4M6WB

Crystal structure of the c-terminal segment of fancm in complex with faap24
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
190
Chain Sequence
HIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fanconi anemia group M protein
publication title Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 48
structure length 190
sequence length 196
ec nomenclature
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m6wB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m6wB01
9ICVA 4JV0A 2ISOA 3FDSA 4Q8EA 3ETLA 3TFSA 3KHRA 2ZUCA 5CJ7A 5J2FA 3MGHA 4O3SA 4EZ6A 8ICUA 4NLGA 1KFDA 2W8LA 4KN4A 1WCNA 2BR0A 4CCHA 3RJEA 5L1IA 5DG8A 9ICLA 1QSYA 3BDPA 7ICRA 2MUTB 4IRCA 5J0OA 3M9NB 4I2IA 3BQ1A 4GLXA 4I2EA 9ICGA 3K75D 2BHNA 3H8JA 3PO4A 4Q8FA 4DLEA 8ICLA 4B9VA 2M9MA 3Q8MA 3IHQB 4RZRA 3GV8B 3ZDAA 4RNNA 1QTMA 3RJJA 1JIHA 4PGYA 2C28A 3V6HA 4YQWA 4F91B 5L1LA 1S0OA 3C23A 4M9GA 4O3RA 5IIJA 5KFZA 1KFSA 4F50A 1IXRA 3C2KA 2BQRA 4M9JA 4J9OA 4ED1A 5BOLA 9ICUA 2IMWP 2W8KA 3FYHA 4Z6EA 2M9NA 4GC6A 1SL0A 8ICCA 3MFIA 4RU9A 4TURA 1QSLA 3RJGA 4O9MA 4TQSA 9ICCA 9ICOA 3JPOA 3ISBA 5KFTA 3V7KA 2XC9A 2VA8A 2FLLA 1KRPA 2P6UA 1N48A 5D46A 3MR2A 3QEAZ 1ZQNA 4KLLA 4FS1A 3TFRA 1X9MA 2HW3A 4B9UA 9ICXA 3GDXA 1H38A 4M9NA 3IM1A 4DSKA 4MF2A 1B22A 8ICKA 1HJPA 5EWEA 1A77A 4YG2A 3PMLA 2BCUA 5HMMA 1DGSA 3RJHA 5KFGA 4KITB 2JEJA 4P4OA 2I1QA 2IBKA 5J0UA 1ZQWA 4F5NA 1SL2A 8ICXA 5J2HA 4QZ8A 2DPIA 1J22A 1N56A 4F2RA 2HHTA 3T5KA 1NK4A 2AQ4A 3RB6A 3KHGA 1JXEA 5CWRA 3BJYA 1TAUA 3M8SA 3RBDA 3V7JA 4DLGA 4KTQA 5KFVA 1ZQTA 4ED3A 5CR0A 5J0PA 4BXOA 1KLNA 4TUPA 4KLGA 1XU4A 3M9OB 3TAQA 4BGDA 3GV7B 5KFYA 4QW8A 3H4BA 5KG0A 2DPJA 1ZQHA 3QZ7A 3C1ZA 5KFQA 3SZ2A 2R8IA 3EPIA 1U48A 1TK5A 1XC9A 3RAQA 2UVUA 4PHDA 2A1JB 8ICFA 1BPXA 7ICHA 1ZQVA 1BPEA 4UB2A 7ICUA 1KFTA 5KFIA 4M9HA 5DLFA 9ICTA 7ICJA 4YXJA 3Q8QB 4EYIB 3G6XA 5J2BA 5DG7A 1Z00B 2FLNA 4ELUA 5KFOA 9ICPA 4QWCA 1HUZA 1ZQXA 5HHHA 1NJWA 1AROP 5DKWA 4P4PA 3JPNA 3GFKB 3SV4A 5DQHA 4HYKA 2NRXA 4DF4A 4KLIA 2KTQA 3AUOA 4RQ0A 2LYHA 4JK1A 4P4MA 4UAYA 2Y1IA 4B9LA 4RQ5A 2P66A 1NOMA 4DSLA 3ZDDA 2XGPA 5J2IA 1BPBA 9ICBA 4RPXA 2AGQA 4F8RA 1UT5A 4ECZA 5IIMA 4I27A 4RNOA 8ICSA 3V7LA 2BPCA 4O3PA 2FPMA 4F93B 3MGIA 1ZQEA 2FMPA 4EBEA 7ICGA 4DQPA 4I2GA 5KG2A 5CA7A 1NJZA 4JV2A 3HPOA 4R8UB 4M6WA 1DOQA 5DGAA 2ZUBA 4GXKA 2PI5A 2UVRA 3N4MB 4I2HA 2PFNA 3KTQA 3ZDCA 4NY8A 2AQ0A 4MEYA 2XY7A 3V6KA 1ZQUA 1BGXT 4PPXA 1L3UA 4YR2A 4GXJA 3MR6A 1L5UA 5HHIA 1UA0A 4QWBA 1S0MA 3RB4A 1ZQSA 5IIOA 4Z6DA 3PV8A 5J0QA 3RJFA 2BCRA 8ICWA 3UQ2A 3RJKA 8ICHA 3GIIA 4QWAA 4K4IA 4JWMA 3Q8PB 2W9AA 5J2GA 4O3QA 3TAPA 9ICQA 2XY6A 3TQ1A 4ELTA 9ICAA 4QZ9A 1JN3A 2BKEA 1T3NA 1LV5A 4JV1A 4F92B 3RAXA 1SKWA 3T5LA 4DSJA 5KG7A 3OJUA 3C2LA 4RUAA 9ICSA 2W9CA 2UVWA 1T8EA 7ICKA 1KEJA 3B0XA 4K4HA 5CHGA 1XWLA 1ZQMA 2HHQA 4F4XA 1SKSA 3GIJA 5KFPA 5KFLA 1V9PA 5KG4A 4QWEA 3T5JA 4I2DA 3K4GA 3HX0A 4ZH4A 4KLHA 3QEBZ 1RXWA 4R66A 4PHEA 4K4GA 3JPTA 2VA3A 1A76A 2BQUA 3B0YA 1ZQYA 4R65A 2WTFA 3EYZA 1BVSA 3AU6A 2C2EA 1K1SA 3GILA 3PMNA 1TKDA 3OHBA 7ICMA 4DL4A 4XUSA 3H8SA 5J0WA 5HP4A 4P0PB 5BOMA 8ICMA 2JZBA 3SYZA 5KFRA 1Z3EB 4IRKA 5KT2A 5BPCA 3OSNA 8ICZA 2BPGA 2JPDA 4NLKA 2ASLA 5KG3A 2ATLA 1X9WA 1XO1A 4DSIA 4RQ1A 2ZIWB 1ZQIA 3V72A 5J0XA 5J2JA 5KT7A 4UBBA 4TUQA 2V4RA 4YR0A 1XS9D 4DOBA 4KLJA 4EBCA 4LZGA 7ICLA 5KFHA 5KTQA 3ISCA 5HMLA 5J2DA 5DDYA 3H7IA 8ICPA 2I9GA 1SZPA 1L3TA 3TARA 9ICJA 3LK9A 5KFDA 4ECYA 4QZBA 4M04A 5CP2A 4NM1A 5EOZA 3KHHA 1MSWD 4YD2A 1L3SA 9ICHA 4RT3A 2W9BA 7ICEA 4XQ8A 3AU2A 4O3OA 5KG5A 4ECXA 4MF8A 4KLFA 1U47A 1NK0A 5HNKA 2JEGA 4I2AA 9ICEA 2J6UA 2F1JA 4P0QB 4F5RA 3EW9A 1S0VA 1TFRA 1ZQZA 4IQVA 3G6YA 3C2MA 3EZ5A 2UVVA 2ZJ8A 5CB1A 1PZNA 4UB3A 4DL7A 2BPFA 2C2RA 2BCSA 1TK0A 4NLZA 4F2SA 1NJXA 3C1YA 2J6SA 2BQ3A 2MAXA 1XSNA 4GXIA 2GWSA 3EWAA 4I28A 3ZDBA 5J0SA 4FBUA 7ICNA 1QSSA 2AGPA 4TUSA 3M8RA 4BWJA 4RQ4A 3PW0A 4BXOB 4F4WA 4YVZA 4UB5A 3RR8A 1S10A 2R8JA 2FPLA 4UQGA 1J23A 2AGOA 9ICWA 2JEIA 1K1QA 4QZIA 4DS4A 5F9NA 5DLGA 1NK9A 4J9SA 1XSPA 8ICBA 5KFEA 2R8KA 2PFOA 1U9LA 5DBCA 3EPGA 2ZTCA 2XCPA 3M9MB 4QZAA 3ZDEA 4YMNA 1L3VA 4B9NA 3PX6A 4KMUA 3JPRA 3QE9Y 4Q45A 3JPQA 1ZQJA 1S76D 4DFPA 4DS5A 7ICOA 2IHNA 4YMOA 4KLMA 4RQ7A 7ICPA 1LB2B 5KFKA 4DSEA 4M47A 1CEZA 4KLUA 1S97A 1KSPA 2PI4A 4DL2A 1SL1A 3T3FA 4I29A 2HVHA 2ASDA 4ED7A 4MFFA 3C5FA 1JMSA 4M2YA 2F1HA 4MFCA 2BDPA 2JNWA 3H40A 1RPLA 4QZEA 4RPYA 4DEZA 3T5HA 3RJIA 1C7YA 5KT4A 4IQUA 3C5GA 3LWMA 1NKCA 2OWOA 4E0DA 4B9SA 5KT5A 4DQQA 5L9XA 5J0TA 1MQ2A 2BCQA 3E2EA 3MABA 2BGWA 5DGBA 1NKBA 1ZQDA 2R8GA 2IHMA 8ICOA 3N97B 4C8KA 5KFJA 1WCLA 4DF8A 1ZQOA 4ED2A 9ICRA 4M6WB 4JUZA 2FLPA 4I2BA 4IR1A 1ZETA 3C21A 1RYRA 5DBBA 4YCXA 4TQRA 8ICIA 4ED6A 3PX0A 2KN7A 3UQ0A 1XSLA 4J9LA 5KFWA 1NJYA 1COOA 3OGUA 2KZMA 1TAQA 4QW9A 1BPZA 4KLOA 3H8WA 7ICQA 1J24A 1ZQFA 4XA5A 1ZQPA 2XY5A 5J2KA 3UPQA 4EYHB 1KTQA 4QZDA 3HT3A 3RRHA 3PY8A 4J9PA 4FBTA 4RT2A 5KFFA 3MR3A 3BQTA 3V6JA 4DWIA 2HHVA 4YR3A 7ICTA 1S0NA 2VANA 4ECSA 4FO6A 5DQIA 4Z6FA 4LVSA 4X5VA 4P2HA 2ZIUB 4EZ9A 4QWDA 4J9RA 1ZQKA 1MQ3A 2NRZA 4B9MA 5KT3A 5J29A 3OHAA 