA 1HJPA 1NK6A 4ED6A 2HW3A 1QSYA 1DK3A 1KFDA 3N7RC 1TAMA 4RU9A 1T7PA 2HSZA 3RJJA 1FFVA 3OHAA 2KIVA 1FO4A 4I2JA 3MBYA 1QQ6A 3KKAA 1SZHA 4X5VA 4C4SA 1U48A 1BVSA 5KFAA 3IRUA 1CRXA 4P4OA 2JEIA 2LPEA 4FBUA 2W3SA 3NTUA 4O5KA 4CNQA 1OUQA 5J0RA 3H40A 1PZNA 4DFKA 3PX6A 4AP9A 4B9TA 2W3RA 1Z1BA 3HILA 1U45A 4TUSA 3KD3A 4C8OA 7ICOA 3NVWA 4BUGA 2ZIXB 2WTFA 2JZBB 2O6KA 4B9MA 1OW5A 4QZBA 4GC6A 2GWSA 4NLNA 3LK9A 8ICSA 9ICIA 1KKXA 4YMOA 2OXOA 4U6PA 5ALZA 5KFCA 1RPLA 1SWWA 4CF5A 1S76D 5HHIA 2NO5A 4F5NA 4C80A 3GIKA 4CE6A 3I28A 5HNKA 5T14A 2WF5A 1BPZA 4PGXA 3PZPA 1TE2A 2DQNB 4BWMA 2J6UA 1TFRA 2WF6A 3BS7A 1Q3VA 2HHSA 1WG8A 3A0HU 2QB1A 5J2EA 2WB1F 4DOAA 2BDUA 1K1QA 2KP7A 2DPIA 5J8YC 7ICTA 2N1RA 3U26A 3UXOA 5ALEA 4IQWA 4RZRA 1Z3EB 5AKLA 4IQUA 3RB0A 2YMQA 4C8MA 4U7CA 4QWEA 2J6TA 3WK5A 3BS5A 3JPOA 3N7SC 4YMMA 4ACOA 5DGAA 1K1SA 1QCKA 3PY8A 3QUTA 3NGDA 2AJQA 3WKAA 3NASA 3PSPA 4CF4A 2IMWP 1BNOA 4EEYA 2HHWA 4KN4A 3OSNA 3V6HA 3C23A 3SQIA 1KEJA 4GFJA 3AEVA 3C2MA 1X6JA 5DG7A 5ALRA 2XVTA 4F2RA 2BCVA 7ICKA 1O03A 1T94A 5AIBA 3H0MB 1RXWA 4DWIA 5J2FA 4QNLA 4M47A 4I2EA 4PHPA 4LZGA 1XU4A 2B6GA 1NK9A 2JEJA 4YVZA 4QWDA 3MDAA 4DL7A 1FEZA 5AKIA 5KG2A 2NRXA 3C21A 4Y2TA 1PUZA 5CR0A 2QB0B 1ZQFA 3IHQB 2P6RA 4ECUA 5ALSA 2FE9A 2VJ5A 2YN4A 5J0SA 5BPCA 2VA3A 8ICWA 1NK7A 4IRKA 3C2LA 2JMGA 4RQNA 1XSPA 1C20A 7ICGA 2R18A 3KHRA 2HOFA 5J2HA 4F5OA 2XY7A 4J9KA 2DKZA 3PMNA 2DL0A 2RLTA 4PJ0U 4CGZA 1ZQNA 2XC9A 2KE7A 1L7MA 5JUMA 5AK5A 2ASJA 5CB1A 1NK4A 1QQ7A 5DG9A 2FMQA 2G06A 4YCXA 2KNJA 1U4BA 5E79U 4I2HA 3QUQA 3V7LA 3GV8B 1L3TA 5HR6A 2R8GA 1S0NA 4RQ4A 3KHGA 1JXLA 2W54A 5ALUA 5DLGA 2RQ5A 3E58A 5KFFA 2HDOA 2KKVA 4KX3A 4CF3A 3UPQA 4M0AA 4UB4A 3UMGA 4FBTA 5J0QA 5AKKA 2YX8A 3RRHA 5KFJA 2Y0SF 4PH5A 2HMXA 9ICQA 4Y2JA 1X9MA 4F3OA 4QZAA 5KG4A 3PO5A 3ICXA 2H3VA 5J0XA 1F44A 3RJFA 5H2FU 1OXJA 4KLGA 1PK1A 1SGGA 1VJ5A 5GTHU 3ETRA 3VC8A 2WF9A 1NK0A 4J9QA 5KAIU 3PSIA 5EE9A 2P35A 2AHOB 1V97A 4CCHA 1CUKA 1XO1A 7ICNA 3CW2C 4KMOB 2W7PA 4KLUA 3BJYA 4Q8EA 5ALMA 9ICFA 2ZIUB 5DB8A 3Q8KA 1COOA 4DL2A 2E1FA 2K4HA 3TQ1A 5IIJA 2KVSA 8ICPA 2ZIXA 3UQ2A 5J2GA 3WK6A 4AYBC 3MDCA 4DOCA 5IIKA 5ALJA 3QU9A 2ZIVA 1ZQDA 2ZTEA 5EWGA 2D8CA 3QU7A 5J0OA 3SZ2A 4DOBA 2AGPA 4M6WB 2JH1A 2HHUA 4F8RA 4UB8U 1ZQEA 4DF4A 1SL1A 3IM1A 4GC7A 5KFOA 2F1HA 1DK2A 2PFNA 5DBBA 4PHAA 3MR3A 3WU2U 3QU4A 3WK4A 1ZD2P 2Z7JA 4YD1A 4TUQA 3EPIA 4F4YA 2DGZA 5CP2A 1L3SA 3GIJA 2G09A 3B9JA 4K4IA 1X9XA 1ZQQA 4R8UA 5KT4A 1NKCA 3M6ZA 3LWMA 4YP3A 2D6FC 3GQCA 2DF4B 2LMRA 5J0WA 1XO0A 4C7ZA 1PVRA 4DL5A 3RBEA 2LKYA 4J9RA 4DL3A 5KFHA 3AUOA 2W9CB 8ICIA 3H8JA 2WHEA 2MRLA 5HHHA 4EYIB 5DQGA 2C2RA 4PGQA 1P7DA 3OGUA 3BQ7A 2KZMA 4QZDA 2LYBA 2H3ZA 5J2CA 5KG0A 1FFUA 3IG8A 4NLGA 4QWAA 3T5KA 2KZZA 5AKEA 1QSSA 5ALFA 2KK0A 3PNCA 4B9NA 2ESEA 3NVZA 2ZIUA 3EYZA 4BJQA 1XNSA 2BPCA 3CNHA 3WKDA 3ISDA 2HBJA 2VKQA 5CHGA 4KLJA 5KFDA 2R8KA 4DFJA 3ZDAA 2KG5A 3AU2A 5AIAA 1T3QA 4O3NA 2GOLA 2A3VA 4UB6U 3MR5A 3LVVA 5AI9A 5IIIA 3QZ7A 3Q8LA 3HPOA 1SXDA 4DQRA 4EZ6A 3TAQA 1F0MA 1M6YA 5KG5A 1ZQJA 3PR4A 7ICFA 4F50A 3TANA 1Q46A 2LYAA 7ICMA 2XI9A 4KLOA 3RJIA 1XSNA 3QUCA 4MEYA 1SXEA 1WUDA 4KLSA 3H0LB 2CXYA 3H7IA 4Q45A 4EBCA 2K4EA 2BQUA 3F5EA 5J0UA 5ALXA 4Y2QA 5ALYA 4RPYA 4DLGA 8ICKA 2KZ3A 3EPGA 2DUYA 2AH5A 2W8KA 4J9LA 2KJ9A 1EXNA 2MA1A 2FJ6A 1Y88A 1Z1VA 1F5SA 4ECRA 4UBCA 2NRVA 4KLTA 3H4BA 4QZ8A 5IINA 4YR2A 1HIWA 1L8LA 4YXMA 2A19A 1ZQGA 2DPJA 2NO4A 4EENA 2VA8A 3K1ZA 4RQ0A 1MQ2A 3MABA 2VANA 4ZOHC 4QW8A 3V7KA 4DSEA 2BZFA 5ALIA 4QZFA 4ICAA 4TUPA 5D4BA 