4M6WB

Crystal structure of the c-terminal segment of fancm in complex with faap24
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
190
Chain Sequence
b'HIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fanconi anemia group M protein
publication title Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 48
structure length 190
sequence length 196
ec nomenclature
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m6wB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m6wB01
1DGSA 7ICEA 1SZPA 5JUMA 5C5JA 2IBKA 4DFKA 2IHMA 4IR9A 3C5GA 2XCAA 2AU0A 1TAQA 3MDCA 9ICAA 1EXNA 5IIMA 1B43A 3H4BA 2ZTEA 5DLFA 3RTVA 3RJIA 1SL1A 4F93B 4EZ6A 9ICRA 2JEGA 4I2AA 9ICKA 5D46A 3JPTA 9ICCA 4F5PA 5KT2A 4O3QA 7ICLA 3HP6A 2V4QA 4CCHA 1ZQVA 4QWAA 3GIKA 4RNNA 1D8LA 3RJGA 1TFRA 4YMMA 1L3UA 1ZQHA 4UB1A 1IXRA 4ECWA 4B9SA 4LZGA 4F4WA 5J2DA 4M0AA 3ETLA 3BQ2A 2IHNA 1NK7A 4Q8FA 3LWLA 3PW5A 3V7KA 3TAQA 7ICMA 4QZBA 3RB3A 4MEXA 4ED7A 2XGQA 1QLNA 5J0TA 4JV1A 3C23A 2ZUBA 3C2LA 2F1IA 3ZDBA 5CJ7A 4FS1A 4FS2A 5IIIA 2BPFA 5KFUA 4YCXA 1XSPA 4F3OA 3AU2A 3H7IA 5KT6A 5KT7A 5DDMA 3QE9Y 1KFTA 2GWSA 4PGXA 3V72A 3PX0A 5KFGA 3M8RA 4C8MA 1SKWA 3E2EA 5IILA 2W9BA 4J9LA 9ICQA 4RPXA 3GFKB 8ICXA 5KG0A 4UBBA 4F5RA 3C1ZA 2NRTA 5EOZA 1HUZA 3JPSA 5DB7A 1WCNA 4RT3A 5KFFA 5F9NA 5HNKA 3PMNA 2ZJAA 1RXVA 3KHRA 4DQPA 3GIMA 4I2EA 3MR5A 2JNWA 1K1SA 2C2DA 1ZQLA 4RNMA 3UPQA 1NKEA 5J2CA 2PFNA 2NRVA 4YVZA 1HJPA 4RQ0A 4MF8A 4DLGA 4RQ8A 2BCRA 9ICJA 3RAQA 8ICOA 3IM1A 3EW9A 5BPCA 5KG2A 5J0PA 1N48A 5CHGA 4RQ5A 4RQ4A 5DB8A 3PMLA 4J9RA 3Q8MA 1NKBA 4F5QA 1X9MA 4NLNA 1ZQNA 1XSNA 4YXMA 1ZQZA 4MEYA 1L3TA 1ZQRA 1TK8A 2UVWA 4TUPA 2OWOA 4I28A 3Q8KA 3GQCA 3HPOA 3QZ8A 3V7LA 4O5KA 3C2MA 4KLQA 4O3SA 4O3PA 1ZQAA 5HP4A 2BCSA 1UT5A 3RB4A 5HMMA 1SKRA 4GC7A 4DFPA 2J6TA 1X9SA 3M9MB 5J0XA 5CP2A 2ISPA 1XO1A 4ELUA 7ICNA 3ORYA 3GV7B 2AGPA 3Q8PB 3PV8A 3OJUA 2J6SA 5BOLA 1S10A 5J0WA 1NK5A 3H40A 3KHLA 1NK6A 4B9MA 3GILA 4ECUA 3GDXA 3PW7A 1KFDA 2H5XA 4BGDA 4QZFA 8ICWA 4QWEA 1NOMA 2BCVA 1JX4A 4QZEA 4O9MA 4R8UA 1TVAA 2JZBA 1AROP 1V9PA 3ISBA 4TQSA 4J9NA 1MQ2A 4KLUA 9ICOA 4UAWA 3UXOA 4IQWA 5KG5A 4DF4A 4P4PA 3JPQA 4F5NA 4EBDA 4PGQA 5DBCA 3SV4A 3V6HA 4EEYA 4RPZA 1H38A 4KLIA 1L5UA 1TK0A 2HHSA 4DQQA 2VA2A 4DF8A 1MC8A 1NJZA 2FLLA 1XU4A 4M9NA 1CUKA 2W9CB 4DSFA 3OJSA 2DPIA 1JN3A 4DQSA 4M9LA 4M6WA 4KLDA 3MGIA 2UVRA 7ICOA 4F92B 1HUOA 1ZQPA 1B22A 1BPBA 3N97B 5KFSA 5DG9A 5DQIA 4JUZA 4P2HA 3K75D 3B0XA 4YFKA 5DG8A 4RNOA 5KFZA 4DOBA 1RXWA 2FMSA 2HHXA 2P66A 4KLOA 4YG2A 2W9MA 4Z6FA 5L1JA 1NJWA 3EWAA 4RZRA 4C8NA 1ZQWA 5KFCA 2XY5A 1ZETA 1ZQFA 8ICPA 1U9LA 3OSPA 3SYZA 3EPIA 2M9MA 3PO4A 3MR2A 4YQWA 3RJKA 4DFJA 2HVHA 5J29A 4DQRA 4B9UA 4JV0A 1TAUA 4F4KA 4KLJA 4PHPA 1KSPA 5IINA 4M9GA 1XSLA 8ICSA 2ZJ5A 2AGQA 5KFIA 3C21A 4BWMA 1KTQA 2XY7A 5J2AA 5KFJA 1XS9D 2HVIA 4NLGA 2AQ4A 5D4BA 4NM2A 4ZH4A 1ZQOA 1BGXT 4NXZA 1U47A 1JXLA 4M04A 2A1JB 3Q8LA 2BCUA 2KZMA 4R64A 7ICSA 3OGUA 2ISOA 4O0IA 4DSLA 2M9NA 2NRXA 4IR1A 4JV2A 4MFAA 2F1HA 4ED2A 4UB3A 4F4ZA 7ICTA 3QEBZ 2JEFA 4C8LA 2MUTB 5J2HA 1ZQXA 5BOMA 2HHTA 3RJHA 1ZQMA 2Y1IA 2KZ3A 2R8GA 3FDSA 4QZCA 5KFPA 3MDAA 2R8JA 8ICTA 4RQ7A 1NK4A 1TKDA 4YR3A 1QSYA 4JWMA 2ZTCA 3JPNA 9ICWA 4MFCA 4RQ2A 4DOAA 4QWDA 5KFHA 1SL2A 3H8SA 3V7JA 1KRPA 4UB5A 4DSIA 3C2KA 3MR3A 4ECSA 4RPYA 5DGAA 5KFQA 1BPXA 2BDPA 4DL5A 3ZD8A 5IIJA 4QZDA 3OHBA 3M9NB 2LYHA 1ZYQA 2HW3A 3MFIA 3THVA 3TARA 2A1IA 4P0PB 2RDJA 2RDIA 7ICRA 1IM4A 4MF2A 2ASJA 5DKWA 3K4GA 4NLZA 1S0VA 2FLPA 5KTQA 1TV9A 1UA0A 4KLGA 3EPGA 4GXJA 4F2SA 2AGOA 3GV8B 4EBCA 4R63A 2PFPA 4KLLA 4Z6CA 4O3OA 5KG6A 3QEAZ 1ZQQA 2ASDA 3BQ0A 1L3SA 4UB4A 5DQGA 2ZIVB 4DFMA 3Q8SB 8ICCA 2BQ3A 5L1IA 3GIJA 4XRHA 4YMOA 4QWBA 4I2CA 4ED8A 2UVUA 3KTQA 9ICHA 3HWTA 3BQ1A 2Y1JA 4B9LA 2W8KA 4KLMA 3PNCA 4BXOB 2FPMA 3RH6A 2ZUCA 2ZTDA 1XC9A 4R66A 2V9WA 5KG7A 9ICSA 1QSSA 8ICQA 4ED1A 5J2GA 4J9PA 1X9WA 4P0QB 2B21A 1N56A 1BPDA 4ELTA 4ELVA 9ICNA 1T7PA 4KTQA 2ZIWB 3V6KA 4KN4A 5HHIA 4RQ1A 3T5HA 4PGYA 8ICZA 1ZQGA 2VA8A 4YXJA 1SKSA 4DS4A 2VA3A 4F91B 4FBTA 5DBAA 5J0QA 3OHAA 4O3NA 4EYHB 1ZQDA 1ZQEA 1Y88A 2MAXA 4R65A 4I29A 4Q8EA 4EYIB 4DO9A 5KG1A 3MGHA 2NRZA 3C1YA 3MFHA 4UAZA 2PFOA 1S0NA 2HHWA 3FYHA 5KFXA 4IQVA 8ICFA 1ZQKA 4LZDA 1ZQUA 1UA1A 2ZIUB 1K1QA 5L1KA 2WTFA 3RRHA 3V6JA 4GXIA 4DWIA 4YMNA 4UB2A 5KT3A 2C22A 4M9JA 3BDPA 3ZDEA 4UQGA 3RJJA 4ECRA 9ICLA 4C8KA 4BWJA 2AJQA 4J9OA 3ZDCA 2BHNA 4ED0A 7ICQA 4I2HA 2XO7A 4DL4A 1S77D 4TUSA 2ALZA 1U49A 2BQRA 4DSJA 2XCPA 9ICVA 1T3NA 1QTMA 4I2BA 4DSKA 3PVXA 2AQ0A 9ICTA 4KN7A 4KITB 2KN7A 2BQUA 1TK5A 3H8WA 4ECQA 4K4IA 3RRGA 1RYSA 4C8OA 1X2IA 9ICXA 4P4MA 4JK1A 4DS5A 3RB6A 2HHQA 1BPYA 9ICIA 2C2EA 4KMUA 5J0YA 2ZUDA 4IRCA 1S0OA 3UXNA 4IRDA 4Z6EA 5DLGA 4F4YA 5KFAA 1NJYA 2NRWA 8ICBA 4DQIA 1LV5A 1S76D 7ICPA 2XY6A 3UXPA 1Z00A 5F9LA 4Q44A 4TQRA 3RH4A 5DBBA 8ICMA 8ICAA 5CR0A 4RU9A 3JPRA 4QWCA 4YR0A 3N4MB 9ICBA 4I2GA 4O5EA 7ICKA 3HT3A 4J9KA 1ZQSA 4ED3A 1A76A 5KFLA 3GV5B 3H8JA 5KT4A 1RZTA 3PO5A 1BPZA 4I27A 5KFYA 1J24A 5KG4A 5J2JA 3TANA 1KLNA 4TURA 3SZ2A 4E0DA 4UAYA 3G6VA 5KFVA 4GC6A 4DL2A 2W9BB 2ASLA 2KZZA 