4C8OA 3RR7A 2FPKA 2W9CB 4KN7A 4F5PA 4DL6A 3MDAA 1ZQCA 1ZQRA 4QZCA 4KLTA 5J2EA 2XGQA 4DSFA 4I2CA 2W9MA 1ZQQA 2HVIA 4DQRA 5IIIA 3H4DA 4RUCA 1S9FA 4C8MA 8ICGA 3LWLA 2ASJA 2XO7A 3HW8A 4ECTA 2XCAA 3JPSA 3Q8RB 4DFJA 4ECQA 1D9FA 2MUTA 1SKRA 3JPPA 4O5KA 4RNMA 3RBEA 4Q44A 3ZD9A 4QZFA 4DO9A 5KG1A 4J9KA 1Y88A 4B9TA 3NTUA 4RQ3A 7ICIA 2KZZA 3PR5B 1TVAA 1IM4A 3HP6A 5L1JA 2VA2A 2JZBB 4F4KA 5DG9A 4DOAA 4YFKA 9ICMA 3PR4A 5DQGA 1TK8A 5KFXA 5DBAA 4JWNA 7ICSA 4RPZA 1ZQBA 3QZ8A 4BDPA 2KZ3A 4ECVA 4UAZA 3OSPA 4NLNA 5DDMA 4R64A 1D8YA 4DFKA 1NK5A 5KG6A 3RRGA 1U4BA 2HHUA 4KLEA 5J0YA 2KFNA 1J25A 4BWMA 4KLQA 2V4QA 1EXNA 7ICVA 4RQ2A 5DB8A 5D4BA 8ICVA 3NGDA 1T4GA 3PW4A 4M0AA 4IR9A 3PW2A 1T7PA 5KFNA 4QZGA 5KFBA 1D9DA 4EEYA 3Q8LA 7ICFA 2ZIVB 8ICNA 3Q8KA 5D49A 4RQ6A 4O5EA 5KFAA 3LDAA 4YXMA 2ZTDA 5J0RA 2W9BB 1D8LA 2R8HA 5DB7A 1JXLA 1ZQLA 8ICEA 3Q8SB 5KFMA 1S77D 2HHSA 1JX4A 2RDIA 4ECUA 4DL5A 2C2DA 1U49A 4NM2A 4I2JA 4UAWA 2ZJ5A 3GQCA 4PGXA 1ZJNA 4M9LA 4ECWA 3RTVA 5J2CA 4YD1A 1NK6A 3GIKA 2F1IA 4KLDA 8ICAA 5TZVA 2Q0ZX 5C5JA 2J6TA 4KLSA 3MBYA 3KHLA 5J2AA 2P6RA 4IRDA 3RB3A 1TV9A 4J9MA 4DQSA 4DL3A 2AJQA 1HUOA 2HHXA 9ICIA 3PW5A 9ICNA 5KFSA 3RB0A 4I2FA 2C22A 4J9NA 2IA6A 8ICQA 4F4ZA 1QLNA 5JUMA 4DQIA 3GV5B 4O5CA 4RQ8A 4F3OA 8ICJA 4DFMA 4EBDA 8ICRA 4UB1A 3SV3A 1ZYQA 1BPDA 4YMMA 3MFHA 4ECRA 2A1JA 4F5OA 2FMQA 4PH5A 1U45A 2RDJA 4DOCA 4NXZA 5L1KA 9ICKA 1KDHA 5KFUA 4ED8A 2ISPA 1UT8A 1NKEA 5DB9A 2V9WA 5EWFA 3ISDA 3UXNA 4IQWA 4UB4A 3BQ0A 3PO5A 2AU0A 3MDCA 1B43A 4YN4A 1Z00A 2ALZA 3UXOA 2B21A 5IINA 4Z6CA 4Q43A 4O3NA 4ELVA 4MEXA 4LZDA 4F5QA 9ICFA 8ICYA 3PX4A 4QZHA 2ZTEA 4UBCA 5EWGA 2BCVA 4PHAA 2ZUDA 1BPYA 3PW7A 3GIMA 1MC8A 2JEFA 1NK7A 4YP3A 4IQTA 4FS2A 1RXVA 3SI8A 4PHPA 3UXPA 3RH6A 5IILA 2ZJAA 5KFCA 2PFQA 4C8NA 2NRWA 1ZQAA 2KFZA 1RYSA 2FMSA 3THVA 2Y1JA 3MR5A 1X2IA 1X9SA 4J9QA 2DFLA 1ZJMA 3PNCA 3RH4A 5F9LA 2H5XA 3OJSA 4R8UA 1UA1A 3HWTA 5IIKA 1RZTA 2PXIA 2PFPA 4O0IA 3ORYA 4GC7A 3TI0A 4F4YA 1ZQGA 1CUKA 5KT6A 4ED0A 8ICTA 2ZIXA 2A1IA 5DB6A 4R63A 3RH5A 3BQ2A 3PVXA 4C8LA 4MFAA 2HHWA 3ZD8A 3TANA 2NRTA 1NK8A 4XRHA 4G3IA 3G6VA 4PGQA 2NRVA
chains in the Genus database with same CATH superfamily
4M8LA 1Z08A 3VC2A 1W30A 4TVOA 2ZYVX 4HGOA 1NFRA 3MT7A 4CCHA 1B15A 3S4YA 3BDPA 2J6CA 5J8YA 1I6KA 2A1TS 1WBDA 3H8JA 2DWUA 1P74A 5L1MA 2MSCB 2ZROA 4UARA 1PSZA 3V6HA 3OEEA 3T7KA 1IYZA 3M1YA 3GR6A 1Y7PA 4GI2A 4HLDA 1YB2A 3HJNA 2VHQA 3FKJA 4A91A 5A3QA 3PNOA 5E3IA 3VKHA 3I8SA 4UTZA 1H38A 1WUYA 3FJYA 1YS6A 5FFMA 1V8FA 4K9RA 4EUEA 3ZHOA 3IP8A 4FE4A 4KFUA 5TR9A 4BGEA 3KZ1E 3ACDA 2GLXA 2C3MA 3WP1B 5FUWA 3DL2A 1T24A 2XYRA 5BN4B 3JR3A 2LKCA 4OAPA 4IWNA 3FDZA 4EL5A 2YWCA 4Z7NB 3JWPA 1L5ZA 4HDKA 4B4UA 3N58A 3E4CA 3RVLA 2VJ4A 4MQUA 2ZRGA 3LDHA 1QV7A 3D59A 3IUPA 4MYCA 4I9HA 1OI3A 5CA7A 1LA2A 2KKVA 1NJ2A 1XQ1A 4UDXX 5KCMA 3SJCA 4R1PA 2WA2A 3I58A 1L3UA 1BIFA 1S0MA 2ZANA 2YICA 4BLPA 5FV7A 3RJMA 4AY5A 4JWMA 1HYGA 4YAOA 1X3SA 2E8NA 1TC1A 5C7IO 4I50A 3WGIA 3K94A 4Z54A 4QWEA 3AZQA 4HAYA 4R3UC 2YZMA 4OJPA 3WJAA 4O8ZA 5FUMA 5HP4A 3HILA 2DLCX 4BNGA 3TSOA 5E1BA 5GADl 5I47A 3GLHA 5T3UA 3EDQA 3DEZA 4JQOA 5KFHA 1GUYA 3ISCA 1PZGA 4RD1A 3U81A 1UPTA 1S0UA 5FHRA 2JGDB 3PENA 1YL7A 3S27A 2IJGX 3ESCA 1SELA 2BQ3A 3EMKA 1J0XO 4M0DA 2WU8A 2H2IA 3AJ8A 4IMRA 1FC0A 4UQGA 2YV1A 5IVPA 3NI2A 1P9LA 3ZGVA 3W3AA 3TMAA 5DBCA 4O2AA 1G6KA 3OM8A 2FOXA 4NXNB 3MF4A 5LOVA 4HLUC 1SU4A 5JZ9A 2BKAA 2YHBA 4HB3A 3OCWA 1WZIA 4KQKA 1AS2A 1K5GA 3ANTA 2E21A 1AK1A 4LXYA 5CHYA 2CDCA 5KSZA 3CWQA 4CUJA 3AL0C 3DZHA 3OOSA 2Z09A 4O4JA 4C7OA 4YLYA 5COBA 4WSOA 2XI9A 2VBIA 3DZ8A 2XY5A 1KZ6A 3VZCA 1IZ0A 4UU1A 1U0EA 4E09A 4KN8A 3EGWA 1ABEA 1TYCA 3DO6A 3GQBA 4I5DA 3QY0A 4JT4A 4DR4B 4ZVUA 3CNNA 3SJZA 1E1KA 2C84A 2DMRA 2QX8A 1LSSA 4BAUA 2PH3A 4LTNA 1IM4A 1GEGA 3G59A 5JH7F 1W87A 5COAA 1AA9A 3FD8A 4B44A 4NENA 5CJPA 4ITRC 1WAMA 2D1SA 4OYHA 1F4PA 4F56A 5DEIA 2R97A 1PQ4A 3WXMA 4D4LA 2JHAA 1EFDN 1P91A 1O94D 4TL8A 1JV2B 1QGUA 4ML3A 5SICE 3CW2A 1IZYA 1KC3A 2OXTA 1H2BA 1Q1BA 1XZAA 3BJIC 2DCMA 1XNGA 5JFGA 1G3UA 2CNLA 1FFDA 3U80A 5JZBA 2AJQA 2FMUA 4MR7A 2WQ6A 4MWCA 2IHTA 2DPHA 1PGOA 5TQ0B 2E4AA 4BB5A 3RU2A 1KOFA 5KYWB 2J31A 5DB9A 5LYYA 2R8XA 4YPOA 3KXKA 1JKXA 4OIFA 4F3RA 3ENNA 3VDXA 3CLUC 2P4HX 4DMGA 2IDJA 4O33A 3I2YX 2ZTVA 1AUXA 1D7AA 3L1VA 2ZT7A 5IILA 3MRXA 2WIJA 5KNIA 4HX9A 4AK9A 4N6NA 1KN5A 1BXRB 2YX8A 2YFKA 4P4LA 1J07A 5I9NA 3ONNA 1SVIA 2Q7DA 3T1QA 1Z5NA 1KY2A 3NTQA 4C0XA 2JCXA 5F5NA 1P39A 5HFAA 3BWVA 1L8QA 3I2KA 5ARDA 4E31A 1FBNA 4PYNA 1JJBA 4KQEA 3AUXA 4M1MA 3B7WA 4NR0A 3ESXA 3CKKA 4C4YA 4KAAA 3SZLA 5DGCA 5K99A 4F91B 4PAGA 4F50A 4NE7A 5LQNA 4A0HA 3PWTA 3JQPA 1TO1E 4YQEA 3OZFA 5FPPA 5EWJB 3PS9A 4DL9A 1X9MA 4RA9B 3TVDA 1P17A 4DA0A 2X86A 2F43B 2JEJA 4OU4A 2OV6A 3SK0A 4AP9A 4FW9A 1UPXA 3CUEF 1TXGA 1YJCA 3HMKA 1QTQA 2VXYA 2P78A 3GV7B 3TZKA 5HIMA 2H3QA 3TLEA 1WB4A 5JLAA 1SKYE 4GPTA 4BN4A 2G5TA 4DMRA 1M2WA 7ICUA 4P86A 3KLNA 4S0XA 4PZCA 1YZNA 2NX2A 3C6ZA 2HRQA 9ICBA 1VIVA 5KAMA 4WPGA 4Y1RB 3OX3A 4EBEA 2NYAA 5IVHA 4NHOA 3R24A 4ALMA 1ZC4A 3H65A 4Q47A 1D0IA 1O3YA 1OZ0A 4YCCA 3RB4A 2ZYHA 5B3JC 