4QIWC

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
380
structure length
369
Chain Sequence
IKSMVSKAELPDNIKEELYAKLIEYNEKYKLKKDEIQAIIDETVREYQKALIEPGEAVGTVAAQSIGEPSTQMTINVTLGLPRIIEIVDARKNPSTPIMTVYLDEEHRYDRDKALEVARRIEGTTLENLAREETIDILNMEYVVEIDPERLEKAGLDMEKVVRKLTGSFKSAEFEAEGYTLVVRPKKVTKLSDLRKIAEKVKKHRLKGLSGVGKTIIRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIWEIAEVLGIEAARNAIIDEIVSTMREQGLEVDVRHIMLVADMMTLDGVIRPIGRHGIVGEKASVLARAAFEITTQHLFAAAERGEVDPLNGVVENVLIGQPVPVGTGIVKLAMSLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 61
structure length 369
sequence length 380
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwC02
3HKZC 4QIWC 2PMZC 4AYBC 2WAQC 2WB1C 2Y0SC
chains in the Genus database with same CATH superfamily
3SZ2A 3HKZF 4OJ6A 5HHHA 4RPZA 4GXKA 4DOAA 3MR2A 2C2RA 1QH9A 5DLFA 5CHGA 1Q8KA 2RLTA 2Y0SC 1F5SA 5J2BA 4CCHA 4BXOA 4UAVA 4QZCA 3HPOA 4Q44A 1NJWA 3DDHA 2QARB 4DQPA 4OO1J 2JEGA 1KFSA 2BPCA 5HHIA 8ICAA 4PL1A 1JN3A 3MR6A 5BOMA 4Z6CA 1KFTA 5F9LA 1CRXA 2VA8A 3WKEA 3RF9A 3M6KA 4JK1A 5KFKA 1LVHA 3VCBA 1X6JA 3IG5A 1RG6A 1TVAA 5AI9A 1ZQTA 4RZRA 1ECWA 1Q3VA 2OCEA 2EAOA 1PK3A 1S97A 8ICOA 2V4RA 2NV3A 1VDVA 1V38A 2LM4A 2WFAA 3KHGA 1L3VA 1AQ6A 4B9SA 2I9GA 4R8UA 5J0RA 4IRKA 4C4SA 4MFCA 7ICMA 1C20A 5AKJA 3KKAC 1MA7A 1ZETA 4JB3A 1J2MA 4F8RA 2XGQA 3ALRA 2RP5A 5KG6A 2ASLA 4I2AA 4TURA 5CJ7A 2W7PA 4Y2XA 1N56A 1HJPA 1MN8A 4NXZA 4OJPA 2CRXA 2ESEA 4IC9A 3WKBA 4Y2JA 4DQQA 2NRTA 1FIQA 5EE9A 5JRTA 2F2AB 4KTQA 5AM1A 2Y9UA 5KFUA 3K75D 1T7PA 4PHEA 4US9A 3MR3A 1KEJA 1ZQPA 4KLGA 3NRZA 1NOMA 1V97A 1BVSA 2I1QA 4DLEA 4ZOHC 1ZRMA 4B9LA 1XSPA 5AI4A 3PV8A 3RJFA 4F5NA 4J9SA 3D2SA 4QZEA 4Y2QA 4QZAA 3OTQA 4Z6EA 3VC8A 1IM4A 1DK3A 4DEZA 4O3PA 2QB0A 4XRHA 1T3QA 3N7SC 1BPBA 3E0FA 8ICZA 3QX7A 2DL0A 3LK9A 2AHOB 3ZDEA 4ECWA 2ZIXA 4UB4A 7ICGA 2ZTEA 1KN5A 3SMVA 3QE9Y 4C8LA 5AKEA 5EE1A 4YCXA 4P0PA 1QQ6A 2FPKA 5KFOA 2YB1A 4IRCA 4ED6A 2BCUA 4QNLA 4KLLA 5AKXA 2K4PA 5DBCA 1L3TA 3JPSA 4YR2A 1B0XA 3H4BA 1JUDA 3F5AA 2KN7A 1ZQRA 4QWEA 2WB1C 2IHNA 4UB5A 2W03A 9ICWA 1RQNA 2PI4A 3GZFA 5CB1A 5KT5A 1TK5A 1BPEA 1SL1A 3RJEA 7ICTA 5KFPA 5L1LA 3KKAA 2JEFA 2PFOA 2Q4TA 3RRGA 4PPXA 4RU9A 4M47A 3N28A 4GLXA 1Z1BA 3D6JA 3OHBA 5HR6A 3KZIU 4DCCA 5J0TA 4DL5A 5KT4A 5J0OA 3Q8SB 4JV0A 5KFQA 1IXRA 4ECUA 3HP6A 3PZPA 5EE0A 2I5HA 2UVRA 4K4IA 4NLZA 1P7DA 1FFVA 5JUMA 4NV0A 4O5KA 3PX4A 1PUZA 1TAQA 3T5JA 2HHTA 1BPZA 1NJYA 3ZDCA 2EH9A 4KLFA 1KLNA 2UVUA 2BQUA 4BJQA 1A76A 4ED3A 5G5GA 1X6IA 4QW8A 2BZFA 4C8OA 2GWSA 2W9BA 5GTHU 1D8YA 4ECVA 4MEYA 5D46A 1JIHA 4ECQA 8ICVA 4MHVA 1L8OA 1Z00A 5J0PA 4DL7A 2JZBA 4KX5A 2R8HA 4RQ1A 3RBEA 5F9NA 4F4KA 3C23A 4P4MA 9ICCA 1DXSA 3ISBA 8ICCA 4GC6A 1OW5A 2FPMA 3IM1A 4C4RA 2PFPA 4KLEA 2YMQA 1F44A 3V72A 2ZJ5A 3ORYA 1COOA 4R65A 1V85A 1TAUA 4DFKA 3SR6A 4XUSA 4QZBA 2DKXA 2XI9A 4X5VA 1JXLA 3UM9A 5C0YA 2W8LA 4FZLA 3IDWA 1ZQIA 4UBBA 3V6KA 4F3OA 5KFHA 2R18A 3C2MA 2W54A 4ED2A 4C7YA 1XSLA 9ICXA 1FO4A 1T3NA 4UARA 3IP4B 3KOOA 5DBBA 1FEZA 2OHFA 5AIAA 2XC9A 2A19A 1KKXA 3GILA 4RPXA 3GIJA 2FJ6A 3EUB2 5J29A 4RQ0A 3IHQB 1D9FA 2ZIWA 4O0IA 1S10A 3ZDDA 3NVWA 3AU6A 5ALMA 2LYHA 3KBBA 3SEIA 4JV2A 3BS5A 4YP3A 2DGZA 5DGBA 3K1RB 4DL3A 3RB6A 4OJLA 5K4LA 5L1MA 4JWNA 2Y9TA 4UB8U 5AM3A 7ICOA 1ZD2P 3MFIA 4CDGA 4GC7A 3GDXA 4F93B 4M9LA 3RH6A 4UAUA 4E0DA 2PI5A 3PX6A 4USAA 2F1IA 1SKRA 2ZTCA 3N7RC 2KJ5A 1ZQMA 5KFGA 1SIJA 3TFSA 2LYBA 4DL6A 3PO5A 3NUQA 9ICIA 1Q46A 1ZD5A 1U48A 4EBCA 2A1JB 3CYMA 3QU5A 2H3IA 4NLGA 5ALGA 4YMNA 4CF3A 1KFDA 3V7KA 1X9SA 7ICEA 3I76A 2XICA 4CF4A 4Y2YA 1Z3EB 2ZUDA 1S8OA 4DL2A 3M8RA 1ZQDA 4KX3A 5KFFA 1ZQGA 3Q8KA 1SKWA 3OHAA 4OCZA 4J9RA 1X9XA 8ICRA 4I2GA 4FS1A 4ED1A 5AKGA 2BDUA 1GO3F 2EDUA 5AM5A 4C8MA 4O5EA 2E8PA 1UA1A 7ICQA 2ES6A 3ETLA 4I2EA 1ZJNA 4RQ4A 2FMPA 2AQ0A 4QZ9A 4B9UA 3WK5A 4AP9A 2PKEA 3M7DA 1U49A 5CWRA 3J81j 4M9NA 1Z4OA 4I2CA 3KHRA 2W9MA 4DFPA 1KSPA 3L5KA 3LVVA 1ZOLA 1NKBA 1NZBA 1S0NA 3PW7A 9ICLA 1UQVA 2DBYA 2DQNB 5AICA 3RR7A 4PZOA 1N48A 1D8LA 5ALHA 3OGUA 1RXWA 2R8GA 3HKZC 2KSOA 3FM9A 1Z1VA 4IQTA 2FLPA 2LBOA 2CPRA 4O9MA 8ICKA 5FP0A 4F2SA 3QNMA 3G6YA 3MBYA 3ISCA 5AIBA 3DEEA 4TUSA 2XCAA 2YMMA 4UB6U 4YD1A 4YXMA 3GU3A 4DSIA 4GXIA 3C2KA 1S76D 5ALDA 4I28A 5AKZA 4IRDA 3CRXA 2EAPA 1ED1A 