7ICIA 3AU6A 5J0SA 3RR8A 8ICLA 3Q8QB 4B9VA 7ICHA 2PI5A 4DEZA 3HW8A 9ICEA 2R8IA 2W9CA 2BR0A 3ZDDA 4TUQA 4F8RA 3EYZA 5KFRA 4XQ8A 5CWRA 2F1JA 4RQ3A 3H4DA 4PH5A 1PZNA 3AUOA 4B9TA 3UQ2A 3RJEA 4XUSA 4RT2A 2FPKA 1KFSA 5EWEA 9ICGA 4QZAA 8ICUA 4UBCA 5DGBA 3PX6A 5TZVA 4EZ9A 5J0UA 4PHDA 1UT8A 2XGPA 3TI0A 5IIKA 4NM1A 4XA5A 1JXEA 1RPLA 2FMQA 2JPDA 3PR4A 4I2DA 1L3VA 1T4GA 4YP3A 2P6UA 4P4OA 4K4GA 2ATLA 3B0YA 4FO6A 3SI8A 2J6UA 4YD1A 3RJFA 4QZIA 7ICGA 8ICGA 3NTUA 3LK9A 3G6XA 3OSNA 1C7YA 1A77A 2I1QA 4F50A 4KLSA 7ICFA 2JEIA 3PR5B 2UVVA 3EZ5A 4IQUA 2C2RA 1SL0A 1NKCA 2DPJA 1QSLA 4GLXA 2PFQA 5J0OA 3M9OB 2A1JA 4G3IA 1J23A 4I2JA 2BCQA 2W8LA 3TFSA 1KEJA 4DLEA 1D8YA 1J25A 2R8HA 4F4XA 4ECYA 1RYRA 1BVSA 5D49A 1ZQBA 2IA6A 4YN4A 8ICIA 3GIIA 5KFNA 4IRKA 8ICVA 3ISDA 3IHQB 4M9HA 3Q8RB 2MUTA 2HHVA 4ECTA 4ED6A 5KFOA 1U48A 5EWFA 3UQ0A 1XWLA 2HHUA 9ICFA 4R8UB 2JZBB 8ICRA 4Q45A 7ICUA 5HMLA 4QZHA 4GXKA 4ECXA 4DSEA 1MSWD 5J2IA 3PW2A 4QZ8A 5KFTA 3TQ1A 3PW4A 1ZQIA 3ZD9A 3RB0A 2PXIA 1ZJNA 4Z6DA 8ICHA 8ICNA 3RBDA 4DOCA 2BPGA 4B9NA 2FPLA 5KFWA 5EWGA 5J2BA 4KLFA 1D9DA 3MR6A 3HX0A 3RAXA 4NLKA 1ZJMA 4KLTA 4J9SA 3RBEA 4M6WB 2VANA 5DQHA 4RUAA 4Q43A 1NJXA 4ECZA 2JEJA 5L9XA 5J0RA 4DL3A 4M47A 3MBYA 4F5OA 3KHHA 3C5FA 4DL7A 4JWNA 1NK0A 4M2YA 1ZQCA 4RUCA 4MFFA 3ISCA 2BGWA 1T8EA 1ZQTA 1MQ3A 2I9GA 2FLNA 4I2IA 3SV3A 9ICMA 4I2FA 4ECVA 1LB2B 1Z3EB 5CA7A 2KFZA 4YD2A 2IMWP 4O3RA 4PHAA 4KLHA 1ZQYA 5J2FA 4QW8A 4IQTA 3G6YA 3NGDA 3TAPA 5IIOA 3QZ7A 4J9MA 3T5LA 1D9FA 1S9FA 1JIHA 3KHGA 2ZIXA 5KFEA 1S0MA 5J2EA 4K4HA 5KFBA 4BXOA 1Z00B 2BPCA 5J2KA 5KFMA 5KT5A 5KG3A 3M8SA 2V4RA 2ZJ8A 3BJYA 4J9QA 1U45A 4FBUA 4KLEA 2KFNA 1NK8A 1JMSA 3LDAA 2KTQA 1J22A 4PHEA 7ICJA 4PPXA 2Q0ZX 8ICYA 2XC9A 1WCLA 2FMPA 1KDHA 2PI4A 8ICKA 1CEZA 3ZDAA 4EBEA 4QW9A 3RH5A 3BQTA 4RQ6A 1U4BA 4F2RA 9ICPA 1COOA 5KFKA 1S97A 2DFLA 5DB6A 4NY8A 3PY8A 1BPEA 3LWMA 4QZGA 5DDYA 3T5JA 2C28A 7ICVA 2R8KA 3JPPA 3PX4A 2P6RA 4O5CA 9ICUA 8ICEA 3T5KA 3T3FA 5KFDA 5CB1A 1DOQA 4BDPA 4QZ9A 4X5VA 8ICJA 4YR2A 5HHHA 2W9AA 4DL6A 4HYKA 4LVSA 3PW0A 1ZQJA 3JPOA 5DB9A 3MABA 1NK9A 2BKEA 5L1LA 3RR7A 5DG7A 3TFRA
chains in the Genus database with same CATH superfamily
5AKLA 4CM9A 2K2WA 1NP6A 3SXPA 2Z4SA 1DBSA 2XSZA 2P9BA 1Y3CE 4PZLA 1TYAE 3V33A 4GKBA 1R9GA 5A9TA 4X7BA 3K0AA 5EJ7A 1RRMA 1UK6A 3O8OA 4TTRA 3CB2A 3VZBA 3OZ7A 1RCUA 3T5DA 4L5IA 1RACA 3EIEA 1WVGA 3ZDYB 1N0WA 5G3ZA 1S7GA 5EE5B 2BZ0A 3I2GA 3M5CA 4U00A 2PT9A 4EMBA 1MQ8B 2L19A 2VTBB 3PTZA 1GRNA 3HJEA 1CNEA 5JCJA 3F47A 5HFAA 3ODPA 4BKQA 3ZCUA 2VXBA 3V1LA 2PUEA 4C0ZA 3G2KA 2Y05A 2QUZA 2JH3A 3DAOA 3KTOA 1MAHA 4B46A 3M7DA 2IELA 4LX8A 5DBHX 3R6LA 1ZSYA 2EKBA 3Q8WA 1L7EA 1JX4A 2PX4A 1AROP 1TZKA 1IBRA 4BTVA 1J9EA 4G65A 2Q0HA 4G5YA 1SZJG 4LVNA 3DA8A 2JBWA 2ZQZA 4M6WA 2G80A 3GG9A 1W59A 4DXAA 4DQDA 3SK0A 4NU8X 1ZC3A 1RYFA 4LSMA 4YG2A 3OCCA 2WZCA 2JGDB 3BFKA 2WKQA 3F9RA 4FD3A 1A7KA 4U7GA 2G09A 1O94A 1M5TA 3CRZA 2HSZA 2ZBFA 5E9JA 6ADHA 2CL0X 1HDZA 3VKHA 4GYYA 2C2XA 4HQOA 4HDKB 4KNWA 3F3YA 2Y1IA 3MDAA 1XMSA 1EFKA 1HO3A 1EMDA 3VFDA 5DM70 3WLFA 2ZAIA 4C04A 3BTVA 3CH7A 4EOGA 5CAEA 2EWWA 1HGXA 4OY3A 3GJSA 3AL2A 4Z6CA 2OCLA 4P7BA 4JVMA 5L3QA 3NKLA 2Y1KA 3RBXA 1EX1A 5LNK6 3Q3VA 5IUNC 4KTQA 2FPOA 1C8VB 3EOBI 4C4ZA 4M1EA 4ZTUB 2IP1A 1HFKA 4UTVA 3K0BA 2DEUA 4HB0A 1L7VC 3OHSX 2AJCA 1HIWA 4FR2A 2JLVA 3WQQA 1ZI8A 1N6LA 3CW2C 1BEEA 1ITZA 3SEFA 3RB6A 2CFIA 3E70C 4CMCA 3B1VA 3HJGA 2WUDA 2Y77A 5EJ2A 1K08A 4FYKA 4PVCA 2WUEA 3HM9A 4HSGA 3WC4A 1K6JA 2RKBA 4ZWNA 2YMMA 4OU4A 3ASVA 3RSHA 4MK4A 1Q5PA 5AVZA 1ZG3A 3AVPA 4O5OA 3AR8A 5IVIA 3A4LA 1SIUA 2D6FC 1RWVA 3VNQA 3GNQA 3FC4A 3ICXA 2PS9A 2YYAA 1NKTA 1K1EA 4KV7A 4DV0B 4JLWA 4H1TA 4GBMA 1RI3A 1G20B 2KM1A 3U5ZB 2BYTA 1KEJA 3QA3E 1SKBA 4HDNA 4PHCA 3D7NA 1CHNA 1MZVA 4ZYWA 3S81A 4BATA 5BYAA 2X41A 2LTAA 1P81A 4QAQA 1ZM4A 3A37A 3JD1A 4X24A 3CLSD 2FPLA 1GL3A 1ZD2P 3DCYA 1F9AA 3KOMA 1TYCA 2P90A 5ERYA 3ZBTA 1WMDA 1G66A 1FLDA 1YE3A 4RZQA 2FZ4A 4YN3A 2VJ4A 5IIOA 4JR2A 2VJQA 2AXTU 3JZMA 3TJZA 4PHEA 4J94A 1Q7CA 1QPGA 3T79A 3P9CA 4CM9D 5AHRA 4W5WA 3PY8A 4P92A 2XSZD 4M87A 5G1OA 4YHBA 4YP7A 1KI9A 1EP1B 3PUVA 4GR9A 3UKOA 4NDZA 1UBCA 2AG8A 4DAOA 1KRHA 2GEDA 4YJKA 1TAQA 1W1UA 2XOXA 1G5TA 3O91A 3R5FA 3WGIA 5FORA 1KAGA 2P30A 1PNOA 2AOXA 3DPIA 1PF7E 3ETNA 4P08A 3RUPA 3PKZA 1Z8NA 2V5UA 4IXTA 3E1KA 1Q7RA 5CYOA 3RYFB 3TQCA 4IHKA 3JQEA 5FRDA 1EB8A 2DR2A 4JQCA 3QWFA 3ZV5A 1AXEA 5JYBA 2FPWA 3V8RA 1XXLA 1M1NB 2WQZA 3CE6A 3I8XA 5F2NA 3HLKA 4GZ6A 1S3IA 2CDNA 5G0VA 3W0LB 4FT2A 3HCAA 1LVGA 2ONKA 1OUQA 1IG0A 2PX3A 2H4FA 2EXXA 5DI3A 3B51X 3EUFA 4MO9A 1G8PA 2KBFA 4OGWA 4WEOA 2R1TB 5A0VA 3ZGNA 1ARZA 4AF7A 4OOEA 2X5NA 3HB5X 3PPVA 1DAOA 1BZYA 1L5UA 3VPHA 2B34A 3BCUA 1PFUA 1O94D 3FPFA 3VC8A 4WNAB 5C1OA 1EE2A 3U3DA 3DKVA 5DU2A 3GFFA 2W43A 1JKMA 5TEVA 3GJ8A 4MAAA 3BWXA 3CLRD 1Y80A 2MYTA 4KIJA 4NLGA 2EKDA 3FHJA 4CFYA 1DX4A 5DHUA 2EJWA 2BFEB 4G1UC 2A0WA 1JALA 4C8LA 4C4XA 2WT9A 2FW0A 5D3ZA 2REXB 1YC5A 4JJAA 2WFLA 1IM4A 3W1EA 3BN3A 2E18A 4JB0A 2Z4TA 2WTAA 1TW2A 3L5OA 5BOVA 3EWIA 2CKMA 3GEHA 1D4OA 5KYUB 1BEUB 3EIHA 4DT1B 3CGGA 1DCTA 