1G9XA 2JA1A 2ZIUA 3ETDA 1L5HA 4D44A 4WZAA 3ST7A 4DDTA 5K3SA 4BLVA 1P2TA 1QPZA 1RCFA 4U7CA 1LQ2A 4UJ3A 1CZLA 1EFVA 2X2PA 1EE1A 5E4TA 3OM9A 2B3TA 3LI2A 2FR0A 2H65A 5HZGA 4WKOA 2XCTB 4J1SA 3M4XA 3Q7IA 2A19A 1Z4QA 3L7YA 4LY9A 2XUAA 4BFCA 1CVRA 1N60A 2PZAA 1NK0A 2C7BA 4N3AA 4P4SB 1R4NA 1NJ6A 3H9JA 3UMBA 5JSHA 3PQDA 5PGMA 1NQOA 3PGKA 3ZDBA 2K87A 3M8RA 5D6NA 3AXTA 1MV5A 2O2ZA 3RSOA 1XU9A 3CUYA 4BN0A 2FP3A 3ZDEA 3PX6A 2D5BA 1QHIA 1M2JA 3CMCO 4FWIB 3D6MA 4AZVA 4HMOA 3IGFA 1P45A 2ZITA 5LQCA 5FL7D 4BUGA 3FOWA 4URXR 2IE0A 3R7NA 3VSBA 3DWIA 5BSKA 1WCWA 3GIDA 3FFWA 2KN7A 1Y98A 3MBIA 1M6WA 1TAQA 3FRHA 4B85A 1U7ZA 2I8AA 2BR5A 4MKXA 2O2IA 3FYUA 3MJFA 1V5EA 3DMNA 3WQHA 2WM8A 5M5BA 3H19A 4WHMA 2PBFA 5AI9A 1GZ5A 2WLTA 4RLHA 4OLFA 5BQFA 4P2GA 5DBFA 1AMOA 1CYDA 2X13A 4IUBS 2GEJA 1A69A 1XI2A 4FUQA 3PEYA 1Q0HA 1SHLA 4OOFA 1D04A 1F2TA 1TM5E 1R0CA 2FQQA 1E92A 3LCRA 1XTRA 2Z4SA 1WDWB 5C5JA 4ZARA 1ZISA 3E0XA 2CUNA 4D8UA 4N41A 4IUCS 1DJMA 3SDBA 3ZDXB 4AMGA 2FW8A 4QLOA 4DJ5X 4EGFA 1ZD2P 3F47A 2HBZA 2D3TA 3KT3A 5TE9A 5IS2A 4JBLA 3T4PA 2WE8A 4UZEA 3GG2A 2O8BB 3BXEA 4GXRA 1KAEA 5HE9A 3AFOA 4QULA 3L77A 4BJQA 2UKDA 1YIOA 2Z8ZA 3AHJA 1R0KA 4Q9IA 4XI9A 3AJRA 4D82A 3CPJB 4DNFA 3FDSA 4E5UA 2QQEA 2X1HA 3GP5A 2A1UB 4DMUB 5D3ZA 3HN6A 5EXXA 1TA4A 5C8YA 3R41A 4KQGA 4KMOA 2FUKA 4E4YA 4ZCIA 4DIOA 5L1LA 1FFBA 2IV2X 3CUTA 3I9KA 2X41A 4M2LA 3C5EA 4TKUB 4IOJA 2X5JO 4TQSA 2IDZA 3FRJA 3GK3A 2J87A 5DOVA 1VM6A 4YC7A 4G84A 2PZJA 2CB9A 2EYQA 4R2IA 4EMUA 1II0A 1LF5A 2A9VA 4B9UA 3PQ3A 1B22A 2FDXA 3OVMA 4EECA 4QYXA 1IATA 4AJLA 2FOIA 5E79U 2IY7A 4FBMA 1JYFA 2XUDA 2G63A 1ESZA 5ICSA 2BBOA 1JEDA 3ESDA 2ZAIA 1IOWA 4TVSA 4Q9HA 3WR5A 3IT0A 1FQJA 1I7QB 2EJWA 1DTEA 1UKAA 4Y7DA 1SIJA 1KQQA 4OK5A 2DPYA 3TE7A 1K3FA 4UCQA 4O3FA 3O1IC 1E6LA 3Q8XB 1PT5A 3P97A 1C20A 3NBFA 5F5LA 1W29A 2QTMA 5JDCC 5KKNB 3LUGA 4NI5A 4DR2B 2PI5A 4EHNA 1K3TA 4D81A 2FG7C 3RJFA 2PGDA 4NDNE 3DOJA 1STOA 5J2GA 2XY6A 3QSYA 1S5PA 4H7HA 2HD4A 3MGCA 1WPRA 4CM7A 3EVDA 4IFBA 1CF4A 5CNIA 1HLGA 3EQ7A 3DSRA 1DWPA 3TECE 3EYZA 2XEXA 1WCV1 2RFLA 3OHBA 5IH7A 1JWLA 2PLNA 5IEBA 4RMNA 3KQMA 3H7AA 4NKRA 2JLYA 2BTOA 3TW0A 2PMEA 1M0EA 4MJXA 1PFUA 2OA0A 4ZOAA 3LK9A 3VVCA 3AVPA 5GIPE 2GBFA 3ADDA 3HFRA 3VNVA 3M6ZA 2AN3A 3B78A 2JKVA 4DSUA 2AZTA 1H3NA 3PFGA 4JZKA 1CR6A 4G41A 3KT6A 1QP7A 4LRSB 1AGRA 3T3OA 1MU0A 4RELA 1Z4KA 2BFCA 1UZAA 4MI3A 1ZN7A 2PPLA 2OHJA 3C3EA 4RQ7A 3A28A 2VJPA 3A0RB 2PGAA 1CB7A 3NKLA 5B3AA 3KOWA 2ATVA 4L6AA 3S40A 4Q39A 4FBGA 3H9BA 4UNQA 1E9SA 3L7CA 1OV6A 1H6AA 3UHPA 1Y8CA 4A5OA 5KFJA 3L82B 4ZJYA 2FN7A 1QFXA 4RWEA 1LQUA 2AC4A 3ZJUA 4BU1A 1MN8A 3D2CA 1K98A 4F7WA 1Z6GA 3FKQA 9LDBA 3OETA 1P4AA 1P4RA 1YRHA 5C1OA 3RSSA 1EUQA 4FVTA 4NCXA 5IZ4A 2W42A 3EEQA 3JPPA 3FF1A 2WD9A 3AP2A 4LNHA 4WXEA 2DQKA 1YR1A 1E2QA 5IUKC 5EJ8A 3T5AA 1GWNA 1RRCA 1W1WA 4NZYA 2DLNA 1NQWA 4G67A 3F5SA 3INGA 3RM3A 2QRZA 4Q48A 1C9NA 2HDOA 3AEXA 3CVWA 2ZR9A 2W22A 4EKDA 2ZLBA 2ZUUA 5KDLA 1JTFA 4KKXB 1HLDA 3RB8A 3X43A 3JVDA 4OHFA 5HVNA 4KL8S 4N7MA 1DTWA 121PA 4OQXA 1Q91A 4TROA 3FPHA 1QHEA 2ADFA 1N2JA 3DLAA 3FTFA 1F0YA 2QMZA 3OQ1A 4LZDA 4X1KB 2GKSA 5BN3B 5LA6B 1XN4A 2L42A 4JOSA 2CHUA 1GRVA 2WD7B 3PXXA 3SIPA 3RAJA 4MICA 5FBQB 4L72A 4E14A 4AMUA 2RHMA 1XNRB 3W9UA 2MYNA 2P1ZA 3ZWMA 4WJ3B 2VDWA 4XQ9A 1RM3A 4BYMA 4IEIA 1VHTA 2BEUB 3RODA 3TFSA 1NQ5A 5T8KA 3D8TA 2WRZA 1NDQA 2NV2B 1VECA 1VYHA 1E2UA 5I4KA 2WAQC 5CDGA 1GUDA 1L5LA 2POQX 3KCNA 3LECA 5F3WB 2I65A 3BS5B 2ACWA 4O9MA 4HS9A 4F1KA 1EYZA 1Q14A 3ISBA 2LZ0A 3PF8A 5BSRA 5IDXA 2J3QA 1DKRA 2OY0A 3AW9A 1NXVA 5TQ2B 1U11A 8ICKA 2VBCA 1JXMA 4GF5A 1BQEA 3K09C 1NULA 1R27A 2J85A 5LU9A 2O7QA 1RRVA 3P0FA 4Q93A 3RKUA 2R87A 1GQ2A 1DMRA 1I32A 3IHLA 1L5MA 1ZSYA 1T8SA 2J7PD 4F38A 3QP9A 3TLCA 2ZWAA 2AEEA 4I5IA 1RZRA 1DHRA 4ZT6A 5DKWA 3PRKE 3JPNA 4X8MA 3K9QO 4D0NA 3ZJYA 1XZNA 4CCAA 1TJYA 5K2OA 3AMVA 5CIYA 1H94A 3IJPA 5G4KB 2G9NA 5M2QA 3H5RA 2BMAA 3N4MB 1FFXB 4EATA 1WUIS 3L0BA 5KNLA 4QWAA 3M6AA 2AG6A 3QUQA 1QYCA 2ZJBA 4XX0A 5FAXA 3G6WA 4P8RA 3ICOA 2B20A 4ZQFA 2I34A 4K4HA 1XZIA 4BBJA 3ASVA 3UFXB 4LPKA 3IQXA 3JPTA 3BHIA 2VA3A 2BR4A 2CDBA 3DGEC 3PJEA 4C05A 2IHVA 3OSNA 4V0SA 4ESVA 4TYPA 1AK9A 2V0CA 3IC5A 4BLRA 5DKFA 3PSAA 2NIPA 2V7QD 4ZHQA 2FX5A 2PS1A 2PUVA 2PAAA 3TAHA 3ZDZB 5L7WA 4PZNA 1MMFB 5JPDA 4NBWA 1NUQA 5F64A 3ZV3A 4IGFA 2HPVA 2GJ9A 4TRRA 4HJXA 1T5OA 3AEUB 1DADA 4D0RA 2ZRNA 4J9SA 3PWKA 1HQYE 3P32A 3K1AA 4NZPA 4JJKA 4Q45A 1T9GS 3YASA 2ZRIA 1RFLA 4Y6GB 3J7AC 3HABA 4IV5A 5EHXA 4IDEA 3OIDA 3IUYA 3DNMA 2XDQB 1RWXA 2BDPA 5C80A 3NP9A 1W85A 5KPDA 4XOIA 4C8KA 2OP0A 3ZE2B 2YV2A 5EP2A 1H9CA 4FCWA 3AWDA 5F4BA 2Z95A 5A0VA 4PRYA 1P0IA 3E22B 3I76A 1J5XA 4J9RA 2IF0A 4BVBA 3C3CA 2VDVE 1T9KA 3GT7A 2RCYA 4JGGA 4WEOA 2DT5A 4MRVA 3AIKA 4N0QA 1D1SA 3DR3A 1RLUA 3WSWA 4ACOA 2VYND 5B7QA 1U3CA 4QDTA 2GBCA 3U6BA 1EPUA 2BEKA 2RBGA 2V7TA 4QO8A 4CETA 3AL0B 4UOZA 3ASUA 1KEKA 3BMNA 4MW7A 5DI3B 4K87A 5MGBA 2IYAA 3F9CA 5GV8A 4EG3A 3GGJA 1I9CA 4I66A 4EB6A 2Z04A 4EEYA 2J3KA 3HDHA 3NBAA 4EG6A 3SDSA 5JRTA 1CT9A 1M0WA 1SXJD 4FYJA 2K4IA 1L4HA 5JMTA 1RE1A 2BCGY 2Y1DA 5E6SB 5IJ9B 