4M6WB

Crystal structure of the c-terminal segment of fancm in complex with faap24
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
190
Chain Sequence
HIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia group M protein
total genus 48
structure length 190
sequence length 196
ec nomenclature
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m6wB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m6wB01
1NJYA 4PGYA 7ICGA 1TK5A 1SL1A 4UAYA 1T4GA 2DFLA 4O0IA 1S77D 3SV3A 4I28A 2P6UA 2FPMA 5KFFA 1ZQPA 3H8JA 3ZD9A 4ED1A 1Z00B 4DSLA 4I2CA 4PGXA 4KLOA 7ICFA 5HP4A 4K4IA 3HWTA 8ICSA 2V4RA 4C8LA 2XC9A 2KTQA 1BPDA 3MBYA 7ICIA 3PNCA 1H38A 1S0NA 1NK7A 8ICJA 4RPZA 4B9MA 7ICVA 1ZQGA 3RJGA 1EXNA 4O3PA 1S9FA 5KT2A 4YQWA 9ICGA 3OSPA 2ASLA 5KFHA 3HT3A 9ICRA 1BGXT 2XCPA 4J9SA 8ICFA 5J2IA 2XY5A 8ICHA 9ICHA 1Z00A 5J0OA 4YP3A 1SL0A 4RT3A 5KFVA 3H8WA 4RQ6A 4O5CA 3JPTA 4RZRA 4QZDA 2ISPA 3H4DA 4NM2A 4IQUA 4UAZA 4DL2A 2AGPA 1NKCA 4ECQA 5KFPA 5KFRA 2BPFA 5KFZA 2UVUA 1K1SA 7ICTA 4BWJA 4DS5A 5CA7A 4P4PA 4YR2A 4UB5A 4KLJA 4MEYA 4UB1A 1HJPA 4Z6FA 2J6SA 4KLFA 2KZMA 3UXOA 4ED6A 8ICBA 4KN4A 3T5KA 4DL5A 4QWAA 5KFKA 4DSEA 2C2RA 1JX4A 2J6UA 3GV8B 4ED7A 1RXVA 1U45A 5DQGA 5L9XA 4UQGA 3TARA 4MF2A 1JXEA 5HNKA 4YR3A 5L1IA 2XY6A 5JUMA 4F3OA 3RH5A 4P4MA 3AU2A 4ECYA 2ASJA 2ATLA 2XGPA 3BQ0A 2A1JB 5DLGA 4ED8A 1BPZA 2BCSA 4ED2A 5KFYA 4YFKA 2JZBB 4B9NA 1ZQHA 9ICFA 8ICMA 4Z6EA 4DF8A 9ICQA 3EPIA 4YR0A 1NOMA 1J23A 4DQRA 3PW0A 5KFXA 5HHIA 5DLFA 3QZ7A 5HMLA 5KFOA 5DBBA 5J2GA 4QWDA 2W9BB 3Q8MA 1L3UA 9ICVA 3H7IA 3T5JA 4KLSA 4RUCA 4TQRA 3ZDEA 4J9PA 2PXIA 1U47A 7ICMA 4B9VA 9ICJA 9ICKA 1TKDA 1ZQYA 5DQHA 5KFDA 3PO5A 4RT2A 4RQ5A 2VA3A 4QZBA 3C2KA 3Q8LA 2R8GA 8ICZA 5DG7A 2HHVA 9ICPA 7ICSA 3EWAA 4I2BA 2BGWA 4R8UA 4M9GA 3V7JA 4ECVA 3TFSA 1S0VA 8ICTA 1XC9A 1UT8A 2I1QA 1NK4A 5J2JA 1LV5A 3LK9A 1JMSA 4RQ2A 3C1YA 3LWMA 7ICKA 8ICCA 1KEJA 1TK8A 4Q43A 1L3VA 1JXLA 2JPDA 9ICBA 4DQQA 5IIJA 2ZUDA 2AQ0A 2ZTDA 5KFWA 1ZQAA 1CUKA 3BQ2A 5KG1A 5HHHA 1UA1A 1ZQFA 4J9NA 4KMUA 2F1HA 3V72A 3MGHA 4RU9A 4R64A 4DL7A 2JEJA 4M2YA 1XSPA 5D49A 7ICOA 4I2GA 3PW2A 1SL2A 4NM1A 4O3NA 2HVHA 3RJIA 1QSYA 4IRDA 3OJSA 4R8UB 5DGAA 2B21A 4DOAA 8ICXA 4O5KA 3KTQA 5KFCA 2JZBA 3EYZA 2IHMA 3ZDDA 5J2AA 3ORYA 2ALZA 2BCVA 2W9CB 4UBBA 1ZQRA 4KLLA 4EBCA 2JNWA 1MSWD 4DL3A 5KT7A 1NK0A 4IRKA 2C28A 3T5LA 4ELVA 4XA5A 4BXOB 4ECRA 5BPCA 