4QZDA 4KLUA 2GO7A 3RTVA 2JR5A 2JMGA 5BPCA 3S6JA 1L3UA 1L3SA 1ZQNA 4KLQA 1YZ6A 4DSEA 1Y88A 5J0UA 1NK7A 4MFAA 4DLGA 1L7NA 5KFNA 2HSZA 3M9NB 4RUCA 2F8LA 3ZDBA 3UQ0A 4MF8A 3OJSA 4M6WA 2RDJA 4KMOB 3TANA 2HBMA 1BNOA 3JPNA 2PFNA 4TUPA 2JH1A 1NNLA 2UVVA 1X2IA 4BDPA 1WG8A 4EEKA 1COKA 1ZQYA 4EEYA 1B22A 1N62A 4I2HA 5HP4A 1V9PA 2OXOA 4EZ9A 2ZUBA 1UHUA 2XY5A 1A0PA 5ALLA 5A0LA 2A3VA 2FPLA 4O3OA 3T79A 2KNJA 2W04A 2N1RA 2G0AA 3GIMA 2W55A 2JEJA 1IV8A 1SWWA 3UXNA 1N61A 3LVWA 3OPXA 1LKYA 3E2EA 3SV4A 1ZQFA 4ECYA 1QSYA 4RQ3A 4UAYA 4P0PB 3B0XA 4F4XA 2BQ3A 3NRWA 2R8JA 1SXEA 2K89A 4C4TA 1ZQCA 2WF5A 5DDMA 5DGAA 5KFEA 1NK5A 4JWMA 7ICHA 2IBKA 4G9BA 3G6VA 4M2YA 2WTFA 2KP7A 5HMMA 4RT3A 1U4BA 2MUTA 1S77D 2OWOA 3TKAA 1U45A 3T5HA 3MDAA 1WYGA 3LDAA 3EZ5A 4NWIA 3WK9A 4P0QA 4J9LA 2I6XA 2K8CB 2BR0A 3PR4A 8ICBA 1VJ5A 1RXVA 1UPHA 3SQIA 2ZIVA 1BGXT 2HCFA 3HRDD 8ICPA 5AKYA 2ZIUA 2EQYA 5CEHA 5J2FA 4RQ7A 3QU7A 3K1ZA 1ZYQA 1ZQ1C 4KN7A 5EOZA 3A0BU 2D3DA 3JPRA 4NJ8A 5KG3A 3M9MB 2DKZA 3RFAA 2KZMA 5HR7A 2B6GA 3WK6A 4QWAA 3PSTA 1K1QA 1IG6A 1ZQXA 2J6SA 2R8KA 9ICAA 4BWMA 5TISU 1RYSA 3M1YA 3GIIA 2D8CA 1XU4A 2LPEA 2ISPA 1N60A 2FE9A 4BWJA 3RJGA 2HHUA 2NRXA 2PMZC 1QCKA 1PZNA 4AYBF 3PW4A 4RT2A 3UMBA 3FC4A 2YTUA 3KD3A 4DWIA 4P4OA 3SI8A 3UXOA 5CR0A 3TAQA 2LM1A 9ICTA 4PL2A 4KLTA 2RRDA 2G09A 4QIWC 3SAFA 5IILA 2LI6A 2ISOA 3H4DA 3QEAZ 4DF4A 3H8JA 3PMNA 3EPGA 5L1IA 1RYRA 3Q8PB 2F76X 4CNQA 1TKDA 1ZQVA 5KFZA 3HJEA 1PK1A 5L9XA 1XWLA 4ZH4A 3PNCA 2DUYA 5J2CA 2AGQA 7ICNA 3NVVA 4F91B 4F4WA 7ICKA 2HOIA 3FDSA 2OYYA 4I2DA 1ZQEA 4YXJA 4DS5A 1XO1A 2M9NA 3M9OB 4ACOA 5DBAA 2UVWA 2HHWA 4ED7A 3N4MB 5KFVA 2QARA 3GQCA 3UXPA 4P4PA 3SD7A 8ICWA 1UCVA 5AI0A 3BQ1A 3UMCA 2ZTDA 4ECXA 2VIXA 3QEBZ 5AI5A 1LB2B 2P6RA 3G6XA 3PY8A 4F50A 4QWDA 3H8SA 5HMLA 4F4ZA 5ALVA 4I29A 2KV2A 3ZD8A 2H3QA 4YD2A 2W9CB 1U9LA 8ICEA 4EELA 1XO0A 4I2FA 2KHVA 1D8BA 3ZI4A 5J2EA 1ZD4A 3TARA 3GV5B 5J2JA 2HBLA 2EAMA 1DK2A 3AU2A 1ZQUA 4TQSA 5DB9A 3SAGA 1MSWD 4DO9A 4YMOA 4PGQA 1DRGA 5DB7A 4MFFA 3F5EA 1K5OA 3Q8RB 1SGGA 3PW5A 3MDCA 5KFIA 2EANA 3H8MA 4B9MA 2BCQA 5KT7A 3LYSA 2ZUCA 4LVSA 5D49A 1PVQA 4DFMA 3WU2U 2HMXA 4F2RA 3Q8LA 2AXTU 2WF6A 2E1FA 3MABA 2BGWA 4M9HA 3I28A 4UQGA 5JTIA 1QQ5A 2K8BB 5KFRA 4QZFA 5EE3A 5J2GA 1KTQA 9ICUA 2XVTA 3SAHA 1C7YA 3AEVA 4KLOA 8ICSA 1SV0C 3HX0A 1VLBA 4RUAA 3PX0A 3IG8A 1NKCA 3C1ZA 1RZTA 5KFYA 4FBUA 5DQGA 4O3MA 5L1JA 3F2BA 2HDOA 1ZQAA 2FLNA 2KTQA 5CRXA 8ICYA 2B0CA 2F3NA 2EZYA 2VKQA 3MGHA 4F5OA 3UQ2A 4DSFA 5KT2A 2F1HA 9ICSA 3ED5A 2O6KA 5HNKA 5G5HA 5KG0A 2HHQA 2BPFA 4JUZA 2D6FC 3FYHA 5KT3A 3TADC 2IOFK 4R66A 9ICEA 3ISDA 2E8OA 2L5YA 2OH2A 4O3SA 1M6YA 2ZJ8A 8ICUA 4LJXA 2HI0A 1UT8A 2HBJA 1DGJA 4PGXA 8ICGA 1YT3A 2P35A 4ECTA 1TK0A 4C7ZA 3RH5A 2K4HA 5IIJA 2XIDA 3HILA 4RPYA 4RNMA 4K4GA 2KG5A 1BPDA 4R64A 2KIWA 2W3RA 4YFKA 1HIWA 4UW9A 3V6JA 4Y2SA 5CA7A 2JRZA 4US8A 3NVZA 1URJA 1ZQJA 4TUQA 1K1SA 1KRPA 2OM6A 3QUCA 4GXJA 3THVA 2WAQF 3IN5A 3NASA 2NO5A 8ICFA 2OEHA 4FE3A 3BQ2A 1H38A 4XQ8A 2KICA 1QTMA 9ICPA 3JPOA 2J6UA 3D2NA 4M04A 1D9DA 2FLLA 2ALZA 1X9WA 1Z19A 3QU4A 4J03A 1XS9D 1ZQLA 2NRVA 4I2BA 4IQWA 3B0YA 3RB4A 4UB1A 5AM4A 3K4GA 4FO6A 4ECZA 4U7CA 2LYAA 2KZZA 2IA6A 4DSLA 4RQ6A 2HHVA 4UBCA 3TACB 3H0LB 2W7OA 4IS7A 4BXOB 2ZXIA 7ICPA 3PR5B 9ICMA 3WK7A 4QW9A 5AI6A 1ZQWA 4IQVA 1X40A 2YB4A 3EYZA 1Z4NA 1J97A 1NK9A 1NJXA 4MEXA 1ZRNA 2E8MA 3UPQA 5DLGA 5KFAA 2E8NA 5DQIA 1RM6C 4CGZA 2ZG6A 1TFRA 5KL8B 2FMSA 2DWQA 1YZ7A 2QLTA 4KLJA 4UATA 5AK3A 1QLNA 1U47A 2G08A 3TADA 4KLIA 2FMQA 3KHHA 3PO4A 2PFQA 2F1JA 4F4YA 3L3FX 2K60A 4M0AA 4HAIA 2WF9A 4QZ8A 1SB3C 4GFJA 2XO7A 1X9MA 3MGVA 1FFUA 4QJFB 1J2NA 4QZHA 4QZGA 4BGDA 2KJ9A 4R8UB 5ALTA 5ALIA 2KHQA 1S9FA 3MFHA 5KFMA 5AK5A 4B9VA 5KFDA 4KLHA 3EWAA 5KFJA 5ALRA 3C28A 2VJ4A 4PHAA 3KZXA 1S0MA 1B43A 1PVRA 4ELTA 4PHPA 8ICIA 2YMPA 5ALJA 2MRLA 1O03A 1NK8A 4DOBA 3GFKB 3T5KA 1OXJA 2B21A 3WK4A 2HOFA 2JH7A 1L7OA 5TZVA 5F3XB 1NJZA 9ICBA 3RAXA 3JPQA 4NLCA 2IHMA 8ICJA 2E3TA 4MF2A 2AU0A 2R8IA 3EPIA 3SENA 3TI0A 1NI3A 4EX6A 1BNPA 1WCLA 1TE2A 5KFCA 3AQEA 2AQ4A 1LV5A 4ICAA 5J2AA 4Y2PA 2XGPA 1ZQQA 1ZJMA 3QYPA 3DV9A 4BUGA 3RAQA 3ICXA 4RQ5A 2QB0B 4IR9A 3Q8MA 5AK6A 5BOLA 3E58A 3H7IA 2ZIXB 3MC1A 4EENA 3LWMA 5D4BA 1TV9A 2BCRA 1EXNA 2P66A 1A77A 4AYBC 5DG8A 