1UA1A 2RP5A 2K8CB 3UQ0A 9ICBA 1N62A 1NJWA 2KVCA 2WAQC 5AKGA 1NJYA 1RDFA 2P66A 1V38A 3G6YA 2EZZA 4QJFB 5C0YA 5J2IA 4MFCA 2E8PA 3SR6A 8ICNA 4XQ8A 4RQ6A 7ICSA 4QWBA 4O3SA 2FLPA 2CRXA 1SL2A 3L3FX 5AM2A 3GIIA 1S9FA 4NL9A 4NLKA 1NJXA 3JPNA 1A77A 3UMBA 4IQTA 4RQMA 5AI5A 8ICLA 2YMMA 1H38A 3T5HA 3Q8RB 5IILA 5KT2A 5AI6A 2ZJ5A 1S8OA 4ECSA 2FDRA 3ZD8A 5D49A 2UVRA 7ICVA 2PMZF 4P4MA 1B4FA 1MN8A 4F5QA 4NM1A 4US8A 3R9KA 2K60A 4ZH4A 4O0IA 1RXVA 3QEAZ 3PX0A 4Z6EA 8ICVA 3G6VA 2A1AA 4Y2PA 3JPSA 1V85A 4M9HA 2BCQA 4B9LA 2K8AA 2G07A 4R66A 4Q8FA 4USAA 4YG2A 5ALPA 5KFWA 4JK1A 4C7YA 2PXIA 3ONNA 3RB3A 3BQ0A 1N56A 1D8YA 1DXSA 4DSIA 3AL0B 4EEKA 4ECQA 3PX4A 5EWEA 1SB3C 4RQ8A 1JUDA 4I29A 1X66A 1ZXIA 5DGBA 3MR6A 1PVQA 4DO9A 2E8OA 1WYGA 3QZ8A 4NLZA 4DQIA 2MU2A 3FYHA 4G3IA 1HUZA 3ISBA 3AN1A 1S0VA 2EZXA 3TADC 4F2SA 1Q8KA 2UVUA 1RQNA 4YFKA 2BPFA 4I28A 8ICBA 5KFUA 4EX7A 8ICMA 2JEFA 4YXJA 3EUB2 5AM5A 3N97B 3KBBA 1SL0A 1KQQA 3V7JA 2I9GA 3RB6A 2H3QA 1AQ6A 3OJUA 3PW7A 1B0XA 4GXKA 3M9MB 2YY6A 4GXIA 2PI5A 1ZD3A 2JEGA 3SI8A 4UQGA 3RR8A 1IM4A 4Q44A 3PR5B 2KICA 2PFOA 3PW2A 4J9SA 5J2AA 4B9VA 2CPRA 2EAOA 2XO7A 3BZCA 5ALQA 1FIQA 2HCFA 1N2XA 4BDPA 4QZHA 5AM4A 3S6JA 1SV0A 3ZDEA 1Z00A 5CEHA 1A6SA 4RQ3A 2C22A 3DV9A 1UQVA 5KFIA 5GTIU 3TFSA 7ICPA 5KFSA 9ICMA 4GXJA 5J0TA 3SV3A 4GLXA 1ZQOA 3C1ZA 1KFTA 1KL9A 5ALHA 2OWOA 4ED2A 2PFPA 2YTUA 2EH9A 5AKHA 1KN5A 1LKYB 9ICSA 1KDHA 5DBCA 4ELVA 3KZIU 1UT8A 2LM1A 3GU3A 4UBBA 2W9BB 2F76X 1XWLA 2H5XA 2W43A 2JGAA 3SAGA 4EX6A 1KLNA 3PMLA 1CEZA 3GV7B 3RFAA 3SV4A 5J2KA 1S77D 2H3FA 3HKZF 2OHFA 4R8UB 1TAQA 5ALVA 4QZCA 3RH4A 1S10A 2QARA 3WK9A 4XUSA 1TK5A 1HUOA 3HRDD 1S5LU 4Y2YA 3KZXA 2AGQA 1YZ7A 3RB4A 1BGXT 4UAVA 2IOFA 4YQWA 3TADA 2G08A 3FAHA 4LJXA 3TI0A 3I76A 4NWIA 2LI6A 3AM9A 2MSNA 4OJOA 4OCZA 1D8LA 5D46A 2F77X 5AK4A 2FLNA 9ICTA 1YT3A 3SAFA 4ED3A 1VDVA 3ED5A 3JPRA 4F72A 1RM6C 2W9BA 4O5CA 2AQ0A 1IXRA 2R8JA 4KLEA 4C8LA 3NUQA 1JRPA 5IIMA 3F5AA 4I2IA 5ALOA 1BPEA 4JB3A 3CP8A 9ICGA 3SMVA 3RAQA 1X40A 2EAPA 2W11A 1QLNA 1IG6A 2JV3A 4F93B 2GH1A 2XY6A 4P2HA 4FE3A 4KN7A 2WAQF 3OPXA 2IBKA 4M2YA 1D9DA 4RNOA 5DB7A 4O3OA 3M8RA 4UB2A 1X9WA 2FPLA 5KFVA 3L5KA 3D2SA 2PKEA 5EE3A 5J29A 4UAWA 1CI4A 1B22A 5DQIA 3M7DA 4RPZA 3QU2A 3THVA 4DFDA 3LYSA 3QX7A 3HX0A 1NK8A 3G6XA 4BGDA 3AQFA 3GFKB 4QW9A 8ICYA 2HVIA 3TAPA 4JV1A 3V72A 2Q0ZX 2HBKA 1URJA 3RJEA 1ZQVA 5HR7A 2ASDA 1L7OA 3NVVA 4Z6FA 3C29A 5AKXA 1L5UA 3B0XA 1ZQIA 5DQHA 1N5WA 3QUBA 5J2BA 7ICJA 1ZQLA 2ZUBA 3HJEA 2JZBA 1Z19A 5KFNA 1JX4A 4P0QB 2W03A 2XCPA 3ORYA 4BX9C 1SV0C 3RRGA 2YB1A 3SYZA 4ED1A 4I2BA 2I5HA 5L1JA 1BPBA 3PW5A 2AXTU 1PK1B 3Q8MA 4JV0A 3ISCA 4KTQA 3HW8A 4PL1A 4NLCA 4ECVA 1BPXA 8ICRA 4NY8A 3Q8SB 4DFPA 1Z00B 3LWLA 5KFYA 4K4GA 3GIMA 5DG8A 2AGOA 4K4HA 1WWVA 2BPGA 2BCUA 7ICQA 3A0BU 2VA2A 2FLLA 4UB5A 3M8SA 3SENA 4R65A 3PW0A 4KITB 5KFTA 3OJSA 3O0FA
chains in the Genus database with same CATH topology
2R18A 2VJ4A 2OH2A 2JGAA 3C28A 2HOFA 2XIDA 3D2QA 3LVWA 4AYBF 3SAGA 3M7DA 2KV2A 2ZIUB 4OJ6A 2WB1F 2BDUA 1Q3UA 2CRXA 2ZIVB 3L3FX 2ZIUA 5KL8B 3IN5A 2WB1C 2KHQA 4P0PA 2E1FA 3LYSA 2K4HA 4BJQA 4QIWF 3SAHA 2N1RA 2F8LA 2ZXHA 3RFAA 1XNSA 1KBUA 3MGVA 2HBJA 2PMZC 2VKQA 5A0LA 4CGZA 4QIWC 4OJPA 1ZQ1C 2H3FA 2JH7A 1A0PA 3RF9A 3AQFA 2ZIXA 3M6KA 3HKZF 1TAMA 3N7RC 2HBMA 5KL1B 3F53A 3GZFA 4AYBC 2GOLA 3HKZC 2A3VA 2HBKA 2KJ8A 1URJA 3LVVA 3PSFA 4C0ZA 4U7CA 3F2CA 2G06A 3N7PD 2RHFA 2H3IA 1SZHA 2KNJA 3N7SC 2H3QA 3DEEA 4ACOA 2ZIVA 2LBOA 4NLBA 5HR7A 2E1EA 3CYMA 4P0PB 2LYAA 1CRXA 2JH1A 2KOBA 5HR6A 