4M6WB

Crystal structure of the c-terminal segment of fancm in complex with faap24
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
190
Chain Sequence
HIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Fanconi anemia group M protein
publication title Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 190
sequence length 196
ec nomenclature
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m6wB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m6wB01
8ICMA 4GC7A 4KLJA 8ICBA 4JV0A 4RQ8A 3UQ2A 5J2CA 4P0QB 1JN3A 4YR3A 9ICGA 2B21A 1IXRA 1BPBA 4P4PA 4KLQA 1ZJNA 3KTQA 3KHRA 4ECRA 5D4BA 4QZEA 3TQ1A 3PW2A 1NJXA 5HMLA 4RQ2A 4PGYA 3RRHA 2AQ4A 2GWSA 4DQPA 2A1JA 2FMQA 3UXOA 2ASJA 4F3OA 5D49A 1SKRA 4BWJA 1QSLA 3OSNA 4B9MA 2Y1JA 3GDXA 4Q44A 1U9LA 3C2LA 1KEJA 5KG4A 1U4BA 4RNOA 1TK8A 8ICCA 4M6WA 4GXKA 4DL3A 4YCXA 1AROP 3MBYA 4YMNA 5DBBA 5KFGA 5KG7A 4ED8A 1D9DA 4DSKA 1XSNA 4K4IA 1HJPA 4R8UA 5KFHA 1TK5A 2XO7A 1X2IA 1CEZA 3TANA 4F2SA 4RQ3A 1ZQOA 1ZQMA 3MFIA 2XY7A 4IRKA 4IRCA 2FPKA 4O3OA 1BPYA 3B0YA 4YXMA 3AUOA 2PFOA 3JPNA 2C2EA 2KTQA 3UQ0A 1RXWA 4KLLA 1N56A 2BCUA 4EBCA 4Z6CA 1ZQEA 2JEGA 2DFLA 4TUQA 4XRHA 2C2RA 1XC9A 1L3TA 2F1HA 1ZQGA 4M04A 3ZDBA 5J0TA 5J0XA 3ZDCA 4I2HA 3Q8PB 3RH5A 8ICZA 4QZ9A 2JEJA 4QW8A 5IINA 4J9MA 3HWTA 3MR5A 4JUZA 1SL2A 2KZZA 4KITB 2P66A 4TURA 4QZCA 2KZMA 4NLNA 4DF4A 4DWIA 4KLTA 1TFRA 5J2IA 1Z00B 1ZQIA 3MABA 4F4KA 4JV1A 1B22A 4RU9A 4DL5A 2ZUCA 2NRVA 2AQ0A 1NKBA 2HHXA 4IQWA 9ICLA 5HP4A 4O3NA 4MEXA 4BWMA 4IQUA 3Q8QB 5KG3A 5DG8A 4UAZA 1J23A 4YD1A 1ZQSA 1S0MA 8ICJA 7ICSA 3H40A 2Y1IA 8ICKA 2F1JA 2ZTDA 1X9WA 9ICRA 4RPYA 7ICVA 3OHBA 2A1JB 2IBKA 4RNMA 3RH4A 5CJ7A 1J24A 2BPFA 4LZDA 1A77A 5J2JA 2BGWA 4MF2A 3H8JA 4NM2A 1B43A 2P6UA 4C8LA 3PVXA 2NRXA 4FS2A 4DSEA 5DG9A 4M9NA 3PX4A 3GILA 3PX0A 4M9LA 7ICUA 4BXOB 1ZQNA 4NLGA 1DOQA 5J2FA 5KFCA 4DOCA 1QTMA 5CWRA 3N4MB 4PHPA 7ICJA 4TUSA 5KFFA 4F4YA 2BQUA 2PXIA 4KLSA 1RYSA 1XWLA 4QWBA 3PV8A 2P6RA 4RQ0A 2HW3A 2RDJA 4P0PB 5DDMA 3C2MA 5TZVA 4RPZA 1MQ3A 4F93B 3M8SA 4DLEA 4PPXA 2NRZA 8ICTA 5KFZA 2BHNA 2R8IA 4KLOA 3QE9Y 5HNKA 4ECXA 3GQCA 4EZ6A 1NKEA 5J2KA 1RPLA 3M9OB 3ZDDA 5KFLA 5DB9A 2AGOA 2W9BB 4KN4A 3V7JA 3RTVA 4YP3A 5F9LA 1C7YA 2PI4A 2XC9A 9ICNA 2IA6A 3JPRA 3V6KA 3PW7A 1NJWA 1ZQAA 1BPXA 4B9SA 4JWMA 4M0AA 2KFZA 5J0YA 9ICSA 1ZQYA 4QZ8A 8ICEA 3GV8B 5DLGA 2XY5A 1T4GA 4UBCA 4ECWA 5J0RA 4B9UA 3RJEA 4J9SA 3G6YA 1KFSA 2C2DA 5BPCA 5DGBA 3SV3A 3TI0A 2FLLA 2F1IA 1X9SA 4UB1A 4F4XA 5IIJA 5KFQA 4FS1A 3H7IA 5J0SA 5IIMA 5J0OA 5KFWA 3QEBZ 1D8YA 4O3SA 5KT5A 4DS5A 4I2FA 5KG1A 3RJKA 4Q43A 3MR6A 4P2HA 3FDSA 4QZDA 3AU6A 4YVZA 1LB2B 3G6XA 5KG2A 4EBDA 3RH6A 3RAQA 3ZDAA 3OJSA 4QWAA 4ECSA 3RR7A 4IQTA 4Z6DA 4UBBA 4DL2A 3TFRA 5KTQA 4X5VA 3Q8RB 5CR0A 3PO4A 8ICNA 4GLXA 1JMSA 4DFMA 4RQ1A 4YMOA 5BOMA 4MFCA 5KFTA 4KLUA 1TVAA 8ICUA 3LK9A 8ICQA 4ECQA 3EPIA 8ICHA 1ZQQA 3C1ZA 5J0QA 1KFTA 2ATLA 4Q8FA 4F4ZA 4ECTA 4NLKA 4F5NA 1N48A 4I28A 2IHNA 5KT2A 5J0WA 7ICKA 2UVVA 3HT3A 4KLDA 2XCAA 2BPCA 3T5HA 5IIKA 4RQ7A 4PHEA 4J9NA 4F5RA 5KFUA 2BQ3A 1ZQTA 4TUPA 3PNCA 2I1QA 4UAWA 3V7KA 4RZRA 1S76D 2JEIA 3AU2A 2FMPA 5DDYA 4QZGA 5KFSA 2W9CA 1TV9A 3M9NB 4KTQA 2XGPA 5DG7A 2XGQA 2R8KA 2H5XA 3RB4A 3TFSA 2UVUA 1S10A 1SL1A 4I29A 4DL7A 4B9TA 3KHHA 2HHVA 1S0VA 2HHSA 1D9FA 5KFOA 4M9HA 3LWLA 2HHTA 4EZ9A 2NRWA 3JPQA 3JPTA 5EWFA 3NGDA 1TKDA 4QWCA 3RB6A 9ICOA 3RBEA 2JZBB 4ECUA 1K1SA 4GXIA 1RXVA 5KFJA 4O3PA 3M8RA 4QZFA 4M2YA 4DSLA 1JIHA 2LYHA 3BQTA 2MUTA 1QSYA 1L5UA 4UB2A 4F4WA 1S77D 5J0PA 9ICUA 4KMUA 2W8LA 3UXPA 1TAQA 4DFKA 4I27A 4MFAA 3IHQB 4RQ6A 1ZQRA 7ICGA 1ZQWA 1HUZA 3ZDEA 8ICOA 5DQHA 1T7PA 1A76A 4IQVA 5DB6A 5KG5A 4FBTA 9ICBA 3GIMA 5DLFA 4O5KA 4F8RA 3OJUA 4F5OA 4ED6A 1NKCA 3BDPA 2ZTCA 3T5LA 1MQ2A 2ZUBA 4O9MA 4I2BA 4LVSA 5J29A 9ICCA 3EW9A 1JXEA 4UQGA 1Y88A 1NK0A 4B9NA 4DQIA 3GIJA 1U49A 2HHUA 1XU4A 5J2AA 2BQRA 5DBAA 2IMWP 2M9MA 2IHMA 3FYHA 3ORYA 4MEYA 8ICVA 1XS9D 3BQ2A 3OHAA 3C1YA 1MC8A 4QZIA 7ICPA 1XSPA 5HHHA 3QEAZ 4O5EA 2VANA 5DQIA 1ZQKA 3QZ7A 3SV4A 4M6WB 7ICFA 1EXNA 4I2JA 4I2GA 8ICWA 5IILA 2ZJ5A 3C5GA 3RJHA 2KN7A 3SZ2A 3JPOA 4DLGA 2V9WA 5KFVA 4R8UB 1UT8A 1MSWD 1J22A 4RT2A 3E2EA 4BGDA 5DGAA 4ED1A 2KZ3A 4QWDA 4RPXA 4KLMA 4F5QA 4P4OA 2W9AA 4ECVA 1K1QA 3RBDA 9ICHA 2A1IA 4KN7A 1QSSA 1D8LA 4M47A 4NM1A 4QWEA 5J2DA 3PR5B 3C5FA 3MDAA 5L1JA 5D46A 3LWMA 3PMLA 1ZQXA 4ECYA 5KFEA 3Q8LA 1ZQCA 8ICIA 2ALZA 9ICIA 1QLNA 5DBCA 2ZTEA 2KFNA 1KTQA 1L3SA 8ICYA 5DB8A 4FBUA 9ICMA 5DKWA 1HUOA 4C8MA 4UB3A 2AU0A 4O0IA 3Q8MA 1ZQDA 2BCQA 5J2BA 3MGHA 8ICAA 2W9MA 5BOLA 1U48A 4P4MA 4PGQA 4F92B 1NJYA 2C28A 9ICFA 3UXNA 1NJZA 9ICPA 2BCRA 4Q8EA 5CP2A 3C23A 2XCPA 3T5JA 1ZQFA 1RYRA 2OWOA 3ZD8A 1RZTA 3T5KA 4TQSA 7ICEA 4UB5A 2ISPA 5J2EA 7ICOA 7ICTA 7ICHA 9ICAA 2ZIVB 5J2HA 3SYZA 3G6VA 4DSIA 1UA1A 8ICGA 9ICWA 1PZNA 1JXLA 2V4RA 3THVA 2BCVA 4O3QA 1BPEA 4LZGA 5F9NA 3H8SA 3RB3A 2ZIWB 4JK1A 5KFAA 2R8JA 3H4BA 4DQSA 2AGPA 4O3RA 4R63A 2VA8A 1ZQPA 3V72A 4YQWA 4YD2A 4TQRA 1ZQJA 4YG2A 4ED0A 2J6UA 4DQRA 3BJYA 1NK9A 4F50A 3SI8A 4J9PA 2NRTA 4F91B 3MR2A 2C22A 2BDPA 4Q45A 4ELTA 4F5PA 2ZJ8A 7ICRA 