4YQWA 4RQ2A 4Y2VA 5KL1B 5J2IA 3CW2C 3MR5A 1SZHA 1X66A 4DFJA 2IMWP 3C5FA 2KE7A 2G07A 3RJHA 2MA1A 4RNNA 3CNHA 1XSNA 5EWFA 2H3ZA 3RB3A 3OSNA 2XY6A 4R63A 2Y1JA 3JPPA 5AI8A 4O3RA 1T8EA 2HOQA 4DQIA 2ODGA 4Q8FA 4NL9C 9ICHA 3NVYA 2CXYA 2FI1A 1BPXA 8ICXA 3RRHA 5EWGA 3Q8QB 1WWVA 3TQ1A 2RDIA 3BQ7A 1L8LA 1Q3UA 2BHNA 4ED0A 4RNOA 2LKYA 2MAXA 2W11A 4QZIA 5B5EU 4DL4A 2BKEA 2Q0ZX 4Z6DA 5C5JA 1SL2A 8ICMA 3RBDA 4PHDA 3C5GA 5L1KA 5EWEA 2ASJA 3ETRA 2WHEA 1RPLA 2KIVA 2MSNA 4YMMA 3WKAA 4KITB 4YR0A 4UB2A 5B66U 4PGYA 3GIKA 4LZGA 2DF4B 3H0MB 1ZQBA 4IQUA 2YQEA 3QU9A 2QB1A 5ALYA 5AKIA 4P2HA 2GH1A 5ALSA 2KD1A 4IL6U 4DFDA 7ICLA 1OUQA 3PSFA 2NYVA 3B9JA 3F2DA 9ICJA 3MGIA 3PVXA 1KDHA 1X42A 2W9BB 1ZQKA 4ELUA 1PVPA 5J2HA 4YR3A 2LMRA 1Z00B 2JZBB 3SYZA 4IR1A 3T3FA 2Y0SF 3JPTA 3RB0A 7ICIA 3AM9A 4BX9C 3RR8A 2VJ5A 4DQSA 3L4PA 4F5QA 4EX7A 5ALXA 3RJKA 5KFXA 1N63A 3UMGA 3AQFA 3EW9A 3QUQA 3F53A 2BPGA 5AKKA 4EZ6A 2K4EA 1N2XA 1L5UA 5KG2A 5KTQA 3V7LA 2QKQA 3H8WA 5AKLA 4KLSA 1RDFA 2G5HB 3AUOA 4DSJA 5J2DA 1KBUA 2KOBA 3T5LA 2BCVA 1CEZA 1CI4A 4M9JA 2H3FA 5J0WA 9ICGA 4NL9A 2YN4A 2ZIWB 4RQMA 4YG2A 3IRUA 1WCNA 8ICLA 4B6JA 5IIMA 2F44A 4O3NA 2EZXA 3C21A 1N5WA 3BS5B 2ATLA 9ICOA 5E79U 2AGPA 3I1YA 1NK4A 2M0NA 3QUBA 1SKSA 4RQNA 3PW2A 2KFZA 2H5XA 4Q8EA 4WJ3B 1DGSA 3QZ7A 2YY6A 7ICRA 3BZKA 4YN4A 5DG9A 1A6SA 2KEYA 1QSLA 4J9PA 3RJJA 5AM2A 3GV8B 1TAMA 5KG7A 5KFBA 4C0ZA 5CP2A 7ICFA 4QWCA 4Q43A 5IINA 5DDYA 4ECRA 5J8YC 4J9MA 2VA2A 2E1EA 5ALPA 5KAIU 3ZDAA 5J2KA 1DOQA 9ICRA 2Y1IA 4ELVA 2PMZF 1RQLA 2HBKA 3BZCA 2GLEA 2K4IA 3M8SA 2PXIA 3BQTA 2DFLA 3TFRA 2KFNA 1KL9A 1CUKA 5KG5A 4QIWF 1ZXIA 3KTQA 9ICVA 4Y2UA 2JV3A 1RYUA 3TAPA 1L7MA 2KZ3A 2KKVA 4G3IA 2AGOA 1MQ3A 4DOCA 1T94A 5DB6A 1WUDA 2HVIA 2F8KA 4C8NA 3PMLA 2WAQC 2AH5A 4QWBA 1L7PA 3R9KA 4C80A 4PZNA 4I2JA 1ZQSA 2HHSA 3QXGA 3D2QA 4CE6A 1TK8A 1BPYA 4Q45A 2RQ5A 2JXJA 2K8AA 2CN1A 2EZZA 2BDPA 4EYIB 4A8EA 3FAHA 3N97B 2W43A 4KMUA 1ZD3A 1QSSA 8ICHA 2VANA 2KSOB 2WB1F 2V4QA 2G06A 5KFLA 2C2EA 3WKCA 2KMDA 1L6NA 4KN4A 2KJ8A 1XC9A 2H3VA 5KG4A 1SWVA 4F72A 2E5SA 4CF5A 3ONNA 3AL0B 2DPJA 3WK8A 1T4GA 5JU5A 8ICTA 5ALOA 2IOFA 3GV7B 5KFWA 2WF8A 5T14A 1KQQA 4CRXA 4NLKA 1XNSA 4UAWA 5AHXA 2P6UA 4TQRA 1S0VA 5KAFU 1JMSA 1NKEA 4J9KA 2RHFA 4OD0A 1JX4A 5GTIU 1JI7A 4RQ8A 5J8YA 9ICFA 2KVSA 4OJOA 4JMUA 5IIOA 1B4FA 2NO4A 4NM1A 4NLNA 2W9CA 2WF7A 2ZJAA 4OJ5A 2G5IB 3QUTA 3ZD9A 5KNIA 3AMZA 4M6WB 2HHXA 4EBEA 2IOHA 1JALA 1NK0A 3O0FA 5ALEA 1HUZA 5KFTA 3H40A 2GOLA 4KLMA 4KLDA 7ICJA 2VA3A 4XA5A 3IV6A 4O5CA 3C29A 4DF8A 4NM2A 2C22A 3WKDA 5ALNA 1KW4A 3PSIA 2NRZA 5IIKA 3QZ8A 1NZPA 4FZNA 3HT3A 3F2CA 4B9TA 2HVHA 3C2LA 5IIIA 4J9NA 2W8KA 4C8KA 3RJIA 2AJQA 2HW3A 1NK6A 4F92B 4DS4A 4I2IA 1SV0A 2W9AA 4UASA 2BCSA 5AM0A 4HYKA 1SV4A 1LKYB 4YVZA 4J9QA 4Y2TA 3LWLA 3OJUA 2JHDA 3NS1A 1ZQOA 2F77X 1JRPA 3C1YA 5KT6A 4DQRA 1UT5A 5DQHA 1SZPA 1HEKA 5J0SA 4JV1A 2J6TA 1S0OA 2NRWA 3N7PD 5DKWA 5KFSA 4ED8A 3V6HA 4Z6FA 2C2DA 7ICUA 5AK4A 3U26A 4I27A 3HW8A 2JGAA 3NGDA 4K4HA 4FZMA 4PJ0U 2MUTB 4UAZA 2W3SA 1N5XA 5KG1A 3RH4A 3NTUA 2ZXHA 3CP8A 3PSPA 2YMLA 5J0XA 5ALUA 5J0YA 8ICQA 4P0QB 4FS2A 1SXDA 5DG7A 4LZDA 4FBTA 9ICKA 4U6PA 4F71A 3V7JA 5ALZA 2ZIVB 5ALQA 1SL0A 7ICVA 2ZIUB 5AKHA 1S5LU 2MU2A 5ALKA 2KVCA 5ALWA 4EBDA 3AN1A 3A0HU 1O08A 1ZQHA 4DSKA 1MQ2A 4ECSA 7ICSA 2ASDA 3BJYA 2Z7JA 1F0MA 3KFUF 2FDRA 3KHLA 4FFDA 1JXEA 2DPIA 1WWUA 9ICNA 3OSPA 3PW0A 9ICQA 3M6ZA 4EYHB 4NLBA 5J0QA 4B9NA 2C28A 1AROP 1MC8A 5H2FU 2A1JA 4Y2RA 2JEIA 1HUOA 2A1AA 4GIBA 2XY7A 2BQRA 3BDPA 4NY8A 2KKPA 8ICNA 5DB8A 3BQ0A 4PH5A 2YX8A 3HWTA 4F5PA 3BS7A 1IIPA 2KK0A 1JROA 3SV3A 3QU2A 2LHTA 4F5RA 3H0RB 2V9WA 1QQ7A 1ZQZA 4UB3A 4M9GA 5ALFA 4J9OA 1PK1B 2XCPA 1UA0A 4O3QA
chains in the Genus database with same CATH topology