3BAZA 1EP3B 2GBPA 5AM0A 3UQYS 4RY0A 3I9NA 1T7PA 4DM7A 3WYCA 3SKXA 1TC1A 1ZQGA 4FIDA 5EWJA 3NM6B 1B8VA 1CJUC 5CK5A 4AJLA 5E2AA 2FF5A 2ZRFA 4RFSB 4OU5A 2FP3A 1IN5A 1X9HA 3MERA 2V65A 1AQUA 1NV9A 1IBMB 3NNNA 4G0NA 2IX3A 4X8HA 3NV9A 5E6UA 4ZV9A 3FFTA 2OEPA 1W5SA 3ZZ1A 3G9XA 2W6OA 1QP8A 2B5OA 1GAJA 4JT4A 1PR4A 3OT1A 3Q10A 2GNPA 3PC8A 7MHTA 4U5QA 1U5AA 5AW6A 1JAIA 2CB0A 2H4XA 2R6JA 1QRSA 1E7MA 3SEZA 5CM2Z 2DT5A 2EJVA 2YB4A 2YMPA 1BPZA 3O1HB 4YRIA 1YJXA 4PWZA 4ZQEA 3G6VA 2QR5A 3FJYA 3NBAA 5CFMA 4GP7A 2PBZA 5CLHA 4PH5A 2JLZA 2IXAA 2GCOA 2B0CA 3GLRA 3PUJA 1JVBA 3Q5EA 4P4OA 1F7VA 2NXWA 2JI9A 2G1PA 1PK3A 3NM4A 3ZDFA 5HDBB 5JS1A 1DAIA 4EF5A 1PGOA 1N2XA 2W6JA 3DZKA 3IHQB 3B1KA 5IJZA 3V5NA 4E5MA 3TNYA 3V9AA 4JQYA 5BUZA 2O7QA 4K40A 3LQ1A 3FHOA 2O6HA 4F46A 4RD3A 3N8DA 1JB9A 1OI2A 2YDYA 1PV4A 7YASA 5A2GA 4B4KA 5FDFA 4CLDA 4JA2A 5B5SA 2FZ5A 3KDPA 4JLVA 5J2EA 4RLHA 4AKIA 3M8SA 3L46A 4HZIA 3ZGZA 3H0CA 4L8YA 4JP2A 3RBZA 1T43A 3BRWD 2IOHA 4TKVA 3L7DA 3WGVA 4AZ3A 4D9HA 3F5AA 2XCSB 1Z37A 3P2IA 2CLKB 1YE8A 3NFYA 5ITZB 1BYUA 4HWPA 3JQFC 2ZAYA 4FCCA 4IR9A 1PTKA 4DHEA 3MMXA 3WZ2A 4C21A 4RE5A 5AI9A 1I6MA 2J0EA 5UKDA 3R5TA 3SMVA 3KU1A 3LT4A 1ZQVA 2AN3A 4NVRA 4DQVA 4ECWA 1M7GA 4F06A 1HNNA 4DQ0A 3DL7A 4QJBA 3EC7A 2HTEA 2K6GA 1AGPA 1PJLA 1CLEA 1ESCA 2GEUA 2QU8A 3NALA 4LE2A 1NMSA 2CSXA 3N2KB 3KR2A 5K8VA 1VYVA 4FGKA 5K4HA 1H05A 2KMLA 5JAQA 1TQ6A 2A8YA 2F8TA 1ZY2A 4NC9A 1BVRA 5L3SA 2QNIA 1BCRB 3GLFE 1R9JA 3MTJA 1ETUA 2D5CA 4RQ8A 3DHYA 3FWZA 5EQFA 3PZPA 2H1SA 2JIQA 1PU2A 4MS3A 4OYRA 1P73A 2P67A 5EESA 3UT5A 4J2HA 4W7SA 1YACA 4LE0A 1OTHA 1CR1A 1N5JA 4PRYA 1YB4A 3PHBE 4Z7JA 4IDFA 3ETDA 1YZNA 1DS6A 5M04A 4EBDA 4R1QA 2OYCA 1D2MA 4NFHA 3S1LA 4DQSA 1U90A 1SBQA 2R62A 2HSDA 1EVJA 3PVZA 1P0QA 1KSGA 3C8MA 3AR5A 2P66A 4Q02A 2FDXA 4DJ5X 4ML3A 4MGIR 1IB6A 4A27A 1YQEA 4LJYA 2BZ1A 1Z28A 3GFTA 3QTBA 4HAIA 3C1UA 3FMIA 1UJ2A 4OH1A 3IQWA 2Y1WA 4BP8A 3IP8A 5HQ3A 3VGJA 2J9YB 2VP2A 1HI9A 4FHEA 3UB4A 1IY9A 1ZAKA 1E4EB 4PQGA 1R0BA 2EBFX 4G1MB 1TCBA 1KWGA 1FF9A 3TZHA 4WIAA 2PMCA 4DCCA 1VLHA 2A9QA 2Z1MA 5FUVA 2G06A 4TV9B 4TMKA 3IKVA 3QLVC 4BGVA 1MHTA 4UDYX 2O0MA 2F90A 4LXUA 4ZQFA 1EXDA 3KAJA 4DSOA 1II8A 1SZCA 1Z5VA 2WICA 4YXJA 4G9GA 3SJ7A 1H9AA 1AD2A 3OEED 4US2R 2ZRQA 2ZB3A 3G1UA 1UM8A 1NJ1A 5T8KC 5F9FA 1ZKDA 4GXIA 4DWIA 2EL9A 2Q1SA 3T7IA 1Q84A 3AF3A 3HVRA 4QXOA 5G4KB 1L7OA 3WK4A 1BJKA 2FWJA 3RSLA 5LXTF 3JD3A 4Q93A 3WLAA 2OYRA 2QX7A 1E5QA 3TTTA 1V8OA 3PEEA 4X8OA 2XY6A 3AOGA 4N6OA 3O47A 4BX3A 1J2YA 5G1PA 2NSJA 1FFXB 4UUMA 5JD5A 4DCJA 3PO5A 2IGBA 3JWPA 3DT9A 3IR5A 4UUOA 4KVAA 2FFHA 2EFEB 3WK9A 4DEZA 4F71A 3AWIA 4PCAA 4L0DA 5CWRA 3SFZA 1XKQA 1YZQA 1S4MA 4K26A 4UULA 2JI6A 2OLJA 2J3KA 2WFMA 1JXEA 3T9FA 1NT2A 3ZZNA 1X86B 3IJ5A 4XD2A 2XOKD 3KJEA 2XDQB 5EC8A 1XEAA 1RYBA 2VTVA 3Q8RB 1E8NA 2QMOA 4DKXA 5FNVA 4EUKA 1MC4A 5CT6A 4YC7A 2XB6A 3WLSA 3ZYCA 4EKIA 1Q1BA 3RBDA 3O9MA 3UPUA 4LPKA 3O31A 3RAXA 1WXQA 2R6DA 2IPLA 4XR4A 1RKVA 2IPMA 3EBLA 5DGXA 1KS9A 4O4IA 1Z8DA 1GRRA 2QKQA 1OXTA 4QNRA 2ZSEA 5MF6A 1XLWA 1Z00B 1MA7A 3GAFA 1XNRB 4BRUA 2J4DA 3FJOA 1KDHA 1MTZA 2FOIA 4MDYA 1DQYA 4ZOHC 1NXWA 4H4DA 5CBPB 4FI3C 3ENWA 4DA4A 4XYLA 2EAOA 2ZQ5A 2D5BA 3SFVA 1YDFA 2KMDA 5LLTA 3UUWA 4Y9RA 1RI5A 3OZVA 3WHLA 1XAHA 2ET6A 9ICKA 1OXJA 1U9YA 3IODA 3IPAA 2Q62A 1V7PC 4I9FA 1SXGA 3L6EA 4J0GA 3UAXA 1DQRA 1H8ED 4Q3KA 1CVLA 1Q92A 1KJZA 7ADHA 1JHQA 1MOZA 3ZDBA 2R6ZA 1JSCA 3HL4A 3KDSE 1OIVA 1CJMA 5CUQA 4DV4B 2QRVB 2QRZA 3OO1A 1E2UA 2Y93A 3PNVA 4K8RB 1RWWA 2NRTA 4JI0B 1WCNA 1RXVA 1UJ6A 5LUBA 1DJLA 1N0VC 2BCRA 5AVUA 2POCA 4AQ7A 2FZWA 1Y63A 2VTEA 1Z18A 2RHOA 3EH1A 4YRZA 3BMXA 3VZRA 1KQFA 5A5DA 3VR3D 4MR9B 3Q9NA 4LC0A 2QM3A 4AJIA 6LDHA 1BQEA 3PIDA 4FONA 3FDXA 3EPPA 4JEIA 4GLJA 1UKYA 1I9GA 3WB2A 2ZSJA 1RM4A 2BR3A 4N9QA 3DNPA 5JD6A 4F5NA 2W6ZA 5CH8A 1KW4A 3P2EA 2QR3A 2CFRA 1O8CA 2DPIA 2NVUA 2W90A 3VHLB 2Q99A 4KX5A 4QYXA 4DOBA 3C8UA 4BV2A 4IKPA 4PLZA 3H2GA 4DCVA 5CXQA 4A73A 3G59A 4KLJA 4ILEA 4UHEA 5IINA 1XSLA 2FQXA 4I3GA 5BW6B 1J09A 3AEQB 3AL3A 1E3WB 1WZ2A 4FGWA 4QQ8A 4Z7OB 2TS1A 4TMVA 3GCXA 1XQ9A 1K68A 3EFHA 1IPEA 2J32A 3AUAA 3MUNA 4RS3A 5HQTA 1JI3A 4DSIA 1E92A 1M0EA 3U6BA 1L7DA 3M9NB 4QZDA 2SCUA 3DOJA 4XGNA 1S0VA 2YJGA 2HT1A 3VC1A 1TV9A 4YMSA 5JE8A 2QW0X 1WZUA 3NGLA 1D2CA 1JT2A 3BERA 2GUGA 4IF4A 1IXRC 4Q0MA 3WVNA 4NHOA 4E11A 2CNWA 4MR8B 1ZMBA 1RZUA 4FE4A 1XQWA 1NV8A 4JX9A 2W7OA 2XZDA 1VC2A 4HZGA 4WESA 4FN5A 1MDBA 1L5SA 4UZFA 2XVXA 1P9NA 3N6RA 5KTSA 5FIUA 4HUQB 3MOSA 3P9SA 4GEGA 3ABSB 3LX4A 1WB4A 5KT3A 2NZ8A 4P9NA 1JHXA 3HUEA 4ED0A 3R7DA 4DL4A 1BHO1 3ZBQA 1PJ8A 4NMLA 4CL8A 1LDNA 3HLTA 3NHAA 4DR4B 4M60A 1VIMA 5K0EA 1CY1A 4N82A 4EFDA 3HEMA 3GNLA 3IO3A 4DDVA 5KFAA 4BFCA 4C7KA 1DPFA 3UXPA 2FX2A 5L3RA 1BA3A 3U9LA 4JMUA 2XCIA 3MRSA 3PEWA 4BKOA 3WS7A 3RC7A 5J8YA 4F9GA 1ZIPA 2IUSA 1KFSA 4DR6B 1SKYE 4C30A 1CFZA 2VQSA 2J3MA 2E7ZA 3NDIA 1YKFA 1NT4A 5E4YA 3QIVA 1W0KA 3QJGA 1A77A 2XVYA 1U2DA 4BYGA 4NOLA 3ADBA 4I4TB 5A5VA 3TSOA 5L8VA 3PR3A 1N25A 2LIPA 3OUUA 4CEHB 3M6WA 3WGOA 3RKUA 1KI4A 2FJUA 1LFDB 1CJSA 3HHEA 3A1VA 1Z83A 5BRJA 4DL7A 5A0LA 2CHGA 