2ZUDA 4PHAA 8ICSA 3HW8A 5J2GA 4DFPA 2PFNA 4CCHA 4PH5A 3K75D 2R8GA 5EWEA 4YR0A 4RUAA 1U47A 1ZQVA 3PMNA 4DQQA 3LDAA 4RT3A 4ELUA 3RRGA 2BKEA 1KSPA 3PY8A 2ISOA 4UB4A 4G3IA 4NXZA 1U45A 1XSLA 4ECZA 9ICVA 3PR4A 3KHGA 1WCNA 3PW5A 1H38A 2FLPA 1KRPA 4IR1A 2UVRA 5KFPA 4J9LA 3UPQA 1SZPA 4HYKA 1SKSA 4BXOA 4E0DA 3ETLA 4YMMA 4PHDA 1UA0A 7ICMA 2BCSA 5J0UA 4ED2A 4DSFA 1S0NA 4B9VA 3Q8SB 5IIIA 3C2KA 4EEYA 4ED3A 3EPGA 2HVIA 5KFDA 2MAXA 3C21A 5HMMA 4NY8A 3K4GA 7ICLA 7ICQA 3GFKB 5KT4A 5KFMA 5KFBA 4XUSA 3GV7B 3Q8KA 4M9GA 1L3VA 3KHLA 4RQ4A 1ZQZA 3MFHA 3RB0A 5KT6A 3T3FA 1SKWA 4B9LA 4YFKA 3ISDA 2W9BA 9ICQA 2ZIXA 4FO6A 1S9FA 1KFDA 5C5JA 1X9MA 2PI5A 4DFJA 2FPLA 5KFXA 4KLGA 2Q0ZX 1CUKA 3IM1A 4DS4A 4ELVA 1KLNA 4QW9A 2AGQA 4UAYA 2PFPA 5JUMA 3B0XA 3RAXA 4NLZA 4K4GA 4PGXA 3PO5A 1SL0A 1KDHA 2VA3A 1BGXT 4C8KA 8ICRA 1LV5A 9ICXA 3MR3A 4J9OA 4C8OA 1Z3EB 9ICEA 5IIOA 4YXJA 4J9QA 4EYIB 4ED7A 1V9PA 2UVWA 4M9JA 4R65A 4RNNA 3QZ8A 2FMSA 4GC6A 2JPDA 4I2EA 4QZAA 4MF8A 3RJIA 1ZQLA 3BQ0A 1DGSA 1NK6A 3OSPA 1TAUA 1NOMA 1BVSA 5CHGA 2ASLA 2XY6A 1NK5A 4JWNA 3TARA 5KFNA 1UT5A 4GXJA 4KLEA 2M9NA 2ZIUB 1COOA 9ICJA 3HP6A 3PW4A 2R8HA 5KG0A 2V4QA 5HHIA 3PW0A 1ZQHA 8ICLA 1ZETA 2W9CB 2I9GA 5KFYA 4MFFA 3GIKA 3V6HA 1T3NA 3N97B 4R66A 3OGUA 3EYZA 5L9XA 5DB7A 2W8KA 3TAPA 1WCLA 4RQ5A 4DL6A 3GIIA 2J6TA 2HVHA 4C8NA 2JEFA 1J25A 3RR8A 1XO1A 3ISBA 4EYHB 7ICNA 2HHWA 3V6JA 2FLNA 4I2DA 1S97A 2WTFA 3H8WA 3H4DA 1JX4A 4JV2A 7ICIA 1T8EA 3GV5B 4KLIA 4IR9A 4QZBA 4I2CA 4IRDA 2BPGA 2JNWA 3TAQA 2MUTB 4DSJA 3V7LA 4K4HA 4DO9A 5KT7A 1ZYQA 1BPDA 3EZ5A 3JPPA 1NK7A 9ICKA 5KT3A 3BQ1A 5CB1A 5L1LA 4ZH4A 5KG6A 4J9KA 4R64A 1ZQUA 1NK8A 1TK0A 1ZJMA 1L3UA 3HX0A 3NTUA 3ZD9A 4DEZA 5L1IA 2PFQA 5DQGA 1BPZA 3MDCA 5KFKA 4DOAA 4DF8A 4KLHA 1IM4A 2RDIA 5EOZA 4DL4A 4EBEA 2BR0A 9ICTA 2FPMA 2HHQA 1NK4A 4YR2A 3ISCA 4O5CA 3M9MB 2AJQA 4J9RA 2ASDA 1ZQBA 2JZBA 2VA2A 8ICFA 4DOBA 4Z6FA 2J6SA 5KFRA 5EWGA 3MGIA 4I2AA 2ZJAA 1S0OA 4BDPA 3EWAA 4I2IA 4XQ8A 4XA5A 3JPSA 2DPJA 3RJGA 4QZHA 4YN4A 5KFIA 4Z6EA 3HPOA 4F2RA 4KLFA 3PX6A 1Z00A 8ICPA 8ICXA 5L1KA 5CA7A 3RJJA 3RJFA 4RUCA 2DPIA
chains in the Genus database with same CATH superfamily
4PGGA 3ZWDA 2WDZA 4EDHA 1NSTA 1Y8AA 1B6RA 1LJLA 1SG9A 1D1QA 5KDLA 4GMFA 4DM4A 2I5PO 2FZCA 4IOKA 4UHDA 4P3XA 1OV6A 3UAVA 3RS0A 1ODTC 4WDQA 2QJFA 1YZHA 3T06B 1D2EA 1HWYA 5B2ZA 5DNAA 4KE6A 1GJRA 4J0GA 3ZV5A 4RVFA 3QMPA 4KK4A 3OKAA 3Q1LA 4H7IA 1XD9A 4LXYA 5CIWA 3GLIB 1XLUA 3TJMA 2JH9A 2R6AA 3B70A 1RJEA 3OD5A 3L7JA 1JV2B 3IAS1 1QVRA 3AERB 4ZQBA 1AK9A 3WAKA 1D9XA 5JNWA 4OHFA 4YV1A 3LI2A 4RMIA 1HM5A 1QHFA 4ES6A 2QPAA 4CMIA 2QB1A 3NQ41 5J5CA 3G0DA 4YRQA 4QIWC 5DTQA 2D8MA 2BUBA 2WFMA 4LZDA 4KIWA 4IQ0A 1BXRB 1DAFA 3ZLBA 2BQUA 3UY4A 4UJ5A 2G06A 4KWCA 2ZOSA 2JFNA 5JBNA 5L40A 3TCNA 3OEWA 6CHYA 4KN4A 3O3MB 2Z95A 1MEEA 1F20A 5AWFC 1BPXA 4AW9A 2GCIA 1T1EA 4DA0A 2NUAB 4NX2A 1X9SA 3QE0A 1S3SA 3U13A 1QHHB 4G8DA 5KKCA 3B85A 2QMUA 2PA0A 4PC2A 4XFJA 2H1LA 2OKGA 3JQ7A 3OURA 2JAPA 2HAEA 2OV4A 2CLMB 1D2CA 5KFTA 3LVRE 3I53A 3C1ZA 2JG3A 4JJ4A 1DAOA 4KBYA 4NOLA 3G02A 2NADA 2O8BB 1EFTA 1L6IA 5KFSA 1MN6A 3JATB 4XVRA 1RP7A 2EQAA 4D8VA 4ZC1A 4ZD6A 2WG1A 1NBIA 2CK3D 1GZVA 3NEAA 3QBVA 2D62A 2ZLBA 2PJZA 3E9NA 1FQJA 3Q7EA 4NBTA 5FFNA 3GRPA 5CVTA 4J9UE 4AICA 3TQQA 3DMGA 4FFSA 2XCIA 2XSZD 2XMRA 5KC8A 4EQ6B 2M6SA 4LY6A 5TJHA 1A27A 1N2CA 2CUTA 4QYSA 3F71A 2OD7A 2B1GA 4JUIA 3I4FA 1W0CA 3IEUA 2P68A 4ISBA 4L5CA 3CLUD 2F3UA 4AQYB 3LW7A 1UKVY 3CS3A 3GD5A 1DC8A 3BGIA 2H3FA 2JZNA 3HKCA 2BCQA 1RQPA 1RWKA 4GLFA 2ZJ7A 5LU8A 3OY7A 3AR5A 3GUYA 4EG7A 1TQDA 1HT1E 2P91A 3MBOA 3QTTA 3A1UA 1T4CA 1DL5A 3RAJA 3WR5A 4CDRA 4H0CA 2ZUDA 3UMMA 4AUEA 1G8YA 2RKOA 1BROA 3D8TA 3FI9A 1K6JA 1XCPA 2PLNA 3S28A 1D1SA 2I67A 1BDJA 3ULKA 1VB3A 3Q4GA 1A96A 4HY3A 3U6BA 3CO0S 2OCIA 3AB8A 4QFDA 1D5WA 2VQSA 4E0BA 2G82A 2VUSA 3H4TA 4FO6A 4M83A 3PQ7A 2J5XA 3RDPA 2IXBA 4TTPA 1W30A 1Z6QA 1M1ZA 1J8FA 3ICVA 4FT2A 4HO1X 3RJIA 1Z5WA 3VPXA 1JQDA 4NBSA 4J2HA 1W4BA 2ECFA 3ZY3A 1JT9A 4HVAA 2H0QA 4ER3A 3V6HA 2KICA 3RF6A 2DAPA 3UV7A 5CDUA 3HKDB 5G02A 4NMXB 2XNDA 5CB4A 3RRFA 2HM7A 1JX4A 4BKMA 2FP3A 2W93A 2RHHA 4GR9A 4LYGA 1ZU5A 1FUUA 2CNLA 4X54A 1YUNA 1A50B 3OZRA 4J29A 3SJAA 1DWPA 1ZA1A 3MUNA 1XAIA 2YWJA 2W4MA 2GF9A 2Y9UA 3LT5A 4TOIA 1J0AA 1DRJA 5J2UB 1U2DA 1QS0A 4KJZA 2V0CA 2W2TA 2FFHA 5BQFA 1KORA 1JROA 1HIWA 3PYXA 1K2VN 4ZOLA 4RLSA 3KUUA 1S3FA 4ZU6X 2DF8A 4K3VA 4S35A 2XUZA 1PBNA 2YS6A 4MDFA 2ZXIA 2HSEA 3M4ZA 3R8CA 4BNKA 4R8UA 4C1BA 4GPIB 1WWKA 4LRUA 3WB0A 2BCUA 4H6XA 1J2UA 3NONA 4AIRA 2Q6LA 1ZXIA 2LUOA 2GAFA 1LPMA 2HJGA 2HMVA 3OSZA 1ZN8A 4D46A 1RAGA 3PR1A 1JA0A 2JLUA 4M7RA 1CD5A 2HLDD 4O3NA 4IL5A 4PNZA 1RTTA 3H0LB 3N8DA 2C4MA 4XYBA 1IBRA 2DPMA 3HA5A 3R23A 4EG1A 4KR9A 3K5WA 3O3CA 3NHKA 3IJEB 3UENA 5EJ5A 2C58A 3G5MA 2PXIA 2B4YA 1HBJA 2YINC 5EGSA 1NLYA 2JL1A 4F93B 2H4HA 4ZJUA 1MGOA 4UREA 4HYTA 2RHWA 3V6KA 2DPGA 3AM9A 3DKVA 2FSGA 3ML1A 2V96A 1T0PA 4GKBA 4KWIA 4Q3CA 3DMTA 5IKPA 3T0GA 1YSCA 3MINB 1JMSA 4DYHA 1K08A 2CYBA 4IH9A 1IL0A 2JCGA 1E2FA 3KWJA 3GMSA 4IL6U 5KSZA 1DKLA 3GU3A 4TUPA 4V3CA 4NNOA 3RJMA 3PQCA 