1UPHA 2Q4TA 2ZIVA 3SQIA 4OJOA 3KZXA 2XVTA 3IP4B 3M7DA 2JH1A 2HOQA 2F2AB 3HKZF 4JMUA 2ZIUA 3D2NA 4OJ6A 4QIWF 1PVRA 2ZXHA 3CP8A 3PSPA 1Z1BA 2MRLA 5HR6A 4OJ5A 2G5IB 2KKVA 4P0QB 3K1ZA 1Z19A 2Y0SC 1ZQ1C 3LVVA 2VIXA 2G5HB 2ZIWA 2HOFA 2JH7A 1T94A 3IG8A 5HR7A 3RFAA 1WUDA 1NZBA 1KBUA 2KOBA 4U6PA 3O0FA 2OXOA 4O3MA 2DQNB 1Q3UA 2ZIVB 3PSTA 2WAQC 3F2BA 2LKYA 2KV2A 2ZIUB 5CRXA 2H3FA 4U7CA 2LYAA 4OO1J 2GOLA 2H3QA 2VKQA 3PZPA 2DGZA 3D2SA 4NLCA 4PL1A 2KVCA 3D2QA 1XO0A 1P7DA 3HKZC 1A0PA 4OJLA 3H0LB 3C29A 2KHVA 2ZIWB 4NV0A 3VC8A 2W7OA 1CRXA 5A0LA 2ZXIA 2A3VA 1D8BA 2LBOA 2K8AA 3RF9A 3T79A 4CDGA 3M6KA 2CPRA 2CN1A 2PMZC 3N7SC 2KNJA 2W04A 2D6FC 3PSIA 2Z7JA 3VCBA 4A8EA 2N1RA 3AQEA 4FZNA 3SAHA 3F2CA 2G0AA 3E0FA 3KFUF 3IG5A 4AYBF 4ICAA 2HBLA 2YB4A 4BJQA 2ZIXA 2OH2A 2DF4B 3LVWA 3OPXA 1ECWA 3DEEA 1Q3VA 3H0MB 3N7RC 4CGZA 2KJ5A 2M0NA 4P0PB 2WB1F 3SMVA 2LYBA 3NUQA 2GH1A 2G06A 2HBJA 2KD1A 2ZG6A 3GU3A 4BUGA 3ICXA 3M6ZA 3SAGA 5KL8B 3NRWA 4NLBA 3CYMA 1OUQA 4WJ3B 4PL2A 2RRDA 2G09A 4QIWC 4P0PA 3SAFA 1YT3A 2H3IA 3PSFA 2NV3A 1L6NA 1DRGA 2K89A 2KJ8A 3F5EA 4KX5A 1A6SA 2K4HA 2YB1A 3F2DA 2H3VA 2G08A 2KEYA 2XIDA 3CRXA 2ZIXB 4QNLA 1ED1A 1TAMA 2E5SA 2XICA 2JHDA 2JMGA 4AYBC 2F77X 2KIWA 3L3FX 1HIWA 4C0ZA 1MA7A 1HEKA 3ONNA 2KKPA 3AL0B 1PVPA 3LYSA 1F44A 3F5AA 2F76X 4GFJA 2YX8A 3ALRA 2E1EA 3F53A 2WB1C 3N7PD 4KX3A 5KL1B 3MGVA 1PVQA 2W03A 2H3ZA 1IIPA 4CRXA 5T14A 1URJA 2RP5A 3GZFA 1SZHA 4QJFB 1XNSA 2Y0SF 2LHTA 2XI9A 2HMXA 2PMZF 2HBKA 5C0YA 2KJ9A 4FZLA 3H0RB 2W7PA 2OM6A 2HOIA 4NWIA 2F8LA 2BDUA 2E1FA 2R18A 4P0QA 4BX9C 1GO3F 2G07A 2K4IA 2KHQA 2OYYA 2VJ5A 2MA1A 2JGAA 2WAQF 2K8BB 4OJPA 3IN5A 4KMOB 2RHFA 2CRXA 3AQFA 2K8CB 4FZMA 4FE3A 4IC9A 4ACOA 3C28A 2HBMA 2KICA 2K4EA 2VJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ C;  4QIW C;  2PMZ C;  4AYB C;  2WAQ C;  2WB1 C;  2Y0S C; 
#chains in the Genus database with same CATH topology
 3SZ2 A;  3HKZ F;  4OJ6 A;  5HHH A;  4RPZ A;  4GXK A;  4DOA A;  3MR2 A;  2C2R A;  1QH9 A;  5DLF A;  5CHG A;  1Q8K A;  2RLT A;  2Y0S C;  1F5S A;  5J2B A;  4CCH A;  4BXO A;  4UAV A;  4QZC A;  3HPO A;  4Q44 A;  1NJW A;  3DDH A;  2QAR B;  4DQP A;  4OO1 J;  2JEG A;  1KFS A;  2BPC A;  5HHI A;  8ICA A;  4PL1 A;  1JN3 A;  3MR6 A;  5BOM A;  4Z6C A;  1KFT A;  5F9L A;  1CRX A;  2VA8 A;  3WKE A;  3RF9 A;  3M6K A;  4JK1 A;  5KFK A;  1LVH A;  3VCB A;  1X6J A;  3IG5 A;  1RG6 A;  1TVA A;  5AI9 A;  1ZQT A;  4RZR A;  1ECW A;  1Q3V A;  2OCE A;  2EAO A;  1PK3 A;  1S97 A;  8ICO A;  2V4R A;  2NV3 A;  1VDV A;  1V38 A;  2LM4 A;  2WFA A;  3KHG A;  1L3V A;  1AQ6 A;  4B9S A;  2I9G A;  4R8U A;  5J0R A;  4IRK A;  4C4S A;  4MFC A;  7ICM A;  1C20 A;  5AKJ A;  3KKA C;  1MA7 A;  1ZET A;  4JB3 A;  1J2M A;  4F8R A;  2XGQ A;  3ALR A;  2RP5 A;  5KG6 A;  2ASL A;  4I2A A;  4TUR A;  5CJ7 A;  2W7P A;  4Y2X A;  1N56 A;  1HJP A;  1MN8 A;  4NXZ A;  4OJP A;  2CRX A;  2ESE A;  4IC9 A;  3WKB A;  4Y2J A;  4DQQ A;  2NRT A;  1FIQ A;  5EE9 A;  5JRT A;  2F2A B;  4KTQ A;  5AM1 A;  2Y9U A;  5KFU A;  3K75 D;  1T7P A;  4PHE A;  4US9 A;  3MR3 A;  1KEJ A;  1ZQP A;  4KLG A;  3NRZ A;  1NOM A;  1V97 A;  1BVS A;  2I1Q A;  4DLE A;  4ZOH C;  1ZRM A;  4B9L A;  1XSP A;  5AI4 A;  3PV8 A;  3RJF A;  4F5N A;  4J9S A;  3D2S A;  4QZE A;  4Y2Q A;  4QZA A;  3OTQ A;  4Z6E A;  3VC8 A;  1IM4 A;  1DK3 A;  4DEZ A;  4O3P A;  2QB0 A;  4XRH A;  1T3Q A;  3N7S C;  1BPB A;  3E0F A;  8ICZ A;  3QX7 A;  2DL0 A;  3LK9 A;  2AHO B;  3ZDE A;  4ECW A;  2ZIX A;  4UB4 A;  7ICG A;  2ZTE A;  1KN5 A;  3SMV A;  3QE9 Y;  4C8L A;  5AKE A;  5EE1 A;  4YCX A;  4P0P A;  1QQ6 A;  2FPK A;  5KFO A;  2YB1 A;  4IRC A;  4ED6 A;  2BCU A;  4QNL A;  4KLL A;  5AKX A;  2K4P A;  5DBC A;  1L3T A;  3JPS A;  4YR2 A;  1B0X A;  3H4B A;  1JUD A;  3F5A A;  2KN7 A;  1ZQR A;  4QWE A;  2WB1 C;  2IHN A;  4UB5 A;  2W03 A;  9ICW A;  1RQN A;  2PI4 A;  3GZF A;  5CB1 A;  5KT5 A;  1TK5 A;  1BPE A;  1SL1 A;  3RJE A;  7ICT A;  5KFP A;  5L1L A;  3KKA A;  2JEF A;  2PFO A;  2Q4T A;  3RRG A;  4PPX A;  4RU9 A;  4M47 A;  3N28 A;  4GLX A;  1Z1B A;  3D6J A;  3OHB A;  5HR6 A;  3KZI U;  4DCC A;  5J0T A;  4DL5 A;  5KT4 A;  5J0O A;  3Q8S B;  4JV0 A;  5KFQ A;  1IXR A;  4ECU A;  3HP6 A;  3PZP A;  5EE0 A;  2I5H A;  2UVR A;  4K4I A;  4NLZ A;  1P7D A;  1FFV A;  5JUM A;  4NV0 A;  4O5K A;  3PX4 A;  1PUZ A;  1TAQ A;  3T5J A;  2HHT A;  1BPZ A;  1NJY A;  3ZDC A;  2EH9 A;  4KLF A;  1KLN A;  2UVU A;  2BQU A;  4BJQ A;  1A76 A;  4ED3 A;  5G5G A;  1X6I A;  4QW8 A;  2BZF A;  4C8O A;  2GWS A;  2W9B A;  5GTH U;  1D8Y A;  4ECV A;  4MEY A;  5D46 A;  1JIH A;  4ECQ A;  8ICV A;  4MHV A;  1L8O A;  1Z00 A;  5J0P A;  4DL7 A;  2JZB A;  4KX5 A;  2R8H A;  4RQ1 A;  3RBE A;  5F9N A;  4F4K A;  3C23 A;  4P4M