2JEGA 4BGDA 5EWEA 7ICEA 2BCUA 3RJEA 3M9MB 4I2HA 5KFUA 8ICKA 2XGQA 3PW7A 4P4OA 5DBAA 3EZ5A 1A77A 7ICQA 5HMMA 2FLLA 1DOQA 4UBCA 3M8RA 1V9PA 4IR9A 5C5JA 3C23A 4EBDA 3RR7A 4P0PB 4I2JA 1MC8A 4RQ0A 1NJWA 2JEIA 8ICVA 2IA6A 4RPXA 2PFPA 4DSIA 1KFDA 1ZETA 3RJJA 1QTMA 4RPYA 5D4BA 4DQSA 2R8JA 4B9UA 1TVAA 2A1IA 9ICIA 3OHBA 5EWGA 4GXIA 4KLGA 1D8LA 3AU6A 3ISDA 3PX6A 4QZGA 1MQ2A 1BPXA 3PX4A 1ZQIA 3PO4A 1PZNA 3IHQB 3GV7B 1RXWA 4Q8FA 1TK0A 4YVZA 4M04A 9ICEA 3RB0A 9ICMA 3ISBA 4IR1A 1B43A 1KDHA 1SKSA 2ZJ5A 4LZGA 4QWCA 4YG2A 3B0XA 2FLPA 4C8OA 1NJZA 3G6XA 2PFQA 2ZTCA 3HX0A 3Q8KA 4XRHA 4DL6A 8ICAA 5BOMA 4NLKA 1ZQVA 2ZIUB 3G6VA 2RDIA 4BWMA 3RBEA 4RQ7A 2HHTA 1D9DA 1XSNA 1ZQBA 2M9MA 5BOLA 3MR3A 3QEAZ 1ZQMA 4M6WB 3N4MB 1NKEA 4NLZA 5D46A 2FPKA 3UQ0A 4F93B 3PW4A 1JN3A 4ELUA 5J0TA 3RH6A 1NK9A 2AGQA 4M9HA 1HUOA 4RNOA 2RDJA 5J0UA 4DWIA 3SYZA 1K1QA 2NRXA 4KLMA 3MR6A 2H5XA 5J29A 2BQ3A 1ZQZA 2PI5A 3C5FA 3Q8QB 3BJYA 2W9BA 4DSJA 1ZQXA 3HW8A 4J9RA 2AJQA 4JK1A 1TAUA 3C1ZA 3GILA 4DQIA 1AROP 4DSKA 4KLQA 3PMNA 3RRHA 3RB3A 1HUZA 5CJ7A 2LYHA 5KFQA 4F8RA 4DLGA 4J9OA 1ZQNA 4ED3A 3T5HA 1D8YA 1KFTA 5KG6A 4JV2A 5KFIA 3FYHA 4C8NA 3ETLA 4QW8A 2PFNA 4IQVA 2WTFA 5CHGA 1BPEA 2R8KA 3TFRA 3GQCA 2NRTA 3LDAA 1S76D 1S97A 3IM1A 3ZDBA 1QLNA 4TUPA 3M9NB 4DSFA 3UXPA 4EYHB 3SZ2A 2VA2A 3JPPA 3TAPA 2BQRA 4NY8A 2IMWP 5CP2A 4F5QA 3V6JA 1U48A 1ZQEA 1NK6A 3BDPA 7ICPA 9ICXA 5J0WA 4UB4A 3V6HA 4C8KA 4DL4A 2BDPA 4YMMA 3EPGA 2W8LA 1ZQDA 4QZAA 4M0AA 9ICSA 4F5OA 4IQWA 4F2RA 8ICWA 1TFRA 5DDMA 4ECUA 3E2EA 5DB9A 1T8EA 4PHDA 5CR0A 3QZ8A 3ZDAA 3RAXA 4K4GA 4RNNA 2MUTB 2XO7A 5DGBA 1CEZA 4ELTA 4QZCA 3PX0A 4I29A 1U4BA 1X9WA 3C5GA 3JPRA 2W9AA 4FBUA 9ICAA 3GIIA 5EOZA 8ICGA 1IM4A 1N48A 1Y88A 3GDXA 5IIIA 1XWLA 4O9MA 5J0RA 3K75D 4GXJA 4HYKA 4KLUA 4P0QB 4NXZA 5DBCA 3FDSA 2BQUA 1IXRA 3Q8SB 4F4ZA 1T7PA 4YXJA 4RQ3A 1KRPA 4FBTA 5KFSA 4Z6CA 1J22A 3B0YA 4DFJA 2PI4A 5J2KA 2C22A 2ZTEA 4YD1A 2KN7A 4F92B 4XQ8A 1L5UA 1ZQTA 4QZ9A 4JUZA 2BR0A 3RRGA 5KG0A 2F1JA 3NGDA 4GC7A 9ICUA 9ICLA 1ZQLA 3UPQA 1N56A 1NK8A 5DB6A 1C7YA 2FMQA 3RBDA 2UVRA 4C8MA 4UB2A 5J0PA 1U49A 4MFFA 4QZFA 3RAQA 4TUQA 2KFNA 5L1KA 1WCLA 4IRCA 4ECWA 1ZQUA 4F2SA 3ISCA 2HHUA 3C2MA 5DG8A 2ASDA 2MAXA 1KLNA 4ECSA 1TAQA 4F5RA 2HHXA 3RH4A 4EBEA 4TQSA 1SKWA 1XO1A 3AUOA 3TANA 4M9NA 4K4HA 7ICNA 3MFIA 4DLEA 4YMOA 4ZH4A 1SZPA 5J2BA 1ZJMA 5KFLA 2KZZA 4B9LA 3PW5A 4XUSA 3RJFA 4LVSA 2ZIXA 