4LDQA 3DF7A 1CRXA 1CE8A 1P3JA 2A78A 2IYVA 4O3RA 4F11A 3NGDA 1KMQA 1E9DA 1TJ4A 5ALVA 1X1BA 3PGXA 4KGXA 1CEZA 4KYUA 2HKIA 2O14A 4W8GA 2R11A 2W22A 3EC2A 2RCNA 1CF2O 3OPYI 1GA1A 2I5PO 3MINB 2K8BB 4FMPA 4KQWA 3DTVB 3RFAA 5BWBA 1HYBA 1T2CA 1R5OA 3Q3IA 4A8PA 5ALFA 1T8SA 2WVGA 3QNMA 1A8HA 1O5IA 2JKZA 5LA6A 3SEIA 3A1UA 1ZVJA 3MZ0A 5J0TA 3NOQA 4O0MA 3KVNA 5ERXA 2M6SA 4XLTA 3H65A 2LI6A 2ILVA 2XJ9A 4IIJB 2OV6A 5EOZA 4D0NA 3I1YA 3PGJA 4BP9A 2ZJAA 1WDMA 5GY7A 1JFFA 2QENA 2P69A 3I2IA 9ICJA 3IM1A 5F7JA 3PWSA 5CHGA 1JQAA 3R5XA 5AR1A 2AFIA 1LW6E 1XXHA 4IAOA 3GGJA 3BGWA 5TNXA 4LOAA 3RB4A 4DFPA 1X9SA 1QKJA 2YJZA 4GFDA 4A91A 3LLUA 1Q3HA 1A9QA 4PC6A 4ONEA 2F44A 2NTJA 4B9MA 2J30A 3QUSA 4TS4A 2GRAA 4QZFA 1OT5A 2WJVA 3T7EA 1CQWA 2QTMA 4B32A 2OZLA 1JRPA 3H0MB 1Q21A 1VE9A 4F1WA 3KJFA 2DBYA 5JBNA 1EXWA 3AUSA 3OKCA 5EE9A 1F5SA 2JH9A 3R2JA 1UAGA 3PRHA 1WW8A 3EGCA 5CIQA 2HPAA 1Q0QA 3GC6A 4KOAA 5J9FA 4ZZ1A 1JE0A 1OX6A 3GIDA 4LMRA 5FOSA 4M04A 3SZRA 2XE7A 5EJMA 2IX9A 4YT2A 1RMYA 1IN7A 3H6KA 1A0OA 4XQ0A 2Z43A 3N07A 1W6RA 1Q6YA 5FLKA 1ODFA 4MVCA 3DS8A 3V2HA 4TOIA 3AJAA 4J49A 2CNWD 3O4HA 2NZXA 5DKWA 2W83A 3RAEC 3QQ5A 4KLGA 3ZG6A 4JWTA 4YTEA 4QFDA 2GN6A 2GZHA 4RPCA 4G1BA 4KGVA 1BAPA 2PIAA 3MHTA 3RYHB 3UXHA 1XL1A 3L4PA 1X7ZA 5BNIA 1BQ3A 2I3BA 5TB5A 3DYBA 4DS4A 3C6QA 4KDRA 1GSIA 3ECSA 3C1YA 3FNEA 3OEHA 4L50A 3OECA 2A0XA 4AJ4A 3S28A 4M9JA 4R2HA 1TQ2A 3EAQA 3JSXA 1EPUA 2QJRA 3AOEC 1V0JA 2AJBA 3I23A 3UJ3X 4A1FA 1GGEA 3H8WA 4ECQA 5AJVB 2VDQB 3AHDA 3TD2A 1TA4A 4WV3A 4P1ZA 5FOUA 1QP0A 4DMGA 5JLJA 2BIFA 4UD6A 3F6EX 1M2GA 3VSAA 3I1IA 2FEPA 1OH8A 2R4QA 3DKKA 2QBYB 4CI9A 4IBOA 2YXPX 1W0KD 1VJ1A 1I51A 4MUBA 5IU6A 1A04A 3BJZA 3FPSA 3OI7A 1I3NA 3MTGA 3IEXA 4D4GA 4Z4FA 2KOBA 1LB1B 1FP7A 5C8ZA 2PKXA 4AYBF 1BMQA 2VJKA 4KLSA 2I1QA 2R6AA 2FMUA 1ZISA 2OAEA 4AY6A 1T2VA 3J81k 5KYWB 1G59A 4HYEA 4G4JA 2MUTA 2ZANA 3NAMA 1YOBA 2MTBA 5A9SA 1DBPA 1E1DA 2EFCB 1QF6A 5F3DA 1TZBA 3N05A 1YFJA 2WINI 1SULA 3LRTA 3QOWA 5FCDA 5DNCA 1V3QE 4M2YA 4H6WA 3CXRA 3T3EA 5B3AA 4LJ6A 1WOMA 4LYHA 5PNTA 2FEWB 1F2TB 5J2FA 3E05A 1J5EB 3SOPA 2OV4A 3RH5A 5D1HA 2AC7A 3UGQA 4REQA 5FL7A 1QYRA 1QGDA 4B81A 3UTDA 4DLTA 4G8DA 1LK5A 2HBQA 3U13A 2JGLA 3MABA 1LLQA 3DGFC 2CLEB 3K5IA 4ZI7B 1J56A 5H70A 4X0EA 4E3ZA 2YHIB 1GOTA 2WE8A 2GFHA 1HWYA 3LU1A 1CIVA 4HC4A 2HDNB 2HJGA 3GT3A 1HDXA 5I7AA 5T41A 2DF4B 1GU1A 4TMYA 3T7SA 2FN7A 4LCJA 3RRMA 4K3UA 3KQHA 3EIWA 1YFLA 2F1IA 4HDAA 4E3WA 5CYPA 2E6UX 3KOYA 2Q9UA 1O96B 4B33A 1MTOA 3T9CA 2HAEA 4CKEA 4LRUA 3ET5A 4BKMA 2JFYA 3ZKAA 5JECA 1XUOA 1ZXIA 2DQNB 1UP7A 2FSVC 4DMLA 3KTAB 1T1IA 3PZBA 3FGPA 1NPTO 4BJQA 3EK2A 5FI1B 1SC9A 2R6CA 4AICA 3DZ8A 3QKTA 3S55A 4ZYXA 4FX5A 4IL6U 3FVTA 2AFHB 1QHXA 4GP9A 2DL0A 3BD8A 3BMCA 2CNBA 2WKRA 4FDLA 4N0DA 3HUFA 4PM4A 2F4VB 1KVTA 5U4XA 4BIMA 3TADC 3CEHA 4MO2A 1Q8KA 2C59A 5GOZA 6REQA 3LWDA 1JHUA 2MINB 4JI3B 1BNCA 2G25A 3T1TA 1ZI6A 3O21A 3RUFA 1JEEA 1SCUB 5CEHA 4LJ4A 3TK1A 1K6IA 1VG1A 1IDN1 2WAQF 4OV6B 3UMMA 3H7AA 4BNXA 3QYAA 2X40A 4TWAA 4MQLA 1VTKA 5K0BA 4EB0A 4RADA 1SVKA 2B83A 1KZ1A 2OV1A 3B70A 3RT1A 4P58A 1OROA 3MVEA 1K97A 2XQGA 3HI4A 3N0RA 2E2WA 4EUHA 1U28C 3IULA 4L7QA 1A9XA 4N8DA 4ZQIA 3HYRA 3LGXA 2JG3A 4OHKA 3GCWA 2AD1A 3CPSA 4KR0A 1SMKA 1TO6A 3OEHD 1FZTA 4NABA 2QSUA 2ZYWX 4PYRA 1Q1QA 3PX3A 5DHAA 1QIGA 1VG0B 2VA8A 1NYQA 4XRGA 1C7FA 1JB1A 3EMVA 3SNHA 4OP2A 1GG2A 1CUCA 4KOEC 3FCYA 3BMNA 3QUCA 1NSTA 3JYNA 3TB6A 2QJTA 2WG2A 2YVQA 3ZDEA 4HGQA 2VJYA 2VUSA 1JROA 2ZSBA 1E2DA 4DG5A 2UUCB 2O2JA 1LVHA 2WWFA 3IKJA 3L84A 1Y1SA 3HN2A 2MSDB 4KMUA 1EUCA 4M0MA 2AZ4A 1QPBA 3L8MA 2ZCVA 4J9UE 4UU1A 2FQYA 2Q8NA 5U9CA 1RLJA 4IQ4A 3NHYA 2PQ6A 5D6OA 2KVSA 1R16A 1KPHA 2Q9BA 2XMRA 1E6LA 3H4DA 2CNLA 5JH7A 3LI2A 1IBLB 4A8HA 2C29D 3C4VA 3HR8A 4P3YA 1ZM3A 3K9LA 3F67A 4WT7A 3LK9A 4I6JA 5DGIA 4NMWA 2IEYA 3C5WP 1CEYA 4B48A 5LXTA 4EG1A 2Z5LA 4AD8A 4Q9DA 3ISDA 3WMEA 3S1SA 1V6CA 1A9ZA 3ZGXA 4B73A 1YZHA 1N2ZA 4MLCA 2PAFA 4GDMA 3C3JA 3PW4A 3HHPA 3K70D 3UH1A 2GBFA 3SC4A 3FDFA 4HUTA 4AX8A 1LBQA 4IJMA 4Q9NA 3VR6D 3FDJA 5I8PA 2JLQA 5JAOA 4X7RA 4NFYA 2WIBA 1SHZA 4Y98A 4FBUA 1RWNA 3BILA 1D2HA 4HDSA 5CT8A 3UT0A 4LZLA 2C28A 3A25A 5IEBA 1TA0A 1H85A 4X1KB 4DCSA 4IJUA 3IJPA 2FA9A 3Q3GE 4NAVA 4ZJPA 1N8SA 3ZS9A 2X0EA 3QBVA 3BE6A 2GF2A 2WLTA 3GQVA 1VMAA 4PG5A 4GWKA 3FLEA 1GTSA 1Y6GA 3BC1A 4P6VF 2A5JA 4TLBA 4M1OA 4LIPD 1KU0A 4PG4A 4K5QA 1GQOA 1U9IA 4B8ZA 2WU1A 2GRUA 5L3VA 2CLIB 3I83A 3AU2A 3O8CA 1T1JA 3FWNA 4IZIA 3DE7X 4KR7A 3QHPA 4JGBA 2FVYA 5KFFA 1V4NA 4OGKA 3FOBA 2HIHA 1BN7A 2ID9A 1FLVA 3U1BA 3FUTA 2FW7A 4WCFC 3WOVA 3ALRA 5CDFA 3BXGA 1PDVA 5FL3A 5H83A 2HA6A 4WA8A 1MABA 4TUPA 2QP4A 2QTHA 3VYWA 4W5OA 1K0UA 2QT9A 3FPBA 2P9ZA 4NK5A 3N59A 1RBMA 4EKGA 1OV6A 5FEUA 1L4FA 4PS1A 3PC6A 1H38A 1UBGA 1V41E 3NT5A 3KAKA 4FLFA 1NXXA 3IAHA 5ICEA 2UKDA 2YDXA 1E5LA 1YJBA 1V1RB 4R9SA 1QFZA 1K86A 2NTNA 2FE9A 2CUNA 4LY9A 1E5XA 4ZZ2A 2QXTA 1JTEA 1IULA 4W1SA 2R5WA 1QGUB 2AD5A 4IEIA 1OA1A 1T6XA 2EZXA 1GITA 4G8JA 2WVHA 5I7HA 2RGAA 1O4WA 2JEFA 3W6PA 4G37A 4YCCA 3W5IA 1ECGA 2DULA 4L4SA 1XKXA 1ZUHA 3H4VA 3EOAI 3R75A 1FYXA 4O4IF 4HEJA 