2GBIA 3HEMA 1KYXA 4H31A 1Q21A 3SZ3A 4ZI7A 4KBGA 2HHTA 1EE2A 2OGWA 4EPXA 5CDYA 4U4AA 4F2HA 2OHXA 1P39A 2P6MA 4LI0A 3G0OA 4XCQA 1AF4A 3FDXA 5DHFA 3GIMA 4E70A 4C0KA 5I9LA 1EUDA 1TQ6A 4IDQA 2ZIWA 3P5SA 3AIOA 3ZVLA 1HR0B 3OZGA 4JJAA 8ICVA 1XS9D 4FXOA 2H52A 3OCJA 5LLDA 5JXJA 3A4IA 2ZIZA 3EXIB 3U17A 5CXQA 1KFJB 4QOFA 1JZQA 4L02A 2PZGA 4IIBA 3ZPXA 4BUCA 1OUMA 3VSAA 4FT4A 1N61A 4TWRA 1CE8B 2VWGA 3DTVD 2AOUB 1L5OA 4WACA 4MV1A 3ZKWA 3ANNA 4LHYA 4DLRA 1P6XA 1LUAA 1XVVA 2ZIAA 1L1QA 1QB7A 4R6WA 5CNJA 3MMNA 3GEHA 5KTYA 3SYLA 1H93A 4A8EA 4MYCA 4G5FA 2DKNA 3K9NA 3LUCA 2PUGA 3N5KA 3TDNA 3K0HA 4YUXA 4F50A 4TRMA 5LM3A 4IC9A 3LVBA 1PT9A 3GR6A 4JBIA 2I2WA 2ZM6B 1PD0A 2QF7A 4H4CA 5LMNB 5AK4A 1OUQA 4Y2HA 3W7VA 1CWUA 3UUEA 1Z4NA 4PONA 3UUGA 2CLLB 4D0NA 2FETA 1WMAA 5CYFA 2WTEA 5I9NA 1NQVA 3GV7B 4H7HA 3EIEA 4R8SA 4KXNA 4R2IA 5K3AA 3L8FA 5EXEA 4FE3A 1NU6A 2JPDA 1T5BA 5EPUA 1TF5A 1VKRA 5F77A 1WHSA 2R8EA 4I46A 4OG2A 5H4HA 1QUFA 3GIIA 3QJYA 2MCFA 4AWBA 1URPA 5AI8A 5CH5A 1SCQA 4JYMA 4YAFA 4UM9B 2QI9C 3OLQA 2C1ZA 1TJ3A 1DAEA 1GZDA 2PX4A 5L53A 1MGPA 1RHUA 1SB8A 2FPMA 1COZA 1NK4A 1AKEA 3EVCA 1MJ5A 3CF4G 2XKBA 4I8XA 3MHTA 1RHQA 3K3PA 5FWYB 4NMWA 2B6GA 3BHIA 4C43A 3DB2A 1ZRNA 4BVBA 1JHAA 4IJQA 2GO7A 3RRHA 3J7TA 4G89A 4B71A 1C0EA 2ZJ0A 5DRTA 1EVLA 3JX9A 3DOEA 4D6YA 1KI3A 4WN9A 2X58A 2JIQA 3AVUA 4D9BA 3BBPA 1ZAYA 3FZYA 5H80A 1P0CA 3IBGA 4RNDB 1FP1D 4IHAA 5KU1A 1Y82A 1KEVA 3A1VA 3WYBA 2YQEA 4RQBA 2X22A 4EMSA 2CFOA 4DA9A 9ICLA 5JT1A 5KAIU 1JQBA 4BAUA 4YRIA 3A6KA 1TAMA 3SIRA 3D0KA 4Y1RA 4Y1EA 1E98A 3K72B 2NW6A 4QTTB 5F7XA 3ZK7A 2DHDA 5JJCA 4JQOA 5L95A 4IX9A 7ICUA 3NDRA 1HSZA 1ZNYA 2V7TA 1NL3A 1V4BA 3OQMA 4RE5A 2Q3LA 4F4YA 2BMDA 1VPTA 2EJCA 2AL7A 2ZCUA 1AC5A 2M98A 3OPVA 4X6UA 2EZYA 4RWEA 4CU5A 1WSWA 3G2HA 1AKWA 2GTIA 1IY0A 3UANA 2ZSAA 3GV8B 3JASA 3DVAA 4D45A 3ND8A 2ZE6A 3UGKA 4A0QA 3AH8A 3THXB 5KPJA 3ZZUA 1V5GA 4EHDA 2OHFA 4EHIA 2NLOA 1T6ZA 3HB0A 2JATA 4PWZA 2P8JA 4AUNA 5H81A 4MAFA 4N5NA 1J33A 5IYZF 3V4SA 3RNOA 1C4KA 5B1SA 1P77A 4QL3A 3UTCA 4TL7A 5BUSA 2OCXA 2NTEA 2AJLI 1W8IA 3P8ZA 1IHUA 1PHRA 3RUIA 3KO8A 1GRNA 4BO5A 5TS2A 2QRVA 4O1HA 5HKKA 1Q1AA 1FDVA 3KPWA 4WNIA 2B5VA 1XEXB 1YTUA 4A2CA 1DV1A 3PITA 3EIHA 4JIGA 1JIHA 2BGTA 1AKQA 3ACCA 3E5NA 1UXOA 2G5HB 3KE8A 2GPAA 3GMTA 3HWSA 1J2EA 3G3EA 2MU1A 5FKJA 1GFIA 2GVDC 3B1KA 3V7FA 5EE0A 1U49A 1GPDG 1BFDA 1AIPA 4QZIA 1ZQKA 4I2GA 1QBGA 2HW8A 3RI3A 4DMHA 3M9LA 2VEOA 1ZW1A 2XLCA 4DANA 4PO3X 1OH7A 3F3MA 4X20A 2YMLA 3L93A 3H05A 4R1PA 4MV5A 4GF5A 2OB1A 2GRAA 1U8EA 5EJ9A 1RZTA 4TQSA 2VA9A 2UZ1B 2H11A 4MKFA 5BRNA 4BGUA 2FKAA 5FPKA 3SIWA 4JC8A 2KJQA 1V7QA 4CN9A 2ZYHA 1K27A 2AX4A 3GX1A 2YIVX 1DO0A 1J2RA 2QTTA 1U3CA 1UINA 1E2QA 3QKTA 3RSLA 3WIDA 8ICSA 5FBVB 4UVDA 2Q4DA 1Q7CA 4PHCA 2JJYA 4QM7A 3ABIA 4YWHA 5BV8A 3QVGB 2IDKA 1KAEA 2ZR7A 2O3RA 5T4HA 1SZPA 3OBBA 5AJWA 1NPTO 2WNSA 1PZXA 3OC0A 4WNAA 5G4KB 4J9VA 4HWOA 3DGEC 2AR7A 2PN1A 3GUCA 1NP7A 3QJ5A 1EMDA 2RAUA 8AT1A 3L2OB 4ZAZA 4K1LA 2XBLA 2NU6A 4NJEA 2KIVA 3CP8A 1MAUA 3PHLA 1PJRA 2MYPA 1VPVA 2DGZA 1J0CA 4R1TA 2OYCA 1Y4UA 2D1RA 2FRDC 1DQNA 2MMCA 5TS3A 1O9GA 2F7SA 5BQ5A 3BKXA 3KOXA 3KALA 2J3QA 4U7CA 5JXHA 3PJDA 4IR9A 4TPKA 5B58T 3HABA 2VYVA 1NK7A 2KJ5A 4R64A 4LE2A 3RHFA 4D9EA 2FX2A 3AHFA 1A4UA 2RI6A 4EBEA 3IQFA 3IBFA 5KO2A 3GT3A 2J6SA 3N2YA 3MGIA 1SKYE 1S0OA 4YBRA 5L6LB 2I55A 3IUNA 1KMHA 4FYKA 2Q6KA 4WK0B 4FZRA 3OEHA 1H3EA 2CPRA 1GXSA 3A6EA 4KAAA 2Y1JA 4U2CA 2J0QA 5AICA 2QR3A 2Z0MA 3AO0B 4NOJA 4IRKA 3UMYA 3KCQA 1G7CA 2F17A 3SDZA 4V03A 3S1LA 3VM6A 2DFLA 3UAOA 1E7YA 5ECWA 1NF2A 2PV7A 5EUCA 4EGJA 3KR9A 1PD1A 3PCXA 1SHTX 1X1EA 1WF6A 2JZOA 4REMA 4MUJA 5H2FU 5A4JA 3O93A 1LTQA 3JPWA 1XSEA 3DVLA 3H8JA 4KWEA 4KN9S 3VHQA 3RSGA 3RYHA 2WWIA 2FPXA 3GRFA 4X63A 3PUXA 5FI3A 1P17A 3GEDA 2XTZA 4LZPA 5TZVA 4F6RA 1FNNA 3WK8A 2ANCA 2Z5VA 2W9BB 2KJ8A 5LQSA 2W6CX 2ZYVX 1UEIA 4J94A 4YAGA 1IVSA 2C2DA 3L9XA 4NULA 4KPYA 2VBFA 1AQJA 2GASA 3SZLA 2GARA 3FH0A 2IYEA 2EW1A 2WICA 4EGFA 2P4SA 2G5IB 1C7ZA 5AXDA 3HJNA 4Q1AA 2VP3A 2CLSA 3O7MA 2PJRA 5ER9A 3FGZA 4BN5A 3BXEA 2JLXA 3BXPA 4XH9B 5FFMA 3IJPA 2YNMD 4YGYA 4I55A 1E77A 1SXJA 1Z25A 5CIQA 5AJTA 1CUYA 3K0KA 2C9MA 3FSGD 4FCTA 3B3FA 3CG4A 3P4UA 5MHTA 1YJBA 4V0ME 4OHOA 2WV7A 2RK4A 4MDEA 3VZQA 1FTGA 5CFRA 1I8TA 3ZGVA 1CDOA 3S2SA 4LXTA 2P4UA 1PR1A 2WIDA 3RRYA 3OT4A 4PCUA 2BFCA 3O31A 1SOMA 1V1RB 5DGAA 3LLUA 1C4XA 4AKTA 5KNLA 3KSUA 1KF0A 4QT4A 1K7SN 8ICIA 1RM5A 2OZEA 3OKCA 3F3YA 2XUJA 4QBHA 4F12A 2EW2A 1WZIA 4JI7B 3OLVA 3OY2A 5J2BA 1AGNA 4I4IA 3SQLA 2V1UA 3U7HB 4ER5A 5IT0A 3LQQA 4IS2A 5EMKA 3VHLB 1Y5RA 4XB6B 2W2VA 1ZOPA 1WD7A 2YV1A 4U3JB 1GITA 4HS9A 2XTMA 1SVSA 5HS6A 2NXCA 2EP8A 4KH0A 1HK7A 3BJRA 1KL7A 1NP6A 4F2DA 3SVTA 4R1MA 4YR0A 4EUHA 1K2WA 1U2ZA 1OA1A 1Z68A 3KJNA 3BZBA 3QHAA 1F8XA 1B41A 4B85A 3OPYB 3MJDA 3R9IA 2C04A 3DL0A 4MVJE 3CEJA 3NHRA 4JBWA 4YUZA 2PIAA 2Y9TA 4QEZA 1DC6A 5HE8A 1R6UA 3BCSA 3VH4A 3ZQKA 4B9LA 5CA0B 3NHPA 1DJPA 1G6KA 1ECWA 1BGXT 2ZTUA 3DBHB 3I9LA 3RVQA 1WXEA 2Z2ZA 1FSGA 1S1CA 4GZ6A 4BLVA 3LHDA 1KE2A 4GT1A 3PW4A 1RC8A 1YA6A 2QD5A 3CSDA 2XB4A 4OQPA 3SWWA 5FUYA 