2K8BB 2G5HB 3C29A 2ZG6A 2XI9A 2PMZF 3T79A 3KZXA 3PSPA 1GO3F 5CRXA 2KEYA 1PVPA 1WUDA 3AQEA 4OJ5A 3H0LB 2KICA 2G08A 2K4EA 2W04A 1Z19A 2KJ5A 3F5EA 1OUQA 4P0QB 2ZXIA 2W03A 4NWIA 2LHTA 2KKVA 4KX3A 4KX5A 2K4IA 4OJOA 1NZBA 2Y0SC 1Z1BA 2CPRA 2F77X 4BX9C 3SQIA 2NV3A 4GFJA 3KFUF 1YT3A 2KJ9A 2Z7JA 3SAFA 2YB4A 3ALRA 2YB1A 4WJ3B 2MA1A 3NRWA 2XVTA 4OO1J 3H0RB 2DGZA 4BUGA 2G09A 2ZIXB 4P0QA 2CN1A 1T94A 2G0AA 2KD1A 3H0MB 2YX8A 3M6ZA 2HBLA 1HIWA 2W7OA 4QNLA 3NUQA 1ECWA 1DRGA 2D6FC 2DF4B 1A6SA 2Y0SF 2F2AB 2HMXA 3F5AA 1XO0A 2KHVA 4PL1A 2K8AA 1PVRA 2OXOA 3CP8A 2RRDA 2LKYA 2K89A 2ZIWA 4U6PA 2G07A 2M0NA 4NLCA 1D8BA 2Q4TA 3SMVA 3ICXA 3CRXA 4CRXA 4PL2A 2H3VA 2E5SA 3D2NA 1MA7A 5C0YA 3K1ZA 2KKPA 1F44A 1HEKA 2MRLA 3PSTA 3ONNA 4A8EA 1L6NA 4ICAA 2GH1A 4IC9A 1ED1A 2VJ5A 5T14A 4NV0A 3IG5A 1P7DA 4O3MA 4FE3A 3PZPA 2G5IB 2RP5A 2K8CB 2ZIWB 3AL0B 2WAQF 3VC8A 2VIXA 2DQNB 3OPXA 4FZNA 3F2DA 2LYBA 2KVCA 2XICA 2H3ZA 2WAQC 1IIPA 4JMUA 3PSIA 3IG8A 4OJLA 2KIWA 2HOQA 2OYYA 4FZMA 4FZLA 4CDGA 1UPHA 3VCBA 3GU3A 2JHDA 2JMGA 1Q3VA 3D2SA 4QJFB 2HOIA 3E0FA 3IP4B 4KMOB 2W7PA 2F76X 3F2BA 2OM6A 3O0FA 1PVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB C;  3HKZ C;  2PMZ C;  2WB1 C;  4QIW C;  2WAQ C;  2Y0S C; 
#chains in the Genus database with same CATH topology
 2K4P A;  1LB2 B;  3V6J A;  8ICT A;  2DWQ A;  4AYB F;  2P6U A;  1ZJM A;  2WF7 A;  4O3Q A;  2F1I A;  3C5G A;  2WFA A;  5KAF U;  4IR1 A;  1S97 A;  2RDI A;  2C28 A;  5AK6 A;  4OD0 A;  4I2F A;  4OJP A;  4C4T A;  1KRP A;  5AI8 A;  2NRZ A;  3F53 A;  7ICH A;  5AKY A;  5DDM A;  4JV2 A;  4Y2U A;  1Z4O A;  4F91 B;  1KW4 A;  3AU6 A;  1KTQ A;  4MHV A;  2LBO A;  4YD2 A;  3M1Y A;  8ICA A;  9ICX A;  5JRT A;  5AKZ A;  2V4Q A;  2Y1I A;  1PVP A;  4OJ5 A;  3WK8 A;  5J8Y A;  2W04 A;  4Z6C A;  1UA0 A;  1WWU A;  3ZDC A;  4RQ1 A;  3H8M A;  5EWF A;  5ALK A;  1L8O A;  5ALN A;  1K5O A;  1X42 A;  3EZ5 A;  4JWM A;  2QKQ A;  4DSJ A;  4F4Z A;  2B21 A;  2KHV A;  3D6J A;  3SD7 A;  4PZN A;  2W55 A;  4DCC A;  2UVW A;  2EDU A;  2ODG A;  5ALD A;  2HHX A;  2V9W A;  2EZY A;  1NK5 A;  4C8K A;  4US9 A;  2DBY A;  4BWJ A;  2EAM A;  1XSL A;  3Q8Q B;  2C2E A;  2DFL A;  4FZN A;  4J9N A;  4JMU A;  4IS7 A;  1XS9 D;  4Y2V A;  2OYY A;  3KTQ A;  3JPQ A;  7ICE A;  2F1J A;  3PW4 A;  2ES6 A;  1NOM A;  3QU5 A;  3LVW A;  1V9P A;  4P0P A;  1Z4N A;  5AK3 A;  5A0L A;  3PV8 A;  4NL9 C;  4YR0 A;  3BQ2 A;  4B9U A;  1VLB A;  4O3P A;  2NYV A;  3KHH A;  3ZDB A;  4C0Z A;  4QWC A;  4I2A A;  5J2D A;  5AI0 A;  9ICN A;  4DL6 A;  4ECW A;  3FDS A;  3UMC A;  4I2C A;  4DSF A;  2KOB A;  3HT3 A;  4F4X A;  2G5H B;  1J2M A;  5JU5 A;  3T79 A;  2KEY A;  5ALT A;  4Z6D A;  4DFM A;  5FP0 A;  2BHN A;  3ZI4 A;  3M9O B;  4EZ9 A;  2Y0S C;  3K4G A;  4EEL A;  2NV3 A;  4PGY A;  2HHV A;  4EBE A;  2YML A;  3H8S A;  5KG7 A;  4RNM A;  1T8E A;  1LV5 A;  3L4P A;  1SKS A;  1DRG A;  2E3T A;  5AM3 A;  4ECX A;  5KG1 A;  9ICC A;  2RRD A;  2EQY A;  4QZE A;  1NKB A;  2KTQ A;  3RJG A;  1D8B A;  2L5Y A;  5KT7 A;  2ZJ8 A;  3C5F A;  1MA7 A;  4BXO B;  2KKP A;  1HEK A;  4J9O A;  4A8E A;  3OHB A;  4O9M A;  1ED1 A;  4NV0 A;  3IG5 A;  4F4K A;  4O3M A;  2ZIW B;  4PPX A;  3K1R B;  5DB6 A;  3JPT A;  2XIC A;  2HHT A;  4Y2R A;  2I6X A;  3BQ1 A;  2J6S A;  9ICP A;  9ICE A;  4RT2 A;  3TFR A;  1ZQY A;  2OH2 A;  4RQ2 A;  4OJ6 A;  4C8N A;  4MFF A;  4IL6 U;  5ALW A;  5KFE A;  1ZD5 A;  3C1Y A;  2KSO B;  2M9N A;  4QZI A;  2F8L A;  1ZQS A;  4UAY A;  4M9L A;  4QIW C;  4BXO A;  8ICO