4KLIA 4BXOA 5DB7A 4I2IA 3SV4A 1SKRA 2V9WA 8ICIA 4B9TA 1KTQA 1ZJNA 1KSPA 4DFPA 3RR8A 4O5EA 4O3OA 2KFZA 1NKBA 3BQTA 2DPJA 4EZ6A 3RJHA 5KT5A 2I9GA 3KHGA 4F4YA 5F9LA 1D9FA 2V4QA 3N97B 3GIJA 4I2EA 3KHRA 3C2LA 2R8IA 4F4XA 1RZTA 8ICEA 3HPOA 3T3FA 1QSLA 5J0YA 5KT6A 2NRZA 4DS4A 1ZQQA 3TI0A 2BPCA 4ECXA 2NRWA 1ZQOA 4LZDA 2P66A 2HW3A 2R8HA 4DO9A 2OWOA 8ICNA 3MFHA 2VA8A 2ZIWB 4EZ9A 3LWLA 2FLNA 4M47A 1X9MA 1BPYA 2ISOA 2F1IA 3TQ1A 8ICQA 5KG7A 2FMPA 4DOBA 1COOA 4UAWA 4RNMA 4EEYA 5DB8A 3UXNA 1ZQKA 3ZD8A 3MGIA 4PH5A 4I2FA 5KFNA 2W8KA 4KN7A 4ECZA 5IINA 5J2CA 9ICWA 5IIKA 3BQ1A 2HHSA 4RQ4A 2KZ3A 5KFTA 3QEBZ 5IIMA 5J0QA 9ICOA 2UVVA 1X2IA 4RUAA 4QZIA 4PGQA 4GC6A 3PVXA 2ZJAA 2C2EA 4MF8A 8ICYA 3C21A 4I27A 4KLEA 1WCNA 5J2EA 1RPLA 2GWSA 3K4GA 4F4KA 9ICTA 1JIHA 3Q8PB 4Q8EA 4DOCA 2UVWA 4YCXA 3QE9Y 3GIMA 4KITB 2M9NA 5KFJA 5DDYA 3GV5B 1NK5A 1KFSA 5L1JA 4DFMA 4J9MA 3G6YA 2ZUBA 5F9NA 8ICRA 3V7KA 4RQ1A 2HHWA 2DPIA 4YD2A 3OSNA 4QWEA 5KFBA 1TV9A 1BPBA 2P6RA 4I2AA 3RJKA 4F5PA 4E0DA 5KTQA 4GXKA 8ICOA 4YN4A 3MR2A 4TURA 5L1LA 4MEXA 4KLHA 5KFGA 1B22A 2AU0A 4RQ8A 4DEZA 2XY7A 4G3IA 4DFKA 4R63A 1J24A 4PHAA 3JPOA 2MUTA 1QSSA 4QWBA 4Z6DA 4PHPA 4Q44A 4F5NA 1RYRA 3GIKA 2Y1IA 5KFMA 4O3QA 1NJXA 4QW9A 5EWFA 3MDAA 5J0SA 1XU4A 1S0MA 5KT3A 3UQ2A 1ZQCA 4M6WA 5KG4A 7ICUA 3Q8RB 4J9QA 4ED0A 3EW9A 3M8SA 3SI8A 9ICCA 5J2DA 3H4BA 4O3RA 4M9JA 1L3SA 5IIOA 4TUSA 5KT4A 2HVIA 5IILA 7ICRA 4MFCA 4KLTA 4J9KA 3JPNA 2NRVA 2IHNA 4EYIB 3H8SA 1L3TA 1BVSA 3RB4A 3PY8A 5DQIA 3RB6A 4PPXA 3JPSA 2FMSA 4DQPA 4P2HA 1U9LA 4FS2A 5J0XA 3THVA 2PFOA 3KHLA 1MQ3A 4NLGA 2ZUCA 4F91B 2JEFA 2VANA 1DGSA 4QZHA 1XSLA 4O3SA 4BDPA 2C2DA 2Q0ZX 3JPQA 3PR5B 2BPGA 2ZJ8A 1A76A 4J9LA 4UB3A 2AGOA 1XS9D 1ZQSA 7ICLA 1UA0A 5DKWA 2BHNA 5KG3A 4F4WA 5J2FA 3NTUA 4FS1A 3MABA 1RYSA 3MDCA 1ZQWA 3OGUA 2Y1JA 5DG9A 4IQTA 4PHEA 5KFAA 5TZVA 4X5VA 5KFEA 1UT5A 2HHQA 3HP6A 3TAQA 2BCRA 4R66A 3V7LA 3V6KA 2W9CA 3H40A 5CWRA 1X9SA 1Z3EB 2FPLA 3KHHA 4F50A 5KG2A 4FO6A 4Q45A 4ECTA 1S0OA 1T3NA 4QZEA 4JWMA 4KTQA 8ICPA 4JV0A 4B9SA 4JV1A 4R65A 3OJUA 2W9MA 4I2DA 2XCAA 8ICUA 4DF4A 3MR5A 9ICNA 3RTVA 5J2HA 1LB2B 4YXMA 3PMLA 2IBKA 5CB1A 4M9LA 2A1JA 1J25A 4KLDA 7ICHA 2BKEA 3PR4A 3GFKB 4QZ8A 2J6TA 1ZQJA 4YMNA 8ICLA 3M9OB 7ICJA 3PV8A 4CCHA 3ZDCA 4NLNA 2BCQA 1S10A 2AQ4A 3OHAA 4JWNA 2ZIVB 4MFAA 5KG5A 1ZYQA 4GLXA
chains in the Genus database with same CATH superfamily