3VHXB 2CWWA 1KKUA 2XKJE 5IVKA 2HVHA 4Z5XA 5LSAA 1SPBS 4JP1A 2XNKA 2LIPA 4FZMA 1IQPA 5BSHA 1JLKA 4MR7A 3TQFA 3K1YA 3HM9A 4BE4A 4J9KA 3KKPA 5ALOA 3E3LA 1GPAA 3RKUA 4BLUA 1A5TA 2UAGA 3LUGA 4WZBE 1XJ5A 4QGBA 3EVZA 3U3DA 3WC4A 5JY1A 3LIPA 1N8SA 3S1SA 5AI6A 1NGSA 4CKCA 4TTAA 4DR4B 1MAWA 1K8ZB 4GSYA 1YMVA 5C8VA 2QD3A 5LMUB 1C3JA 3NHSA 1XRRA 3OJOA 4S04A 5K99A 4QYIB 4X90A 2A1AA 4N7JA 3BUSA 4CMKA 2Y1CA 3AHGA 2JK0A 4ZHQB 2GN0A 5KNIA 4YAKA 3ZDCA 3GNTA 2D1TA 4PSVA 1CLUA 4IUYA 3CJRA 2KZMA 2HK9A 3E8MA 3JALB 5BR1A 1HKHA 2IPOA 4Z4HA 5HRCA 1D0SA 4X71A 4LNAA 5JCPA 3W8FA 3VMMA 2HJRA 3MQ4A 2G67A 2Q7OE 3UMCA 1KFKB 3ANTA 2GF0A 4U6QA 4ZI5A 3WTBA 2R1VB 3CGWA 3N4MB 4EY4A 3ENZA 3HEBA 3KOUA 3SM9A 2Z09A 5REQA 3ZQ6A 3ZDDA 3RTVA 1Z29A 1XEWX 3RBZA 2KFZA 3OFKA 2HDWA 3BCRA 3WKCA 4D4GA 1C2TA 4A92A 4F4XA 5B7NA 5LDHA 5KT5A 4YRDA 5T6BA 4ME6A 1L5LA 4XSGA 2PK3A 1M6YA 2WOOA 5EHGA 3MR6A 3OJSA 1RAIA 4B83A 2ZBGA 4MK4A 1NKTA 4M55A 1YZ6A 4HDOB 4GZLA 1U28C 2NP7A 4UFOA 1VXRA 5F2EA 1IY2A 1O03A 1Q44A 4ND3A 2WJ4A 4G5XA 5CX1B 2ODEA 2ZWMA 4HFNA 4XYEA 3QKSB 1GCUA 4FQ5A 4CUJA 3WNDA 5F2OA 4IS3A 1TJNA 4YT8A 3AI3A 2JI7A 3PQEA 2ILTA 4DZZA 3K9WA 3KAKA 3M3HA 1HDIA 1XN4A 2WBLC 1KOFA 3K9BA 2Y1WA 2XA2A 4DZRA 2JFVA 4QDJA 3GI1A 2V97A 2X2FA 1DKRA 3KX2A 3F2CA 1E3MA 3L1UA 2Y1DA 1E2UA 3BIWA 2V3WA 5DNEA 4B3DA 3BTUA 1XU4A 3A6DA 1DJNA 1SQ0A 3B89A 2G0AA 2J45A 1Z5NA 3P32A 3MJSA 3HO1A 2QQ0A 3OD1A 2C42A 3HVKA 4PS0A 4HNVA 2IYFA 5FYQA 3TSWA 2HDNB 2OHIA 1ZKDA 3I5AA 4Z7OB 1OGYA 3GEBA 3NX4A 9ICIA 1W0JD 1WMDA 4MPJA 1PT6A 5C81A 1DC5A 4ZYXA 4PLHA 1E1CB 1YULA 1OFGA 3AY7A 3PICA 4OQDA 5DNVA 5HOQA 2BFNA 1FPMA 1TW3A 5JTUA 1JQKA 1WUTA 4N40A 1FU7A 4U2BA 5LKAA 4II2A 1DMSA 1PT8A 2ZS8A 3H1PA 4OQ4A 3MTQA 4W5OA 3C6KA 2OORA 4PQGA 3JPYA 4DB2A 4UU0A 1S7CA 3AEYA 1KSPA 4RFVA 1OI2A 5DGCA 1SU7A 4NOMA 1W5FA 3W4IA 4U6PA 4PAGA 5IDXA 1NXPA 4R2HA 4DSFA 3UAZA 5IBRA 1NW6A 2QPOA 3KQNA 5KX5B 2FKNA 5LP6A 1KLNA 3NHUA 3HWX1 4N7MA 1B14A 1M2VB 3IHLA 3GRYA 1JU9A 3CPSA 5TVGA 3BQ0A 3PT9A 4X94A 1A9XB 3EXHB 1N2HA 1GPBA 2N0SA 1JHUA 3D8NA 5KFYA 3AZPA 4W5RA 1DAKA 1A7KA 2YN2A 2OVBA 2JEFA 3SMQA 1IUPA 1YBAA 4EA8A 1D03A 4HUQA 1UC5B 4H15A 4RO0A 1G60A 1YJAA 1COWA 2UU9B 3OX1A 2JLVA 1VG0B 3T7SA 4ACAA 5KYNA 4MV6A 2PG3A 1N33B 4OCZA 2CF6A 3DCIA 2X5XA 4GRIA 3ZCRA 4UTVA 3BULA 5CA1F 2A9QA 4IVQA 1USIA 5JALA 2IGBA 1JGTA 1OLUA 2L5YA 1MO2A 5IJ9A 4JV0A 4U0JA 4NLCA 5B5EU 3HR7A 2IV7A 3GZJA 3PW2A 4HCJA 3C5EA 3IVCA 4DGQA 2OESA 3KUKA 1PG0A 4XTRA 2XMZA 1MFZA 2ZTLA 2OAGA 3LQYA 5F23A 2Z8YM 4M8LA 4PX9A 3P45A 4F9TA 4JDUA 2VDUE 2PRIA 3TEJA 3X1ZA 4BECA 1R64A 2COKA 3B52X 2ZT5A 2H5LA 5TVKA 4UOEA 1W9HA 1PVVA 4NQZA 1UC8A 1KP9A 4ZCTA 3A1CA 4G01B 3VJKA 3BTVA 5AK3A 1FA9A 2GEKA 2WJAA 2UYCA 4IRXA 3C3DA 4E3ZA 3OHBA 4ODIA 5KYUB 3A31A 3TKYA 4YCMA 3L6RA 2FAXA 1MNQA 3B1XA 4YHHB 4C8LA 2X8WA 3QPVA 2JGEA 1XTJA 4H59A 1JN0A 2R2AA 4BO9A 4HLUA 5K6AA 1FW8A 4QWBA 4JZYA 1ZO8A 3TRHA 1BDBA 2K4EA 3Q9SA 1RS0A 3M34A 3RS7A 1MZPA 3KVYA 4FFBA 4ABTA 4R81A 4HDKB 1PL7A 2IOQA 3AEUA 3GVXA 4G07A 2GPWA 4FX5A 2Q2QA 2JDIA 2ZUSA 5J0OA 2I3GA 4O33A 4C0HA 4GUAA 4P80A 1E9RA 1U8ZA 1BN6A 2HRZA 3HJHA 4I4TA 1QMPA 1RXIA 4GLXA 1XMVA 4ER6A 2AGVA 1UWVA 5BOMA 1YBMA 3JZDA 8ICHA 5E6RB 3VC2A 5GIOE 3CV3A 3M6IA 3QQ5A 2VJCA 1C8BA 3C3WA 1VPEA 1GGFA 1NQUA 3TADA 1F12A 1OU4A 4RANA 1O0BA 1X9HA 4IIEA 3PDIA 3X2SA 3X0DA 3BS7A 7MDHA 2PQ0A 1JJ7A 3TTUA 3WMFA 3ST7A 4GE0A 2ECQA 2QG4A 1ONSA 3ZQUA 4PE5B 5M29A 1NZBA 5DBAA 2OY0A 4IXNA 1Z63A 3NO4A 1ISPA 3PX2A 1ESCA 3NTRA 3EF0A 1WG8A 1KW4A 3BTOA 4UZEA 4RPXA 1BEUB 3K9LA 1F38A 1O95A 2YJZA 2VTDA 3RU3A 5FHRA 4MRRA 3SQNA 3IURA 5HEKA 1G20B 4HI0E 7ICTA 1PJ8A 3KVNA 2GMWA 4MRAA 3TR5A 2A1UA 3V1UA 3I2JA 5G1NA 3W2HA 2WG0A 4D57A 2ORVA 3B6JA 1GDHA 1W2WB 4YRCA 4A23A 1G6OA 3CZCA 4AMVA 1GSOA 4O0MA 1OXSC 3ECAA 1CUDA 1GKLA 1SVWA 5HFAA 1HE1C 2EDUA 4WUTA 3T4UA 3FFAA 3GP8A 4KR3A 2HJSA 4I4NA 1ISGA 3CZAA 1JPUA 1ZICA 1QJ4A 4QYXA 1AUVA 5EKSA 5KVVA 3Q8SB 1X7DA 4CKXA 4G25A 3AYZB 5IUJC 1GWNA 2VLBA 2ZJBA 4EYEA 5HJ7A 3JQ7B 1C30A 2I6XA 2NYRA 3BORA 4URFA 4PGXA 1K4MA 3HUTA 4JQZA 4P7FA 4EL0A 5IIOA 1S8FA 3EOAI 4JQCA 2OZLA 4GX5A 1IDOA 4ZVVA 2P4HX 3LKBA 3KZCA 1EWTA 1C8VB 4NBVA 4GLBA 2RGGA 3T5TA 3ROQA 1YF3A 3SKVA 1U6JA 4K4HA 1PKEA 1RFLA 2HNKA 3P2EA 1JLSA 4P2GA 4JUDX 3CLRC 1CI4A 2VJBA 1SKMA 1IHXA 3UWOA 3JQBC 1LLCA 1N2CB 2ZXFA 2H7YA 1RZ3A 1GYPA 5JNUA 2IEZA 1T5DX 2KX7A 1N5RA 4L07A 3K09C 4ECRA 4TL8A 1TRHA 2ASJA 3AB7A 4JK3A 3RUHA 1OGJA 4H7FA 1PNQA 4FKBA 3HKCB 2IIPA 5EWLA 2X6TA 2IX9A 3TLCA 4TQAA 4PAMA 5LYYA 2ZBRA 2JIZD 1JQLB 3IVRA 3E2MA 1TKAA 2HC9A 1ECLA 2EDCA 5JO9A 4M1ZA 1T2CA 1UBGA 4MGKR 3V7NA 3BT7A 4TXLA 4MI1A 1T4CB 4WOBA 1L5FA 4L8WB 4KSBA 4BPBA 3ETCA 4DJDC 4QXPA 2R6DA 1TQ4A 2YQ5A 5C8YA 5HDQA 5AVSA 1GGHA 1H6CA 2Z1MA 4N5HX 3NP7A 4B3RB 1E92A 1TRKA 2WJIA 4KRYA 3PX0A 3N7TA 4MP3A 4X1IA 1II8A 7ICJA 5GTDA 3EPHA 3O4GA 4Q3KA 1MX9A 5CXSA 3N6RA 3ICQB 3GYGA 3E9ZA 1VIAA 2B35A 1KOLA 4MQ6A 4M0AA 3SHWA 2QGFA 8ICEA 5DASA 3GLGA 2C96A 2FLWA 3M8KA 4B5KA 3LVQE 4Q4CA 4EENA 1DDOA 1VI5A 3B5JA 4KVZA 1RI1A 3FSJX 4D41A 3O38A 1NASA 1P73A 3PJEA 2QQEA 1DG1G 2NZ8A 3AKEA 