A;  9ICC A;  1DXS A;  3ISB A;  8ICC A;  4GC6 A;  1OW5 A;  2FPM A;  3IM1 A;  4C4R A;  2PFP A;  4KLE A;  2YMQ A;  1F44 A;  3V72 A;  2ZJ5 A;  3ORY A;  1COO A;  4R65 A;  1V85 A;  1TAU A;  4DFK A;  3SR6 A;  4XUS A;  4QZB A;  2DKX A;  2XI9 A;  4X5V A;  1JXL A;  3UM9 A;  5C0Y A;  2W8L A;  4FZL A;  3IDW A;  1ZQI A;  4UBB A;  3V6K A;  4F3O A;  5KFH A;  2R18 A;  3C2M A;  2W54 A;  4ED2 A;  4C7Y A;  1XSL A;  9ICX A;  1FO4 A;  1T3N A;  4UAR A;  3IP4 B;  3KOO A;  5DBB A;  1FEZ A;  2OHF A;  5AIA A;  2XC9 A;  2A19 A;  1KKX A;  3GIL A;  4RPX A;  3GIJ A;  2FJ6 A;  3EUB 2;  5J29 A;  4RQ0 A;  3IHQ B;  1D9F A;  2ZIW A;  4O0I A;  1S10 A;  3ZDD A;  3NVW A;  3AU6 A;  5ALM A;  2LYH A;  3KBB A;  3SEI A;  4JV2 A;  3BS5 A;  4YP3 A;  2DGZ A;  5DGB A;  3K1R B;  4DL3 A;  3RB6 A;  4OJL A;  5K4L A;  5L1M A;  4JWN A;  2Y9T A;  4UB8 U;  5AM3 A;  7ICO A;  1ZD2 P;  3MFI A;  4CDG A;  4GC7 A;  3GDX A;  4F93 B;  4M9L A;  3RH6 A;  4UAU A;  4E0D A;  2PI5 A;  3PX6 A;  4USA A;  2F1I A;  1SKR A;  2ZTC A;  3N7R C;  2KJ5 A;  1ZQM A;  5KFG A;  1SIJ A;  3TFS A;  2LYB A;  4DL6 A;  3PO5 A;  3NUQ A;  9ICI A;  1Q46 A;  1ZD5 A;  1U48 A;  4EBC A;  2A1J B;  3CYM A;  3QU5 A;  2H3I A;  4NLG A;  5ALG A;  4YMN A;  4CF3 A;  1KFD A;  3V7K A;  1X9S A;  7ICE A;  3I76 A;  2XIC A;  4CF4 A;  4Y2Y A;  1Z3E B;  2ZUD A;  1S8O A;  4DL2 A;  3M8R A;  1ZQD A;  4KX3 A;  5KFF A;  1ZQG A;  3Q8K A;  1SKW A;  3OHA A;  4OCZ A;  4J9R A;  1X9X A;  8ICR A;  4I2G A;  4FS1 A;  4ED1 A;  5AKG A;  2BDU A;  1GO3 F;  2EDU A;  5AM5 A;  4C8M A;  4O5E A;  2E8P A;  1UA1 A;  7ICQ A;  2ES6 A;  3ETL A;  4I2E A;  1ZJN A;  4RQ4 A;  2FMP A;  2AQ0 A;  4QZ9 A;  4B9U A;  3WK5 A;  4AP9 A;  2PKE A;  3M7D A;  1U49 A;  5CWR A;  3J81 j;  4M9N A;  1Z4O A;  4I2C A;  3KHR A;  2W9M A;  4DFP A;  1KSP A;  3L5K A;  3LVV A;  1ZOL A;  1NKB A;  1NZB A;  1S0N A;  3PW7 A;  9ICL A;  1UQV A;  2DBY A;  2DQN B;  5AIC A;  3RR7 A;  4PZO A;  1N48 A;  1D8L A;  5ALH A;  3OGU A;  1RXW A;  2R8G A;  3HKZ C;  2KSO A;  3FM9 A;  1Z1V A;  4IQT A;  2FLP A;  2LBO A;  2CPR A;  4O9M A;  8ICK A;  5FP0 A;  4F2S A;  3QNM A;  3G6Y A;  3MBY A;  3ISC A;  5AIB A;  3DEE A;  4TUS A;  2XCA A;  2YMM A;  4UB6 U;  4YD1 A;  4YXM A;  3GU3 A;  4DSI A;  4GXI A;  3C2K A;  1S76 D;  5ALD A;  4I28 A;  5AKZ A;  4IRD A;  3CRX A;  2EAP A;  1ED1 A;  4QZD A;  4KLU A;  2GO7 A;  3RTV A;  2JR5 A;  2JMG A;  5BPC A;  3S6J A;  1L3U A;  1L3S A;  1ZQN A;  4KLQ A;  1YZ6 A;  4DSE A;  1Y88 A;  5J0U A;  1NK7 A;  4MFA A;  4DLG A;  1L7N A;  5KFN A;  2HSZ A;  3M9N B;  4RUC A;  2F8L A;  3ZDB A;  3UQ0 A;  4MF8 A;  3OJS A;  4M6W A;  2RDJ A;  4KMO B;  3TAN A;  2HBM A;  1BNO A;  3JPN A;  2PFN A;  4TUP A;  2JH1 A;  1NNL A;  2UVV A;  1X2I A;  4BDP A;  1WG8 A;  4EEK A;  1COK A;  1ZQY A;  4EEY A;  1B22 A;  1N62 A;  4I2H A;  5HP4 A;  1V9P A;  2OXO A;  4EZ9 A;  2ZUB A;  1UHU A;  2XY5 A;  1A0P A;  5ALL A;  5A0L A;  2A3V A;  2FPL A;  4O3O A;  3T79 A;  2KNJ A;  2W04 A;  2N1R A;  2G0A A;  3GIM A;  2W55 A;  2JEJ A;  1IV8 A;  1SWW A;  3UXN A;  1N61 A;  3LVW A;  3OPX A;  1LKY A;  3E2E A;  3SV4 A;  1ZQF A;  4ECY A;  1QSY A;  4RQ3 A;  4UAY A;  4P0P B;  3B0X A;  4F4X A;  2BQ3 A;  3NRW A;  2R8J A;  1SXE A;  2K89 A;  4C4T A;  1ZQC A;  2WF5 A;  5DDM A;  5DGA A;  5KFE A;  1NK5 A;  4JWM A;  7ICH A;  2IBK A;  4G9B A;  3G6V A;  4M2Y A;  2WTF A;  2KP7 A;  5HMM A;  4RT3 A;  1U4B A;  2MUT A;  1S77 D;  2OWO A;  3TKA A;  1U45 A;  3T5H A;  3MDA A;  1WYG A;  3LDA A;  3EZ5 A;  4NWI A;  3WK9 A;  4P0Q A;  4J9L A;  2I6X A;  2K8C B;  2BR0 A;  3PR4 A;  8ICB A;  1VJ5 A;  1RXV A;  1UPH A;  3SQI A;  2ZIV A;  1BGX T;  2HCF A;  3HRD D;  8ICP A;  5AKY A;  2ZIU A;  2EQY A;  5CEH A;  5J2F A;  4RQ7 A;  3QU7 A;  3K1Z A;  1ZYQ A;  1ZQ1 C;  4KN7 A;  5EOZ A;  3A0B U;  2D3D A;  3JPR A;  4NJ8 A;  5KG3 A;  3M9M B;  2DKZ A;  3RFA A;  2KZM A;  5HR7 A;  2B6G A;  3WK6 A;  4QWA A;  3PST A;  1K1Q A;  1IG6 A;  1ZQX A;  2J6S A;  2R8K A;  9ICA A;  4BWM A;  5TIS U;  1RYS A;  3M1Y A;  3GII A;  2D8C A;  1XU4 A;  2LPE A;  2ISP A;  1N60 A;  2FE9 A;  4BWJ A;  3RJG A;  2HHU A;  2NRX A;  2PMZ C;  1QCK A;  1PZN A;  4AYB F;  3PW4 A;  4RT2 A;  3UMB A;  3FC4 A;  2YTU A;  3KD3 A;  4DWI A;  