3Q2OA 1QONA 3B5EA 4M89A 3X2EA 3N0VA 5CG2A 2XB2A 3O9MA 5ILQA 3GFBA 3GG9A 2LP4Y 4XARA 3VKVA 1GXSB 3BD7A 2JLCA 1RVV1 5KWVA 1RAIA 1V4VA 3TSAA 4TQGA 2KB0A 3BN3A 1BPDA 2AE1A 5E2AA 2HJSA 1CP2A 1SXDA 4PHTA 5PGMA 4BQNA 1GGHA 2CL6X 1G98A 4AO6A 5ALLA 1PR5A 2FUKA 3RUCA 4AF8A 1T5IA 2O2CA 1M34B 2VSNA 3MT7A 3H1BA 4I1OA 4TPKA 5AJWA 3AF3A 3FR8A 2YN4A 5EUBA 2HBQA 4XFJA 1LV8A 2VDPB 4X84A 1Y0BA 4H7PA 3CR3C 4CIVA 2ZT8A 2XT0A 2QAGA 3MUOA 5CYFA 3LAWA 3CWCA 1S4QA 5KFVA 4ARZB 4EIWA 1A8IA 5AVQA 4G24A 2PGAA 1FFWA 2W6QA 2Z4TA 2C59A 1QYCA 3WHIA 3GXBA 1RTTA 1CUHA 4MUAA 3P0FA 4FJ0A 2OQ2A 3GDGA 1MDBA 3UCFA 1XXLA 1IEWA 2R8RA 2H3IA 1K2VN 3MT0A 2CCKA 3R20A 4XEHA 3WLOA 4XUCA 5B3KA 3E9YA 5CCDA 1SCQA 5EMKA 1DTSA 1QC5A 1RQGA 3QEOA 4KLFA 3PT5A 5F3RA 2H7XA 1LLCA 4YRFA 2ZBUA 4JI1B 1N5IA 4UHEA 4C06A 1E6WA 4CG2A 4P54A 2DM6A 1N5RA 5DNVA 5ENZA 1U1FA 3D6JA 1XJ0A 3TBHA 4CTNA 1H0RA 2ZDHA 3LQKA 4JAVC 3SYTA 3ZYCA 3SG0A 2FLKA 1WQ3A 2FKNA 1O0CA 5E3HA 1MH1A 4X62B 5P8WA 1FDUA 4I8IA 1JFRA 2EWMA 2GZHA 2IDKA 4IDBA 4WXYB 1U7XA 2X8AA 1DIOB 3EUB2 4Q00A 3KUCA 1CDZA 4N0QA 3O75A 1GQOA 1J7KA 2Q0QA 2Q5FA 1BN6A 4OV6B 4A27A 5C8DA 2WF6A 4D3YA 3OCYA 2H51A 3VH2A 4O3MA 4U5XA 5J5AA 3C3BA 3OQBA 2Y0EA 4DQRA 3O83A 5TC4A 3QUSA 3QVGA 2PT7A 3GUYA 9ICVA 3MTAA 1L7NA 1R5JA 3EGEA 3U61B 3EIHA 2C1ZA 5FL7A 4KLSA 1U3DA 1A5AB 1C7RA 4MP3A 2PXIA 4X20A 4KN6A 3PXDA 3EEYA 3RS5A 1TYZA 3LFHA 1I7NA 1KR5A 4GR4A 4DDWA 4Q02A 3AQFA 1W49A 4O1IA 1ZLXA 4O02B 2Q2NA 2HJGA 3Q85A 8ICZA 4HDKB 4NEHB 2HHVA 3TW8B 1D5WA 3THWA 3AVUA 3VU8A 1C20A 1SXQA 3KJNA 1I5OA 5EVCA 3P9KA 5GMOA 1DG3A 5FPQA 5B1SA 5BQOA 5BWCA 1FBTA 4FE7A 2LZ0A 1N34B 2QVGA 3F71A 1NA5A 5EC8A 4DQQA 4REMA 3SICE 1FSGA 1GGJA 2ZIAA 2R3SA 4WK0B 1QANA 3W3ZB 4DCPA 4GSLA 1VRCA 3N7UA 1ZOSA 2ZSJA 4ZEMA 5IULC 1NW5A 2ANCA 4G5SA 3RTEA 3SHFA 4FKZA 4G2NA 4R8KA 2QMQA 1NVWQ 2W6JD 1MA7A 5DYGA 3VHQA 1SIUA 4E6EA 5FH9A 1PT8A 5IXJA 4WK2B 3R0QA 4GOXA 5COQA 4DHWA 1PSDA 1JFSA 2GM5A 3JSAA 4I2GA 3T3OA 2Q2QA 1B0UA 3KJQA 2ZBEA 4AWXA 5K8LA 4RS3A 1MTOA 1NLUA 1JKIA 3L7KA 4G26A 3HM9A 1WZ2A 3NPAA 1WXQA 1U04A 3SHOA 5CU7A 1X7ZB 2RBEA 2W6IA 4GLBA 2ALZA 2X6TA 4EHBA 3B1WA 3OP4A 3FPBA 1JALA 5EERA 1IK6A 1QKIA 3GD7A 2B8EA 4EBCA 1DBIA 3RDPA 3UG6A 1XELA 2GPBA 2JFHA 3J7TA 3DDWA 4RKWA 2D2XA 3EPJA 3NFYA 3ON5A 3D8SA 4M98A 2QRKA 1F51E 1RWMA 1VLZA 2AFIA 2PCJA 2ZBRA 3ROKA 3IVAA 4LBYA 4BGDA 5EWEA 7ICEA 1MUUA 2JLVA 1KZ1A 1RP7A 3H1EA 