6NULA 2UVPB 1VE3A 1GIAA 4L5AA 4KFCA 3WLRA 2COKA 3F4BA 3UMJA 3KRTA 3AR7A 2J9FA 1R2QA 4N8EA 4X62B 5JY6A 4IOLA 1P91A 1G9SA 4ARSA 4UTPA 1XZLA 1JBKA 3UBMA 2WI8A 2Y6VA 5AOVA 1WZCA 4RHUA 1J0AA 4MAFA 4W9RA 1TM1E 3R3XA 5BSRA 4Z6KA 1LBTA 1NQXA 2IVZA 2IYZA 1AZLA 1WX1A 2YWFA 1YZKA 4JELA 1DV2A 4WZBA 4MDFA 2HHWA 3D8TA 3SF8B 3HKDA 3EGXB 2JLBA 3LZ6A 2ETXA 2UXCB 3WGMA 4YJFB 1BPYA 3O8RA 4I4IA 4JIGA 4WBNA 4OO3A 2GZDA 4Q7KA 2HK9A 3MGCA 4II3A 2QLBA 4TMWA 4D9EA 1TD9A 3V1UA 3H17A 3L8EA 1Q6ZA 3G8CA 1GYQA 2GYWA 2FRDC 4PO3X 2AR0A 2Y27A 3O2JA 3DDHA 3O4VA 3SZ2A 4U7WA 1T5IA 4BBZA 4Q9KA 2DFPA 4NZZA 3MCVA 1OWMA 3NXSA 4JROA 3K9BA 1ZICA 1WMFA 1FYWA 3AC0A 1CZLA 2EP8A 1JEDA 1NG1A 3F5SA 3BF8A 4JJKA 3SIPA 3JAMA 2HV9A 4EUFA 5A4KA 1ADGA 1ZUWA 1JV2B 4UHBA 4EYGA 1XTVA 4BVJA 2J67A 4AJKA 1V6AA 2ZS9A 3N86A 3MXTA 4ENPA 1UANA 4JH0A 4IILA 3VKWA 2HHUA 4TYQA 3I73A 5EYPA 2OZVA 1JI0A 1PQ4A 4YUYA 4PICA 1QE5A 1ISIA 3MPUA 4X95A 5KDOA 3VR2A 3V4LA 4B71A 3PHHA 3GIWA 3QPDA 1MJHA 1N6PA 5A4JA 4YRKA 4Z7NB 1W2HA 3WYAA 2J9XB 2BL4A 5E1DA 4P4TA 1YDGA 3A9RA 2GK6A 2WG1A 1PT8A 4I4CA 1QGAA 4L57A 3Q12A 4EA7A 1FFCA 4M1ZA 3TGWA 1XGKA 3M6FA 4L5BA 1A8UA 2DTXA 2WAAA 2EGUA 1T1RA 5BR8B 3OTQA 4IVPA 3KQTA 4YAJA 1MO6A 3C3XA 5BT9A 5K45A 4F72A 2C2KA 1MEJA 1SCQA 1C7RA 2G9RA 1ZVMA 3GN1A 4IIFA 1XEWY 3ZIAA 1W36B 4EZ6A 1M10A 4IFEA 3L79A 2YIMA 4HS9A 5JBQA 4NPAA 1NX9A 4UNNA 4XQGA 2VP9A 4I9NA 1M1UA 2XGQA 1T0JB 2PRSA 3OPNA 2YJ4A 1DBRA 2ASVA 3TI9A 3L0ZA 2CWWA 4X20A 4AVYA 3WNQA 3A6KA 2DAPA 4AN4A 3GDGA 5F9NA 4WWHA 1KZ7B 4KLNA 3JZDA 2F7SA 4C14A 2F3SA 2VK2A 5I9LA 4J9RA 5F5XA 2PZJA 2CZQA 1PJ4A 4ALLA 3WJAA 1X1SA 1SY7A 4X71A 3T7AA 2QP3A 2PUGA 1G1AA 3L7KA 1RBZA 2VVTA 3CRRA 1BDJA 1G20E 1FW6A 4NL9C 3VO8A 4QTXA 5CM8B 3UJHA 2FUEA 3PD1A 1GFSA 1J2TA 4AMBA 4IQWA 5JXHA 2FUNB 3ITDA 1O6GA 1ZJYA 3REQB 5JNUA 1T2AA 3AWDA 1NOKA 1CUKA 4QPZA 3B2QA 3G85A 1SPBS 5IK2D 1RXWA 4F4UA 2EERA 3K9WA 2GARA 2D4AA 2YY6A 2PIDA 3MEQA 5L4LA 2C0QA 3R0JA 5AJTA 1X2BA 2W55A 2FE4A 1HSOA 1P74A 3RSFA 3KYCA 2YV5A 3HY3A 1GYRA 2H8KA 1PCXA 5BVHB 1QFSA 3AHJA 1UKVY 2A84A 3GB9A 4MH0R 1YQDA 4RQ2A 2WP0A 4EB6A 4JJZA 2FPXA 1X9IA 1I9CA 3QM1A 3D1LA 5ADWA 1EX7A 3TR0A 3PQ2A 1ADYA 1WUIS 3AR3A 1PJ2A 4KYTA 1V2GA 1RAAA 3A4TA 2I2AA 1U5BA 3C43A 1FNCA 2ADOA 2OXRA 2Y71A 3FWKA 5DNYB 4FEAA 1MOSA 5KOJA 2HJHA 4HWKA 1Z07A 2JKYA 4NATA 5I8ZA 4GI2A 4G2NA 3R3UA 3N8HA 3A6HA 1F8FA 4FPXA 3OURA 3GUYA 2HBLA 3D6MA 2VHEA 5K4LA 3ZY6A 3W78A 2F67A 1N2HA 3R23A 2PGOA 5LA6F 5DGHA 2GLEA 1L9KA 1SOVA 3SKVA 5KWJA 1XDWA 1XZQA 4BC1A 4G5OA 1Z8FA 1XNHA 5KWIA 4C5AA 2Y3IA 1RI2A 1X74A 1XCGB 1XVAA 4ZIRB 5JG7A 1QYCA 3DDNA 3M1IA 4D44A 5KTKA 4N0EA 4US8A 3EB9A 2OLEA 4UVIA 4ISBA 4MRRA 1EGQA 3MUFA 3MN1A 2PGLA 3ICPA 1YULA 3K53A 3OU6A 4DL2A 3OX2A 7ICHA 3BRWA 4B6QA 2A88A 1M66A 1DKPA 3HBJA 4IDOA 2Q3MA 1G4AE 1PK8A 1N6OA 1RZ3A 3C3BA 3TI0A 1GKYA 1LW7A 3E15A 3GOQA 3HC7A 1TMKA 3NBQA 1NVWQ 8ICGA 3KQUA 3P4YA 2XYHA 3T9EA 1X7HA 2O20A 4X1OA 5JNLA 4JC5A 2VZ0A 2D06A 2IK8A 3VR2D 1CJKC 2XKKA 3I1FA 2EFYA 2OHJA 3I52A 2NQ2C 2BN4A 4K88A 5KFOA 3WGJA 2JLXA 2O3UA 2Q45A 1NZPA 5ENDA 4DOCA 1DKNA 2FN4A 2FUCA 3SSNA 3MR6A 3RBEA 1RCFA 2PR2A 3E9CA 4F9EA 1GPYA 3VPXA 2QKYA 4TZKA 5DLEA 5IKMA 4LQCA 2NV2B 1A2BA 4NAHA 2AK3A 1AURA 2QTVB 3OY2A 1QHNA 3ONNA 1NJ5A 1DINA 4GI3A 1XRQA 1RYMA 3LXMA 3OOWA 1BU8A 5LIPA 2WUVA 3BK1A 1NVVQ 2I3AA 1VECA 3ZIAD 1CR4A 1F14A 3TBFA 1DG9A 3RR2A 2JFBA 4MZXA 1ND5A 1QTIA 1NW3A 5AVJA 4JUDX 4C80A 5LMNB 3DDUA 4WPGA 4EY5A 1QP4A 3EMKA 3RTVA 2GAJA 3ORFA 2OCIA 3L8CA 1RKXA 1P72A 4CI0B 1L5HA 4PBRA 2E89A 1P9WA 1ZR4A 3D0KA 5CXUA 5ARCA 1Z45A 3C6KA 3G5UA 2JGJA 4EGJA 2I6SA 4OCZA 1RWMA 1Z6ZA 3TNDA 2EX4A 3U3KA 4PGXA 4BNIA 2PG3A 2UUOA 4PGFA 3B6MA 2OD7A 2Z9CA 2X0NA 4JKOA 2HDOA 3EDMA 4U2CA 2IUTA 4LXYA 3OBIA 1MN8A 8ICOA 1SXPA 1L4EA 2HV8A 3MGBA 3SZOA 1NBAA 3Q8MA 3KLOA 2JL1A 4L5YA 2K7FA 3LYUA 3THWA 2BR5A 4WZAB 4EJMA 4F3KA 3NEJA 1VB5A 2DERA 2FXVA 2Q2WA 3M6AA 2HK7A 2VCYA 4PIPA 3OQJA 3AETA 4HH0A 3UK0A 1KI3A 1PL0A 2A33A 2DMRA 2O8VA 3GPCA 3ZHUA 1SCAA 3FTNA 1TK0A 1X7XA 2PWYA 1V71A 3G2HA 5CDUA 2QOEA 4FUQA 3OEEA 1OH5A 3BSSA 3PJDA 3MGIA 4YDRA 3RWMB 3RC3A 3JY6A 4RJKA 3AINA 3BORA 2WJPA 1TAUA 4JV0A 5G0UA 1J2EA 4RX1A 4AP5A 4WXEA 1Q20A 5A02A 2LMRA 1R4NA 3AR4A 1TOAA 4A92A 3HJCA 5FI0B 3RV4A 1JU4A 2YXDA 2LYAA 4GOLD 5I01A 1FUUA 1Y8QA 1N60A 5AJUA 4DLSA 3LHIA 3SQNA 2W58A 3RG2A 4K9SA 5KFQA 2Q5OA 1T9ZA 5JCPA 2HHHB 4QIWC 1VI5A 4KXWA 1FVFA 4IC9A 4HUJA 2X5JO 1QNLA 3KC2A 4EHAA 1TVKB 1PVVA 4G8BA 3ZN2A 2FJPA 3PFHA 5JO9A 3TTSA 4YJ2F 5J2TF 3PTLA 3FTPA 2ONJA 3LZDA 4NCHA 2XOKA 4B7ZA 4LMAA 1SG0A 3R3VA 2RLTA 4JXZA 2AE2A 1ZQDA 1WUYA 2V74B 3WRYC 2ATVA 1U8UA 3MCZA 2G0NA 3LOPA 2GO7A 5A7FA 3PRYA 4BVFA 4OXNA 1T2EA 1K1QA 4KYIB 1UWVA 2AV6A 1AKTA 3HCEA 5CXSA 4XXHA 2Z8XA 3EBPA 4DMKA 1Z0DA 1Q2XA 3MGKA 3EIFA 1SHKA 4P32A 1WZEA 3HRHA 3MYYA 3SQOA 2QVXX 1C1XB 1LD3A 3ND7A 4FFNA 1VP3A 1DOZA 4ZU6X 1NRXA 1QIHA 1U8XX 1P8AA 4AO6A 5IULC 4A3SA 4G0YA 4O5EA 3CF0A 1B4FA 5I45A 2QD3A 2VJCA 4D9CA 4EG5A 4UHHA 1NI3A 2BR0A 1GA4A 1Z5ZA 1I3KA 1IHXA 4BQRA 3RJEA 1HETA 3ORSA 3NB0A 3AUUA 3CPEA 3FDIA 1HE4A 1S1CA 3KVOA 3ZQ4A 4BKUA 