2AT1A 1DUVG 4FKZA 2DWCA 3C3AA 3ER6A 4YJKA 5JXJA 2PFSA 3EQ2A 3LS2A 1HKHA 2QV0A 3OIVA 4JODA 5E8RA 5GINE 2CDNA 1XAHA 3HBAA 5JEEA 4YP3A 4M8NE 3LP5A 1L3BA 2EOAA 2CYCA 3EIUA 3PB3A 3TX2A 1I2AA 3F4BA 4BQPA 1LZLA 2GCOA 3C97A 5HTKA 1E6WA 1YQWA 1TI7A 3HCBA 1E7QA 2R1TA 2V4UA 2F7SA 2QA5A 2WM2A 3JVUA 2CYAA 1M76A 6AT1A 4IIJB 1Z3CA 2YN0A 3JAWB 1KYQA 4V03A 3OZCA 3HS3A 4MRMA 1XMQB 4EUNA 2QG4A 1RJDA 2P7HA 1EVJA 1Z7GA 4KEAA 3CBQA 3QKSA 2HU5A 3HB5X 5HW0A 1TM3E 1SY7A 2V0GA 1GTG1 4KC0A 2GEDA 4L8VA 2MDTA 5LMNB 4DCTA 4IYRA 2P7IA 3GJZA 1XQWA 2HW3A 5BUQA 4EBFA 1LNZA 3KJGA 4OQFA 1A77A 3PMLA 2WT4A 1QV6A 1BN7A 3BTSA 1NX9A 1E5TA 1KO4A 3T5KA 2AQ4A 4JP8A 4REQB 4ZO7A 3D9QX 2G06A 3AR6A 1FSZA 1CR2A 1P29A 3HVKA 3RGGA 2IXTA 4GE3A 2OCGA 5AM3A 3U3RA 1LKYA 5CFQA 5FWNA 9ICTA 2VQFB 1YVRA 2QWXA 4PLPA 2JHGA 2C9DA 4ER7A 2D62A 4ZJZA 1VLQA 1EUDA 4GZ6A 1Z2OX 1G2OA 1YOVB 3CVVA 4OSEA 4I3FA 1GG5A 4QVIA 1QC5A 4EABA 3BD7A 3D6AA 1T9AA 7REQA 1L7AA 1YZ6A 2E85A 2E4UA 1JIUA 1BNOA 3U7JA 5CVUA 3QWBA 2ZAYA 4FZJA 3HDVA 3MINB 2NO0A 3NLLA 3VJLA 2IXGA 4H59A 2AA3A 3ZVLA 3DMFA 3A1TA 1CF9A 2WB1C 5IKOA 2AMLA 4Y67A 3FB1A 4R65A 1KJZA 3B5EA 3T7JA 1JAXA 1B0UA 1ADBA 3HFGA 3KKPA 1G2IA 1I51A 1NZJA 4TUQA 4S24A 3RS3A 3J80A 1PEDA 4MR9B 1RPZA 3BA1A 4LHVA 4G0QA 3DC2A 2ZIVA 1Z5OA 1FMTA 1F8YA 5E7QA 1QYDA 4HWRA 1QMGA 2ZYGA 3HU1A 5BW8A 5CGZA 1TFRA 2FPPA 3VKWA 4TV9B 3R6WA 1NJXA 1AO0A 5ITZA 1U63A 4WLUA 3WLTA 4S1VA 4LV8B 1XVAA 5EE5B 3M1IA 1I7SB 2DX7A 1HC7A 3VMMA 4ZEWA 1M2VB 2W2LD 2EQYA 4LWPA 5JHGB 4B6QA 3D0RA 3N0RA 4MQMA 2JF0A 1YVUA 3TNYA 3L4BA 3OE5A 1RPLA 3T5HA 4AJ4A 2WUFA 1JAYA 2WKWA 1LB1B 3IP9A 4JUZA 3ISJA 2BBWA 3B82A 4P4TA 1XDBA 2YJ4A 4XPZA 4D5GA 2YJGA 1KJ9A 3V3KA 3HADA 4LVSA 1YZFA 4MQ5A 1R0BA 4CTOA 3TAUA 1NZFA 2FP4A 4KDRA 4LZPA 3BIJA 4IHKA 1XC7A 2VYVD 3F53A 4Q44A 3LUBA 3A3NA 5CW1A 1T2DA 1REQB 4F4KA 5BQ5A 4JWNA 2QUIA 1DS6A 4OLAA 1GYQA 2ZBQA 4BJ6A 1NFQA 3CZAA 3T34A 3MG9A 1EXNA 1SQFA 2I76A 4F9EA 5D5HA 3Q8SB 2BKUA 3KKAA 4MV4A 3GHHA 3M6XA 5JXWA 4I4CA 4BV3A 2NU8B 3FR8A 4JQZA 1E63A 2V96A 1TJ4A 3X1XA 5FTMA 2QE6A 3BTUA 1Y8RA 2JHPA 5L1KA 2QN2A 1KAGA 1PQYA 4YCLA 1ZK2A 4UB4A 1ULHA 1DBQA 1Z00A 4W9NA 1WQ4A 2YS7A 4BFYA 1O1YA 3MM4A 1N5KA 4COKA 1N2OA 2PGLA 1LFAA 1KJQA 2EW2A 3RADC 1Y8AA 1RZVA 1M7GA 4R0VA 4PYKA 2NG1A 2MOKA 1K7XB 4BO0A 2O1WA 3K0FA 5A0LA 4B9AA 1VMAA 3OZGA 4ZEVA 4HH0A 5C1IA 1CBUA 3ITKA 1LI7A 1ZUWA 4MUEA 3B89A 2XKJE 6NULA 3WNCA 4WOJA 1KSJA 2I4MA 3HM9A 2ZXUA 1VJGA 1G60A 3SS8A 5KNDH 3OTIA 4ND8A 3O1JC 5AM0A 3A4IA 4R9NA 2B94A 1ZL0A 4HWSA 5CT5A 1B6TA 2W6NA 3BFXA 1AGXA 1Q50A 3CMMA 1KI6A 4RMHA 4ZQEA 2ZRHA 3QXCA 3DLHA 1XZGA 3B3FA 3BL8A 4KITB 2O3JA 3NHFA 2O5EA 1N0WA 2B5OA 3RB6A 2B1IA 2I99A 5G1NA 4G2NA 1PJQA 1BG6A 2IUTA 2PMWB 5J40A 3BC1A 2G80A 1NI4B 2E4VA 4G0NA 1TPZA 4BNWA 1X1RA 2B61A 4I4NA 2JH8A 2JVKA 1W36C 2Q27A 5JAUA 4LZLA 3WDKA 1RYUA 1Z7YA 2WM9B 3TRDA 2P2ZA 4DBVO 3GPDG 3TOZA 3AH8A 3R3SA 2HOFA 2WNSA 4IIGA 1LF0A 5GIOE 3HQ4O 3ZEAA 4H3KB 4IGKA 3DEAA 1M10A 221PA 3V6KA 2HEGA 1UA0A 1ZQSA 5JFTA 2PZBA 1XA4A 3STXA 4XGKA 4AG5A 1C0IA 2Y76A 2WK1A 2UZIR 2HMYB 4MW6A 4JV1A 3JSXA 2BP7B 5IBQA 4Q15A 3QU5A 4G63A 1DIBA 3REFA 5LLTA 4IS7A 1P5RA 4CL3A 4I50F 3U3XA 2YFQA 4Q3AA 1ZH2A 1PRYA 2FSFA 2JMGA 3QJ5A 5M04A 1GZSA 3B3JA 5JU6A 2ABWA 3ZU4A 4D0GA 3WYEA 3ROQA 2OESA 3ZI7A 5DK4A 3JAMA 5K3FA 5DTEA 4DBLC 1SZPA 5KTMA 2VHCA 3G89A 3OZEA 2DUWA 2C8VA 4ND4A 1ESDA 1OXMA 4YN3A 3EW9A 2X4DA 4KLCA 3FR7A 1IHDA 1XSNA 4H0FA 1U0JA 1J6UA 4QXAA 3DPUA 1W5BA 3OLYA 4E13A 2XEDA 3I3OA 1YI0A 1FMJA 1MH9A 2H2AA 3DVAB 4X1YB 2Q6LA 5AK5A 4O2AF 5FNZA 2JZNA 3O82A 5A5GA 1Q7BA 5L4SA 3VR4A 4A3SA 2RBEA 5L4LA 3V2HA 1JIKA 5LOVF 1P75A 4POOA 4YMTA 4WXPA 1YB5A 2BFBB 4M6WB 3FM9A 1NMYA 4TKVB 3TZLA 1U0FA 4RSGA 4MI9A 2AR7A 4O4JF 3RTCA 3ZWCA 3BQ9A 1C3XA 4B9MA 4HEA1 5F77A 5CNKA 1W46A 1E0KA 3JQ8B 4RTNA 1S9FA 3EZ2A 5KQLA 1N6LA 2VJAA 2JFVA 4GVPA 4J9KA 1L5SA 3EA5A 3DD5A 3KLOA 3PLNA 3PHIA 1XUOA 1IE3A 4IUYA 3E7WA 4Z2AA 2RJ3A 5TVKA 4B79A 2IEGA 2XZOA 2I3AA 3UHAA 3KHTA 3PUIA 2AVNA 1IVYA 2C5SA 3F6RA 1YHYA 2GSWA 4TMFA 1Z2CA 2ZVQX 2A30A 4BO7A 4I2JA 2ZJ5A 5I9TA 2YL2A 1N2XA 3RTVA 2YWDA 4NBLA 5IMBA 3EIHA 1QP0A 1N78A 4U2CA 2H8KA 5DLYA 1XX6A 3P5SA 4UBJA 5AVXA 2J8ZA 4FM9A 3L6CA 2DBZA 1EX7A 1JIIA 4Q4DA 3RBVA 4LBVA 1B2LA 2PK3A 1MC4A 5EJ9A 3U49A 4FDVA 3WX0A 1UR5A 2Z5LA 4IQWA 2QE7D 3IRUA 3FGZA 1MX9A 3CIFA 5EIOA 2VWHA 2C82A 2HJGA 2WKPA 5CXSA 3N1UA 5ALQA 2HFKA 3VPBA 3EIOA 3BREA 1ZQAA 1J5EB 1N9KA 2FN3A 3I6MA 2AZDA 4X9XA 3WAJA 1IY0A 3DM5A 2ZIXA 2P9EA 2RI1A 2W2VA 2DT8A 1ZR2A 2GD0A 1GCGA 3WDLA 4HK4A 3RHFA 1H85A 3UANA 3QMWA 3UWPA 3MGHA 3BUSA 4KQ6A 4YRLA 1TPYA 7ICRA 1YS1X 2XJ9A 3AM9A 2N1MA 3PO4A 2WIFA 2M9MA 3IHQB 2OO3A 3FVVA 4N6OA 2BFMA 3O90A 2R11A 3QPWA 1CIJA 1YE3A 1VYUA 2HWUA 4HUQA 4QGAA 4LXXA 5F35A 2PZKA 1QB7A 5EIFA 2Y4OA 4HQ0A 2BF7A 4KJXA 4XRRA 1NBMD 3K9NA 3QEOA 3EFHA 1DV1A 1FU8A 1E69A 3RS2A 1CVLA 1ORVA 3QTBA 3IMKA 1CRLA 1U3DA 2J3LA 3JS5A 3VH4A 1NF2A 3LHKA 5CHEA 1OMOA 3T3GA 4RE5A 2PMBA 3COSA 4FEAA 3VV3A 5A4FS 3AHEA 5BSMA 1CF2O 2FRXA 1AROP 4KXNA 3U4CA 1BNCA 2FH5B 3AOEA 3HCOA 3FVQA 3BTVA 4PGFA 5F76A 3AF2A 3DBLB 2H59A 