3HL4A 4AUMA 2PEZA 2WT9A 1II0A 4BBAA 5HKKA 1PZEA 2R6ZA 4LYFA 4WJLA 1UFRA 1NMQA 1WIWA 5ALFA 2JAHA 3CO5A 4KQ6A 4U3JB 4ZOBA 5DI3B 2R8XA 1EGMB 5FO0A 4B1FA 3QQ5A 4KGXA 1KETA 1QIIA 4LRWA 1GCIA 4XCQA 4ZT7A 3MN1A 3FIUA 3PL1A 4HPWA 1E32A 1ZA2A 1WO8A 1OZHA 1U2EA 3K53A 4Q9JA 4R83A 2R66A 4Z4FA 4GF5A 2JFOA 1ULTA 5I9BA 2P9HA 3K96A 3U26A 1QIEA 1FXSA 4MA4A 5AJHA 4F06A 5B6JA 4QYMA 1YF3A 2FP3A 3WIEA 1SZJG 1VRWA 4NY1A 1WKBA 1TM4E 1KPHA 3TVYA 5AHOA 4EVIA 5LP6F 1KYXA 2ZYAA 2YOHA 3AU6A 2QRMA 2FPPB 3PX4A 1O08A 4GQAA 1ORWA 3DVRX 4MJLA 1QKJA 2C4MA 4DLZA 1F0MA 3GZNA 2RG1A 1H1LB 4BX0A 1WE2A 4IHKA 1PDWA 3LT0A 1M2NA 4M04A 2HY7A 2II6A 3RTCA 4XCVA 2P9ZA 2XVAA 2X8JA 3PQ4A 3LP8A 4K9DA 4W1RA 5IBCA 1KDHA 4KPEC 2NZWA 1VLJA 3MWFA 4X9XA 5TPWA 1PJ2A 3STVA 1Q0TA 3AEXA 1QRRA 1Y9JA 1CP3A 1XMXA 3QVTA 1SO8A 3QY9A 4LMRA 3S0JA 4YJ2F 4Y9TA 3WNCA 2Q4TA 2E82A 3NWBA 4MKZA 2CXQA 1MGPA 1NVVR 3FHJA 2PUJA 3O0TA 1O5OA 1DTWA 1MLDA 4PLPA 1A98A 3HSYA 3DV9A 2C8LA 1XSNA 2RAFA 2WEKA 3TLXA 4ZYVA 1N9GA 3VQTA 1JJFA 1GCGA 1Y34E 1K8RA 4FWIB 5NULA 2X7XA 2F9MA 3PZPA 3FNEA 3PS9A 4KAJA 4P84A 4IJQA 2PZAA 1JN3A 2Z2IA 5KCMA 3K9BA 2EANA 1C7QA 1O8BA 2BHLA 1WCWA 3IP8A 2HO4A 2TMGA 3VU3A 2FN3A 3TKLA 5DJ5A 3HSSA 1CV2A 3W3AA 2Q5OA 4AKGA 3IJEB 5F3XB 2KHVA 1DRUA 3E9NA 3GB9A 4LOAA 3T9CA 4KLMA 1TTQB 3D7SA 3JZIA 4ZCQA 3SHTA 2ZVQX 3PX7A 1KI8A 4Z9AA 1MJHA 4LBZA 1ZD8A 5AVXA 1EQUA 2WTEA 3VO1A 3WGJA 2PS1A 3CW8X 2DMRA 4CCSA 3TAUA 4DT1A 4LYEA 4QZVA 2MTBA 4B4WA 5LD2B 5JWRA 5CW1A 1HUZA 2EP7A 2IEBA 5IT0A 1HNZB 5I7SA 2F77X 4DLGA 1DIBA 2RHRA 1KFTA 4K8OA 2BC9A 1J9ZA 2RCNA 3K31A 2HF8A 2FWMX 3JX9A 1QH8B 3KDSE 5IPFA 1YCHA 3A2KA 1EZ1A 2GLEA 2F43A 3IPYA 4Z7JA 2IPNA 1LDGA 4D8UA 4UU7A 4Z5XA 2OGUA 3CVYA 3OCWA 4MRVA 1ECWA 5AOAA 1XLUA 4L1KA 4TWJA 2NU8B 2DKZA 4N0PA 5JAZA 1S89A 3OEED 3OPXA 1A7AA 3JZAA 2Q4DA 3JQBC 2OBXA 3PNPA 1NVEA 5JU6A 5CP2A 1ZWLA 2GPWA 3FSJX 4IYRA 5DLDA 4HNVA 2QKQA 1IN8A 2WUDA 5LUBA 1RDFA 1CUDA 3LLSA 4DV4B 2OL4A 4ALNA 3EOZA 3UWPA 4YMMA 2YJNA 3ZZ1A 1ZR2A 1H0KA 4QZAA 1W87A 4FD3A 4FKMA 1VI2A 3VPXA 2R751 2FUNB 3UK7A 3WZMA 1ZKDA 3SR6A 1QF9A 3D8TA 2KS6A 1CQPA 3C4JA 3C4VA 3T7SA 1ZYUA 2Q6KA 2J41A 4M0UA 1MW8X 4NV3A 2ZREA 3DAYA 4FQ7A 3SZ3A 4IJMA 3W34A 4Q3LA 2I6UA 1SHZA 1VG9B 4H59A 4BO9A 2IOFA 1YJ8A 2I67A 2K8CB 3F1LA 2IDMA 1JI3A 2WFZA 2X5XA 3GDXA 2Z3VA 3I9NA 3LY7A 1WUJS 2AUNA 4TZ6A 2ZYTX 3KLMX 4GX5A 4XM0A 4QGHA 1N6IA 1ODJA 2AFIB 