4GBJA 1RAFA 3Q12A 2X14A 3RH6A 3DQQA 1II9A 4J2OA 3VVBA 2QX9A 4DFMA 4HL6A 3AU9A 2UDPA 3B82A 4PZ9A 4QSHA 4U7TB 3A3NA 1KFTA 3L7IA 2GN1A 4WW0A 4I28A 1LBIA 3QKRA 3VDQA 1Y4ZA 2JD0A 3N28A 3SSAA 1RYMA 2QTLA 1LH0A 3BZCA 4OP1A 2R7MA 1L7XA 2AJTA 3DMHA 4M0DA 9ICOA 1FSZA 1GQFA 3TTVA 1PV1A 3Q5DA 3V4FA 3GVHA 3HXMA 4K28A 2WIGA 1I2MA 1QS0B 3RYTC 4PFQA 4BRUA 2G80A 4ZOLB 2FX3A 3EAGA 3LZ6A 1IOZA 1JR4A 3I1JA 4HEA6 3QLUA 1E1MA 1M73E 3OQIA 3VOAA 1K0FA 3SLKA 2HK6A 2PFKA 1VBNA 1N3BA 1AS3A 1CDZA 3GRKA 2W6JD 1E7SA 2NMVA 1YO6A 3PPVA 4R8UB 3UIEA 3UBMA 1HE5A 2V7XA 3ZW8A 4ED1A 1I2AA 4F5QA 2NZJA 2Y2UA 3D3QA 1LNSA 2W2KA 1RWXA 1ZBQA 2BIFA 3E3MA 1PWZA 3V4PB 2BOVA 2XD4A 1I5EA 1HUOA 2J3EA 4Q3LA 2OBLA 5HSGA 3EEYA 3IDSA 4F0JA 1ZQFA 4EHFA 1FYXA 4D0GA 4D5EA 3VCBA 3G6VA 2GNAA 4L6IA 2G5CA 1XLWA 4EBBA 3JARA 4AP5A 4PBSA 3GLRA 5A2GA 5K2OA 3NC4A 4X5OA 5ELMA 4Y6QA 2J3KA 1SBTA 2W6IA 4A2QA 3VJMA 4QTUB 1W36D 3CH5A 3T34A 2C59A 3WA7A 3DZDA 1VXOA 1EU1A 4LISA 3SQDA 1UAGA 3I52A 2ZPAA 3TXYA 3K15A 1QU2A 4FR0A 3F2BA 3TQTA 1ZDMA 2W48A 3ASYA 3WGTA 3D6TB 1PFUA 2GPBA 4W6QA 4N0DA 5AK5A 2CFCA 2YJGA 4LX8A 2P2YA 4DFJA 2PMZC 2CYCA 4ICIA 4ELVA 4O02B 1PUZA 1NVVQ 5KTTA 1CUBA 1V35A 2HXSA 3PDWA 4YXJA 4IDOA 1T9KA 5HM8A 1V9PA 2IVFA 1W1UA 5BNWA 2NP6A 3MWEA 1I2CA 3L7AA 3KKOA 1MOPA 3K6KA 4PAQA 1ODKA 1J42A 2DH5A 1BE1A 4BP1A 3EZNA 2J9FA 3IAM1 4ZI7B 4OHYA 1A0OA 1E3SA 4Y8VA 3KB6A 3RVRA 1NR7A 1S5LU 2D0DA 4B7AA 3OTWA 1ZYQA 4FFDA 3IXMA 3L05A 1A4XA 2X9LA 4GOMD 5L4SA 1QHSA 3IC5A 3PSPA 3SU8A 3R7LA 4RTSA 1KOGA 5I4BA 3WWCA 3P9QA 3U09A 1TYDE 4E51A 3K96A 2QP4A 1FFHA 4FZNA 3E35A 5EJAA 3CLSC 1XKQA 3KNZA 3BE4A 4EG4A 2PRYA 1TZKA 4DQ0A 4HQRA 2XYPA 2IYZA 4CQMA 4O4LA 3I01A 3KLPX 3ZKWB 1FK8A 4BVHA 3ILYA 4LSZA 2CJXA 2BF7A 5CJJA 4AJLA 4CTMA 1B0XA 4QJ4A 5K45A 5IKXA 1D6JA 1MA3A 1B22A 1PQUA 1VTKA 2HRRA 4XEUA 1Z5UA 4YD1A 1MB9A 4B7XA 5E3IA 2P4EA 4BQNA 1OT5A 4CCSA 3I3SR 4B3HA 3RF7A 1YI0A 1KGSA 2RDJA 3K2EA 3O7WA 5HQ3A 4HNTA 3C3JA 2WJ6A 3VTAA 5FTKA 3SC2A 1J7JA 2OUKA 4M1WA 3G5AA 4EKEA 4D98A 2YUIA 3LW8A 4CFZA 3DAOA 3WZ2A 4DR2B 2FLLA 3GJ3A 4QXAA 2HIAA 5A9RA 5J0SA 2KB0A 5L6MB 4M8IA 4UE3S 3GLUA 3A3OA 4KI0A 3EPLA 4QZDA 1WHSB 4KK3A 3CC8A 3W8EA 3ZQJA 3VU8A 3D0OA 4AJ2A 1EFAA 3Q85A 3PGXA 1NLMA 3OJFA 4D4IA 1ULSA 3IESA 2AJBA 1PQ4A 4HGNA 3WWYA 2QZ9A 4Z4GA 3ITEA 1Z0IA 3M6KA 3DBVO 4FM9A 3BTSA 3UHJA 4GYJA 1V2HE 1OD6A 5EJ6A 4O4JF 1DP4A 4GE3A 4ZCMA 1IPHA 1FX0A 3FD8A 2OLKA 1R1DA 1RWOA 3WB1A 4OB7A 3VKVA 2WVHA 3GRZA 1HGXA 4C06A 4XX1A 1K9SA 1B0PA 7ICGA 1J49A 1IWBB 3VR4D 1C9NA 4KQFA 4HZUA 2ODBA 1R37A 3BWMA 4TS9A 4RHTA 3DJYA 4UQGA 1NK0A 5LC1A 1BRTA 4N5MA 2RGAA 1LV8A 3ZH2A 4GOXA 7ICPA 2UUOA 4WN9B 4KO1S 4PLPA 4AJ4A 3Q7QA 1SCAA 4M9UA 3FETA 5EN4A 4FYVA 3IUEA 2IH5A 3H1GA 2XEDA 1O4VA 4M1KA 3R75A 3PSIA 1Q7TA 3E9YA 5D85A 3RC1A 5BP7A 5K0CA 4FC7A 4EDFA 5DB4A 1GIAA 1P44A 3AR7A 2R7AA 4BRSA 3B6MA 2AQHA 3TQSA 2YWXA 2J9ZB 1HQCA 4PX2A 4BEJA 4HWTA 3BIFA 1SNYA 5BW6B 1BVRA 4Y1RB 5KFAA 1VE3A 4DBLC 3WLHA 1IOVA 3MELA 2J0UA 1Z0DA 3WXBA 4LRQA 4QU9A 4PTZA 1I0LA 4RELA 1KZHA 1Q91A 1AA9A 5KNBD 1WPRA 3SBXA 5THXA 2DFPA 2P2NA 4RJKA 4PYNA 1FQWA 3JASB 3DVAB 3IHKA 2PM8A 1XA0A 4TYPA 3HVRA 1JDNA 1P2VA 4AF6A 1XTPA 2Q0ZX 1R8QA 4QSMA 4NLZA 1NVVR 3UJHA 2D74A 4J16C 4DR5B 2XCSB 5K8CA 1WQ1R 4XYLA 2HK7A 4R5MA 2HPZA 3MAJA 5BOVA 5HHIA 4Q9LA 1Z4MA 4EQZA 3COSA 1DQZA 2Y9PB 1BH6A 1GT6A 4ZOHC 4DNFA 1XEWY 2QRVB 2V5UA 4J0CA 2ZBQA 5TQ0B 3KEQA 3PD0A 1YJCA 3IP1A 3K0AA 3T52A 3KEOA 4QPZA 2QI9F 4J7UA 3GMDA 4JLVA 4X9XA 4LJKA 2KHZA 1XB2A 4G0WA 4GVLA 3HJEA 4KXVA 1P8JA 4TV8A 2G1KA 3JZAA 1Y63A 4UNIA 4PGMA 1LY1A 2OR3A 1SHKA 2I6QA 3NVVA 1EEXB 4M1QA 2DBYA 5LKRA 1QFXA 1G8AA 4HC4A 1NNLA 2MYUA 5CCXA 1I7NA 3H2IA 2DETA 3ZJ4A 2RRDA 4XVQA 4XASA 3HJAA 3PQ8A 1TJYA 4PQFA 2IF2A 1KWGA 2QZZA 4X20B 3NHLA 1UBNA 2PGNA 2ZREA 1U11A 2VFAA 2D2EA 2MYTA 3V00A 3JPNA 3WIEA 2FZEA 1OT3A 3R5HA 3HJGA 1AO0A 1VKNA 2GJ4A 4G09A 3ZWMA 1PL0A 2CLIB 3RH5A 1KI4A 2UZ3A 3ZJ5A 3LO5A 4M76B 2X23A 2VSNA 4UAZA 3P7MA 1L9XA 5ERYA 2AN4A 3TOCA 2ZIVA 5IM4F 1S0MA 3WDSA 3LF2A 4JVMA 3ZWWA 5EXPA 1RI3A 3MGAA 1QNLA 2QUHA 3QWBA 5JLJA 1R9NA 3D59A 2RGBA 2J8ZA 3EK2A 1GGNA 3B2EA 1MQAA 4PHPA 2YICA 4WNAB 4HZGA 1EAMA 1V71A 1G8HA 2GEBA 4GMGA 5LP1A 2WIAA 2AG6A 2NU6B 4NJEB 4QBTA 1BD4A 4ZMBA 2A67A 4KQKA 4BWFB 4KAFA 1KJ8A 2XOKD 4EZBA 3LC7O 3FDSA 2W70A 4MTLA 8ICNA 4IDFA 5DNDA 4XDHA 2A6PA 1RD4A 1OLOA 1LDEA 1GY8A 2CJWA 4KDCA 3SC3A 2UVVA 1L5HA 2JJ2D 2P8SA 3PQDA 1IPFA 4RYLA 2JEIA 5DDYA 2V3VA 4W82A 1T2VA 2DTDA 1RMYA 1Y3CE 1U7XA 5F12A 4PV7A 2GNPA 1ED1A 1K68A 4I27A 4ZMRA 5JMPA 5KYTA 2XMSA 1KMHB 4HWRA 1JHMA 1YZVA 4CEIB 2C4UA 3BAZA 4X60A 1GXSB 3PL5A 4B9NA 4DQIA 5CM9C 2HTEA 1OR8A 1ZNQO 4AJ9A 1G5HA 3ZV7A 3SYNA 2C3UA 3R0VA 4K9OA 2G28A 3FCSB 2EIHA 4TXHA 3CF0A 3OFND 3HM2A 5HR5A 2J3MA 4JHXA 2KFNA 5LUBA 1X14A 3VKGA 3COVA 2KP7A 5EXSA 1JRPA 1VL2A 1XK6A 4IYRA 3UXNA 2P9HA 5IT5A 1RJ9A 2IOFK 2IYVA 2P3SA 3VNQA 4KIJA 9ICAA 3HFRA 5DGIA 1WZCA 4XWKA 1LBSA 3CVYA 4JK1A 3IO5A 3IQGX 5GZ3A 1EVYA 4XWWA 5JDIA 2XVAA 4Q45A 1ISHA 1EDDA 3C6MA 3EOBI 4PH5A 4GOLD 2JK1A 3VR3A 1KU6A 1ZQVA 4F6RB 4RW0A 1A9ZA 1L4BA 5DGHA 3ZK8A 