5K3FA 3FMVA 3G0BA 2ZDQA 2I62A 4F5ZA 1WVIA 5JPIA 1FRNA 4JUAA 4D9MA 1BVSA 3EXHB 3GI1A 4CUZA 1H8EA 3B52X 4IIUA 1DCFA 1XV5A 2P9TA 1DTEA 3W90A 1Y34E 4DSEA 2VQ6A 1EVYA 4HQKA 3STUA 4IOJA 3W6UA 3MGVA 4PO9A 2ZYSA 3AY0A 4U6PA 3I5UA 4V39A 2PEYA 4BNLA 4BHTA 2BF7A 2RSLA 4ND2A 2I87A 1CUDA 2ZVQX 3O1IC 1COZA 4FGSA 2J9ZB 1FSGA 1ZJ5A 4Y2UA 1P5FA 2WTMA 2EQAA 1G42A 1AA6A 5CD9A 2XWJI 1ONPA 3VR3A 3STTA 4AUMA 2F76X 4B74A 4F2RA 5EKXA 2CWDA 5CFRA 2XGMA 4RD4A 1HLPA 3DBVO 2FPRA 3X1KA 1CUVA 3KXDA 2NU8A 3OU7A 4FGJA 3QY0A 1SCBA 4FW9A 3E8XA 4JR0A 4B4VA 2C3YA 1JJAA 4WW0A 5T3YA 4BJHB 1XDUA 2Y0PA 1VI2A 3RGWS 2PRKA 4I2AA 5HM6A 3AI1A 4BFZA 1E6KA 1HTWA 2D8CA 1YU6A 1DBQA 5KAPA 2YBDA 3RS0A 3PUHA 3N2ZB 4MQFB 4MWDA 4HZUA 3RTBA 2VXCA 3RC2A 2NZWA 4QNMA 3GT7A 4BZPA 2GBGA 4V0ME 5JJBA 5GTDA 1RQ2A 3CWZA 4HTFA 1R6BX 5FPYA 2OGSA 2CBZA 4QOEA 2XUFA 3N5KA 1P77A 3L5KA 4J3FA 4F5QA 1JZTA 4OHFA 1P7YA 3M83A 4QO7A 3S4YA 3MS4A 1H93A 3BF7A 1UT5A 4M2LA 5B12A 5LQNA 1P2TA 2DX7A 4XAQA 2FWBA 2OZEA 1J2JA 3E9QA 1C9JA 3DKPA 4I9GA 5JH7F 1AF4A 3Q6MA 2B92A 4COKA 5IJAA 3KKKA 3I37X 3MJ4A 2B20A 3DMDA 2HB6A 4DQQA 3AO0B 1AXRA 3ICWA 1KMMA 3JQ9C 3KZIU 4G9EA 3UHJA 4OHPA 2IITA 1UDRA 3EHDA 1Q91A 3CWCA 4N6NA 4BQNA 3BQ7A 4FQ8A 1O89A 1FFGA 4XJVA 4Y7DA 2SBTA 2QLTA 2ILTA 1PGNA 2FQWA 1DRVA 1X40A 2R3SA 3A4NA 5TQ0A 2KZMA 4QJ3A 1S2MA 2YASA 1J0BA 2VYQA 1Q3UA 2R44A 4TXHA 1ZWKA 4G5HA 3DCNA 3QEBZ 3IALA 1X7WA 2B1RA 1TU3A 5J4HA 1RTKA 1OZHA 4DV7B 1SOAA 4BLRA 4UUPA 3LD9A 3EEQA 4LNUB 3OC0A 4ZPJA 1IBCA 3WMRA 2OCEA 1KY2A 3TLYA 4LBVA 3J80A 1VZ2A 1C9EA 2AGOA 1WWUA 3L0OA 2CLDX 3QU4A 1W44A 1ODLA 3EDOA 3N7RC 2I91A 1E2BA 3EEOA 4D56A 2GPYA 4EG7A 4X85A 1FMFA 2ZRNA 3BH7A 1Y88A 3HP1A 2XAAA 2RGNA 1J2MA 3RV3A 4BV9A 1YK0A 3WNZA 2ZIUB 1UA1A 1Z5UA 5HQJA 4NPCA 5EOVA 1NOIA 1ISRA 3TZLA 4X92A 4DMCA 5H16A 2Q0SA 1FOEB 4QYIA 5E0OA 5BY2A 2R8RA 4LQDA 4KN5A 2D54A 3WTCA 3SE7A 3HDJA 4ZDJA 1XO0A 1W8DA 3H0EA 4KO4S 3V2UA 3MIZA 4XPIA 2ODPA 1BSVA 1QZUA 2JAHA 1DEOA 4KC0A 2J0QA 2O1XA 1ZHOA 2XOEA 1JLRA 4QWCA 3PHGA 1UOQA 1NIJA 2Y2UA 1XZHA 1NVFA 4JLBA 2BTEA 1OGIA 1GNVA 4PZDA 3UN1A 2IU0A 4UAYA 5JDIC 4KPUB 2BEWB 3DVSX 2ZYAA 2XW6A 3LK7A 1HPLA 1QRTA 4YRFA 3D4IA 5G41A 5DEIA 3CWQA 4LFBB 5EA2A 1JR6A 1GXSA 3PJGA 4UXIA 2OT3B 3BL6A 4J07A 2Q5IA 1JBEA 5I9IA 3MS2A 3GL9A 9ICFA 1FLAA 1EFLA 4MP3A 3RI3A 3G13A 2B4KA 1WMBA 1AS3A 2XMZA 4KVFA 1GGFA 1ZM9A 1G5IA 4EQ6B 2IE8A 4UVEA 4IHJA 5CB6A 3KR0A 4KLTA 2QUAA 3EDRA 4BRZA 2BFBA 1OFIA 4LYAA 1JHRA 3SVTA 2R60A 1SXJA 2EDUA 1V8PA 1FDRA 3TTWA 4ZTZB 3D6JA 3GJ7A 4N3BA 1DG3A 2PSSA 5CA0F 5BOSA 5KFMA 5AXAA 4U7PB 2HK8A 4FSHA 1G8YA 3L0BA 3OPQA 4C05A 2KTQA 4UREA 1WCLA 4UQLA 1CY7A 1U0FA 4GI7A 1HYGA 3KELA 1ZVQA 1LLDA 4KSBA 4UOQA 1KKMA 5C2JB 4DL6A 5AWFC 1PWEA 2WHYA 3EXG2 4PRLA 1REQB 2YWBA 2Y6UA 3KEQA 1EA5A 5C7YA 1SA0B 4JI7B 4N3AA 5B3JC 5BRNA 3RJGA 3K0HA 1GLNA 3NVZA 4M8IA 3ETLA 2LV8A 1KORA 3MJHA 4MULA 1M7BA 5B7QA 4YI3A 1XMQB 4NYMQ 4CIAA 4DTCA 4FFSA 4EIWA 2GWSA 3UJPA 8ICXA 2FLKA 3TW8B 3SDBA 2X2OA 3GGOA 1CY6A 3W1WA 4F9FA 3RC9A 4WBNF 3LVQE 1U81A 2XNKA 5JHHB 3JZFA 2O7VA 4AI6A 3N8NA 1K63A 4RK5A 1F1JA 2SECE 3NHFA 3ODGA 4E4RA 1JJIA 1NIPA 1VSVA 1K6MA 1V3TA 5CP2A 1NK6A 3BQNB 5BV0A 1KFDA 1T35A 4BFUA 5CNJA 1ONBA 4ETMA 3HABA 1S8OA 2WWHA 3G5AA 4Z3DA 4LC9A 3R09A 3FWHA 1NBMA 4U2KA 2Y1DA 2WHEA 4YFKA 1Y82A 1ZD5A 2ZWMA 1V25A 1TAHA 4WKNA 2ZRLA 4U2EA 3I8OA 5KDLA 1E9AA 3T54A 1W9MA 4BVGA 3PC3A 2A19A 1QVAA 3UK6A 4M0LA 1V43A 1ESNA 1YRWA 4K3VA 4QODA 1M6WA 3EGDA 2C4TA 4R0NA 2IXDA 2I9KA 3N2GB 1ZQMA 3A04A 4A8TA 4HXEB 1Y1PA 4ZJYA 5IVKA 3U61B 3ZE2B 3B12A 1K3FA 4WINA 3SHFA 3P2YA 5ALJA 4FDVA 5C7OO 4XWOA 5TGDA 2VFAA 1SEVA 4LUCA 5GWXA 1KMCA 1SN7A 4D3SA 1GFIA 1NUSA 2Z6AA 3VKUA 3AZOA 2WWVD 3OIGA 1QDLB 3VU9A 3VQTA 3R5SA 2P9CA 3LT0A 1K7CA 3THOA 5GM1A 3BSYA 2ZIWB 1QAQA 3T5HA 2JASA 2BMWA 2PLNA 2QSJA 2GSWA 2RI1A 4U02A 4R0VA 3BB3A 3OMLA 5KFXA 2E1FA 3OF5A 4HK4A 3RRHA 1GPUA 3CJRA 3LP8A 1IVSA 1WSWA 3AF0A 1WQ3A 1GUZA 4RVOA 2BQRA 1GN8A 3HN6A 2NU7A 3WK5A 3DWIA 1NLMA 1JPVA 4HF7A 2Y9TA 2E49A 3LT5A 2ZTSA 5CFPA 5FBVB 3UK1A 1EX9A 2OVFA 3DBLA 5CBKA 2OK7A 1JYEA 4DYDA 3LSYA 4F6CA 3NNSA 1ML4A 1C50A 1NMZA 1VSTA 2GEBA 3AF6A 4B9VA 3DONA 1U4OA 2QVBA 3NHZA 1X19A 4MI3A 3WLPA 1NQVA 4RO0A 4CT5A 1QRAA 5B53A 2I80A 1KJNA 3H4MA 2LKCA 4I2DA 1GTRA 1B2LA 1TVMA 4O8ZA 2KIVA 3ROGA 1C1HA 3TI7A 2XICA 5AW0A 4KLZA 3ZQJA 3V1NA 4F4XA 2HA3A 1NUAA 3BVPA 4MWOA 2IYTA 4ECTA 2H1HA 3AR9A 3FLAA 2Q3BA 1C3EA 1SXJD 1NMEA 2WP8J 4EG4A 4CKWB 1MSWD 3T5CA 4OHVA 5AMXA 3AY3A 2WU3A 5DQHA 3C3EA 3NTRA 1ORHA 4S05A 4QATA 2IUFA 2BSQA 4CV1A 3PFBA 1OJ7A 1YTUA 1IPFA 1D9FA 3E9RA 4YFVA 5DULA 1D7AA 2BMJA 4H7FA 1V1MB 3J81A 5BXYA 3I4FA 4HN9A 2CK3A 1IWBB 1AB5A 1O1YA 4ZYLA 2KD1A 3T5KA 4YRBA 4HMPA 1GN9A 3E22B 2QG4A 2JFGA 2GK3A 3OJWA 4EMUA 4P54A 1DARA 1Z63A 1H69A 3O90A 3D5TA 2VT2A 5E3IA 2ACWA 4WBXC 4IDAA 2DB3A 3JPTA 5DNWA 4EW6A 1RYNA 3DTNA 1DC5A 2H4WA 1UQRA 2FZCA 3KVRA 3ZWAA 1H0HA 2QRJA 4M89A 2QM7A 4K05A 1KOFA 3QPCA 3PKJA 2WIGA 3K30A 1GQSA 2YNMD 3PHCA 4DB2A 4C8MA 5KPJA 1LX6A 3ESDA 4L1KA 4I9UA 3ZUPA 2QZJA 1UBJS 1ZKMA 2BR4A 3V1KA 2A1UA 4ERNA 2VZ9A 3BJRA 5TJ9A 1L5LA 