4P4O A;  3SI8 A;  3UXO A;  5CR0 A;  3TAQ A;  2LM1 A;  9ICT A;  4PL2 A;  4KLT A;  2RRD A;  2G09 A;  4QIW C;  3SAF A;  5IIL A;  2LI6 A;  2ISO A;  3H4D A;  3QEA Z;  4DF4 A;  3H8J A;  3PMN A;  3EPG A;  5L1I A;  1RYR A;  3Q8P B;  2F76 X;  4CNQ A;  1TKD A;  1ZQV A;  5KFZ A;  3HJE A;  1PK1 A;  5L9X A;  1XWL A;  4ZH4 A;  3PNC A;  2DUY A;  5J2C A;  2AGQ A;  7ICN A;  3NVV A;  4F91 B;  4F4W A;  7ICK A;  2HOI A;  3FDS A;  2OYY A;  4I2D A;  1ZQE A;  4YXJ A;  4DS5 A;  1XO1 A;  2M9N A;  3M9O B;  4ACO A;  5DBA A;  2UVW A;  2HHW A;  4ED7 A;  3N4M B;  5KFV A;  2QAR A;  3GQC A;  3UXP A;  4P4P A;  3SD7 A;  8ICW A;  1UCV A;  5AI0 A;  3BQ1 A;  3UMC A;  2ZTD A;  4ECX A;  2VIX A;  3QEB Z;  5AI5 A;  1LB2 B;  2P6R A;  3G6X A;  3PY8 A;  4F50 A;  4QWD A;  3H8S A;  5HML A;  4F4Z A;  5ALV A;  4I29 A;  2KV2 A;  3ZD8 A;  2H3Q A;  4YD2 A;  2W9C B;  1U9L A;  8ICE A;  4EEL A;  1XO0 A;  4I2F A;  2KHV A;  1D8B A;  3ZI4 A;  5J2E A;  1ZD4 A;  3TAR A;  3GV5 B;  5J2J A;  2HBL A;  2EAM A;  1DK2 A;  3AU2 A;  1ZQU A;  4TQS A;  5DB9 A;  3SAG A;  1MSW D;  4DO9 A;  4YMO A;  4PGQ A;  1DRG A;  5DB7 A;  4MFF A;  3F5E A;  1K5O A;  3Q8R B;  1SGG A;  3PW5 A;  3MDC A;  5KFI A;  2EAN A;  3H8M A;  4B9M A;  2BCQ A;  5KT7 A;  3LYS A;  2ZUC A;  4LVS A;  5D49 A;  1PVQ A;  4DFM A;  3WU2 U;  2HMX A;  4F2R A;  3Q8L A;  2AXT U;  2WF6 A;  2E1F A;  3MAB A;  2BGW A;  4M9H A;  3I28 A;  4UQG A;  5JTI A;  1QQ5 A;  2K8B B;  5KFR A;  4QZF A;  5EE3 A;  5J2G A;  1KTQ A;  9ICU A;  2XVT A;  3SAH A;  1C7Y A;  3AEV A;  4KLO A;  8ICS A;  1SV0 C;  3HX0 A;  1VLB A;  4RUA A;  3PX0 A;  3IG8 A;  1NKC A;  3C1Z A;  1RZT A;  5KFY A;  4FBU A;  5DQG A;  4O3M A;  5L1J A;  3F2B A;  2HDO A;  1ZQA A;  2FLN A;  2KTQ A;  5CRX A;  8ICY A;  2B0C A;  2F3N A;  2EZY A;  2VKQ A;  3MGH A;  4F5O A;  3UQ2 A;  4DSF A;  5KT2 A;  2F1H A;  9ICS A;  3ED5 A;  2O6K A;  5HNK A;  5G5H A;  5KG0 A;  2HHQ A;  2BPF A;  4JUZ A;  2D6F C;  3FYH A;  5KT3 A;  3TAD C;  2IOF K;  4R66 A;  9ICE A;  3ISD A;  2E8O A;  2L5Y A;  2OH2 A;  4O3S A;  1M6Y A;  2ZJ8 A;  8ICU A;  4LJX A;  2HI0 A;  1UT8 A;  2HBJ A;  1DGJ A;  4PGX A;  8ICG A;  1YT3 A;  2P35 A;  4ECT A;  1TK0 A;  4C7Z A;  3RH5 A;  2K4H A;  5IIJ A;  2XID A;  3HIL A;  4RPY A;  4RNM A;  4K4G A;  2KG5 A;  1BPD A;  4R64 A;  2KIW A;  2W3R A;  4YFK A;  1HIW A;  4UW9 A;  3V6J A;  4Y2S A;  5CA7 A;  2JRZ A;  4US8 A;  3NVZ A;  1URJ A;  1ZQJ A;  4TUQ A;  1K1S A;  1KRP A;  2OM6 A;  3QUC A;  4GXJ A;  3THV A;  2WAQ F;  3IN5 A;  3NAS A;  2NO5 A;  8ICF A;  2OEH A;  4FE3 A;  3BQ2 A;  1H38 A;  4XQ8 A;  2KIC A;  1QTM A;  9ICP A;  3JPO A;  2J6U A;  3D2N A;  4M04 A;  1D9D A;  2FLL A;  2ALZ A;  1X9W A;  1Z19 A;  3QU4 A;  4J03 A;  1XS9 D;  1ZQL A;  2NRV A;  4I2B A;  4IQW A;  3B0Y A;  3RB4 A;  4UB1 A;  5AM4 A;  3K4G A;  4FO6 A;  4ECZ A;  4U7C A;  2LYA A;  2KZZ A;  2IA6 A;  4DSL A;  4RQ6 A;  2HHV A;  4UBC A;  3TAC B;  3H0L B;  2W7O A;  4IS7 A;  4BXO B;  2ZXI A;  7ICP A;  3PR5 B;  9ICM A;  3WK7 A;  4QW9 A;  5AI6 A;  1ZQW A;  4IQV A;  1X40 A;  2YB4 A;  3EYZ A;  1Z4N A;  1J97 A;  1NK9 A;  1NJX A;  4MEX A;  1ZRN A;  2E8M A;  3UPQ A;  5DLG A;  5KFA A;  2E8N A;  5DQI A;  1RM6 C;  4CGZ A;  2ZG6 A;  1TFR A;  5KL8 B;  2FMS A;  2DWQ A;  1YZ7 A;  2QLT A;  4KLJ A;  4UAT A;  5AK3 A;  1QLN A;  1U47 A;  2G08 A;  3TAD A;  4KLI A;  2FMQ A;  3KHH A;  3PO4 A;  2PFQ A;  2F1J A;  4F4Y A;  3L3F X;  2K60 A;  4M0A A;  4HAI A;  2WF9 A;  4QZ8 A;  1SB3 C;  4GFJ A;  2XO7 A;  1X9M A;  3MGV A;  1FFU A;  4QJF B;  1J2N A;  4QZH A;  4QZG A;  4BGD A;  2KJ9 A;  4R8U B;  5ALT A;  5ALI A;  2KHQ A;  1S9F A;  3MFH A;  5KFM A;  5AK5 A;  4B9V A;  5KFD A;  4KLH A;  3EWA A;  5KFJ A;  5ALR A;  3C28 A;  2VJ4 A;  4PHA A;  3KZX A;  1S0M A;  1B43 A;  1PVR A;  4ELT A;  4PHP A;  8ICI A;  2YMP A;  5ALJ A;  2MRL A;  1O03 A;  1NK8 A;  4DOB A;  3GFK B;  3T5K A;  1OXJ A;  2B21 A;  3WK4 A;  2HOF A;  2JH7 A;  1L7O A;  5TZV A;  5F3X B;  1NJZ A;  9ICB A;  3RAX A;  3JPQ A;  4NLC A;  2IHM A;  8ICJ A;  2E3T A;  4MF2 A;  2AU0 A;  2R8I A;  3EPI A;  3SEN A;  3TI0 A;  1NI3 A;  4EX6 A;  1BNP A;  1WCL A;  1TE2 A;  5KFC A;  3AQE A;  2AQ4 A;  1LV5 A;  4ICA A;  5J2A A;  4Y2P A;  2XGP A;  1ZQQ A;  1ZJM A;  