1E59A 3A2KA 3CLKA 1U5BA 1VRWA 2WV9A 2O8CA 1TW2A 1TO6A 2UZAA 1ST2A 2ID8A 2I2CA 7ICLA 4A91A 3A9CA 4ROTA 1G8KA 3KQWA 1L3VA 4PYKA 2Z9CA 1HYHA 3C87A 5FBWB 5CW2A 2OQVA 2O0JA 3NIDB 4UTZA 4AK9A 1BWRA 2Y9MB 3P0IA 1AQUA 1EQAA 3HRHA 5H9VA 4NAVA 2HA4A 4EO9A 4RTKA 1GDTA 1ZI9A 3AOEC 4HQ6A 5AHOA 4F84A 3GNSA 1HURA 3GCGA 1ZEJA 5C4GB 2JV3A 4JH0A 3QBTA 5C3UA 3GAMA 5HRUA 4I55B 1SXJB 1D4OA 1AKRA 1E2HA 3Q8WA 3GGPA 2DECA 3GCXA 5ESWA 1M66A 4LXIA 3WISA 1U3UA 2FWNA 5DQGA 4F9GA 4GPZA 3TNJA 3D9QX 4LQLA 1RI5A 1I3OA 4EUSA 4CIBA 2Y67A 3ROTA 1FCJA 3CUTA 3SNHA 3CSUA 3PPIA 1NQWA 1II0A 2CWDA 3JD0A 4XPIA 4EECA 4DVJA 1KAMA 3QXJA 4QQFA 4QO8A 5J5AA 2D6FC 4H16A 4LUCA 2Z3VA 1JG2A 4AIIA 2ZRKA 2G63A 4KMMA 1NIJA 4M04A 4CMCA 4RD1A 2LGJA 2E5WA 3MTGA 2XIQA 5IINA 3V48A 3VPBA 4EKDA 3RPEA 3NXSA 4ZXFA 2CXRA 3I6IA 4D9FA 4BVEA 4QWWA 2I4NA 2IU4A 3ITDA 2E89A 3RK1A 2NO0A 3T3PB 1CC1S 2X4DA 5AOVA 1QGYA 1JG7A 4S1WA 5DCLA 4FW8A 3GJ6A 2QNIA 5KJ6A 1Y3DE 4V0MA 3TN7A 4DLKA 5IHPA 1UBFA 1DOQA 2C2BA 1T3SA 1CULC 4C0QC 1GG5A 3T3OA 1QCZA 3NWBA 5KNCA 2HA0A 5FT9A 4R51A 1GFZA 3AFNA 2JXJA 1R4AA 1B2LA 2VP2A 4OYYA 1FUYB 3LKDA 5CH3A 1Z4OA 4LFAB 4OHXA 1X7GA 1LB2B 1L8LA 4BIIA 3QVLA 1JZSA 3H7AA 2LCFA 3F49S 5FHQA 3ICWA 4MCHA 1UM9A 1E1QD 4EPRA 4BZPA 2XZDA 4Q1CA 2NU9A 1Q0PA 3COZA 4MUMA 1YZ3A 5HJ2A 3H13A 2IS6A 1SQ6A 1KTIA 4XSHA 2EEZA 5BR4A 1JHZA 4G4JA 4DIOA 3EF1A 3UXPA 4F8EA 3KKLA 4CKCB 5LQDA 5C1IA 5J47A 1N0IA 4MVJA 1UF9A 2GT1A 3WG9A 4CR6A 3RBAA 1RT9A 1OHHA 1LB1B 4AG3A 4JAVC 5F78A 4CQJA 4WNCA 4JR0A 4ON9A 1U3FA 3V2IA 1R5NA 1WEKA 1AB5A 2QMOA 4YP5A 1E1DA 4D9NA 4HFMA 4FYPA 5KVQA 2Q6VA 1I80A 3QOYA 4LZJA 3N86A 4LW8A 1BW9B 4NH0A 5DTMA 1HE2A 3UC5A 5CBPA 5EL0A 6NULA 4BATA 4B09A 4HRYA 4WY2A 4YG2A 3PSAA 1KI9A 3CYFA 1TCUA 2F8KA 3AETA 5A5EA 1MH9A 1PFWA 2JCYA 2B1IA 3B1YA 4QWMA 5REQB 1H8HD 3UV3A 2AW5A 1IOLA 3CNQS 4FLEA 4A10A 1W59A 2R84A 1UBTS 3ODPA 3IKJA 1R8SA 4AJKA 3NEJA 1G291 5C7IO 2ORED 1PNOA 3NIBA 2B7CA 4BIMA 1LBTA 1LVGA 4WINA 5CT8A 1IZZA 2X4IA 2IXGA 1M0TA 4V39A 3ISDA 3F5FA 4JV5B 2BH2A 2DEUA 4HNUA 1RC1A 3R5SA 1Z6PA 2WJJA 5CVDA 5KYXA 1RZUA 4MWEA 4FMDB 3MCVA 5D3QA 1C81A 3KS9A 4XWAA 4W6ZA 4CKWA 3K53A 3B8HA 1DQSA 2NV0A 4FOLA 1COOA 1JWLA 1WRBA 2P2CA 3P9NA 2WHPA 3FTDA 3GMIA 4FOPA 5ICEA 3N97B 4NBWA 3TTYA 4A1FA 4HNRA 4W1SA 1K97A 4EPTA 3UPTA 1ECCA 2VK1A 3ICEA 1LJUA 4GZMA 1I4OA 2UYHA 2OXFA 4P8RA 2QRMA 3U4CA 4O5OA 3W6UA 2CD7A 1MW9X 5FUVA 2F2TA 2GWHA 2VYND 3BD8A 3DMYA 5AOCA 3VVMA 1ML3A 4IFTA 2KMLA 2HN9A 1EXWA 1VZ2A 5KKNB 5EZYA 3SQWA 4BMVA 4XIJA 1WXWA 1QKKA 2QKQA 2XRMA 4QQ8A 1RRCA 4XIFA 2BZ0A 1Y1SA 1RZRD 1NBWB 2ENUA 1N6KA 3A9SA 1JR3D 2A7QA 3UXOA 5D49A 1DQYA 2YZNA 4YAIA 2DPXA 1BEZA 2DWUA 4EFLA 1TTTA 1P0QA 2QNRA 2QE7D 4YNBA 3M4XA 1YQTA 1TK5A 4R98A 3ED5A 1GPMA 1OA0A 3EQ2A 3IV9A 1UQTA 3QENA 1S1MA 3KKZA 5CR9A 1TDJA 1LX6A 3NT4A 1T0UA 2Q8QA 1CQWA 1WUJS 3D8RA 3U4DA 2GD0A 4I5DA 3ZBPA 1QPBA 3NDJA 5CT5A 1ZI8A 2QL9A 1IVNA 1XTUA 4I36A 2FWJA 1C20A 1IMOA 4OGFA 1QZXA 5D1HA 1VCNA 5T67A 5E1OA 3WBKA 2HI0A 3WBFA 5DG9A 3A4LA 2H8KA 3HJCA 4NLGA 2I71A 4CIAA 4DKXA 4P1ZA 5A5FA 1AG9A 3Q9LA 5LP6B 4RV5A 1G63A 1IHYA 4JHLA 5DXAA 2C20A 3D6HA 1WP9A 4HDMA 4BBPA 4RQTA 2GLXA 3NV9A 4ZDIA 4FU0A 1XNSA 1XQVA 4W8HA 1DKNA 1Y3HA 2J41A 3DBLA 4LQDA 3H6KA 2NZYA 4D8TA 2YV2A 2V03A 1CTQA 2FE9A 2IJGX 3WSVA 1L4LA 3ZX5A 1YGPA 4RQ7A 1B26A 3E9DA 4J6EA 4DTCA 4G67A 4BO6A 3NPAA 5JSZA 3KZMA 2VG8A 1FTWA 2AX3A 3KVVA 3M7IA 4MEBA 2LDBA 3G2LA 1QIKA 2P5UA 1ZSVA 1DG9A 1EFKA 4HYEA 4EKIA 3G49A 1OLUB 4JCOA 2OCKA 3RANA 5IJ9B 5FBRB 1QRAA 1HETA 3EVTA 1XBTA 1P9OA 3BC1A 1TF2A 2POCA 3NHWA 3BDPA 2ZTCA 4YJGA 4HQKA 1KZ6A 1Q12A 3RTAA 1G5PA 3JTEA 3NRBA 3WNBA 1E64A 3B36A 1X15A 4FJ0A 2ARKA 4ND6A 3FCOA 3OTQA 1THGA 5F64A 3RIYA 4BGDA 3HN7A 2W9AA 3C5FA 2XMBA 2V74B 1Y7HA 2ZWIA 3MD9A 5JSFA 2I9PA 4C20A 4XWGA 2ZK7A 2E55A 9ICFA 3L4SO 5FNVA 5ADVA 1CF4A 2Z9BA 1EP1B 3EY4A 1FSPA 3TW4A 2QL7A 4YJ3A 3RSCA 1WDMA 2FEOA 2XCOA 4P3KA 3AVVA 3H4BA 1YR1A 1P1KA 1C3XA 3HRIA 4JP5A 3QVJA 2P67A 4MXDA 3VRHA 1E2BA 3UK7A 2FU5C 2G1UA 1O54A 5KNCH 3R0XA 3LFUA 1SPXA 3A0RB 4FFBB 2Y0EA 3WJ7A 4IJVA 3AEUB 2BKVA 4L4RA 3Q3JB 2TMYA 4UEQA 1R8XA 4ED2A 3CISA 2BRUC 1Q0ZA 4AKHA 1PR5A 2FMUA 4HRVA 4WBNB 1YIAA 2XUQA 1YQQA 1P5HA 2J1LA 4I4TB 4I9NA 4V0OA 4PYQA 2GEFA 3B0XA 4RESA 3USES 4C8KA 5BW8A 4P4LA 2IEIA 1V3QE 3QZ8A 3E5HA 3FRIA 2DWQA 1S2DA 2QARA 3I9MA 3H86A 4X7BA 1JECA 2PMFA 4U9UA 4R40A 1VB5A 5L9XA 3X1KA 2YXNA 3QW4B 2J6TA 3PDIB 4DXHA 5CT9A 2N9UA 3CO5A 3W9YA 3LVFO 2ADFA 5B1HA 4DA4A 5I7WA 3GV5B 4OHPA 1LX7A 1EEHA 2YC2C 1QIEA 2OPHA 2XAUA 3ACBA 5IABA 2JNWA 2Q1SA 4CLDA 2R86A 3NTUA 4MVJH 1C4WA 2W03A 3HC7A 4OV6B 2F8TA 4A36A 3U60B 1ZK3A 9ICTA 1DCKA 1PFYA 4L72A 1IBSA 4MGHA 4C6TA 3LC2O 4IXMA 2QGZA 3RJJA 1JDBB 4JEIA 4UPDA 4JLSA 4GYKA 1P2BA 2GA9A 3U3MA 3D3NA 4BO3A 3BQMB 1J1ZA 2B99A 1FYEA 3D31A 4HAIA 2B83A 2IV2X 5DW0A 3R40A 3VSDA 3U3JA 3QVTA 3AVYA 4OMFG 3E18A 5LCXA 1TL7C 2C2RA 2HB6A 3TTSA 4KOEC 2CL5A 5JHGB 4JB0A 3CEAA 3N7UA 3TIVA 3I9NA 4Q3BA 4Q01A 1PVOA 2E87A 1JEAA 4GRDA 2XCLA 2GCNA 3D6JA 3B38A 4YXWA 5D00A 5J1TB 4D25A 2I5HA 5IRCD 3F6RA 4KGXA 2HA7A 3JQ8A 1WR8A 1ZG3A 3I64A 