2K4HA 1A5BB 1FLNA 2FPSA 2WSYB 2XBLA 4ANFA 3SQMA 2YRFA 1XROA 3OLXA 1NLFA 5JNVA 2OHIA 3E8XA 2JASA 3QW2A 4HTFA 1IUKA 4E0BA 4N5MA 3H6HA 2D59A 4MS1A 3JSAA 1KPHA 2I5PO 2ZTUA 3U4QB 4RUKA 4HG2A 2F64A 3FI0A 2RAFA 5KG7A 2FRVA 2W6CX 2Q1TA 1V9PA 1NXPA 4BMVA 2JH1A 5DHSA 2HKIA 4OA5A 1SK9A 4MTCA 3WHIA 3ZZUA 4Q3KA 4UMFA 5GONA 5FPHA 4ARAA 2FR8C 4PE5B 4MVWA 4RKQA 4F5DA 2JBAB 3PDJA 2JEOA 1TRKA 4MV6A 2PSEA 3HG7A 1ZC3A 2XKKA 5CEJA 3FPAA 4RVSA 3OLVA 1SD1A 3QYAA 5FOWA 1BRTA 4Y2QA 1MO4A 4JL5A 2O5CA 3Q7RA 1PUJA 2VJMA 1Y9JA 1GA1A 1I4DD 4L76A 1HZZA 3LSTA 3LWBA 1UL1X 5A9TA 3RTAA 5CCXA 1YACA 4W1RA 1KZYC 4FHDA 1N36B 1WDKA 2AEFA 4FOSA 4NARA 4OJTA 3WV4A 1XP5A 2REXB 5HKKA 3C21A 5DBBA 2QS9A 4G01B 3I1IA 3ERCA 3RANA 3GT0A 4HQFA 1XAGA 2JAUA 1CFZA 1XJWA 4AP6A 3IBGA 3EX7C 5KT3A 2Q41A 4I6GA 4C4SA 4RXTA 1M54A 2WQ7A 4RADA 3KVRA 1EVIA 1OB5A 3AQIA 1O2DA 1SU7A 3AF4A 1SA0A 5EIXA 4IX1A 2EF1A 3SLKA 3L84A 1KEWA 3BE6A 2CCKA 4CEJA 1N5MA 4HX2A 2Q7XA 4DC1A 3SKVA 2YJNA 3CR7A 3D3EA 4BCDA 4QQRA 3A04A 3SE7A 2CFOA 3U0BA 1NW5A 3EAFA 5IUJC 4XGIA 3WRYC 2JRLA 4RH0A 1BWSA 1YZGA 2EFCB 3PR3A 5TGZA 3ZWVA 1T3HA 5JO0A 2P3SA 4KNYA 1Q0PA 2FMFA 5AXAA 4QGSA 1CRQA 4KSYA 1B43A 3CUSA 3T54A 2PSJA 3I9FA 1V26A 3W79A 2UDPA 3RSCA 1DRUA 2CNWA 4LOAA 3PUKA 2V7EA 4CIWA 1DG9A 3PC2A 2IKQA 3EODA 1YUNA 3PRJA 2OQ2A 4K0RA 1R3DA 3PE3A 1OBHA 5G0WA 2P35A 1WBJB 2OG2A 2EAPA 4FYYA 2G71A 4M1KA 3UAVA 3IKLA 3PDCA 2OHHA 3ENVA 5C1DA 1BN6A 4R31A 2JKYA 1UJBA 4BGIA 3HKEB 3A3OA 3S8MA 1KBOA 4W9MC 3BQNB 2QM3A 3ZXIA 1GLVA 3OECA 1B7GO 5EZYB 5C8YF 2LM4A 2VJCA 4CM8A 1DHTA 4O3RA 1BDIA 5F7XA 5FUVA 1JNXX 5ESWA 2CNDA 3Q11A 2EFYA 2WAMA 1YMUA 5B1IA 5JS1A 1DWOA 4MF2A 3M33A 2I3ZA 4H2DA 4D0SA 2E1PA 3CONA 3HL0A 4PC2A 1JRLA 4H4CA 4HDCA 1ZD1A 1MNAA 2WTXA 1KHTA 4UM7A 3W5DA 4ARBA 4Y0VA 1YQXA 1S8AA 3MZ0A 5EXPA 2XUQA 3LPNA 1NG9A 4HTAA 3P9ZA 1TMKA 4D9NA 1KU0A 4OL0A 4FILA 1VE9A 1X15A 3FJOA 3RVPA 4AAYA 1Q0QA 3HHEA 1ZHOA 3CYFA 3UMCA 1Y4SA 3ZEIA 4F86A 2FEPA 3ICEA 3KZNA 3EVZA 1AG9A 4OB8A 4P98A 1QHGA 1BDBA 2AG5A 3NASA 4FUTA 4OK6A 2JATA 1FJGB 4B2YA 1HSZA 3WK5A 1QK3A 2RONA 1F7UA 1T8YA 5JJBA 1ZSVA 2O8DA 4NNJA 3L6OO 4LZZA 3IMGA 2NZVG 3PNYA 3OZDA 2QJRA 3TMYA 4G09A 1HDCA 4RY0A 4HH3C 2ORED 2FG6C 3OCVA 3BCUA 4LBYA 3V72A 5J0XA 7ICLA 3VU0A 3UWOA 1GSOA 4NSNA 1E1MA 4DLYA 2RHCA 3O03A 3IP7A 3KTAB 1F8XA 4Y2RA 4J2HA 1A9ZA 1X80B 5B3LA 2VT2A 2GPJA 2R4QA 4Q0MA 3LNCA 5E9QA 2WW8A 3HV2A 5CXQA 2HF7A 1KMHA 2AGOA 1XL0A 1IDOA 4M38A 3DE7X 3UQZA 1QBKC 2HV8A 1U7HA 1FFHA 1GTRA 3GLGE 1UMBB 3MPOA 3L93A 1QIIA 4W1PA 4DEZA 4Q05A 1BA2A 4HUJA 3ZK9A 4BX3A 4MP6A 1DX6A 4IC9A 1XMXA 1PU2A 3WRWA 1PNTA 3GX1A 1PWXA 1SHTX 3TXYA 4CNQA 2V7PA 1HRKA 1OREA 4UFPA 4AMZA 3DDHA 4FEGA 1S0NA 1X92A 5IAKA 4Z9AA 2PPVA 4RESA 2CVOA 2QQ0A 2XNDA 1F8FA 3RT1A 2PIAA 3QVTA 5CDUA 4R0NA 5BWOA 2B83A 5L4NA 1RRPA 3WGVA 3I32A 1XTVA 2QRQA 1PUZA 4C4PA 2QRNA 4Y2YA 2O54A 4KLQA 1QCDA 1YIDA 1KAMA 2X9LA 4RKRA 2W7TA 3IXQA 3RFFA 3ZHYA 2XWSA 4KLDA 4MYRA 3CEAA 1W75A 3PXCX 1FP7A 1H2XA 4US9A 3TBHA 4D3SA 4PC1A 3LUDA 4FZLA 4KYUA 2GZMA 2ZYUX 1W4LA 4RV4A 4KMSA 1Q0RA 4CM4B 2I4LA 4JJ8A 2B1QA 2GN4A 4NMHA 2DB3A 4LCJA 1RE0A 3LWNA 4U4AA 4HNUA 4YRSA 2ODWA 3PLAE 2W4IA 4IP0A 1EB8A 3A4MA 2RI0A 4KIWA 1P3JA 2C03A 1JF8A 3SLRA 4PGAA 3UOAB 3T4EA 2BW0A 1VPTA 2A1IA 2I78A 5CB0A 2JGEA 2X14A 3SSOA 2J4FA 1J9GA 1P3DA 1UINA 3SX4A 3SQWA 3R4VA 3RIMA 1PSDA 1UP4A 3BF8A 1CY0A 2D2IA 3QE2A 3TCKA 3D2LA 3B7PA 1QZ3A 3ODPA 2LNDA 3QFFA 1RQRA 3WIVA 4R9SA 4ZDIA 3THRA 2K8BB 4FFNA 3QM1A 3NTRA 1RCTE 5TARA 3WB0A 2IYWA 2I1QA 4CFZA 2IBKA 1ZQWA 1AKVA 1UIMA 2IGBA 3ABSB 1XEWY 4PAQA 5HCNA 5GTIU 3IMCA 2RHTA 1I3CA 4ZOBA 2Q50A 2IEYA 4EHKA 5DSZA 4RTQA 1ONNA 1A95A 1GRQA 4ENPA 1T4BA 3EA4A 4Z4EA 3GNLA 1OYYA 5AK6A 1ZQXA 1SVLA 2ZBRA 3W6ZA 2FW7A 1KEVA 2LYHA 2H5EA 3F5QA 4NCJA 5FAKA 5J2TF 2PY6A 3QWFA 1M0SA 3A2KA 3SEZA 3K2QA 2AE1A 2IYRA 4QWBA 3NDBB 2X8WA 2H1WA 1RP1A 1W36B 4A1OA 2QTVB 3SR3A 3MCAA 1K08A 2GLEA 1KZ1A 1UOQA 1PG2A 4UHCA 3G2JA 4I2DA 2HRBA 3Q98A 1MIOA 4LNAA 3DTTA 4GL4A 4N3NA 3GILA 4YROA 5D85A 2KHZA 1OYOA 3PKZA 2O57A 3AFGA 1T5SA 1YO6A 1V6SA 1ZK0A 3WYBA 5G3YA 3PVZA 5IU6A 1XVUA 1CP2A 3LY9A 4LKRA 3JRWA 3SOZA 4ZEMA 4F6RB 4ZHQF 4G89A 4YD2A 4KLFA 1E94E 2JGKA 3AUFA 2EKBA 3LX8A 1W4CA 4RWZA 1CUEA 2QYTA 4C1BA 1UBKS 4JR2A 1YR2A 1T9ZA 2OCPA 5DI9A 5HIJA 4E5NA 5HDBB 2EBUA 4MCJA 3IP1A 3CNEA 4MGHA 2HSDA 3RYHA 4X20A 2FPIB 4KYVA 1O0CA 4Y2UA 3X1MA 1NXSA 3FWYA 4LOLA 3VX4A 3SF8B 4BBPA 1VJCA 1SGWA 2DOKA 1OAOA 3BRCA 4RQMA 1ZXXA 4KOEC 4JC0A 4BVAA 5DNYB 3MEQA 4M8SA 6GPBA 1NUSA 4C78A 1W581 4S3MA 4BV9A 4G3XA 4WXYB 4TTAA 3TTWA 3NRWA 2L82A 4ZDKA 4RF4A 5JALA 3M5PA 3ZTWA 3ZJ5A 1EEHA 5E3JA 5GQSA 4MIEA 3TBKA 1XO0A 3PGVA 1OLXA 3WA7A 4RIEA 3SYRA 2KZ3A 3DEFA 3CVXA 4JNKA 3MUNA 1BWRA 4B4KA 3VDQA 3N7UA 5KFNA 1WD5A 3A9RA 3DTVA 4CN8A 1EUZA 3QFSA 3O93A 3ACCA 5J4HA 2CHFA 1VKRA 2LV8A 4IINA 2J6TA 4AKHA 5J2AA 3H75A 1NMSA 3N70A 1XJ0A 4ON9A 2RH5A 3FHLA 1PVRA 4QYWA 5KYXA 5FNVA 1AB5A 2A1JA 3F5FA 3DLBA 3MIZA 1SXEA 3QEMA 1M9NA 1NJ8A 1YDHA 4EKYA 3P9KA 1E89A 5KDOA 5FDFA 1S8FA 2A4KA 3NOOA 3FHOA 5DDIP 2IW1A 1YCFA 3GN1A 4E33A 3THVA 2GUGA 4B75A 