1O9BA 2OBXA 3ZU6A 4J6FA 4HAXA 1NBMD 1FFYA 3V8NA 1BWRA 2ZRBA 2ZSKA 5J63A 1THTA 1Z5PA 4YP1A 4L2IA 2DC1A 2OV2A 1DOAA 3WJ7A 5DM1A 1A5ZA 1AKEA 2JZBA 3L0DA 5ALLA 4UTXA 1O9GA 3OIDA 3T06B 5TSDA 2O8DA 4IDHA 3O2SB 4LJKA 2YWXA 4OHBA 3UICA 3G9TA 4RVCA 4B7XA 1WIWA 1N92A 1K5PA 3C3MA 1GU7A 4QJ4A 1FDUA 4CIYA 1BVYF 3VPFA 1Z13A 4UM5A 2F1OA 1Y1TA 4AJPA 1PG2A 4CF3A 1QV6A 3GT4A 5AI4A 5K03A 4F4ZA 4M53A 1TNDA 4H7HA 2AQKA 5AVTA 3HKZC 4WNCA 3OIYA 4V0KA 2BVNA 2IHUA 2QE7A 5LQDA 1IATA 3RC8A 4NLZA 1CU1A 3O3OB 4IQ8A 4EVIA 2VDUE 3EPGA 4GXJA 1E2GA 4BKRA 4HNAB 3EGVA 3FI9A 1SCKA 2DETA 1OC2A 2AQ8A 3PYLA 3JQAA 1F2VA 4M9XA 4ZOCA 5I7RA 2AEFA 4RV4A 4EP1A 3VRHA 4PN7A 5L51A 4F0JA 5TPWA 3COZA 4B6EA 5JZOA 3KB2A 1HT2E 1DKOA 3LM8A 3MGHA 1JLSA 3NUGA 3NVDA 4WXPA 4TYNA 3C39A 1Z16A 2Z30A 4C2TA 2MWMA 2Q5HA 1SNYA 4J4BA 2XO7A 4AF8A 2B36A 4GGMX 3LWBA 1Z36A 4QPCA 2Z8ZA 3HYCA 3VR6A 4AYWA 1E2LA 2SKDA 2JGRA 2ZUDA 3K0AB 4B80A 3GLUA 3BFPA 4YJ2A 2VJPA 5J2TA 5AYVA 2Z8YA 1CJBA 1Z6QA 2AFHE 3DR5A 1FPMA 1UZNA 1KMNA 3FSRA 3VNBA 1NONA 2YZKA 2C20A 4J0CA 4DDUA 3WV5A 1ZW6A 3CZ5A 3FGZA 2JLAA 1LJ8A 3JYOA 5AKHA 3PQFA 1PWXA 1NBEA 3V4PB 1P8JA 4FDAA 3K32A 1TMYA 5MDHA 3HI6A 2OQRA 4RAQA 2ZTVA 3HDQA 3CZ9A 2ZM5A 2JFWA 5IC4A 4MW1A 5HX7A 4ECYA 4MPRA 1ZQBA 4MJ7A 1YR3A 4PSVA 3GIIA 3VTKA 1TZMA 2G8LA 5HMLA 1I1NA 4YCBA 2R66A 1U1CA 2P0EA 3TSZA 3D6UA 4MVYA 1V7CA 3DAHA 5TS2A 3W5AA 4K6OA 2WWRA 2GN9A 1Q74A 4PYQA 2GPBA 3BGIA 4M6WB 1RPZA 1RRGA 5BMVB 3WGZA 2ANBA 2DHCA 1I5RA 4IDNA 3SV3A 3MM4A 2CK3D 4Z4EA 5AJYA 3EEBA 2ZYUX 3JX9A 4K6CA 2ZT8A 5CX1A 5I7WA 2GD0A 1PG5A 3KPYA 3E7XA 4JCOA 5K3BA 1FIQA 1M2JA 2O0JA 2HXSA 1UC5B 4LJLA 1B0XA 2ZW9A 1V47A 2JZNA 2QQGA 2ZAMA 3LCJA 5CAEB 4L95C 4KBGA 1P2GA 2CJWA 2HZBA 2EU8A 3HVHA 4URUR 1M2KA 3EJ6A 2G5PA 5L3QB 3LYAA 2YC2C 3TOVA 1ISGA 2R2GA 1UOEA 3G0IA 4B09A 1U8CB 3WB0A 4LZWA 1EWVA 4D43A 4LNHA 4N54A 4Q01A 1UZLA 3ENVA 2GXSA 5CNMA 3UUGA 5F5LA 1DC6A 3F5EA 3JWEA 4RMHA 3TFOA 2QTGA 4Q1VA 1T3LA 9ICQA 3CIOA 1QC5A 4ESEA 3C3PA 1KI6A 4M0DA 3F73A 1ISJA 4M8SA 1WEHA 1V16B 2J5RA 5BPCA 4MPPA 1WD7A 1TB4A 1YQQA 5B1HA 4LV6A 1TEHA 3DH0A 4BQSA 2ZJFA 2VF4X 5JZSA 5FTNA 5HP4A 2GWRA 4GLBA 1FP1D 1L6RA 4ELUA 1SCIA 4AZ0A 2JFUA 1VJRA 2X7HA 4ZAGA 4A2CA 4J9NA 3ESBA 4LF8B 3LVVA 1UDAA 1JDPA 1ZITA 5SZKB 2GA8A 2O2HA 3D1VA 2P0YA 5TISU 2AMFA 2FR0A 3LAWA 2X5OA 3RU7A 2PSDA 4R4JA 5AVYA 1Q44A 1C7QA 4ARIA 1UR5A 1RHQA 1IUPA 4L8WB 3SKYA 1IIPA 4NLCA 4KHPB 3ANTA 2JK0A 4G5SA 1I30A 5FWYA 1U47A 2X0FA 2QE7D 1XZEA 1YO6A 2JHPA 4B82A 4HDNB 1DIHA 3GZNA 7ICTA 5FBHA 3DV0A 1K98A 2QTZA 1WAMA 1ISFA 4K6MA 1S8FA 3V4FA 1TXGA 3AP1A 4OO1J 4PSAA 5A1TA 2XCUA 1Q0ZA 2UZIR 3JQAD 1AA9A 3WB9A 4DIEA 2C1ZA 1E1KA 2WAYA 2A4MA 3NDRA 1M8GA 1HYHA 4DIDA 1MKYA 3WDMA 2W2NA 4J0HA 3WO0A 1VA5A 4DCNA 3PFWO 1RWXA 2PUWA 4TWBA 3R6DA 1Q50A 4LHEA 4WOJA 4FDMA 2V6JA 2Q4DA 4TYPA 3JYLA 3N2NA 2HA2A 3NQ41 5LOVA 1U9ZA 1FZQA 4NZPA 1OE0A 2IW3A 1GAXA 1EFCA 2HW8A 1AN9A 1TM5E 3TQTA 3ADPA 2YR0A 3R3WA 1B6RA 3P5BA 4G89A 1U0SY 2NSHA 1I3LA 1NR1A 4F5EA 4OHZA 3AHHA 4P4MA 4R2WA 4FX2A 3BBLA 2EEZA 4JP8A 3EG5A 1PEDA 5JCZA 2MSLA 2BOVA 4M9UA 1T0PA 3L0CA 2HBMA 4NXNB 4JYAB 3JRXA 3WG9A 4ED3A 2UVDA 1BQ4A 4RCYA 1DRWA 2VSOA 1A5SB 3RUCA 2NP7A 5C34B 3IAAA 2VSYA 4L76A 1JPJA 2GZ1A 2FGKA 2PX2A 5TZVA 1K2WA 1KEEB 1UZUA 1GPNA 3RAJA 4EK9A 2WA1A 3QVWA 5GVRA 1QVRA 1OI4A 5DYWA 4K03A 4EHBA 4JODA 5DI3B 2Q1YA 5GOTA 3SR6A 4LF9B 1DKRA 1P1BA 4EVRA 2OQIA 2WD9A 1JQ3A 3TAXA 1NNI1 5CNKA 3RB0A 3ZW7A 3V2GA 4CIXA 3G5TA 1XC7A 1M1XB 2G71A 4K9MA 4CDGA 3C5FA 4Q12A 5LWQA 2MSWA 3VBCA 2ZRIA 1E77A 1ULSA 4G23A 1MG5A 2OORA 2OSVA 5KFEA 4GRAA 4OQFA 1CY0A 1YZYA 2X2PA 1NBIA 2DBVO 1YVEI 3RF9A 4ZXFA 3PL1A 1RRKA 3T4UA 4E2FA 2RGYA 2A5FA 1T8RA 4GM0A 1F7UA 3T7RA 4O1MA 3W7AA 2GJAA 2HX1A 4TZTA 1VFPA 3HJRA 1UKZA 3B6IA 2WFLB 3OTIA 4E32A 1LTQA 2JCSA 2AYZA 4Q48A 1EBFA 3IOYA 2HWXA 4Y2GA 2PGXA 3OCXA 1BS2A 2XV1A 5ADHA 1RQXA 3B78A 4NJEA 1NRJB 2D62A 1T5SA 5IK2A 1LDGA 1Y9ZA 1VCOA 1RJ9B 1R66A 4EHKA 4PRZA 5CA0A 4ED7A 2QJOA 1AGNA 2G3YA 2WU8A 4FN4A 5MGBA 4AECA 1R8YA 4YPFA 5EJ8A 3JQ8A 4ZVPA 5EWJB 4YB8A 1KR2A 4JFRA 1M2HA 5HPYB 2JGIA 1PP4A 1V35A 2QY6A 4X64B 2DTDA 4ENVA 3EZ9A 1MX5A 2ECOA 5E6UB 1E1LA 1P4JA 2Z9BA 3C45A 3GFSA 4DNOA 2TSYB 3OT1B 1Y3HA 1B8OA 2KYRA 2WUGA 3WJ2A 4X97A 4HL6A 3OM1A 3RSCA 5IBPA 3GDXA 3VKGA 2JH7A 3WWDA 2DLDA 3EW7A 3NNDA 1PR6A 3WAGA 4OYLA 4NK4A 1L9XA 3NGMA 1N8NA 5KJCA 3UNXA 1Z0JA 4M0PA 1OW5A 2GCOB 1B8NA 5KFZA 5ILGA 3IG5A 2JGNA 1O97D 5KFCA 2ZIAA 3KL2A 2YXBA 1ZGGA 4U9IS 1U9JA 3CNEA 5IARA 1A7JA 4PCVA 9ATCA 2ATCA 5EZYA 1ZOSA 3IFSA 4IHJF 1NJGA 3SHQA 3IL2A 2R47A 3OOSA 4E5KA 3ZD6A 3CF6R 4QX6A 2AGVA 2PGNA 5IAGA 1M83A 2NWQA 5BORA 1W34A 4B9EA 3BWCA 1SUDA 5T6BA 4BN4A 7ICRA 1AKQA 5KTQA 1MJNA 1SHLA 3H11A 5KVCA 1K27A 2K7ZA 3ZZMA 1B76A 2A57A 1Z7YA 3L40A 4OFXA 1E6WA 1EFRD 5JSZA 3TTYA 2FPGB 5E8RA 4YRNA 4NV3A 3PGLA 5IF3A 4OHOA 1USUA 3OHAA 4JL6A 5BSMA 4TKVB 4CIVA 5TQJA 3BS5A 1R74A 4AZ3B 2H3HA 3CQ9A 3W8RA 2O7NA 4Q7LA 4BQQA 3UBTA 2AQHA 1LVUA 4W63A 7ICQA 4QOHA 1N62A 3VZSA 2QN9A 2VPTA 3PD7A 2PM8A 1JYFA 3I01A 2ZZKA 5SYNA 4KAXA 2JRCA 4J1TC 2FXIA 2EBHX 2XUGA 1R10A 1A7AA 5FOQA 