A;  4KLH A;  1A0P A;  1JIH A;  1JXE A;  2W9A A;  1JMS A;  2KJ8 A;  8ICH A;  1MSW D;  7ICI A;  4LVS A;  4I27 A;  4MFA A;  2HI0 A;  1RYU A;  1TVA A;  5CRX A;  2JXJ A;  3WKE A;  1DGJ A;  1TV9 A;  3RR7 A;  4R63 A;  3EW9 A;  1NZB A;  2JRZ A;  1ZQW A;  9ICK A;  4NJ8 A;  3NRW A;  5KFX A;  3H0R B;  4I2D A;  5AHX A;  4XA5 A;  1COK A;  4UB3 A;  2UVV A;  5KT3 A;  4P0Q A;  2G0A A;  3UXN A;  5HP4 A;  2FPM A;  4F5P A;  1UHU A;  1NJZ A;  2ZIW A;  1UT5 A;  1ZQC A;  3AMZ A;  2Q4T A;  4CRX A;  2C2D A;  4Y2X A;  2ZTC A;  2AQ4 A;  4M04 A;  4DS5 A;  3OSP A;  2OEH A;  5KFM A;  8ICJ A;  7ICR A;  3GDX A;  1TK0 A;  3MFH A;  4DQS A;  3F2D A;  4YN4 A;  8ICE A;  3TKA A;  2HVH A;  9ICJ A;  1IIP A;  2OCE A;  4FZM A;  1ZQA A;  3VCB A;  5KFQ A;  1BPY A;  4IQV A;  4DQQ A;  1IV8 A;  1KSP A;  2VJ4 A;  3D2Q A;  1N5X A;  7ICL A;  9ICH A;  4DSL A;  5TZV A;  2WB1 C;  3MC1 A;  3J81 j;  3RH5 A;  3N4M B;  1KBU A;  2FPK A;  5KNI A;  3MGV A;  2PMZ C;  3LDA A;  3TAC B;  1ZET A;  2XCA A;  3HP6 A;  4ECY A;  5KL1 B;  3M6K A;  5IIO A;  2HBM A;  3C2K A;  1N61 A;  3N7P D;  1KFS A;  5KFR A;  2IOF K;  4NLB A;  2V4R A;  5C5J A;  3T5L A;  3IDW A;  4F71 A;  2AU0 A;  3K75 D;  4DSK A;  1UCV A;  1U47 A;  1GO3 F;  2ISO A;  2KJ5 A;  3QEB Z;  2QAR B;  1DOQ A;  2LHT A;  3EWA A;  3FC4 A;  5B66 U;  1X9S A;  4Y2S A;  5AKJ A;  3B0Y A;  1MQ3 A;  4OO1 J;  4ED0 A;  1ZQB A;  2KFN A;  1ARO P;  2KD1 A;  4RUA A;  5KG3 A;  2MUT A;  1ECW A;  2ALZ A;  4MEX A;  1QQ5 A;  2MUT B;  4EBD A;  3V6K A;  1RG6 A;  1C7Y A;  4UAU A;  2BCR A;  2IHM A;  3CRX A;  4PL2 A;  3ETL A;  1SV4 A;  4ECZ A;  1QTM A;  4O3R A;  9ICU A;  4IR9 A;  1NI3 A;  4DQP A;  3TAR A;  1X6I A;  4M9J A;  1D9F A;  1NZP A;  2G5I B;  2R8H A;  9ICO A;  5KFP A;  1LVH A;  4NM2 A;  5J0Y A;  1ZQX A;  4O5E A;  1B43 A;  2KIW A;  5G5G A;  1RZT A;  1U49 A;  3IP4 B;  3F2B A;  2OM6 A;  2F8K A;  3C28 A;  5B5E U;  3I1Y A;  2NRT A;  1Q3U A;  2ZIV B;  2E8N A;  2KHQ A;  2MAX A;  1ZQP A;  2ZXH A;  4RQ7 A;  7ICU A;  4FFD A;  2BGW A;  4M9G A;  3KHL A;  4UAS A;  1N63 A;  2HHQ A;  1MC8 A;  3F2C A;  1ZQK A;  3GV5 B;  3KKA C;  2I1Q A;  4HYK A;  1RYR A;  3NRZ A;  4YMN A;  1TK8 A;  4UAZ A;  3OTQ A;  2PI4 A;  3MFI A;  2E1E A;  3CYM A;  4P0P B;  4RUC A;  3MR2 A;  3WKB A;  2ATL A;  4B6J A;  5J0P A;  4TQR A;  5KFK A;  1S0M A;  1SKW A;  9ICA A;  3Q8P B;  5AM1 A;  4R64 A;  3RAX A;  2K4I A;  2ZJA A;  4UAT A;  3IV6 A;  3ALR A;  4WJ3 B;  1QSL A;  4MF2 A;  4ELU A;  3RBD A;  8ICF A;  4KMU A;  1JI7 A;  1SKR A;  4J03 A;  2IA6 A;  2IOH A;  2CN1 A;  1RYS A;  1ZRN A;  4DF8 A;  4TUR A;  2M0N A;  2A1J B;  3BQT A;  3QNM A;  2ZUC A;  4NXZ A;  3SEI A;  4DS4 A;  1TKD A;  3QE9 Y;  2Y9T A;  3PO4 A;  2FMS A;  1L6N A;  5CA7 A;  5KG6 A;  4RPX A;  4IC9 A;  3BDP A;  1WCN A;  3BS5 B;  5F3X B;  1T3N A;  3FM9 A;  5ALL A;  1SWV A;  1ZJN A;  4J9M A;  3DDH A;  5BOM A;  3RH6 A;  4CDG A;  1UPH A;  3E0F A;  1ZQR A;  2F44 A;  9ICV A;  1PK3 A;  2XID A;  3BZK A;  4DL4 A;  5KL8 B;  3T5J A;  3KOO A;  1N48 A;  4B9S A;  3MGI A;  3NVY A;  5EOZ A;  5HMM A;  4ECT A;  3RF9 A;  5TIS U;  1O08 A;  4UAR A;  5L1K A;  4QZ9 A;  3PSF A;  5AIC A;  4IRD A;  1ZQT A;  2Y1J A;  4J9P A;  3T3F A;  2PFQ A;  1J2N A;  4HAI A;  2GLE A;  2A1J A;  5J2J A;  2YQE A;  4JWN A;  1ZOL A;  1TAU A;  5CWR A;  4KLF A;  3WK7 A;  2LM4 A;  4KLL A;  2ZXI A;  4ELT A;  1NKE A;  4KX5 A;  1ZRM A;  2ASL A;  2BDP A;  5KT5 A;  3KFU F;  2YB4 A;  1RQL A;  8ICC A;  4Q43 A;  8ICG A;  4DLE A;  3H8W A;  