2UZ1B 3UJCA 4S3MA 2GNAA 2MSCB 1E0SA 1Q0ZA 2V6JA 4EGSA 2PZEA 3ILHA 3EGOA 4M0FA 4Z6CA 4EEKA 1J22A 4K9LA 1W1UA 4U63A 1USGA 3VR2D 1E66A 3GZNB 1K6JA 3JTMA 4N3CA 1PGNA 5A0FA 1KQPA 3LLMA 1LA2A 3RBAA 1K8YB 5CLIA 3WADA 4QOSA 3SDSA 3EPLA 5SYNA 4NL9A 1Z2OX 5FLEX 2YHIA 4I19A 3WGUA 1CJTC 1USWA 1NK8A 4PPGA 3DE2X 4PRYA 4V0KA 5FOUA 4XWYA 3JRNA 3W06A 3G88A 4ENTA 4MEJA 3CX8A 3ONFA 3U1TA 2VHEA 1IHPA 1D2EA 2N1BA 4FBMA 1EXVA 3L7NA 1KYVA 3NIBA 1L5NA 4G0XA 1WVIA 4WKBA 9GPBA 1ZGGA 3HU5A 1MX9A 3ER6A 2NX2A 2YS6A 4RW0A 1YFKA 3LL7A 5FL7D 1RAEA 3TKAA 2VPIA 5GJCA 1GDHA 2XMPA 3SJAA 4B71A 3UM9A 5BMVB 1GFIA 2QB0A 4WXEA 2GUWA 4PSAA 1YUMA 1HQCA 4N65A 3RC1A 1UZUA 4D3DA 4GQBA 3BHMA 5KQLA 5JR3A 3UA3A 2FV8A 4Q1VA 2ZZNA 1OWMA 1NQOA 4FNMA 1RI4A 1PKEA 1JA0A 4KWIA 4A0RA 2GUGA 1DPFA 1W93A 2CLMB 3AO0B 1UFKA 4XUDA 3TE6A 4EMUA 1LPAB 4BECA 5C52B 4C2TA 1PZMA 2ZJOA 2HA2A 3GU3A 1DXSA 3ANYB 4E5MA 5LXTF 1IBCA 4M1TA 3AHEA 5AM4A 4LPSA 1YOVB 4F4YA 1M73E 2P5TB 1P7YA 1Y3AA 2V7EA 2YHAA 2EP8A 5EFZA 4QDTA 4EG6A 3S40A 5A5EA 4GC9A 1Z47A 2J1LA 4PYLA 3HYTA 1I2BA 5KT6A 3JU3A 1UKVY 3P5SA 1P77A 1ZK1A 3B36A 5ETJA 1UODA 2FOLA 1R74A 2BUCA 3D0KA 2F62A 4ZAFA 2PMEA 1QFJA 1FY2A 1CR4A 1UOPA 3NHFA 4RENA 1KFEB 2R5WA 1G8KA 4ZOHC 3C1OA 4M7WA 1X9MA 2N3ZA 5C1PA 2FGKA 4FILA 3GOHA 1I4EB 2JFFA 4EEYA 2QORA 3V4SA 2EDUA 1J8DA 3G7NA 4NZ9A 2HQBA 1VL0A 4LDQA 4KXFB 1RPAA 3IESA 3EVGA 3RRZA 3ZQKA 1KHHA 2R84A 4RK1A 5J2CA 1BS1A 4XH9B 4CLOA 3GXOA 2OGZA 3N2KA 5J0QA 4MS4A 1BHO1 5BQ5A 1T4BA 1V96A 3V5NA 5E1BA 1E4YA 3NXKA 2Z6UA 4PY2A 2UUOA 3EWIA 2DKNA 4OQPA 4MGYR 4RX1A 3O4VA 4N5IX 4KLEA 1BDJA 2XEDA 3MGVA 1W52X 3TW4A 2Q3LA 3LCUA 2YJTD 3OX2A 4TS4A 3EX7C 2G5IB 2YXEA 2BLNA 2C9MA 4CKXA 1U3VA 2JK1A 3M6ZA 1ZMBA 1LZKA 1W36B 1UK6A 4KXUA 1DWOA 1T5DX 2BE9A 5E6UA 4ZZIA 4J94A 5L1JA 3G2OA 2HO5A 2WZBA 3B78A 1V48A 2JL1A 1IPFA 3I52A 3N6XA 3OF3A 8ICRA 4HDCA 5EJ2A 5F2OA 2HHWA 2XWJI 5FRDA 2ZWIA 2Z8YM 1ECBA 4JOSA 4MEXA 3A9SA 4TTVA 1O5TA 3OM9A 4U9UA 3EPPA 4W1QA 3CSDA 3DTYA 3AOEA 1KO7A 4FC7A 5HGJA 1E99A 4CQMA 1JFFA 1YK1A 5IVPA 4G0VA 4EG0A 4RZHA 3LHDA 5AKGA 2VDWA 1OBFO 3HYNA 4LYGA 4R1PA 2QQ0A 1ZRMA 1XTVA 1S0MA 1DINA 1XU4A 2HHJA 4QBKA 4UE6A 4ZMRA 4M6WA 4HMQA 5JCJD 5IAJA 4BJ5A 4DA0A 2WD7A 1FW8A 4HY3A 3QV1A 2BUAA 3U7QA 4YRDA 2NVOA 4X7MA 3QYAA 1W4ZA 3HNOA 4M1KA 1FFAA 4P92A 3SF0A 2I7TA 4MQLA 1GRCA 2EKBA 2F3RA 3GI1A 1BTOA 2UV8A 1P0IA 4NWIA 2COEA 2X6QA 3OVMA 