2SKEA 2NGRA 1UA1A 4M9CA 5DYYA 4NQZA 4TX1A 2JAOA 5B64A 1RHRA 3WLPA 2BF4A 4F1WA 5COQA 4RK4A 2BRUC 1YKSA 5U4QA 1Z4MA 1P73A 3HR4A 5L51A 1DAGA 4IQ4A 3WWOA 3PSFA 3O8NA 5ALKA 5LQRA 5EIBC 4DMHA 5DNDA 5F33A 3AU8A 4X8OA 4GLXA 5HJ5A 1YASA 5LBTA 4FB4A 2PA0A 4RXUA 4BEWA 3BZCA 1SHUX 2G36A 4IJVA 3WADA 4RCZA 1SAYA 1QF6A 3GDWA 2CXQA 5A9SB 2J3EA 3LGSA 4IM7A 2M1ZA 4Z4HA 2VCHA 4ESEA 2B4YA 1HH4A 2HZBA 3U7GA 4DLGA 3E0QA 4WY5A 3O2QB 2EATA 4XQCA 4M21A 4WJLA 3N7PD 3FTPA 1Y8QB 4NJMB 1I6WA 4FIDA 2R5WA 2IUEA 2WNHA 2BDEA 5KTSA 4ECEA 1PR0A 4JB8A 2IA5A 1CIPA 5BT9A 2NO7A 4J2TA 2AFVA 3HUDA 4TL6A 4YMLA 2Q2WA 1NJZA 1IXSB 4GEKA 3MBKA 3SZOA 4IWXA 2JBWA 2Q9AA 3USES 2XA2A 3G2MA 4PPNA 1FUYB 1Z45A 4ZI7B 1V5WA 2R1ZA 9ICQA 4KU4A 1TK9A 1CEEA 3KXDA 2GJAA 5CHGA 4KQWA 3A6HA 2JFYA 3H9GA 4UE3S 4L08A 2BQUA 2YC2C 4AMBA 4R8LA 5EXTA 4LJ9A 4OHZA 8ICMA 4G0XA 2ZYRA 2PZ8A 3N2GB 4BHTA 1DZ3A 4AO6A 3IOEA 4O4HA 2X8AA 4ZK6A 1TB4A 4Q19A 4ECYA 3W04A 3KHHA 1G5HA 2XPCA 1ZM3A 4HEA6 5CPFA 1ZPDA 4K6CA 2BEVB 4DDWA 2G0TA 4D80A 4IHJB 1LX6A 2CVPA 5EE3A 2P30A 4ARZA 5KU7A 1GGFA 3PDWA 3PWZA 5B55A 3IUSA 1GTJ1 3VR1A 4M1QA 4OLHA 2WAXA 4WCVA 1KSPA 1UXJA 4BNHA 5CD1A 5D51S 5FXMA 3KSBC 1VKNA 4HBGA 1UJ6A 3CA8A 1EUCA 1V1MB 4D99A 2QN9A 1YHZA 2QHXA 3OI7A 4MIOA 5ENZA 2GD2A 3PX7A 1A5TA 1ZCJA 2GBPA 4QW9A 1G66A 2V8BA 1V7QA 4Q4JA 1VXOA 4RL6A 1NPDA 3PHBE 1NZDA 1SZCA 4DMCA 1E1YA 3KVOA 4ZAWA 3OHAA 4UDOA 1IJBA 3RUFA 2A84A 4CDGA 1YFLA 1G1AA 1Z4IA 1S9HA 1VOTA 3E5RA 3TIGA 2D2XA 1P1JA 5ICEA 2AS0A 4DLSA 1VI6A 4DABA 1F4LA 5CA0A 4TWAA 1LSOA 4NMMA 1JA1A 3PSHA 1PHPA 1E3DA 4B2LA 4PNZA 4QBFA 1PK9A 4OGGA 1NONA 1MFZA 4JDPA 2GTPA 3OT1B 1RU3A 2I54A 4EQ6A 3ZCRA 2WF9A 1YZKA 2DHQA 2ZI7A 2REQA 1KDYA 3KYBA 2XBUA 2PBLA 3H16A 1ZGAA 3A10A 3W3AD 3WU2U 4F12A 2DWPA 4Z51A 4XWGA 5JD6A 4I2FA 2G6BA 2CK3A 4FMPA 5C3UA 1B3BA 1E3TA 2TSYB 2FMQA 3KFVA 5AOAA 1RWBA 4YMGA 2JZOA 4MVJA 1Z82A 4QOHA 3OFSA 1XHLA 1O95A 2PL3A 4MEXA 4TLLB 2H3FA 2JJ8A 5JXIA 2AN9A 3KSAC 3PD1A 1A98A 4AX4A 3GLRA 3IMFA 3NBMA 1FX1A 5EOVA 2OLKA 3R7WB 1CE8B 3EOZA 1UXGA 3C39A 1N1MA 2J09A 2WWGA 2H1CA 1OC2A 1FSSA 5F3RA 2O2XA 5AKIA 4YRPA 4U9HS 4URHA 3B8HA 4JV0A 2AVDA 2ZREA 5DG8A 1QUEA 2H17A 4PRZA 2PRYA 4V0MA 5JC8A 4EG8A 3AUAA 2JGJA 4R3NA 4HAOA 4KZPA 1RBQA 2ZE5A 4LRXA 4OBBA 5DRTA 4F2HA 3NONA 3WV5A 2ESEA 3EPPA 2XE4A 1V9CA 1JU3A 3TW6A 2QT9A 1GR0A 3OG9A 5GWXA 2XZPA 4TMVA 3C2QA 3KIPA 3E35A 2FMXA 3L3BA 1BFDA 1KLNA 5FPQA 1SVNA 4A0SA 5KG0A 5AXDA 1FY2A 3T5CA 2AMFA 2R4UA 1HQDA 1NW6A 4EGAA 1IIBA 1NL3A 1KFTA 3ZW9A 3B52X 3IQIX 4NJEB 3KJNA 2UUBB 2FLNA 3G5MA 1BWQA 5CLFA 2B6HA 4XWWA 1XALA 1YJAA 5IT4A 1GITA 1CJVC 4M1YA 1JR2A 1WEHA 2YYYA 3GB9A 4QUBA 2Q3FA 3QYJA 3IERA 4NY8A 1RQ2A 1WXGA 4GXJA 1JIJA 4AZ0B 2J5BA 3KYCA 3SDZA 4O3QA 1WHSA 1WXIA 2ZBGA 4XPIB 1YT3A 1UFKA 3FYTA 3KXLA 4PZAA 1YCGA 4ZH4A 4MB6A 4YUZA 4ZT3A 4FHCA 3ZHUA 3IO5A 2I2FA 3AMZA 3W90A 1CQPA 1PGPA 2LIVA 3IIKA 3H5VA 4Q01A 3WNQA 4TMWA 2QG6A 3R0XA 1NUTA 3EF0A 1EK1A 3O73A 3EC2A 2AQIA 7ICEA 4OI1A 1DSSG 5LM3A 1ISSA 3ZNPA 4HMQA 1NSFA 3BWYA 3WL4A 3NJRA 5A5DA 4ER3A 3KZCA 5JNUA 4KNVA 4IVNA 3PW0A 4X24A 4QUKA 4Q9JA 5CIWA 1XRRA 5U1PA 1TQ6A 4L8WB 1JJ7A 3MGAA 2AUNA 4N49A 1J9ZA 3DKRA 4EG5A 1N25A 2R8BA 3F73A 2WZDA 3B6MA 3R3VA 3T35A 2BGRA 1A8UA 8LDHA 1BHSA 3MLBA 1Y6RA 3H0KA 3VHXB 2LCIA 1P2FA 4QGHA 4Q7QA 3VNUA 2E48A 3QITA 5H9WA 2DTDA 2X3UA 2BM8A 1R5NA 2IV3A 3E82A 2B6NA 1XNJA 1LDNA 3VNSA 2WF6A 3TADC 3UXEA 4I1UA 1BEUB 2HVIA 4KWCA 2NUAA 1H05A 3SN6A 5JAQA 3M4NA 3L7JA 2JLUA 1N92A 1XCPA 1AXRA 1KI3A 3T9FA 5DDMA 4K28A 1E1LA 2FX3A 5EA2A 4KLEA 2VDKB 1UK6A 2JRZA 3NDIA 3JALB 1FYVA 4DUYB 2C2MA 4PS0A 2PL5A 1YQGA 3LOQA 5CD9A 5AHWA 4DXHA 3ADOA 5ER9A 4G5RA 5EJ6A 3MJCA 4GEGA 2RMKA 1IRIA 2H2DA 1H2AS 2WSIA 3TQFA 2HSEA 3RB3A 4CKXA 3VAZA 5FFNA 4G2TA 1N1EA 2XXBA 4CM1A 4KQIA 5J9FA 5LCXA 3GIWA 2YRWA 3WO0A 4YJ2B 1ZHHA 4EBDA 1H5UA 3VH1A 2ZTHA 3R7FA 4BBZA 3TD2A 3ISDA 1YBFA 1SIUA 4MTLA 4QIHA 4C06A 1NC1A 2QSYA 2P9CA 4MS4A 1IN4A 4KXUA 3IP4B 4S0ZA 4PHPA 2FSHA 5BOSB 1T0PA 1NVAA 1SN7A 4J9QA 3E9DA 4PLYA 1W49A 3OF2A 2IV7A 4XARA 1CEYA 4B34A 4O0IA 2L5YA 3FMVA 1KAHA 2H11A 4GZLA 3SMQA 5U4XA 1ECFA 1SKYB 3IIMA 2KX7A 1XVTA 1KPGA 1A1SA 4PLHA 3QKWA 3V1KA 2XTMA 3FIUA 2VIXA 2IP4A 3ILXA 4WBNA 4WLVA 5A04A 1OJLA 4NMLA 5GJVC 3N9IA 4QASA 1R6VA 4RD2A 3OF5A 3RRBA 4M9GA 3EZXA 4JLPA 2O7NA 4C9BA 1ZN8A 1SBTA 1CUSA 4TQGA 4YALA 3ETHA 4J16C 3IEVA 3TDKA 3K96A 2ZUEA 4IICA 2VUTA 2XCIA 4PS1A 2W0MA 2E4ZA 3H1BA 2XVAA 1TW3A 3S2EA 4C0WA 2HA5A 4BVHA 1PV2A 2BHLA 3GF4A 1UIRA 1BW9B 1JMYA 2DWQA 3PI6A 1P6QA 1MBZA 1T8PA 3EGDB 4P08A 3H83A 4DCMA 2R5NA 1E7SA 4WLFA 5HILA 2Q4EA 2G5CA 4B9EA 2X5NA 4IXNA 1GFZA 2P62A 4DIDA 3O7WA 6REQA 4RQ0A 2DZDA 4F8RA 2NZJA 2AC2A 1GZ3A 1NRXA 3KR1A 1L5UA 1QPGA 4HNAB 1UAAA 1RC0A 3M83A 3CLTD 4HEHA 3JVVA 1YS2X 4KH1A 3UMYA 5LQJA 1D8BA 3B0XA 2I3GA 3HYSA 1TT5A 1Y7HA 1ZQYA 4QICA 1I3MA 5BSTA 2PX6A 1G291 5FWDA 1BDMA 1JILA 2ODPA 1SEVA 1J49A 4IKPA 3OQ6A 2XJ4A 1U28A 1N2HA 2H52A 3VNAA 5LZ8A 2EBHX 4S2UA 1NTRA 2OBNA 3ET4A 3LF2A 4NBTA 2CLSA 2PANA 1T3SA 2ZSJA 4MF8A 2ZU6A 2WSLA 1GSIA 2Z2KA 2DHCA 3RAGA 2KJ9A 3FE2A 4E70A 2AG1A 2GM4A 4URWR 4KXMA 1M2FA 5JWOA 4QO7A 3DO5A 1MO2A 3LVRE 2YOFA 4JJEA 5EJAA 1ISMA 2B2XA 3AHDA 4EB3A 5L3VA 3TI9A 4BFLA 4QU8A 1ZIYA 3QMMA 5G2OA 2LBPA 4MS3A 4CHTA 1LC3A 1EU1A 4LN1A 2AR9A 1ISHA 4BQIA 2ANCA 2QD4A 2BVNA 3TW8A 4MPRA 3K4HA 4FYXA 2XZDA 3JAKB 3QFTA 1N5DA 3T5MA 4DF8A 1SC4A 1C1DA 3BJZA 3GVXA 1VKZA 2QTRA 3I5YA 4KLOA 4ZQBA 5D01A 5KPJA 2EBFX 5F5XA 4B3CA 3PY8A 5HX7A 2KBFA 1PYDA 1OLUB 3RR7A 2VCYA 1YZTA 2FV8A 4Z3OA 4G0MA 4FMBB 2ZJ4A 3TTSA 2HBYA 2J07A 1KZHA 1SZHA 2P9FA 3C8DA 2DQNB 3H2GA 5AHOA 3I52A 2WG1A 4F9FA 2FWJA 3GG9A 2QTWB 1UMDA 2NUTB 2M6RA 2Y1GA 4Y9RA 1SV4A 2RJNA 3DT9A 1WMSA 3QXJA 3B3AA 1KYTA 3GZJA 1AK2A 1VDZA 4ZANA 2RKWA 2F4NA 4YRCA 3F74A 3VGJA 1JFLA 1ULSA 5EP3A 5DCLA 5THXA 3IA2A 1EGQA 2F8LA 1G8JA 4CT0A 3KS9A 4MWOA 2FN4A 5HFNA 3I2JA 4G5HA 5DIFA 3QNMA 2RDJA 4RENA 3E5NA 3AETA 3LY7A 2DUYA 2AJCA 3BQ0A 1V2GA 2QVCA 1JPVA 4BJHB 3GWGA 1EVKA 1XKQA 1NATA 2I4NA 2FFJA 4CV1A 2ZIAA 3FPJA 3ONEA 4Z7OB 421PA 3SHFA 1NVVQ 2H4XA 2YNMD 2ZWPA 5BSVA 4CMJA 4R2KA 1FMLA 3OUZA 1DI0A 1J97A 2HF9A 4JI6B 3A8TA 2VA9A 1YZ3A 2FWRA 4DA4A 4ZYYA 4LWQA 1MOSA 4DCCA 2RBKA 4ZO9A 3UMVA 4KRGA 3ANLA 2ZB8A 2GXQA 4FHGA 4EZ6A 5AKEA 3IAAA 4WVLA 3HRDD 1U7DA 4LDAA 4EKEA 3FOAA 4B5KA 4EW3A 2XLCA 3W4KA 1TKRA 3NEPX 3A9CA 3BWMA 3KQTA 4U2GA 4RSRA 2QOEA 4NYIQ 4B7UA 4C7BA 2G5PA 4EHHA 4RH3A 3A0HU 3KJXA 3NRJA 2PUJA 2M0NA 4HFRA 4HHEA 3AUUA 5B2FA 3HJTA 4Z1MD 3RF7A 4MUKA 2D3DA 1E5LA 4MGEA 5CT8A 3WY9A 2X6RA 2JLZA 4JUDX 1YR9A 5G02A 2YXBA 4MRPA 2X2EA 1UKBA 1NOIA 2W37A 1X19A 5PNTA 3M8SA 5FPYA 1V16B 3U17A 1GN9A 3AEYA 3FYCA 1YF3A 4EA7A 1XTUA 3OT4A 2BFFA 4XW2A 1QTIA 3GFBA 4RA6B 5DEOA 1TD1A 1CUUA 2ZWOA 2YHSA 4LJ6A 5EFOA 3WAKA 4N8EA 3GZNA 3FZQA 5DHQA 2QNIA 5ALRA 3BMCB 3L9XA 5A3SA 1MVNA 5JCOA 4TS9A 4TKLA 1MAVA 3RYFB 3WL5A 5ALHA 5K0NA 3PJRA 4TMYA 1TYAE 1ECWA 2R00C 1JA0A 1I7LA 3D6TB 3PFCA 1P18A 4HZUA 4A36A 5H70A 5J0QA 5DT9A 4YGYA 2DWOA 3WGNA 3M9WA 3V4VB 2C9YA 1WB5A 1PGJA 2V6GA 2R7KA 3T5LA 4EY7A 5JYEA 2H1OA 4LFCB 4HNVA 3EXEA 1T8EA 3CH6A 3SE0A 3WMXA 1HLPA 1XWIA 2FA9A 1L1QA 3CCFA 1Q46A 4Q1AA 2B36A 1QIJA 4M54A 5CFMA 4HAVA 3OOWA 1KA9H 1M8FA 5BV2P 2EZ8A 2JB9A 2O3UA 1DOHA 2ZKIA 2VSYA 3QPVA 1WQ1R 4FLMA 5IVDA 3ZJ4A 4EBCA 3TLGA 4LK2A 2IHBA 2VSQA 4JB0A 3G0OA 3B1XA 3TR6A 2IPAB 3EXG2 4YAFA 2NM0A 2FW6A 4ESHA 5TX7A 3Q6IA 2HA7A 3NX4A 2C7OA 3A2NA 3V8PA 5BQPA 4UB3A 2IEIA 4NK5A 3K8YA 3MCZA 4GXQA 5LP1A 3E3LA 4G4SO 3MWEB 4L4UA 2QAGC 1P72A 3UN1A 4BRWA 5FTKA 2BDUA 4B9NA 5EYPA 1POWA 1SNYA 1JQLB 3A4YA 1F2UA 2QUAA 2HSZA 2JNWA 1K0FA 2ZOSA 2LXNA 1IJFA 2P40A 4FW8A 3LOPA 4F71A 3NGXA 4JVOA 3IE2A 4C4ZA 4RLSA 1WMDA 3TCNA 2PX4A 3B12A 2QBYA 4X41A 4MLPA 3QWIA 1HL3A 4OKSA 1DINA 1C0KA 3I3SR 2OCYC 2O05A 1SXQA 5F7ZA 2ZSFA 1DCMA 4Y18A 3FVRA 4MKGA 5ENVA 4IDPA 3K6JA 4ZEXA 4ER5A 3OCUA 3QVJA 3UCFA 4LNUA 4F4UA 4QOGA 4YYZA 1M67A 2HDNB 5JNSA 3TX6A 1T26A 4MA5A 5BV0A 1SV0A 3TXAA 2ZS9A 4RANA 4OO3A 3CWZA 1NXOA 2RDIA 1BWPA 1BEEA 1K3UB 1YQQA 2QR3A 2GYVA 1U3VA 3B13B 1BCRA 4B80A 4CCYA 4XEHA 2GLTA 4CEHA 2P2NA 2HNAA 1N2EA 2NV0A 2ZSIA 1LNSA 4V2IA 1DC4A 2Q28A 3URMA 4AUMA 1J7KA 4O1HA 4O3NA 3PQ2A 3CZ5A 2OXOA 4I55A 3WGZA 3PX4A 3GIMA 3RLFA 3GMIA 5G0VA 4LK3A 3COPA 4FXPA 1HM5A 2NO1A 4ED0A 4CUKA 4IS2A 1TMOA 1BOOA 2J30A 4P9NA 3R1IA 1WSBA 1X39A 3AVXA 3S99A 5FOSA 1U1IA 3DDUA 1NWHA 4KQFA 1S7CA 4LXHA 4GMHA 4JP1A 3TQCA 4AB1A 2FN8A 4EVSA 2VJKA 3H6GA 3DKIA 1XCJA 3MFIA 4C2BA 5JZSA 3TRHA 3ROZA 4MCAA 4NDAA 1GTSA 3VMFA 1H2EA 2NXWA 3QNUA 3IQZA 4ZV4A 2PD3A 1VKOA 3UGQA 3BB1A 4LYEA 1UK9A 1Z8DA 1QOQB 1Q7EA 4JXZA 4QBKA 2YV4A 4DCOA 1N8TA 1ZQTA 2XD4A 3W8FA 1Q0TA 3DE1X 3U3KA 2QZ4A 2W6JA 2VNHA 1ZS9A 3EPIA 4BPBA 2G9UA 3SCZA 2ATXA 5BVHB 2EERA 2FR1A 3DJYA 1QORA 1O8BA 1PTJC 4K3UA 5HJ7A 4UXIA 3PVSA 2G9VA 1E3MA 3PGLA 4LF9B 2HJSA 3ELWA 3EQ9A 4I27A 3DHVA 1MABB 4NBVA 2BPCA 2A0KA 5GOTA 1T5IA 4H1HA 4IR7A 1NRIA 1DIAA 3BZBA 3RREA 3I0NA 4PPXA 5AKLA 1P2BA 3BD9A 4NICA 4ZYUA 2I8LA 2I6TA 4BVGA 4CIYA 4C03A 4MKIA 3TZBA 2QAJA 3RAXA 3N2KA 3QFRA 3HKZF 2C2KA 2IOQA 2PMZC 4FI3C 3TPFA 1TKDA 5BOMA 1E61A 3DCNA 4JK3A 3NORA 1TJ3A 1GZUA 4RQ1A 4CMBA 2Y1WA 1OVMA 3WLMA 1OQAA 2BSXA 5HF8A 3ULKA 3DFIA 2P9JA 5LYJA 3CX3A 4LXGA 2XSZA 3HFJA 1XQ9A 3RC8A 1UAGA 4WKPA 1G5RA 2UVVA 4GP7A 3KQKA 1MOQA 4LC1A 2KD1A 2NO4A 1NBOA 2PT6A 3CNOA 1SBYA 1GFSA 1YA8A 1JALA 2XMRA 4HGPA 5D84A 2C4NA 3JYNA 1F2DA 1NU6A 3K31A 1X9IA 2HPHA 2OQIA 1H4VB 4D3DA 1QIEA 1S97A 3K9HA 2PJZA 5ILQA 4R1NA 4MPDA 4FNAA 5KSOA 3ME5A 1GKIA 2HXGA 5G1OA 4JC5A 3I6YA 1KEUA 5C4IA 4Q4LA 4RHTA 3BSSA 4AWXA 2NUBA 1EFPA 4DIBA 2Z2JA 3LVVA 1MQ3A 3G82C 3HY3A 3V2IA 4KLTA 4XSVA 4C0JA 1G19A 5LQMA 2EAUA 3A1SA 4KAXA 1UWKA 4R9VA 1ZIXA 3U7RA 3BXHA 1XLUA 5J0YA 3G9QA 2B8NA 5DSTA 1POXA 4TZTA 2HRZA 4TSFD 1D0VA 1GTVA 2IK8A 4B0OA 2IEAA 1TVEA 2XRFA 3UHJA 1LTHR 5HRCA 1IBCA 1E2DA 3EG5A 3MTAA 5G1PA 1EP2B 4JI8B 1XLVA 4ETIA 2AQ8A 1ODTC 3CCBA 1AKEA 4DQIA 1N8NA 4JBWA 5HGXA 6CHYA 5F51A 5KWIA 3PA6A 5KC8A 3NGMA 2FN9A 5FNVF 1B8NA 2FLKA 2NU9B 1OY1A 5HQTA 1BS9A 4FSXA 3WGGA 3D8HA 4IUDS 4JI3B 3BWBA 4LYDA 3SVLA 4R8UA 4C6RA 4UUMA 3U3ZA 5DGDA 1JPNA 3E27A 2VBFA 3A3YA 3WOHA 2FPRA 2G17A 2B99A 4IQFA 5BVGB 1JYSA 1YSCA 3VX3A 1UANA 