5G5H A;  1JRO A;  2QB0 A;  3UXP A;  2IHN A;  4F4W A;  2W7O A;  2HBL A;  1T4G A;  3JPP A;  2F2A B;  2WF8 A;  4UW9 A;  4KLI A;  2QLT A;  1WCL A;  2XGQ A;  4FO6 A;  5HML A;  2K89 A;  2BQ3 A;  4UB1 A;  4XRH A;  2BQR A;  4PZO A;  9ICR A;  5KFZ A;  5KTQ A;  2GO7 A;  4RQ5 A;  4KLQ A;  3GIL A;  1ZYQ A;  1NNL A;  4QZG A;  2BR0 A;  1ZQU A;  8ICU A;  5JTI A;  3RJH A;  4F5R A;  4FS2 A;  1ZQM A;  2BKE A;  1ZD4 A;  3QYP A;  4F92 B;  3NS1 A;  5BOL A;  2HOI A;  4QIW F;  8ICZ A;  2DKX A;  2F3N A;  3MGH A;  1LKY A;  2ISP A;  5K4L A;  5L1I A;  4M9N A;  4IRC A;  2E8M A;  3HWT A;  4I2G A;  4ED8 A;  2JR5 A;  3SAH A;  4EYH B;  4KLD A;  1QH9 A;  2KSO A;  5ALG A;  1BPD A;  1ZQ1 C;  2JH7 A;  3GZF A;  1S0O A;  3HKZ C;  4C4R A;  2KN7 A;  3PVX A;  1BNP A;  1YZ6 A;  2RHF A;  2H3I A;  4G9B A;  3DEE A;  5DBA A;  4TQS A;  4GIB A;  2BCS A;  5AI4 A;  5L1M A;  2K8B B;  2W8L A;  5F9L A;  2ZG6 A;  4MF8 A;  1A76 A;  5DDY A;  4DEZ A;  3AQE A;  5DKW A;  1N60 A;  1L7P A;  5KT6 A;  1X2I A;  1L3U A;  2R8I A;  5EE1 A;  3WKC A;  4PHE A;  1DGS A;  2YMP A;  2ZTD A;  3RTV A;  9ICW A;  1JN3 A;  5L1L A;  2ZUD A;  5AM0 A;  1XC9 A;  8ICQ A;  2LYH A;  1U9L A;  4ED7 A;  2FI1 A;  5F9N A;  4P4P A;  2W9C A;  2E5S A;  3D2N A;  3QXG A;  1ZQZ A;  2RDJ A;  1L3V A;  2EAN A;  5DB9 A;  3PST A;  5KFL A;  5KFB A;  4PHD A;  3RJK A;  2B0C A;  2VIX A;  4RT3 A;  2NRW A;  2XY5 A;  1JAL A;  2Y9U A;  4JUZ A;  3E2E A;  3N28 A;  2XGP A;  1J97 A;  4LZD A;  1SZP A;  1L7N A;  5L9X A;  4OJL A;  2HOQ A;  4FZL A;  4RNN A;  5EE0 A;  3M9N B;  1ZQH A;  2KFZ A;  2D3D A;  3H4D A;  2FMP A;  2JHD A;  4YR3 A;  3ZDD A;  9ICL A;  2W9M A;  5DLF A;  5CJ7 A;  5KFG A;  1SIJ A;  2KV2 A;  4KLM A;  4E0D A;  3IN5 A;  3UM9 A;  3ZD9 A;  4FS1 A;  8ICX A;  4M6W A;  2KMD A;  1HJP A;  1NK6 A;  4ED6 A;  2HW3 A;  1QSY A;  1DK3 A;  1KFD A;  3N7R C;  1TAM A;  4RU9 A;  1T7P A;  2HSZ A;  3RJJ A;  1FFV A;  3OHA A;  2KIV A;  1FO4 A;  4I2J A;  3MBY A;  1QQ6 A;  3KKA A;  1SZH A;  4X5V A;  4C4S A;  1U48 A;  1BVS A;  5KFA A;  3IRU A;  1CRX A;  4P4O A;  2JEI A;  2LPE A;  4FBU A;  2W3S A;  3NTU A;  4O5K A;  4CNQ A;  1OUQ A;  5J0R A;  3H40 A;  1PZN A;  4DFK A;  3PX6 A;  4AP9 A;  4B9T A;  2W3R A;  1Z1B A;  3HIL A;  1U45 A;  4TUS A;  3KD3 A;  4C8O A;  7ICO A;  3NVW A;  4BUG A;  2ZIX B;  2WTF A;  2JZB B;  2O6K A;  4B9M A;  1OW5 A;  4QZB A;  4GC6 A;  2GWS A;  4NLN A;  3LK9 A;  8ICS A;  9ICI A;  1KKX A;  4YMO A;  2OXO A;  4U6P A;  5ALZ A;  5KFC A;  1RPL A;  1SWW A;  4CF5 A;  1S76 D;  5HHI A;  2NO5 A;  4F5N A;  4C80 A;  3GIK A;  4CE6 A;  3I28 A;  5HNK A;  5T14 A;  2WF5 A;  1BPZ A;  4PGX A;  3PZP A;  1TE2 A;  2DQN B;  4BWM A;  2J6U A;  1TFR A;  2WF6 A;  3BS7 A;  1Q3V A;  2HHS A;  1WG8 A;  3A0H U;  2QB1 A;  5J2E A;  2WB1 F;  4DOA A;  2BDU A;  1K1Q A;  2KP7 A;  2DPI A;  5J8Y C;  7ICT A;  2N1R A;  3U26 A;  3UXO A;  5ALE A;  4IQW A;  4RZR A;  1Z3E B;  5AKL A;  4IQU A;  3RB0 A;  2YMQ A;  4C8M A;  4U7C A;  4QWE A;  2J6T A;  3WK5 A;  3BS5 A;  3JPO A;  3N7S C;  4YMM A;  4ACO A;  5DGA A;  1K1S A;  1QCK A;  3PY8 A;  3QUT A;  3NGD A;  2AJQ A;  3WKA A;  3NAS A;  3PSP A;  4CF4 A;  2IMW P;  1BNO A;  4EEY A;  2HHW A;  4KN4 A;  3OSN A;  3V6H A;  3C23 A;  3SQI A;  1KEJ A;  4GFJ A;  3AEV A;  3C2M A;  1X6J A;  5DG7 A;  5ALR A;  2XVT A;  4F2R A;  2BCV A;  7ICK A;  1O03 A;  1T94 A;  5AIB A;  3H0M B;  1RXW A;  4DWI A;  5J2F A;  4QNL A;  4M47 A;  4I2E A;  4PHP A;  4LZG A;  1XU4 A;  2B6G A;  1NK9 A;  2JEJ A;  4YVZ A;  4QWD A;  3MDA A;  4DL7 A;  1FEZ A;  5AKI A;  5KG2 A;  2NRX A;  3C21 A;  4Y2T A;  1PUZ A;  5CR0 A;  2QB0 B;  1ZQF A;  3IHQ B;  2P6R A;  4ECU A;  5ALS A;  2FE9 A;  2VJ5 A;  2YN4 A;  5J0S A;  5BPC A;  2VA3 A;  8ICW A;  1NK7 A;  4IRK A;  3C2L A;  2JMG A;  4RQN A;  1XSP A;  1C20 A;  7ICG A;  2R18 A;  3KHR A;  2HOF A;  5J2H A;  4F5O A;  2XY7 A;  4J9K A;  2DKZ A;  3PMN A;  2DL0 A;  2RLT A;  4PJ0 U;  4CGZ A;  1ZQN A;  2XC9 A;  2KE7 A;  1L7M A;  5JUM A;  5AK5 A;  2ASJ A;  5CB1 A;  1NK4 A;  1QQ7 A;  5DG9 A;  2FMQ A;  2G06 A;  4YCX A;  2KNJ A;  1U4B A;  5E79 U;  4I2H A;  3QUQ A;  3V7L A;  3GV8 B;  1L3T A;  5HR6 A;  2R8G A;  1S0N A;  4RQ4 A;  3KHG A;  1JXL A;  2W54 A;  5ALU A;  5DLG A;  2RQ5 A;  3E58 A;  5KFF A;  2HDO A;  2KKV A;  4KX3 A;  4CF3 A;  3UPQ A;  4M0A A;  4UB4 A;  3UMG A;  4FBT A;  5J0Q A;  5AKK A;  2YX8 A;  3RRH A;  5KFJ A;  2Y0S F;  4PH5 A;  2HMX A;  9ICQ A;  4Y2J A;  1X9M A;  4F3O A;  4QZA A;  5KG4 A;  3PO5 A;  3ICX A;  2H3V A;  5J0X A;  1F44 A;  3RJF A;  5H2F U;  1OXJ A;  4KLG A;  1PK1 A;  1SGG A;  1VJ5 A;  5GTH U;  3ETR A;  3VC8 A;  2WF9 A;  1NK0 A;  4J9Q A;  5KAI U;  3PSI A;  5EE9 A;  2P35 A;  2AHO B;  1V97 A;  4CCH A;  1CUK A;  1XO1 A;  7ICN A;  3CW2 C;  4KMO B;  2W7P A;  4KLU A;  3BJY A;  4Q8E A;  5ALM A;  9ICF A;  2ZIU B;  5DB8 A;  3Q8K A;  1COO A;  4DL2 A;  2E1F A;  2K4H A;  3TQ1 A;  5IIJ A;  2KVS A;  8ICP A;  2ZIX A;  3UQ2 A;  5J2G A;  3WK6 A;  4AYB C;  3MDC A;  4DOC A;  5IIK A;  5ALJ A;  3QU9 A;  2ZIV A;  1ZQD A;  2ZTE A;  5EWG A;  2D8C A;  3QU7 A;  5J0O A;  3SZ2 A;  4DOB A;  2AGP A;  4M6W B;  2JH1 A;  2HHU A;  4F8R A;  4UB8 U;  1ZQE A;  4DF4 A;  1SL1 A;  3IM1 A;  4GC7 A;  5KFO A;  2F1H A;  1DK2 A;  2PFN A;  5DBB A;  4PHA A;  3MR3 A;  3WU2 U;  3QU4 A;  3WK4 A;  1ZD2 P;  2Z7J A;  4YD1 A;  4TUQ A;  3EPI A;  4F4Y A;  2DGZ A;  5CP2 A;  1L3S A;  3GIJ A;  2G09 A;  3B9J A;  4K4I A;  1X9X A;  1ZQQ A;  4R8U A;  5KT4 A;  1NKC A;  3M6Z A;  3LWM A;  4YP3 A;  2D6F C;  3GQC A;  2DF4 B;  2LMR A;  5J0W A;  1XO0 A;  4C7Z A;  1PVR A;  4DL5 A;  3RBE A;  2LKY A;  4J9R A;  4DL3 A;  5KFH A;  3AUO A;  2W9C B;  8ICI A;  3H8J A;  2WHE A;  2MRL A;  5HHH A;  4EYI B;  5DQG A;  2C2R A;  4PGQ A;  1P7D A;  3OGU A;  3BQ7 A;  2KZM A;  4QZD A;  2LYB A;  2H3Z A;  5J2C A;  5KG0 A;  1FFU A;  3IG8 A;  4NLG A;  4QWA A;  3T5K A;  2KZZ A;  5AKE A;  1QSS A;  5ALF A;  2KK0 A;  3PNC A;  4B9N A;  2ESE A;  3NVZ A;  2ZIU A;  3EYZ A;  4BJQ A;  1XNS A;  2BPC A;  3CNH A;  3WKD A;  3ISD A;  2HBJ A;  2VKQ A;  5CHG A;  4KLJ A;  5KFD A;  2R8K A;  4DFJ A;  3ZDA A;  2KG5 A;  3AU2 A;  5AIA A;  1T3Q A;  4O3N A;  2GOL A;  2A3V A;  4UB6 U;  3MR5 A;  3LVV A;  5AI9 A;  5III A;  3QZ7 A;  3Q8L A;  3HPO A;  1SXD A;  4DQR A;  4EZ6 A;  3TAQ A;  1F0M A;  1M6Y A;  5KG5 A;  1ZQJ A;  3PR4 A;  7ICF A;  4F50 A;  3TAN A;  1Q46 A;  2LYA A;  7ICM A;  2XI9 A;  4KLO A;  3RJI A;  1XSN A;  3QUC A;  4MEY A;  1SXE A;  1WUD A;  4KLS A;  3H0L B;  2CXY A;  3H7I A;  4Q45 A;  4EBC A;  2K4E A;  2BQU A;  3F5E A;  5J0U A;  5ALX A;  4Y2Q A;  5ALY A;  4RPY A;  4DLG A;  8ICK A;  2KZ3 A;  3EPG A;  2DUY A;  2AH5 A;  2W8K A;  4J9L A;  2KJ9 A;  1EXN A;  2MA1 A;  2FJ6 A;  1Y88 A;  1Z1V A;  1F5S A;  4ECR A;  4UBC A;  2NRV A;  4KLT A;  3H4B A;  4QZ8 A;  5IIN A;  4YR2 A;  1HIW A;  1L8L A;  4YXM A;  2A19 A;  1ZQG A;  2DPJ A;  2NO4 A;  4EEN A;  2VA8 A;  3K1Z A;  4RQ0 A;  1MQ2 A;  3MAB A;  2VAN A;  4ZOH C;  4QW8 A;  3V7K A;  4DSE A;  2BZF A;  5ALI A;  4QZF