2XMCA 4WD3A 2XB9A 4I3HA 4FS2A 1RWOA 4IDEA 2H2AA 2A9FA 2B1GA 4FFBA 2ZS9A 5TS3A 5KNBD 2OH2A 1HYGA 3FGPA 3W5BA 4EPRA 3W3AD 3MAJA 1RYMA 2Y4OA 2J5RA 1BA2A 1LPNA 3LZ6A 1J90A 1Y7PA 3OBIA 2D2VA 4MDHA 3L7IA 2BFPA 3V33A 4CHGA 4D4LA 5JH7A 5KOHB 4BFUA 1RWPA 4FW8A 2C57A 1XZGA 4JNKA 3OE5A 1P80A 4BNUA 4I1YA 4DADA 2HCBA 3O4IA 3MABA 3Q5DA 4RH1A 1RXUA 1CDEA 2EX4A 4X1YA 4H1HA 5B6IA 2DLCX 1JPJA 1ZPDA 2QTHA 1JEYB 5KFEA 1XX6A 2J0QA 2WAOA 3HP6A 2PZ8A 1RPJA 3C6QA 3LW8A 1M75A 2F43B 4EVSA 3KHHA 4KMOB 2OCAA 2PSSA 2ZI6A 2QUAA 3GLIE 4CL8A 2R97A 3PP8A 1AB5A 1GNVA 4I5EA 5BN4B 1A4RA 5IHXA 4RJTA 2LCFA 3NWEA 2JHCA 4YUWA 2AN5A 5HJ5A 5ALRA 4TN5A 1R0RE 1O89A 1BXRB 3EQ7A 9ICNA 3RTVA 5L8VA 4AI6A 1VL1A 3JQDA 2VSOA 4QGSA 3U0VA 1CI4A 1C8KA 1J0DA 2G8LA 2B2NA 3KOOA 1K89A 3ZWMA 3CN7A 2BY4A 3D7LA 3PHCA 1E20A 3C3DA 3OHAA 1K75A 1X8LA 1W5AA 4PCLA 2VBFA 1D1QA 4HNAA 1LI4A 2JLQA 4UAYA 1GEGA 2OZKA 3R44A 3GFPA 5AW7A 2A0YA 2FPMA 3DB2A 9ABPA 3GRKA 3D6TB 1OWOA 2A9KA 2AJCA 2CHQA 2P69A 1Z00B 2AQHA 2XUIA 4PGXA 3FMGA 3QBDA 4KMOA 4P33A 3IAUA 4K4IA 5F4ZA 5TARA 2B8JA 1IG3A 1UBOS 2W2QA 4CQNA 4YJHA 1VPDA 1NAHA 1I2CA 3IIEA 5DW3A 4ED9A 2CYAA 1YUNA 2HF2A 2NO9A 2WV9A 3INNA 4WDQA 5AJYA 3AEVA 4JIMA 1VDVA 1QHGA 2VYFA 4RVDA 4JP2A 4PR0A 1G59A 4NAVA 3HT3A 1F9EA 4P0PA 2D7CA 6Q21A 2B98A 3DLAA 3NKFA 2NV0A 4I6EA 3K0SA 3AEUB 1VJGA 2Y3IA 2FX3A 2RKWA 1QH0A 4IS2A 3A9TA 1E2KA 1RM4A 1Q7CA 3I39X 4QQ8A 1MAVA 1UBMS 1GA6A 4GVLA 5BSTA 1MB2A 3HXOA 1PDOA 4G0WA 2IX3A 2PS3A 1Y7IA 3WJ2A 3T0GA 3OMWA 1LBQA 5BSKA 1T6XA 1NKCA 1J8QA 3C6XA 3HFGA 3KYDA 3DO8A 4KWEA 4NCAA 4CR8A 2OPBA 3PC8A 1UQRA 1N2SA 3ZOZA 4AUKA 4A10A 1UMBB 1YNSA 1LSSA 2LVBA 2XSZD 3EQ9A 3X1WA 4YAGA 1E18A 3O3NB 4YJHB 1R9MA 3BKXA 2BMEA 2KZMA 3WL3A 4AJLA 1HETA 3DC2A 4W9MC 2JLUA 2WT4A 3T5KA 5EJMA 1VL6A 4HDSB 3KQVA 4Q7EA 5EAIA 4DLPA 1XNJA 1AV6A 1FTNA 1PUJA 4UEJA 2ILTA 1U45A 3KETA 4FOPA 1IXRC 1Z6YA 4C6TA 1KMIY 2J30A 1RHRA 2VPWA 1S8FA 1EBUA 4BNKA 2XY6A 4JC4A 3JD0A 5G0TA 1EFDN 3QEKA 3WS7A 2ZGVA 3WKCA 2I8LA 1FXWF 3BE4A 4YN3A 1K9VF 2QUKA 2REQB 5LLTA 3IUNA 1KMQA 3PNVA 1IUOA 4G5QA 3TM4A 2Y1DA 1GR0A 4ZAGA 2OHIA 2XVTA 3P2KA 2JJ2A 5EWMA 1YE3A 4U9HS 1F2VA 4WCFB 2K7ZA 1WMBA 3HDJA 3VR6D 3D8UA 1TUGA 2XGGA 1J23A 2ZATA 3GRAA 3LSYA 4IV8A 3AOGA 1GYQA 3C3XA 3ILYA 3LUJA 3RVPA 3PDHA 1B42A 1ND6A 1E6UA 1XHLA 2J3LA 3ZU4A 1XA3A 4F38A 5J2GA 3Q8MA 5BUQA 5LNK1 4BE9A 4U00A 1A9YA 3T5JA 2PR2A 4H6WA 1FVHA 