3LUDA 4N41A 2GILA 3O4VA 3W1WA 4RPGA 1DGQA 4MQEA 3WBJA 2IA6A 1C30B 5KHOC 2HHCA 4PSUA 4RJLA 4QHTA 4R9NA 2IU3A 5BSEA 2JBWA 3V2UA 1WUHS 1ZJZA 1U5CA 2D2VA 2EKPA 2OZLB 1ZCBA 2ANBA 1FMFA 3UG6A 1E5VA 2W5UA 1U2DC 5J5VA 1YQ9A 4OH7A 2FCRA 3GWGA 4IO0A 3EMBA 5HWSA 1S9HA 3EPPA 1MX3A 2ZTSA 2VAXA 4FFRA 1X0XA 1AZWA 3ET4A 2O6HA 4C7ZA 1HF3A 1RJGA 2FEMA 3U61B 4MLCA 2Z5LA 9MHTA 4ZAGA 3ZLVA 3FKQA 4M21A 4CF4A 4FMBB 4YMWA 3DT6A 1GM5A 5DN6A 4FFNA 4BV8A 5ETJA 4HWKA 2WFAA 5KFJA 4OHZA 4M2YA 4YY3B 3WB2A 1NX6A 4KMUA 8MHTA 4RTOA 1QP8A 4LVSA 2VP5A 3DXFA 4JQYA 2ADOA 2JFPA 4BYGA 3FVWA 3MLEA 4YASA 3PXXA 4XSVA 2W00A 3K70D 5EWLB 1F2UA 4OJ5A 4ECVA 2VBIA 4CIVA 3UOWA 2TMDA 4PZLA 4B47A 1QLNA 5I9IA 3SXPA 2WUWE 3H5WA 5ELLA 1IRXA 1OASA 5B64A 7ICEA 3KJFA 3HJRA 3DMTC 3OHMA 5C8YB 4V2UA 2QLJA 2B0CA 3R6TA 3L8EA 1NA5A 1EZ4A 1ZJYA 5IJXA 1O58A 4OB6A 2XPCA 1II8B 3HUFA 4F72A 1ZD1A 4LXQA 4PICA 5FOWA 4DLZA 4XA8A 4R0VA 4ZRMA 3FVRA 1CUEA 1HT3A 2XVYA 2D3TA 1E1NA 1JZTA 3GLGB 1V41E 4C0AC 2QRKA 1QFMA 3GJRA 1JR3E 1N6LA 1XTVA 4UXHA 4NPAA 2FQXA 1YR9A 2HQOA 3Q7PA 1W88A 4ZO6A 3DVSX 4UU7A 3CR8A 3GT4A 3OQ6A 3A25A 2PANA 4KDRA 1YAJA 4RNNA 3E9CA 2RGNC 3BZWA 1DIBA 2Y1KA 3HZZA 2FW1A 8ICLA 4EGAA 4RCYA 2J5KA 1NVAA 5J2UF 3A4YA 3TLBA 4LYAA 4B2YA 4U7JA 2FVYA 5AOBA 4V0RA 4RJIA 4ZZ0A 2O05A 2A59A 4YPVA 3CB2A 4RHUA 4HSGA 4QZBA 3DEHA 4DC1A 2VXOA 4QDZA 2ZROA 1RWQA 4YT4A 1KHTA 1XVUA 2ZVPX 1LS1A 1SXDA 3D2NA 5E1DA 1H65A 2PUEA 3AHHA 5C5IA 1UDAA 3OQIB 5DM70 4F2RA 1OBVA 3RJFA 1XVAA 1PFGA 3ENQA 4CIYA 1TVKA 3SG0A 3F7OA 1U0HC 2W2KB 4WASA 4RADA 1I0ZA 4L08A 1U9LA 1AA6A 3DWFA 2P9FA 4R41A 4FZ5A 5C35A 2XXAB 3HLYA 4PL1A 3WGVA 2DR3A 1NJ5A 5TIIA 5K8VA 5FH9A 1KAQA 3PKZA 1BMQA 4FKZA 3FPHA 5KSPA 3NHYA 4GI5A 5DP1A 3JARB 2PE5A 1NM5A 2BGKA 4TSRA 4RU9A 1JXMA 4Z9YA 4ZQGA 4KXWA 4R8MA 3V1LA 2EF0A 3JQAD 7ICSA 4EBFA 2FZ5A 1GFSA 1R18A 1ZHHA 5JS8A 3KJXA 5M04A 4RH0A 1O1YA 5F21A 4PQEA 1W4ZA 3ASUA 2QLNA 5BVHA 2WAQC 5B3AA 5DLGA 4I9UA 4JSYA 5LZ4A 2IOHA 2WZQA 3EIXA 3ASVA 1T4BA 2LKDA 4UB1A 2EZZA 4LOLA 5IIMA 3MWEB 4LRWA 4CMIB 4QFCA 1WU7A 4Q43A 3IP3A 1TC2A 3O2QB 4NPHA 3TRJA 4C2AA 4FDLA 4Q03A 2J9FB 2OWEA 3M89A 5A2QA 4MQUA 4L51A 4NLKA 5FL7D 3FWKA 3QX8A 2CSUA 3EHEA 1NQXA 1VSTA 1GAWA 5JXGA 3UJPA 4ZOAA 1QO0A 3E05A 3DNMA 1EWRA 1P4JA 3IEIA 4HLCA 3D6UA 3TUZC 3N0XA 4MFAA 3W4KA 1QWSA 4RHCA 1NE2A 2A92A 1A76A 3QSGA 4RGVA 4FBTA 4YLYA 4EA6A 1E6CA 5LR6A 2LMRA 3R8XA 3G6KA 1DE0A 4CQMB 4XCVA 4O4LB 3N8HA 2IT1A 2IELA 1FPQA 1G2PA 1ZJ5A 4JLJA 1J21A 1MO5A 1QTQA 2K8BB 1SUEA 4GC9A 4WE3A 5IF3A 3MF4A 4NV3A 5CCEA 1C7JA 3RTGA 5HYVA 3BGVA 3QVWA 4KO8A 3C5HA 1E60A 1IATA 1PVRA 4NDAA 1RQ2A 1VLBA 3ZHXA 3HWWA 3CEHA 1I14A 3JR3A 1KFEB 1ZJ6A 3NGLA 2CVOA 4KX3A 4DPKA 4LF8B 821PA 2VOEA 2JA1A 1RHMA 5C32A 2JLYA 3VOTA 3VPHA 2YWEA 5KWEA 4IDPA 3K75D 1EVIA 4QLAA 5HQ3B 1R9JA 3HY6A 2QN1A 2HT6A 3I01M 3SC2B 3FZGA 1N0VC 2AD1A 1HSOA 4E0DA 1TADA 4MGYR 2FPGA 121PA 4FQ7A 2IYXA 2OV8A 3DZJA 4WJKB 3NAZA 2C5AA 4YC7A 5E0OA 3S3TA 3NBYC 3NFYA 2V9CA 3JWGA 1KQOA 5JCJD 2PMZF 3FHLA 4RA6A 3ADBA 1NUQA 1VJTA 1B0AA 5CU7A 4ZI3A 3E1GA 5A0LA 2FVXA 4E03A 2RHFA 1CX9B 3OZDA 2FPIA 3MWKA 3GJ4A 1FX0B 1G8SA 1CUZA 1YZFA 4MJXA 1FMLA 4K05A 4DDMA 1F2DA 4C6HA 3ETDA 4ZOQI 1KDZA 1YIDA 4C4TA 4JVLA 1K3FA 4HZUB 3ZNOA 1NW7A 4NU8X 4YA6A 4AY3A 5BN4A 1OPRA 4K9RA 2DPIA 4A1OA 1PJLA 2ON6A 3CMMA 4KKXB 1B4FA 2ODPA 3JVUA 3KKAA 1V43A 1QLJA 4PGYA 2ZI4A 3KQVA 5JADA 5CB4B 2OGUA 3W77A 1EAYA 2WB2A 3GEGA 1KOJA 2CYAA 4XB1A 4FFVA 4DSKA 2B5WA 2BF4A 3E81A 5FWXA 1XPOA 4GW3A 2JBAA 2JJ1A 4Z1MA 5G1OA 3JRWA 4YRMA 4WKCA 1DAIA 2NYUA 5J8YA 4BFYA 4IKPA 2J0UB 521PA 2J0VA 4IQWA 2RBKA 4EKNB 4BFCA 2BONA 1WF3A 2ZANA 4RF4A 3TIFA 1A9QA 4AKGA 1F6WA 5JNRA 2X77A 3L02A 3JRXA 2HW3A 1AMOA 4KLOA 4IKOA 2O5VA 1VBKA 4IVRA 3R3UA 4J3JA 1H3NA 1SEPA 1QE5A 4F38A 4YROA 4KACA 1JEEA 1FVHA 3HFGA 3ZHZA 1R12A 2VRCA 4LXGA 5KFWA 1OI7A 3TM4A 4TKMA 3T3MB 4WZAE 4WCFA 1DINA 4N9QA 5CDFE 1D1TA 2YZKA 4WEQA 1T0BA 4DL2A 1LZKA 4G4GA 5KCZA 4DV1B 5I45A 2VNAA 2BGMA 4YTEA 2QN3A 3U7JA 2DKFA 3KCNA 2OSVA 4TWZA 2XUKA 3K0AB 2QVXX 3HB9A 4HUTA 3RB4A 2QRUA 4BBJA 1FS4A 1S0VA 2FRVA 1WWVA 4TV8B 3BCUA 1K7XB 1WY5A 5ILQA 3PNBA 3C8ZA 2QX4A 1LTKA 4ND7A 1CRLA 4O5KA 5FI0B 2Q2WA 5F3WB 1XRPA 5EZ6B 1R16A 4BBZA 3PGVA 2G09A 4I9FA 3ZHTA 3SIXA 5BSKA 4ND2A 4BQSA 3SZ2A 3DOJA 3O5AA 2IUYA 3VJLA 3TKLA 1G59A 3AVWA 2PWZA 3NBZC 3WGYA 2XTNA 3UKJA 3ANLA 3ESDA 3B3AA 4JDPA 1P19A 3GJZA 3X1YA 4KQGA 3CRQA 3CONA 2BJVA 3PI6A 2I0FA 2Q5IA 4NABA 3RROA 2ZIVB 2BSAA 1XUOA 1UA1A 1EUDB 2Q5OA 2ZIWB 2QQFA 4WRRA 1DLJA 2C3YA 3DLAA 1TB4A 4FP9A 1CU1A 2I78A 3L8HA 4OX9Y 4IJUA 5AW1A 4GH5A 4JZKA 1KZ7B 3GW8A 4WUVA 2WKPA 3LDAA 1CDDA 4BDSA 4J90A 1EJBA 1UKCA 2YOFA 1NHGA 4C9BA 5IZ4A 4V3BA 1GTSA 1L7NA 1SXJC 1NOJA 4F97A 3LLMA 3DM5A 5HMMA 3EDRA 7REQA 4UDNA 4QM6A 4NECA 1ZESA 4ZGGA 3C16C 1L3IA 3A37A 3QVVA 5CLFA 1GTZA 4HH0A 3L1JA 4C4ZA 3U4MA 3DBRA 4M9JA 1DRGA 4NJ8A 4PLTA 3Q2OA 3DW1X 4QZAA 2H57A 2CJWB 1L5HB 3HP6A 1ISFA 1KQPA 5IKEA 3PHIA 1PEYA 1BCRA 4HBGA 3WMEA 1VFPA 1SUIA 5I5EA 2JR5A 2CMDA 2B6NA 2DHRA 2HQSA 2OILA 2VPWA 5K5EA 4EOGA 2WLSA 1XCJA 3UJNA 4L4XA 3K31A 3FBWA 2GBCA 