2Q2VA 3HMQA 4BLQA 5DLDA 5JI3E 1R0WA 1SOUA 3CEHA 4FEEA 4K9QA 3C5WP 4Q8FA 1O6BA 5GVRA 1JIHA 4BWVA 4M49A 5ULLA 3HTXA 4BO8A 3QX7A 1YI1A 3NEYA 4YTEA 4TWRA 7AT1A 3GUHA 4CMEC 4KR7A 2BFWA 2FCRA 3QYFA 4ZEOA 1HG1A 2PKWA 4G23A 1CETA 3M6UA 2I03A 1MCZA 4Z3DA 3WYFA 3EDYA 4B40A 3C5CA 1R9GA 3S70A 1GL3A 5KKAA 3NV7A 1VL5A 4QXOA 5CWRA 4J1TC 5HUQA 2PD4A 4MWEA 2C7PA 1LTKA 5EKDA 1GZHB 5JBQA 2KOBA 1PEYA 2FE1A 4YK7A 3K32A 3CVOA 3U61B 2XXJA 4J29A 3AVVA 4OUDB 2OZEA 3QVGA 3KO8A 1J99A 2Z3VA 2Z5VA 3L7MA 4CF3A 4C0LA 4WL0A 3U16A 3DMPA 2TMYA 5CYFA 2WDZA 2AGVA 1LLQA 1VJRA 4IOKA 2ZTMA 4RXMA 5ECYA 4Y9DA 4W5JA 1BGXT 1A2OA 1NKSA 3GD7A 1HXHA 5JRZA 1ACMA 3BXGA 4PYIA 2MTBA 3P8ZA 7ICKA 1YONA 3R0VA 1VYTA 4KVAA 3LWDA 1RJWA 1RC8A 3PMNA 1D8AA 1Y6QA 2V3CC 1V8ZA 1JFVA 5KFRA 2BJWA 1HNNA 2G3YA 4A6XA 2A6PA 4FDUA 4C0AC 4L5IA 1FFSA 5JDIC 4O4HF 2GF0A 4WVFA 1QSGA 3NHZA 3KTDA 4UREA 1SG6A 1X2BA 3L6BA 1WF6A 1AUVA 2BCSA 4HPXB 4JLBA 1NBAA 2G9ZA 1KBUA 3P9CA 4FMCF 4Z9XA 1W19A 4B7ZA 3AERA 3INTA 2X58A 1YFKA 3BGIA 3OPYI 4OQNA 1Q15A 4RNCA 5JVDB 2TECE 5EKTA 3CH7A 3IEPA 4BO9A 4QZEA 4RPYA 2ILVA 2PUCA 2ZU0C 2Q4DA 3C5GA 1U1EA 3RKSA 1JQ3A 1ORDA 4JI2B 4ED6A 3IUNA 2IQ5A 1UMCA 1GG2A 3UPQA 5IJAA 2FJ6A 1I30A 1RQGA 3CXUA 2F55A 3MOGA 2YHUA 4LTDA 1R5OA 4DSFA 1USGA 2O8FA 2AXPA 3Q0TA 4IIEA 1Y5LA 3JRNA 1E6KA 4OSPA 4GICA 4L7QA 4Y1EA 3LYSA 3AVQA 3L1UA 1H93A 1E98A 2QSZA 4OYLA 1A1VA 1S2NA 5CA0F 1XZLA 3VC3A 2VZLA 3E2IA 4RQ2A 3N05A 3NGDA 3SQOA 4CL2A 1ZWLA 3UV7A 2O2SA 4L2IA 3IVRA 1N2CE 4ASUA 2GPYA 2Q0SA 5DHAA 1U2TA 1GKLA 4GG1A 3PKJA 3HSSA 1U8YA 1IN5A 1N63A 4RHFA 3TKLA 4NU0A 1B76A 1I2CA 3KKOA 2IX3A 2A9QA 1PJ2A 1IOLA 1OXUA 1TE2A 4ZCTA 1T25A 1C3LA 2RGGA 2C4VA 2RARA 3R09A 2C5GA 4L4RA 2Q5CA 1DFIA 4PG8A 4IFIA 5DBEX 1IEXA 2D2FA 1C9KA 4A23A 4MVJF 2I9PA 1VMIA 2Q6KA 1L5NA 4HDRA 1VDMA 3BCRA 3BG5A 3PV0A 1DQSA 4Z4CA 2DFPA 3LXXA 2XLBA 4CLOB 1HDRA 4G4JA 3E61A 2CHGA 4WINA 2OC9A 4DHWA 4MA4A 3K0AA 3A36A 3DFUA 4Q8EA 3C41J 3GT4A 4I4LA 4J4TA 4MINA 2ECFA 3NHSA 1THMA 3HEBA 4MW4A 4HQLA 3SHWA 1Y3HA 3BXFA 2N46A 3NRCA 2V5AA 2I6XA 1A8QA 2WICA 4C5BA 2V98A 2G07A 3Q7EA 2ODEA 3A1UA 4EUFA 2WYIA 4DPMA 3VU8A 1RAHA 2YJ3A 2ONYA 4PLCA 1ZSNA 4E32A 3NTXA 4BGDA 4MZXA 3H4BA 5ALXA 3RVNA 2XIJA 4LJKA 4FP9A 3S1SA 2DC1A 5TRTA 3L1JA 3DZGA 4BNKA 1U2DA 3RNOA 1JSLA 5EFZA 1NJWA 1KVRA 2ZCUA 4H6WA 3V7WA 3E23A 4XYLA 3AEKB 3IB3A 4ZPJA 4ARIA 1LPNA 3N8DA 1T5DX 5IHPA 1IG3A 5DHUA 4HXYA 2LVBA 5AJHA 3ZD6A 5TQVA 1GAJA 1Z6YA 4FJ0A 2QXYA 2ZZKA 5AW6A 3NWEA 3OJUA 1IONA 4C6TB 1KZ9A 3U44A 3FCYA 2WMYA 4QT0A 3S7ZA 3I2HA 5H4GA 3FPSA 3D6VA 3Q9SA 4BE9A 2GUWA 3GRPA 1PFVA 5T41A 2JCVA 3RUDA 2VLBA 2PWBA 3GEMA 1QGDA 2EDCA 4QUDA 3X2SA 3L7OA 3MYRA 4L6CA 1JA9A 4RNDB 2FUCA 1ICEA 1XFAA 1RKQA 2VTEA 3DV2A 1LX7A 3SZUA 2XUKA 4FONA 3ESAA 4IGIA 2YHIA 4QZBA 4BCBA 3L8GA 3JQ9C 3W0LB 2PBZA 2F1JA 2F3TA 3NOQA 5L45A 4GNKA 4PX3A 4AF7A 2QG9A 1OW5A 3PQ8A 4IXMA 1LGYA 1ZMTA 5BMOA 2OXRA 5KWJA 3A1CA 3MW8A 3PPIA 5LPNA 1NBWB 3H0MB 2PFOA 4R16A 4QOFA 2CNBA 1OW3B 4N5IX 5EJMA 3FSRA 4L8FA 4WA7A 1SPXA 3I39X 3LIIA 3JQAB 3WQBA 1NR7A 3ZXXA 4EG0A 2PH5A 3NM4A 4LJYA 1WPGA 4XM2A 2XCOA 2WKSA 4QPJC 4CKCB 5EY5B 1P8JA 1WCLA 4DJAA 4UVIA 5AI5A 1EWKA 5KOHA 2QAGB 3GCXA 1DB3A 5KFWA 2EGHA 1MA3A 2OBLA 3WKCA 5ECGC 5HRUA 1DK2A 4J9PA 3WLFA 5K0SA 4GD3Q 3AVYA 1OX4A 2COEA 2WJHA 1UBTS 2A58A 4QDOA 4GWGA 2FJ0A 8ICGA 3Q2KA 3Q8RB 1D2HA 1O97C 4E15A 2OWEA 2Y9UA 5BW6B 3QVUA 4BLWA 3I37X 1JHAA 2WEKA 3PICA 3V4ZA 1NYTA 1UC5B 2C59A 2YQZA 4QJ5A 4OQ4A 1PWEA 5JQGA 1VC2A 4Q4HB 1SHZA 1QS0A 2GHIA 3GQCA 1GOTA 3GJ8A 3T15A 4D9KA 4YQYA 2JFXA 2SCUA 1HEUA 2J9RA 5FPSA 1WQ3A 2IA6A 3WMGA 2QD5A 2AFHA 1GPNA 3O84A 3E5MA 1LC0A 4BP1A 3KZOA 1KO5A 4G65A 2RKOA 3MLEA 4DUGA 3FSGA 1BCSA 2HDHA 1DIRA 1F12A 3KEMA 2B7CA 2QT0A 1S02A 4P5DA 5HKKD 4F46A 1PWYE 5GZ3A 1FDSA 1MA0A 4NZNA 2PYZA 2DETA 2W2NA 3AN1A 1X2IA 2HGSA 1M2GA 3AFIA 1GGHA 1NN3A 3HEAA 1C9JA 3ER9A 1K89A 2XQIA 2QVZX 1D1TA 1Q57A 1ZJZA 5IKMA 2PFKA 4KIUA 5G0UA 1F0KA 1YZVA 4GZMA 5K0CA 3OHPA 2Q0HA 5IT0A 3M6FA 3R20A 3E53A 3WGHA 3L0CA 4JLVA 1TKAA 4FE7A 1SUAA 2WJPA 5LKAA 2WHQA 3OEED 4WBNF 4B9VA 2D6FC 4UB8U 3QXGA 4D26A 1NQXA 2GM9A 2I7CA 1D4ZA 1CR4A 1ONSA 3HXKA 3RYCA 4CQMB 2IRWA 3DLPX 2F9LA 2QX6A 2WT9A 4WLNA 2WILA 1S3IA 4L5YA 4R9UC 4PICA 4RHYA 4UUPA 3FOCA 2CJWB 1JHQA 3KLMX 1UFRA 4LEIA 4CZ2A 1UBFA 4KH0A 5REQA 2AHOB 5T6BA 1S5LU 1EK5A 1J0DA 3FKSA 2OBBA 4U2DA 3FDIA 4M0EA 2ET6A 3MSCA 4KLAA 1FVHA 1C8LA 2CNWD 1XTIA 1FP4A 5LIPA 1ECJA 1OGIA 3CG4A 1HUZA 4MYTA 3BILA 1A9RA 3A1NA 4MV7A 1OFVA 3FUVA 3QZUA 3Q9UA 1J2TA 2DJIA 4D02A 5TEWA 3F8TA 4AQYB 2IOYA 5E95A 3PGJA 1ABFA 4HGNA 2JCBA 5EQJB 2AWOA 1SBCA 2LKYA 2XADA 1LXCA 2R0QC 4MRRA 1KETA 5JAHA 2BHRA 2A14A 3N6VA 2IH4A 4YRZA 4R40A 1W88B 4Q9AA 2J33A 3BXPA 3T3EA 2KG5A 1EK6A 4XIIA 4G81A 4EHFA 4PZZA 1WW3A 1J2EA 2ZYWX 5KYNA 3SJ7A 5E3HA 2IHZA 5KSYA 3KKNA 1EJ6A 2QQFA 3RV3A 2ZIWB 3IOMA 4C88A 1MTZA 1IH8A 4FIZA 4LXIA 4AY2A 4O4LB 4I1OA 4AZ3A 1V8BA 4G56A 5B1DA 1ZRHA 1PJ4A 2QSJA 2Q3BA 3D8RA 3QJYA 1I14A 3F67A 2UUAB 3Q85A 1UPBA 2Z9DA 3CLRC 3VC1A 1GCOA 3NVZA 4PHCA 3V7UA 1WP9A 3H0RB 1P1BA 1C3OA 1A2QA 1DAIA 3P9PA 2ECOA 4UW9A</