3QYP A;  3DV9 A;  4BUG A;  3RAQ A;  3ICX A;  4RQ5 A;  2QB0 B;  4IR9 A;  3Q8M A;  5AK6 A;  5BOL A;  3E58 A;  3H7I A;  2ZIX B;  3MC1 A;  4EEN A;  3LWM A;  5D4B A;  1TV9 A;  2BCR A;  1EXN A;  2P66 A;  1A77 A;  4AYB C;  5DG8 A;  4YQW A;  4RQ2 A;  4Y2V A;  5KL1 B;  5J2I A;  3CW2 C;  3MR5 A;  1SZH A;  1X66 A;  4DFJ A;  2IMW P;  3C5F A;  2KE7 A;  2G07 A;  3RJH A;  2MA1 A;  4RNN A;  3CNH A;  1XSN A;  5EWF A;  2H3Z A;  3RB3 A;  3OSN A;  2XY6 A;  4R63 A;  2Y1J A;  3JPP A;  5AI8 A;  4O3R A;  1T8E A;  2HOQ A;  4DQI A;  2ODG A;  4Q8F A;  4NL9 C;  9ICH A;  3NVY A;  2CXY A;  2FI1 A;  1BPX A;  8ICX A;  3RRH A;  5EWG A;  3Q8Q B;  1WWV A;  3TQ1 A;  2RDI A;  3BQ7 A;  1L8L A;  1Q3U A;  2BHN A;  4ED0 A;  4RNO A;  2LKY A;  2MAX A;  2W11 A;  4QZI A;  5B5E U;  4DL4 A;  2BKE A;  2Q0Z X;  4Z6D A;  5C5J A;  1SL2 A;  8ICM A;  3RBD A;  4PHD A;  3C5G A;  5L1K A;  5EWE A;  2ASJ A;  3ETR A;  2WHE A;  1RPL A;  2KIV A;  2MSN A;  4YMM A;  3WKA A;  4KIT B;  4YR0 A;  4UB2 A;  5B66 U;  4PGY A;  3GIK A;  4LZG A;  2DF4 B;  3H0M B;  1ZQB A;  4IQU A;  2YQE A;  3QU9 A;  2QB1 A;  5ALY A;  5AKI A;  4P2H A;  2GH1 A;  5ALS A;  2KD1 A;  4IL6 U;  4DFD A;  7ICL A;  1OUQ A;  3PSF A;  2NYV A;  3B9J A;  3F2D A;  9ICJ A;  3MGI A;  3PVX A;  1KDH A;  1X42 A;  2W9B B;  1ZQK A;  4ELU A;  1PVP A;  5J2H A;  4YR3 A;  2LMR A;  1Z00 B;  2JZB B;  3SYZ A;  4IR1 A;  3T3F A;  2Y0S F;  3JPT A;  3RB0 A;  7ICI A;  3AM9 A;  4BX9 C;  3RR8 A;  2VJ5 A;  4DQS A;  3L4P A;  4F5Q A;  4EX7 A;  5ALX A;  3RJK A;  5KFX A;  1N63 A;  3UMG A;  3AQF A;  3EW9 A;  3QUQ A;  3F53 A;  2BPG A;  5AKK A;  4EZ6 A;  2K4E A;  1N2X A;  1L5U A;  5KG2 A;  5KTQ A;  3V7L A;  2QKQ A;  3H8W A;  5AKL A;  4KLS A;  1RDF A;  2G5H B;  3AUO A;  4DSJ A;  5J2D A;  1KBU A;  2KOB A;  3T5L A;  2BCV A;  1CEZ A;  1CI4 A;  4M9J A;  2H3F A;  5J0W A;  9ICG A;  4NL9 A;  2YN4 A;  2ZIW B;  4RQM A;  4YG2 A;  3IRU A;  1WCN A;  8ICL A;  4B6J A;  5IIM A;  2F44 A;  4O3N A;  2EZX A;  3C21 A;  1N5W A;  3BS5 B;  2ATL A;  9ICO A;  5E79 U;  2AGP A;  3I1Y A;  1NK4 A;  2M0N A;  3QUB A;  1SKS A;  4RQN A;  3PW2 A;  2KFZ A;  2H5X A;  4Q8E A;  4WJ3 B;  1DGS A;  3QZ7 A;  2YY6 A;  7ICR A;  3BZK A;  4YN4 A;  5DG9 A;  1A6S A;  2KEY A;  1QSL A;  4J9P A;  3RJJ A;  5AM2 A;  3GV8 B;  1TAM A;  5KG7 A;  5KFB A;  4C0Z A;  5CP2 A;  7ICF A;  4QWC A;  4Q43 A;  5IIN A;  5DDY A;  4ECR A;  5J8Y C;  4J9M A;  2VA2 A;  2E1E A;  5ALP A;  5KAI U;  3ZDA A;  5J2K A;  1DOQ A;  9ICR A;  2Y1I A;  4ELV A;  2PMZ F;  1RQL A;  2HBK A;  3BZC A;  2GLE A;  2K4I A;  3M8S A;  2PXI A;  3BQT A;  2DFL A;  3TFR A;  2KFN A;  1KL9 A;  1CUK A;  5KG5 A;  4QIW F;  1ZXI A;  3KTQ A;  9ICV A;  4Y2U A;  2JV3 A;  1RYU A;  3TAP A;  1L7M A;  2KZ3 A;  2KKV A;  4G3I A;  2AGO A;  1MQ3 A;  4DOC A;  1T94 A;  5DB6 A;  1WUD A;  2HVI A;  2F8K A;  4C8N A;  3PML A;  2WAQ C;  2AH5 A;  4QWB A;  1L7P A;  3R9K A;  4C80 A;  4PZN A;  4I2J A;  1ZQS A;  2HHS A;  3QXG A;  3D2Q A;  4CE6 A;  1TK8 A;  1BPY A;  4Q45 A;  2RQ5 A;  2JXJ A;  2K8A A;  2CN1 A;  2EZZ A;  2BDP A;  4EYI B;  4A8E A;  3FAH A;  3N97 B;  2W43 A;  4KMU A;  1ZD3 A;  1QSS A;  8ICH A;  2VAN A;  2KSO B;  2WB1 F;  2V4Q A;  2G06 A;  5KFL A;  2C2E A;  3WKC A;  2KMD A;  1L6N A;  4KN4 A;  2KJ8 A;  1XC9 A;  2H3V A;  5KG4 A;  1SWV A;  4F72 A;  2E5S A;  4CF5 A;  3ONN A;  3AL0 B;  2DPJ A;  3WK8 A;  1T4G A;  5JU5 A;  8ICT A;  5ALO A;  2IOF A;  3GV7 B;  5KFW A;  2WF8 A;  5T14 A;  1KQQ A;  4CRX A;  4NLK A;  1XNS A;  4UAW A;  5AHX A;  2P6U A;  4TQR A;  1S0V A;  5KAF U;  1JMS A;  1NKE A;  4J9K A;  2RHF A;  4OD0 A;  1JX4 A;  5GTI U;  1JI7 A;  4RQ8 A;  5J8Y A;  9ICF A;  2KVS A;  4OJO A;  4JMU A;  5IIO A;  1B4F A;  2NO4 A;  4NM1 A;  4NLN A;  2W9C A;  2WF7 A;  2ZJA A;  4OJ5 A;  2G5I B;  3QUT A;  3ZD9 A;  5KNI A;  3AMZ A;  4M6W B;  2HHX A;  4EBE A;  2IOH A;  1JAL A;  1NK0 A;  3O0F A;  5ALE A;  1HUZ A;  5KFT A;  3H40 A;  2GOL A;  4KLM A;  4KLD A;  7ICJ A;  2VA3 A;  4XA5 A;  3IV6 A;  4O5C A;  3C29 A;  4DF8 A;  4NM2 A;  2C22 A;  3WKD A;  5ALN A;  1KW4 A;  3PSI A;  2NRZ A;  5IIK A;  3QZ8 A;  1NZP A;  4FZN A;  3HT3 A;  3F2C A;  4B9T A;  2HVH A;  3C2L A;  5III A;  4J9N A;  2W8K A;  4C8K A;  3RJI A;  2AJQ A;  