A;  4ICA A;  4TUP A;  5D4B A;  1UA1 A;  2RP5 A;  2K8C B;  3UQ0 A;  9ICB A;  1N62 A;  1NJW A;  2KVC A;  2WAQ C;  5AKG A;  1NJY A;  1RDF A;  2P66 A;  1V38 A;  3G6Y A;  2EZZ A;  4QJF B;  5C0Y A;  5J2I A;  4MFC A;  2E8P A;  3SR6 A;  8ICN A;  4XQ8 A;  4RQ6 A;  7ICS A;  4QWB A;  4O3S A;  2FLP A;  2CRX A;  1SL2 A;  3L3F X;  5AM2 A;  3GII A;  1S9F A;  4NL9 A;  4NLK A;  1NJX A;  3JPN A;  1A77 A;  3UMB A;  4IQT A;  4RQM A;  5AI5 A;  8ICL A;  2YMM A;  1H38 A;  3T5H A;  3Q8R B;  5IIL A;  5KT2 A;  5AI6 A;  2ZJ5 A;  1S8O A;  4ECS A;  2FDR A;  3ZD8 A;  5D49 A;  2UVR A;  7ICV A;  2PMZ F;  4P4M A;  1B4F A;  1MN8 A;  4F5Q A;  4NM1 A;  4US8 A;  3R9K A;  2K60 A;  4ZH4 A;  4O0I A;  1RXV A;  3QEA Z;  3PX0 A;  4Z6E A;  8ICV A;  3G6V A;  2A1A A;  4Y2P A;  3JPS A;  1V85 A;  4M9H A;  2BCQ A;  4B9L A;  2K8A A;  2G07 A;  4R66 A;  4Q8F A;  4USA A;  4YG2 A;  5ALP A;  5KFW A;  4JK1 A;  4C7Y A;  2PXI A;  3ONN A;  3RB3 A;  3BQ0 A;  1N56 A;  1D8Y A;  1DXS A;  4DSI A;  3AL0 B;  4EEK A;  4ECQ A;  3PX4 A;  5EWE A;  1SB3 C;  4RQ8 A;  1JUD A;  4I29 A;  1X66 A;  1ZXI A;  5DGB A;  3MR6 A;  1PVQ A;  4DO9 A;  2E8O A;  1WYG A;  3QZ8 A;  4NLZ A;  4DQI A;  2MU2 A;  3FYH A;  4G3I A;  1HUZ A;  3ISB A;  3AN1 A;  1S0V A;  2EZX A;  3TAD C;  4F2S A;  1Q8K A;  2UVU A;  1RQN A;  4YFK A;  2BPF A;  4I28 A;  8ICB A;  5KFU A;  4EX7 A;  8ICM A;  2JEF A;  4YXJ A;  3EUB 2;  5AM5 A;  3N97 B;  3KBB A;  1SL0 A;  1KQQ A;  3V7J A;  2I9G A;  3RB6 A;  2H3Q A;  1AQ6 A;  3OJU A;  3PW7 A;  1B0X A;  4GXK A;  3M9M B;  2YY6 A;  4GXI A;  2PI5 A;  1ZD3 A;  2JEG A;  3SI8 A;  4UQG A;  3RR8 A;  1IM4 A;  4Q44 A;  3PR5 B;  2KIC A;  2PFO A;  3PW2 A;  4J9S A;  5J2A A;  4B9V A;  2CPR A;  2EAO A;  2XO7 A;  3BZC A;  5ALQ A;  1FIQ A;  2HCF A;  1N2X A;  4BDP A;  4QZH A;  5AM4 A;  3S6J A;  1SV0 A;  3ZDE A;  1Z00 A;  5CEH A;  1A6S A;  4RQ3 A;  2C22 A;  3DV9 A;  1UQV A;  5KFI A;  5GTI U;  3TFS A;  7ICP A;  5KFS A;  9ICM A;  4GXJ A;  5J0T A;  3SV3 A;  4GLX A;  1ZQO A;  3C1Z A;  1KFT A;  1KL9 A;  5ALH A;  2OWO A;  4ED2 A;  2PFP A;  2YTU A;  2EH9 A;  5AKH A;  1KN5 A;  1LKY B;  9ICS A;  1KDH A;  5DBC A;  4ELV A;  3KZI U;  1UT8 A;  2LM1 A;  3GU3 A;  4UBB A;  2W9B B;  2F76 X;  1XWL A;  2H5X A;  2W43 A;  2JGA A;  3SAG A;  4EX6 A;  1KLN A;  3PML A;  1CEZ A;  3GV7 B;  3RFA A;  3SV4 A;  5J2K A;  1S77 D;  2H3F A;  3HKZ F;  2OHF A;  4R8U B;  1TAQ A;  5ALV A;  4QZC A;  3RH4 A;  1S10 A;  2QAR A;  3WK9 A;  4XUS A;  1TK5 A;  1HUO A;  3HRD D;  1S5L U;  4Y2Y A;  3KZX A;  2AGQ A;  1YZ7 A;  3RB4 A;  1BGX T;  4UAV A;  2IOF A;  4YQW A;  3TAD A;  2G08 A;  3FAH A;  4LJX A;  3TI0 A;  3I76 A;  4NWI A;  2LI6 A;  3AM9 A;  2MSN A;  4OJO A;  4OCZ A;  1D8L A;  5D46 A;  2F77 X;  5AK4 A;  2FLN A;  9ICT A;  1YT3 A;  3SAF A;  4ED3 A;  1VDV A;  3ED5 A;  3JPR A;  4F72 A;  1RM6 C;  2W9B A;  4O5C A;  2AQ0 A;  1IXR A;  2R8J A;  4KLE A;  4C8L A;  3NUQ A;  1JRP A;  5IIM A;  3F5A A;  4I2I A;  5ALO A;  1BPE A;  4JB3 A;  3CP8 A;  9ICG A;  3SMV A;  3RAQ A;  1X40 A;  2EAP A;  2W11 A;  1QLN A;  1IG6 A;  2JV3 A;  4F93 B;  2GH1 A;  2XY6 A;  4P2H A;  4FE3 A;  4KN7 A;  2WAQ F;  3OPX A;  2IBK A;  4M2Y A;  1D9D A;  4RNO A;  5DB7 A;  4O3O A;  3M8R A;  4UB2 A;  1X9W A;  2FPL A;  5KFV A;  3L5K A;  3D2S A;  2PKE A;  5EE3 A;  5J29 A;  4UAW A;  1CI4 A;  1B22 A;  5DQI A;  3M7D A;  4RPZ A;  3QU2 A;  3THV A;  4DFD A;  3LYS A;  3QX7 A;  3HX0 A;  1NK8 A;  3G6X A;  4BGD A;  3AQF A;  3GFK B;  4QW9 A;  8ICY A;  2HVI A;  