4I3HA 4JC4A 1NN3A 4ALJA 1K7YA 2GI4A 1SIJA 2GK3A 4JEMA 4X7MA 4P58A 3KQQA 2JI9A 3HR4A 2E1PA 5CX4A 4F4IA 1OLXA 2XH8A 5D7NA 5AKEA 1VIYA 1S2MA 3EODA 4MPPA 4Q47A 3AV3A 5GJVC 2YWRA 2BI4A 5K2MA 4NAHA 2FMQA 4OJMX 4R0NA 1BSVA 2JIOA 5LIPA 1L4GA 3RT1A 2AI1A 5JY6A 4NMHA 4A6XA 2AB0A 3FCUB 2GF2A 2JCSA 4RVGA 2AZXA 5C80A 3GG2A 1U0BB 1RJ9B 2SCUA 1ZQEA 4W5TA 2YZ2A 1CNMA 4DYVA 2MSNA 2FSVA 1IEQA 2YWFA 4KL8S 3SSNA 5AXAA 3KKKA 3NTOA 4ZYWA 3N9IA 4AMYA 3WK5A 4LIPD 4CWAA 2EWVA 1XT6A 1OC4A 4Y2YA 4B6RA 2VUUA 2TMGA 5ICGA 4X8MA 3F5SA 4QVIA 1TTQB 4ARZA 1Y9EA 4HN2A 1Q0TA 1U5BB 4M9LA 3AJ9A 2O8CB 4CT4B 2VTKA 3O73A 2XV1A 5KFFA 3GOQA 3R5TA 1Z4JA 5BSFA 5BXQC 4ND4A 4X6YA 3FG9A 1FIQA 3P0EA 4JI3B 3VVCA 2FMTA 4IKEA 1JJVA 1C7QA 3R6GA 4IEIA 4F8JA 1OILA 2CBXA 3DZ8A 1Y4DE 4Z7QB 1P2GA 2PX8A 2CEAA 2IZ1A 4KFSA 1UZUA 1TEVA 3SN6A 5AKGA 5TC4A 4HWGA 3AP3A 5AUOB 1L4UA 4DR3B 3RVJA 3D5QA 1IEWA 4YV7A 1X2EA 3VU3A 4UAWA 2P27A 4MKZA 3E84A 1M0EA 2G5GX 4MVJP 3NJRA 1BDMA 4IH1A 3DFUA 2DFKB 1RLIA 3EDMA 3T7RA 4HGPA 1UBLS 1WNTA 3T5LA 1KEZA 4XPIB 1UKAA 4B79A 3FYHA 3K0FA 3L7BA 5KI6A 5E9AA 1ZMBA 4WT7A 3K32A 4DLGA 3C4QA 1PZHA 1V3TA 1QSSA 5CK4A 3NIGB 3ZWKA 1BA2A 2CK3A 3H65A 5JMOA 1CUWA 4F71A 1JKJA 3O8RA 3LRXA 1QHEA 1XV5A 1YC2A 5ECDA 2QMYA 3D7RA 5TXGA 2DGDA 3IQIX 3N3AC 1KTVA 1USGA 5TJ9A 3VGJA 1LLDA 4CV0A 1H5UA 4IGEA 2BCVA 3VR6A 1UQUA 2YY6A 3T9AA 4E14A 2HHJA 3L0SA 4HJRA 1KRWA 5CA0F 2CDAA 5AW5A 2WF5A 3ZI7A 1FQOA 1Z6XA 3TNLA 4L9WA 1QKIA 3UAYA 1LPSA 1GUAA 3LXMA 2NZWA 1HZZA 1PE0A 2XQIA 1PUXA 3A3YA 5DYTA 2ZAIA 3IP4B 2JKZA 1A98A 4XM1A 4JEHA 4B1FA 2PVCA 4FGSA 2PGJA 1P72A 2FZGA 4YT5A 1A6SA 2HBMA 1C5KA 4MRSA 4MI6A 1XKTA 1YU6A 1RR6A 4WJLA 3L79A 1Q20A 1N5LA 3IUPA 1UM9B 1UAAA 3H9EO 2E3JA 4UEKA 2NU9B 1Z1BA 1ZGJA 5DB7A 1ECGA 5JISA 2BEJA 4ZGBA 5CLQA 4G81A 4DILA 3FBTA 3V6JA 4UBKA 2BMWA 1QTIA 2BGUA 1YUBA 1XCOA 4BO7A 1E2PA 4ZOBA 1SAYA 4WN3A 3KZ1E 1L6NA 5ERXA 2PFQA 4YRGA 1DPFA 4Q6WA 4ZHQF 3T1HB 4KQMA 3P9XA 3BMCA 3RSSA 2DPJA 1B8PA 1T3TA 1VG1A 2GOYA 4D9CA 4W63A 4DJFC 4ARVA 3QPAA 3LX8A 4RUCA 3J81j 5HIMA 1RNLA 2GPSA 3EXG1 3WLRA 2WUFA 3D0RA 2NTJA 3SF0A 1CF9A 3OEED 3GDOA 3N1UA 4F2WA 4AYBF 2KW5A 3F3KA 1CJMA 1WBJB 4LKRA 3MWDA 4D6PA 2ZRDA 4E94A 1X1SA 4M9ZA 3LM8A 1YQGA 6GPBA 1UKYA 3BJMA 2ATIA 4FJ1A 2JD1A 4NF2A 4AMZA 2XZOA 3OAAD 4KQWA 1E5LA 5CBPB 4QW8A 4NNJA 4QFBA 1PHPA 1ECBA 3OM8A 1PCXA 2QROA 5FTLA 3FYSA 3AT1A 4E31A 1SBQA 5E9WA 3RTCA 4GI1A 4P5PA 4MVJM 3IDOA 4N8EA 5ALLA 1S5PA 2WB4A 1Z6TA 2YYAA 3PC7A 3OQOA 3QYJA 4X44A 2IU0A 1XMJA 3OPMA 1M1NA 1MENA 2YIDA 4RXMA 1RI4A 5IARA 2EFEB 3DHEA 3LFHA 1E9DA 1NKEA 4R2XA 4NOKA 4ZT2A 1FUEA 4U00A 4JOCA 3IAHA 5KYXB 4FGLA 1KZ1A 4CKWB 4B8YA 2IHYA 4HVCA 1FJXA 2P9YA 2IWRA 2Z6UA 2WHPB 3ELDA 4BMNA 1X9GA 1R0XA 3CT4A 2O3QA 3MT9A 3RYHB 2NWQA 5F1PA 7ICKA 5IIKA 5TEVA 1E79A 3PNCA 3W7AA 4C7MA 4UAGA 5DBGA 4LBYA 4OUDA 1DB3A 2JRLA 3WLMA 4HQOA 4AJHA 3L4BA 2IYLD 1U9CA 5ENVA 1OH5A 2WQ7A 4DSLA 4I99A 4NBLA 5EZYB 4PX5A 3TQHA 1YRHA 3C3MA 4H7JA 3M33A 2GFQA 4I2BA 2F9FA 1Y88A 3HDGA 2EJUA 1U1GA 1HLPA 5HZGA 3KTAA 3O8CA 4UM7A 5B36A 1VHJA 3RYFA 1XFDA 5FUQA 2FFQA 3CUEF 5G0VA 1J0BA 4PGFA 1K06A 4X65B 3SIPA 4FNAA 4DRYA 1ZLXA 1QH9A 2V6IA 1RQGA 3A2NA 1ENYA 3CLVA 3SHOA 3T0IA 4INJA 3PKJA 2IQIA 2ZKLA 2O2GA 3H2GA 3U31A 3DE1X 3NTQA 1B76A 4QG3A 4NCKA 3OUTA 2V5VA 1I5RA 3AYXB 2AKEA 1ZM9A 5A4MS 5KX5F 2J3DA 1FNBA 4EZIA 3V72A 1G9TA 3M5WA 1RLMA 1CB0A 2BFCB 5DISB 2GM5A 5AW0A 1YT3A 4LJ9A 4AYBC 4ECZA 3WX0A 1GPKA 1ISMA 3TEMA 2YHAA 3DTVA 3UXHA 4B3MB 3TADC 4BVGA 4MW2A 3T3GA 3TECE 4HDMB 2BDEA 3CBQA 2CMHA 3GJ7A 4AECA 2BZGA 4KIUA 3QY9A 2VS1A 2IBTA 1WQ3A 3DBLB 2D1QA 2GSDA 5H7XA 1KY2A 1OF1A 2HZBA 3ESYA 2B82A 4S1VA 4FN5A 4TS4A 3BK1A 1TJ5A 3GJ0A 1VPDA 3I4LA 1OQAA 3ZDFA 3TCKA 1ZETA 2IZ7A 2H5IA 1T6NA 3HCWA 4TQ9A 3Q10A 5JSZB 4R8LA 4LN1A 4RL4A 2V59A 2W2NA 5DNCA 4B6EA 3AKCA 3IJRA 3GRCA 1CZLA 4JV2A 1T8EA 1FY2A 3VUEA 1BS2A 2C9OA 3TZ6A 4B33A 4BMYA 2X13A 1FXWA 2VHUA 1YD7A 4Q3EA 4EI9A 3OP1A 2ZE5A 2X2EA 4S3MA 1IAQA 5LMZA 1CR6A 1L8QA 4YJGB 4BFXA 3WP1B 2ZFUA 1YS7A 3RJGA 3CURA 1SV0A 4GXNA 4BZWA 3K8QA 4R4JA 8ICMA 1GZHB 4DIMA 3KV3O 1R27A 3PPWA 2HXGA 4TTJA 5I7SA 5DM60 1ZUHA 4DWWA 5J3JA 4E7OA 1FDRA 5A62A 4HAUA 2J5BA 1R5JA 4BZZA 3ZXUB 2HZ7A 4B74A 3VTFA 3T95A 3VH3A 4MR7B 1NVTA 3DAFA 1MC1A 5DTJA 4MRVA 2PYDA 5FNVB 1O2DA 3EX7C 1MXFA 5BNTA 3VR6H 4H77A 4YJ3B 1KYIA 1W5EA 2PKXA 1NIPA 2ZJ3A 2QVYX 3AUUA 4MGIR 3B51X 2PUVA 1KO5A 2OXEA 3ZY2A 1LF5A 5IPFA 3S29A 2AW3A 2DG2A 1A2BA 2O2EA 5ARDA 3BQ7A 4WQMA 4UNSA 2IBKA 1NDQA 3H18A 1QE0A 3T3IA 5CYGA 4DNOA 2ERYA 2JLRA 5L3QA 4M98A 2NX2A 5JJIA 1Z74A 4YRBA 3IRUA 4OXRA 1MAAA 1QX3A 4UU8A 1NC3A 4QLOA 4PPQA 4YV2A 1K5HA 3CBGA 1LBQA 3MTDA 1CJVC 1WCWA 2I80A 3JPRA 3G9XA 3IE2A 4QNRA 4C7XA 1W6RA 4POAA 3IS3A 3DV2A 2QARB 2G07A 2EFGA 2EJWA 5H83A 2ZI6A 3Q72A 5HUHA 3L0YA 5EZQA 3HMQA 2C8JA 5TNXA 4DV3B 3N6VA 4WFQA 2QTVA 4WZBA 2C5FA 1TA9A 1J39A 2WINI 3EXHC 1T3ZA 2OYSA 3QTBA 4YAEA 2BTEA 1SWWA 5K4LA 4M0CA 2XI9A 1V5WA 5FULA 2JAQA 4UNPA 1YJ8A 5FV4A 3X43A 3ILXA 3Q2KA 4RVOA 4YRNA 1L5UA 4BLWA 1N7IA 1XMSA 3O8NA 4KXLA 4MV8A 4C6TB 5BW4A 2OT3B 4NJMA 4ARSA 3O92A 4HWSA 1KFC