2D7CA 4L8FA 1VCNA 4MQ4A 1WWKA 2FEKA 3TM4A 5JOQA 4YACA 3HW8A 4PZCA 1TM2A 4AYTA 1YRBA 2F1JA 1BHSA 3AUOA 5L3SB 4EG6A 1YR1A 2RMKA 2PUAA 1YA6A 1QHYA 5ALQA 1QG4A 3HZRA 5J0UA 1Y4ZA 4LFCB 4MS3B 4DCTA 1UJBA 5KYKA 1Y3BE 5IYZA 3O92A 3UT5B 5CB8A 1C7YA 1DQZA 3UXEA 1TAMA 3IKTA 1YRYE 4GI1A 4XFDA 5KHLB 4M1QA 4AY4A 2FW9A 3LKZA 3WXBA 4TQGA 5FF9A 1SHUX 2JAXA 3IJRA 5H02A 1ZJNA 4AX4A 1MIHA 1A9OA 4ZICA 1YR9A 3ON5A 2DKFA 2GO1A 4NZYA 3B2EA 3W4KA 1KEZA 1CZNA 4I2IA 3QYFA 5FTJA 2P2LA 1XELA 4II2A 5E79U 1N3LA 4NZMA 4QEZA 3G0OA 1U1EA 3FNBA 4MUXA 1U0HC 3M89A 2BAGA 2JHAA 3HCWA 3ZU5A 4ZCPA 1MQ9A 5E7MA 4ACOA 5E2IA 5C81A 5HQ3B 2EJTA 4HFMA 2J9RA 3EOZA 3PX4A 1FC0A 4DUYB 3A1CA 5FUQA 3LQYA 4YYEA 3KKAA 1B93A 4YR2A 1WHSA 2HXGA 5TARA 1QMGA 3EYAA 2AL7A 2H4YA 2Q07A 7ICEA 1NU8A 3OQ6A 1EDBA 3QP9A 4C5CA 2ESRA 2PYDA 1OWOA 3FZNA 2IZ7A 3Q7EA 1CEEA 4X3CA 1D4ZA 2W2KA 3M4JA 3GXOA 3DG9A 1MO3A 5A0FA 4EGFA 3NBFA 1SQ0A 3JATA 4W5HA 4B75A 3E5MA 3G0HA 1T8YA 1E66A 2AW5A 3NRJA 4EELA 4NE9A 3GY0A 2FEAA 1HUZA 3NC1C 4JUIA 3H2IA 1MDFA 1EVZA 4CV0A 3ACDA 4C3ZA 3VOBA 1I4EB 3EQZA 2JAOA 1O3YA 1VBKA 3NYQA 3FF4A 4MHTA 4I50F 1PW5A 1DWPA 4Y2TA 3OC6A 3ZLVA 2CV1A 2IIPA 1A27A 4YRRA 3X3HA 2WEKA 1X80A 1Z68A 4BE4A 2YKGA 1H3EA 2FJ0A 1OBHA 1G8FA 1XZMA 3NBKA 5GQSA 3GDWA 1EK2A 3LDHA 2UZ1B 5IMBA 5IKOA 7ICOA 1HX7A 3L43A 1T34A 2I65A 4M54A 2J6BA 4INZA 4H1UA 2IHYA 4D9JA 3REGA 2DLNA 2JHCA 3AESA 1HFEL 1U9LA 1AZSC 4JL8A 1DUSA 3SYRA 3P9YA 3IDQA 1ISSA 4JV5B 1O0SA 2D3WA 4JB3A 2HWUA 1KYZA 4O0IA 4LXXA 3IDWA 1TTPB 1F8UA 1H2XA 4REOA 4S24A 4BQFA 5FNVB 3WK7A 2HRQA 1KARA 5LQMA 1CVRA 1XEXA 3LX6A 1KO4A 1VMDA 4HAUA 1Z2AA 4RNDB 2CVHA 4QUKA 1PR2A 1OLSA 1COKA 3W3AH 5JV5A 3S5UA 2M1ZA 5DX8A 3CRMA 1JLLA 4TRMA 3R9WA 1L3SA 3Q8SB 1RLTA 1T3ZA 4CM8B 1W19A 1XJQA 1CS4C 2FG6C 5KWSA 4NS4A 4MYSA 2BGMA 2EX0A 3DE2X 4JLPA 5L1MA 2LE0A 2XITA 2E0IA 4TM8A 4TWZA 3CUEF 1NVMB 4A4DA 5IBCA 4PQFA 1L5OA 5CFZA 4B79A 3BDPA 2IBSA 1ELOA 5E7IA 4I55F 4LYGA 4J4HA 3BDIA 4JOQA 4ARZA 3ZV6A 1HC7A 4MMXB 2XDYA 1K6EA 4G0VA 2GEJA 4WZAE 2CUTA 3GLSA 3LWZA 4Z49A 2NW6A 4QGFA 2REBA 4H4EA 3JALA 2X7XA 4ND8A 1MC5A 4QU9A 3S2FA 4F21A 5BO5A 4C7YA 4ZT7A 5KCMA 7ICIA 3RIGA 3K9CA 5JAHA 4RJ2A 5CPFA 3BWBA 1P9LA 4D9BA 1FJHA 3TL3A 2WIFA 2JF0A 5ISMA 3OOYA 3OY7A 1H2EA 4V3BA 1C1DA 4XDZA 1MQAA 5D3MA 1EJBA 4YD1A 4DGQA 2YIDA 2WRZA 3D8HA 3W7VA 1WXIA 3BJEA 2IS6A 1E7RA 3M9OB 2QNRA 2OTCA 3TRKA 3PA8A 2OBFA 2I1WA 4YCDA 1Q2UA 2AJ8A 1KY3A 1HTTA 3ZD7A 1RKQA 1W581 1I1QB 1OIXA 2AG0A 4Q9IA 1J2RA 1W4BA 4ZK6A 4IINA 3U31A 4Y6OA 2R6HA 5J0RA 3LVFO 4NIMA 3OHPA 3MJFA 1PK9A 3ZU2A 2PX0A 3HJBA 1H8HA 3AHEA 1RMTA 4PG8A 3CLKA 3DBHA 4LDPA 3RUHA 5JAZA 1W5FA 3L06A 2ZB7A 2WZQA 1YMUA 2HCTA 2ORYA 4GS5A 2ZXUA 2QW1A 3W2FA 4ALIA 1LBHA 5AW5A 1P2DA 8ICJA 3K3PA 4LRYA 5L1LA 1FVHA 4N48A 2AMVA 2QT1A 3BULA 3T34A 2MRLA 3RF7A 1RXSA 3WU2U 3LFHA 4JU9A 1U1FA 4LYJA 2ALJA 2FEMA 1C4WA 621PA 3U9TA 1SKUA 5AVQA 4JHLA 1WZIA 4RNNA 2PMZC 1NUUA 2OESA 5JSUA 4G0XA 4F4WA 1OT3A 2GFIA 1KJIA 4IOKA 2CD9A 2F3UA 2X6QA 4RACA 2GPAA 1W88B 9GPBA 4U2BA 2C4NA 5CNIA 1O4VA 5KT7A 4WESB 3OCJA 3IA2A 3H4IA 4F4IA 2H7CA 2O8BA 3CXUA 2DQYA 4YHHB 3UWMA 2VHYA 2H1WA 1GDTA 4ZVNA 4A36A 4JLMA 1R5JA 2Q4BA 1N3IA 2VYND 3ZGLA 2VDKB 1PT9A 2GVNA 1M6EX 1HUQA 2EATA 2ISPA 1XO1A 2DFVA 3OQOA 3EZYA 4OQYA 2Q3JA 4Q4JA 4PC7A 3ISBA 3RO7A 1U0EA 3AF4A 2H1FA 4I4LA 2PZ8A 4M9NA 1K5DA 3IERA 1ODIA 3EVEA 1FFWA 2ZJ6A 2CXTA 1GQ2A 4RMJA 1QG2A 1TADA 5E3HA 4X44A 1FX0A 5JWHA 3WAJA 2I55A 4JOSA 3SR0A 2AGQA 4J7CA 4LQ4A 3KKMA 3U7QA 4I5IA 1KO8A 4ID9A 2W03A 3HZOA 5B4VA 1BNOA 2H16A 2VA9A 5EJ6A 2PXAA 3FDSA 5IWAB 3TQSA 2GZSA 1OQAA 2F8MA 3IQZA 4EABA 2ODGA 3HL0A 2X6RA 3TIFA 3GV8B 3KZ1E 5HBRA 1CE8B 3FYCA 2CHEA 4JP5A 2ZT6A 2VTDA 2IBMA 3I4LA 2I8AA 2CXSA 2HLDD 1UOOA 5CIWA 3CKKA 4GDFA 2VUHB 1XTBA 3R41A 4O3NA 2C54A 4COOA 3K5HA 4G85A 4OYHA 4KX3A 1KETA 2VYFA 3LUPA 4R5HA 2GNOA 4U7JA 2YVUA 2KEYA 3UG7A 1NZDA 5LP1A 1NR5A 2IQIA 3R3YA 1T3NA 4G4SO 3QXCA 1GNRA 2XE8A 3K1YA 3EYWA 3O74A 3E0XA 1NTRA 5F9HA 1LPNA 3VPSA 5FTMA 4L07A 4YWJA 4TYYA 1GUAA 3KOUA 3LW7A 3CF4A 5E0KB 5IJXA 3I6ZA 3MAAC 4YGYA 3JPRA 1LFAA 3IIIA 1HDCA 3HT3A 1S8AA 1N2IA 2VEOA 4ZCRA 1C29B 5CJPA 3TGPA 3VAAA 1HOXA 5FB3A 4Y67A 3HSSA 4RK7A 1PR9A 1OLOA 2XGPA 4NM1A 1NUQA 3BSWA 1T6BY 4S1PA 5TT0A 4ZZ0A 4YP3A 2AFIB 3U7EB 5K6AC 3IE2A 4YUWA 2IZ0A 1XXHB 7ICFA 2YINC 3RH0A 1XZAA 1UBHS 1GV1A 3B89A 1ZRNA 3GX1A 3OF2A 1DMSA 4O4JA 2VPXA 3A58B 8ICRA 1GUYA 3PNKA 2OZLB 1FXSA 1AV6A 4I6EA 2DU8A 4XDGA 3GVCA 3WA7A 5E9AA 1H8HD 4JJFA 4FB4A 4GIBA 4WK4B 1U4SA 3T3MB 2ZKLA 5ICMA 2H06A 1XZIA 3TEJA 3E0FA 1CUXA 1XQ1A 1GG8A 5AW2A 5ECDA 5ALEA 4KG7A 1S9FA 4IUCS 4J9QA 3A3KA 4KLEA 4R01A 4JKIA 3DWGA 4S1WA 3OTOB 8ICYA 2ZT5A 4R1MA 2FV8A 3EXHC 3U1TA 3WLQA 3U3ZA 1E2FA 3HYLA 1VE1A 3SC3A 1ZA1A 4QM6A 1T1GA 3DFKA 4QBTA 1DWUA 4EMSA 3NV7A 4AURA 2EF0A 4DG9A 1SELA 3WHPA 4GH5A 3DC2A 2Q6TA 3W6OA 4K6GA 1JLMA 4KYVA 3IBTA 4DA7A 4M9RA 4HDRA 4P3KA 4OJOA 1XDBA 3TZKA 4PC3A 4F5PA 3P19A 4FC6A 1WB5A 2E4XA 1NVVR 3QKUA 1OWNA 5LOVF 1W5AA 1UBSB 4GXRA 3CB4A 1X7ZB 4F84A 4MJLA 4G6ZA 5DCUA 4TZ0A 4KREA 1CP2A 3LY7A 3UZUA 4GZ3A 2A92A 4M1KA 4NOJA 2O2G