2HW3 A;  1NK6 A;  4F92 B;  4DS4 A;  4I2I A;  1SV0 A;  2W9A A;  4UAS A;  2BCS A;  5AM0 A;  4HYK A;  1SV4 A;  1LKY B;  4YVZ A;  4J9Q A;  4Y2T A;  3LWL A;  3OJU A;  2JHD A;  3NS1 A;  1ZQO A;  2F77 X;  1JRP A;  3C1Y A;  5KT6 A;  4DQR A;  1UT5 A;  5DQH A;  1SZP A;  1HEK A;  5J0S A;  4JV1 A;  2J6T A;  1S0O A;  2NRW A;  3N7P D;  5DKW A;  5KFS A;  4ED8 A;  3V6H A;  4Z6F A;  2C2D A;  7ICU A;  5AK4 A;  3U26 A;  4I27 A;  3HW8 A;  2JGA A;  3NGD A;  4K4H A;  4FZM A;  4PJ0 U;  2MUT B;  4UAZ A;  2W3S A;  1N5X A;  5KG1 A;  3RH4 A;  3NTU A;  2ZXH A;  3CP8 A;  3PSP A;  2YML A;  5J0X A;  5ALU A;  5J0Y A;  8ICQ A;  4P0Q B;  4FS2 A;  1SXD A;  5DG7 A;  4LZD A;  4FBT A;  9ICK A;  4U6P A;  4F71 A;  3V7J A;  5ALZ A;  2ZIV B;  5ALQ A;  1SL0 A;  7ICV A;  2ZIU B;  5AKH A;  1S5L U;  2MU2 A;  5ALK A;  2KVC A;  5ALW A;  4EBD A;  3AN1 A;  3A0H U;  1O08 A;  1ZQH A;  4DSK A;  1MQ2 A;  4ECS A;  7ICS A;  2ASD A;  3BJY A;  2Z7J A;  1F0M A;  3KFU F;  2FDR A;  3KHL A;  4FFD A;  1JXE A;  2DPI A;  1WWU A;  9ICN A;  3OSP A;  3PW0 A;  9ICQ A;  3M6Z A;  4EYH B;  4NLB A;  5J0Q A;  4B9N A;  2C28 A;  1ARO P;  1MC8 A;  5H2F U;  2A1J A;  4Y2R A;  2JEI A;  1HUO A;  2A1A A;  4GIB A;  2XY7 A;  2BQR A;  3BDP A;  4NY8 A;  2KKP A;  8ICN A;  5DB8 A;  3BQ0 A;  4PH5 A;  2YX8 A;  3HWT A;  4F5P A;  3BS7 A;  1IIP A;  2KK0 A;  1JRO A;  3SV3 A;  3QU2 A;  2LHT A;  4F5R A;  3H0R B;  2V9W A;  1QQ7 A;  1ZQZ A;  4UB3 A;  4M9G A;  5ALF A;  4J9O A;  1PK1 B;  2XCP A;  1UA0 A;  4O3Q A; 
#chains in the Genus database with same CATH homology
 1UPH A;  2Q4T A;  2ZIV A;  3SQI A;  4OJO A;  3KZX A;  2XVT A;  3IP4 B;  3M7D A;  2JH1 A;  2HOQ A;  2F2A B;  3HKZ F;  4JMU A;  2ZIU A;  3D2N A;  4OJ6 A;  4QIW F;  1PVR A;  2ZXH A;  3CP8 A;  3PSP A;  1Z1B A;  2MRL A;  5HR6 A;  4OJ5 A;  2G5I B;  2KKV A;  4P0Q B;  3K1Z A;  1Z19 A;  2Y0S C;  1ZQ1 C;  3LVV A;  2VIX A;  2G5H B;  2ZIW A;  2HOF A;  2JH7 A;  1T94 A;  3IG8 A;  5HR7 A;  3RFA A;  1WUD A;  1NZB A;  1KBU A;  2KOB A;  4U6P A;  3O0F A;  2OXO A;  4O3M A;  2DQN B;  1Q3U A;  2ZIV B;  3PST A;  2WAQ C;  3F2B A;  2LKY A;  2KV2 A;  2ZIU B;  5CRX A;  2H3F A;  4U7C A;  2LYA A;  4OO1 J;  2GOL A;  2H3Q A;  2VKQ A;  3PZP A;  2DGZ A;  3D2S A;  4NLC A;  4PL1 A;  2KVC A;  3D2Q A;  1XO0 A;  1P7D A;  3HKZ C;  1A0P A;  4OJL A;  3H0L B;  3C29 A;  2KHV A;  2ZIW B;  4NV0 A;  3VC8 A;  2W7O A;  1CRX A;  5A0L A;  2ZXI A;  2A3V A;  1D8B A;  2LBO A;  2K8A A;  3RF9 A;  3T79 A;  4CDG A;  3M6K A;  2CPR A;  2CN1 A;  2PMZ C;  3N7S C;  2KNJ A;  2W04 A;  2D6F C;  3PSI A;  2Z7J A;  3VCB A;  4A8E A;  2N1R A;  3AQE A;  4FZN A;  3SAH A;  3F2C A;  2G0A A;  3E0F A;  3KFU F;  3IG5 A;  4AYB F;  4ICA A;  2HBL A;  2YB4 A;  4BJQ A;  2ZIX A;  2OH2 A;  2DF4 B;  3LVW A;  3OPX A;  1ECW A;  3DEE A;  1Q3V A;  3H0M B;  3N7R C;  4CGZ A;  2KJ5 A;  2M0N A;  4P0P B;  2WB1 F;  3SMV A;  2LYB A;  3NUQ A;  2GH1 A;  2G06 A;  2HBJ A;  2KD1 A;  2ZG6 A;  3GU3 A;  4BUG A;  3ICX A;  3M6Z A;  3SAG A;  5KL8 B;  3NRW A;  4NLB A;  3CYM A;  1OUQ A;  4WJ3 B;  4PL2 A;  2RRD A;  2G09 A;  4QIW C;  4P0P A;  3SAF A;  1YT3 A;  2H3I A;  3PSF A;  2NV3 A;  1L6N A;  1DRG A;  2K89 A;  2KJ8 A;  3F5E A;  4KX5 A;  1A6S A;  2K4H A;  2YB1 A;  3F2D A;  2H3V A;  2G08 A;  2KEY A;  2XID A;  3CRX A;  2ZIX B;  4QNL A;  1ED1 A;  1TAM A;  2E5S A;  2XIC A;  2JHD A;  2JMG A;  4AYB C;  2F77 X;  2KIW A;  3L3F X;  1HIW A;  4C0Z A;  1MA7 A;  1HEK A;  3ONN A;  2KKP A;  3AL0 B;  1PVP A;  3LYS A;  1F44 A;  3F5A A;  2F76 X;  4GFJ A;  2YX8 A;  3ALR A;  2E1E A;  3F53 A;  2WB1 C;  3N7P D;  4KX3 A;  5KL1 B;  3MGV A;  1PVQ A;  2W03 A;  2H3Z A;  1IIP A;  4CRX A;  5T14 A;  1URJ A;  2RP5 A;  3GZF A;  1SZH A;  4QJF B;  1XNS A;  2Y0S F;  2LHT A;  2XI9 A;  2HMX A;  2PMZ F;  2HBK A;  5C0Y A;  2KJ9 A;  4FZL A;  3H0R B;  2W7P A;  2OM6 A;  2HOI A;  4NWI A;  2F8L A;  2BDU A;  2E1F A;  2R18 A;  4P0Q A;  4BX9 C;  1GO3 F;  2G07 A;  2K4I A;  2KHQ A;  2OYY A;  2VJ5 A;  2MA1 A;  2JGA A;  2WAQ F;  2K8B B;  4OJP A;  3IN5 A;  4KMO B;  2RHF A;  2CRX A;  3AQF A;  2K8C B;  4FZM A;  4FE3 A;  4IC9 A;  4ACO A;  3C28 A;  2HBM A;  2KIC A;  2K4E A;  2VJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...