3TAP A;  4JV1 A;  3V72 A;  2Q0Z X;  2HBK A;  1URJ A;  3RJE A;  1ZQV A;  5HR7 A;  2ASD A;  1L7O A;  3NVV A;  4Z6F A;  3C29 A;  5AKX A;  1L5U A;  3B0X A;  1ZQI A;  5DQH A;  1N5W A;  3QUB A;  5J2B A;  7ICJ A;  1ZQL A;  2ZUB A;  3HJE A;  2JZB A;  1Z19 A;  5KFN A;  1JX4 A;  4P0Q B;  2W03 A;  2XCP A;  3ORY A;  4BX9 C;  1SV0 C;  3RRG A;  2YB1 A;  3SYZ A;  4ED1 A;  4I2B A;  2I5H A;  5L1J A;  1BPB A;  3PW5 A;  2AXT U;  1PK1 B;  3Q8M A;  4JV0 A;  3ISC A;  4KTQ A;  3HW8 A;  4PL1 A;  4NLC A;  4ECV A;  1BPX A;  8ICR A;  4NY8 A;  3Q8S B;  4DFP A;  1Z00 B;  3LWL A;  5KFY A;  4K4G A;  3GIM A;  5DG8 A;  2AGO A;  4K4H A;  1WWV A;  2BPG A;  2BCU A;  7ICQ A;  3A0B U;  2VA2 A;  2FLL A;  4UB5 A;  3M8S A;  3SEN A;  4R65 A;  3PW0 A;  4KIT B;  5KFT A;  3OJS A;  3O0F A; 
#chains in the Genus database with same CATH homology
 2R18 A;  2VJ4 A;  2OH2 A;  2JGA A;  3C28 A;  2HOF A;  2XID A;  3D2Q A;  3LVW A;  4AYB F;  3SAG A;  3M7D A;  2KV2 A;  2ZIU B;  4OJ6 A;  2WB1 F;  2BDU A;  1Q3U A;  2CRX A;  2ZIV B;  3L3F X;  2ZIU A;  5KL8 B;  3IN5 A;  2WB1 C;  2KHQ A;  4P0P A;  2E1F A;  3LYS A;  2K4H A;  4BJQ A;  4QIW F;  3SAH A;  2N1R A;  2F8L A;  2ZXH A;  3RFA A;  1XNS A;  1KBU A;  3MGV A;  2HBJ A;  2PMZ C;  2VKQ A;  5A0L A;  4CGZ A;  4QIW C;  4OJP A;  1ZQ1 C;  2H3F A;  2JH7 A;  1A0P A;  3RF9 A;  3AQF A;  2ZIX A;  3M6K A;  3HKZ F;  1TAM A;  3N7R C;  2HBM A;  5KL1 B;  3F53 A;  3GZF A;  4AYB C;  2GOL A;  3HKZ C;  2A3V A;  2HBK A;  2KJ8 A;  1URJ A;  3LVV A;  3PSF A;  4C0Z A;  4U7C A;  3F2C A;  2G06 A;  3N7P D;  2RHF A;  2H3I A;  1SZH A;  2KNJ A;  3N7S C;  2H3Q A;  3DEE A;  4ACO A;  2ZIV A;  2LBO A;  4NLB A;  5HR7 A;  2E1E A;  3CYM A;  4P0P B;  2LYA A;  1CRX A;  2JH1 A;  2KOB A;  5HR6 A;  2K8B B;  2G5H B;  3C29 A;  2ZG6 A;  2XI9 A;  2PMZ F;  3T79 A;  3KZX A;  3PSP A;  1GO3 F;  5CRX A;  2KEY A;  1PVP A;  1WUD A;  3AQE A;  4OJ5 A;  3H0L B;  2KIC A;  2G08 A;  2K4E A;  2W04 A;  1Z19 A;  2KJ5 A;  3F5E A;  1OUQ A;  4P0Q B;  2ZXI A;  2W03 A;  4NWI A;  2LHT A;  2KKV A;  4KX3 A;  4KX5 A;  2K4I A;  4OJO A;  1NZB A;  2Y0S C;  1Z1B A;  2CPR A;  2F77 X;  4BX9 C;  3SQI A;  2NV3 A;  4GFJ A;  3KFU F;  1YT3 A;  2KJ9 A;  2Z7J A;  3SAF A;  2YB4 A;  3ALR A;  2YB1 A;  4WJ3 B;  2MA1 A;  3NRW A;  2XVT A;  4OO1 J;  3H0R B;  2DGZ A;  4BUG A;  2G09 A;  2ZIX B;  4P0Q A;  2CN1 A;  1T94 A;  2G0A A;  2KD1 A;  3H0M B;  2YX8 A;  3M6Z A;  2HBL A;  1HIW A;  2W7O A;  4QNL A;  3NUQ A;  1ECW A;  1DRG A;  2D6F C;  2DF4 B;  1A6S A;  2Y0S F;  2F2A B;  2HMX A;  3F5A A;  1XO0 A;  2KHV A;  4PL1 A;  2K8A A;  1PVR A;  2OXO A;  3CP8 A;  2RRD A;  2LKY A;  2K89 A;  2ZIW A;  4U6P A;  2G07 A;  2M0N A;  4NLC A;  1D8B A;  2Q4T A;  3SMV A;  3ICX A;  3CRX A;  4CRX A;  4PL2 A;  2H3V A;  2E5S A;  3D2N A;  1MA7 A;  5C0Y A;  3K1Z A;  2KKP A;  1F44 A;  1HEK A;  2MRL A;  3PST A;  3ONN A;  4A8E A;  1L6N A;  4ICA A;  2GH1 A;  4IC9 A;  1ED1 A;  2VJ5 A;  5T14 A;  4NV0 A;  3IG5 A;  1P7D A;  4O3M A;  4FE3 A;  3PZP A;  2G5I B;  2RP5 A;  2K8C B;  2ZIW B;  3AL0 B;  2WAQ F;  3VC8 A;  2VIX A;  2DQN B;  3OPX A;  4FZN A;  3F2D A;  2LYB A;  2KVC A;  2XIC A;  2H3Z A;  2WAQ C;  1IIP A;  4JMU A;  3PSI A;  3IG8 A;  4OJL A;  2KIW A;  2HOQ A;  2OYY A;  4FZM A;  4FZL A;  4CDG A;  1UPH A;  3VCB A;  3GU3 A;  2JHD A;  2JMG A;  1Q3V A;  3D2S A;  4QJF B;  2HOI A;  3E0F A;  3IP4 B;  4KMO B;  2W7P A;  2F76 X;  3F2B A;  2OM6 A;  3O0F A;  1PVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...