1MEEA 4JKOA 1U9CA 1V85A 2ATCA 4MVJP 1RFLA 5CW2A 1P5JA 3GJ4A 1SIJA 4B6SA 3L7CA 4G84A 2BZGA 3KLOA 2DECA 3D6MA 3BB4A 2X8JB 1U3TA 1SKMA 2IUSA 4QTYA 1Z8HA 3L7DA 2BGWA 2AB0A 2J3KA 2PKRA 1UCFA 4KTTE 4DYHA 1DBSA 1TAGA 1ACMA 4DIDA 1OI3A 2I1QA 4L51A 2RBKA 3HVUA 1JMVA 5I3CA 4J2OA 2VI5A 3KFLA 1G8PA 2ZYWX 3VDMA 4MGEA 1MENA 4DVJA 4GOJA 1UOEA 1HEYA 1K92A 1M2VB 3PU6A 2WSBA 1E2DA 1OYYA 4GGOA 4DXHA 4EYGA 2C2KA 2PGLA 3BMCA 3CQ9A 1AZTA 3KXKA 1OLOA 1QOQB 2JGJA 4ND4A 4QGGA 4J9NA 1HDYA 2HH9A 2ZYSA 1H2WA 3H84A 4RORA 3U13A 1W5SA 3GGGA 1T13A 2IYYA 1IY8A 3NHKA 4BZPA 3CW2A 1E2LA 3UAVA 3VJLA 1MIOA 3B85A 4HL6A 1C80A 3R6DA 2IE8A 1Z0UA 3SHWA 3SI7A 2NZVG 4P81A 1R8QA 5AW9A 2GCOB 4AP5A 4CM8A 4DOMA 5JJLA 1DC6A 3OJSA 5DP2A 3AUYA 4J0FA 3CB2A 1JTEA 2JF0A 5DCWA 5FEUA 1JBQA 3L7BA 2ISQA 4ZT5A 4E1BA 1G6KA 5A0TA 2WIBA 2JJ1A 1YZ7A 3SVTA 3NDPA 4PIMA 1JR4A 3W9YA 1MSWD 1V11B 1RQ7A 1Q77A 4LEIA 4AJEA 4BVHA 4LDPA 1T26A 3ANMA 3L4KA 2OAGA 2PAFA 3EY9A 1HPLA 4PRKA 3U09A 4BXOB 1SUBA 4EK9A 4KQXA 3PCTA 2CDRA 5JXHA 1PQYA 2UYCA 3H83A 5AICA 5GINE 3AVPA 2Q8NA 2ASEA 4COKA 4RY0A 1R4ZA 5DBAA 1UCVA 1YWGO 1CKEA 2ZWPA 3GMIA 1CS0A 2ROQA 2Y4NA 3IYLW 2B94A 4HFJA 2DQZA 3RAGA 2GK4A 4FDTA 5JCJA 4WJ3B 1SKBA 4DNOA 4BB9A 2LYAA 3C23A 1UIRA 2I34A 4IDNA 4YAIA 2F3TA 2VWPA 4HNTA 2C82A 1X86B 1TD9A 3EB9A 2B4AA 2VF4X 1K6MA 4HPXB 1ZETA 3RJJA 1QTMA 3QY0A 4UQPA 5EYPA 1OJLA 16PKA 1AGXA 5J40A 3GHHA 3SXUB 4D6YA 1E0KA 2FSUA 2ANBA 4JKYA 3G2QA 3RO7A 1TUBB 2PKYX 3TRHA 1KDRA 5EWGA 3ZCVA 4MA0A 1T36B 3SJUA 2QS9A 3QM1A 4OGLA 1J1UA 5CRXA 2J5KA 1FUUA 5YASA 5H3LA 3GV7B 3F2IA 1W5EA 3EZLA 3DFUA 1TIBA 3PQDA 4RZXA 4YVZA 1CCWA 1XD2B 2CVFA 4USAA 1SULA 4HQ6A 4QNLA 2C4UA 5EZYB 5K0JA 3C3PA 4JLDA 1VPWA 1BVRA 2XHZA 3BQMB 5ADWA 4NXNB 2PXCA 4DBLE 4N5MA 2DC1A 3ZGZA 2J9FA 1CZHA 1YDGA 4PONA 3ZW7A 1EPUA 1XDZA 2V7PA 4FONA 1P1IA 3A7EA 4LMPA 4H27A 4IC9A 1H69A 3GVHA 4O4LA 2ZJ4A 1U9YA 3PRKE 4LC0A 4ZCLA 4C08A 1ZQBA 3DEIA 1L5HA 1DV1A 1ADGA 1CUWA 3H11A 2JJYA 4PG6A 4CEIB 2UXDB 3CPHA 1PBNA 3BS5B 1RI2A 4LN1A 1SU6A 5B4TA 4WBNA 3E8MA 3GGJA 3EARA 4KW7A 1NQ5A 1ADJA 1VB3A 3S68A 1F7VA 2C61A 3OAAA 3R5HA 1QO0D 2R8OA 3E1KA 3FDFA 3HC7A 3IT3A 4Q6BA 2RAPA 2RDJA 3I72A 5E2BA 4ZTBA 1BKDR 3WNQA 2NXNA 5J29A 1Z7WA 2FZ4A 5D85A 3EMDA 2XD9A 2EZTA 5DWDA 3ZV5A 2BIFA 2ZIGA 4OFBA 1I51A 1E2EA 2WLSA 5DWQA 5J47A 5JY1A 5TMDA 3WGYA 5FWYA 1QOPB 3KOWA 3O8RA 1Q2XA 2WVGA 3AM3A 2IIVA 3P27A 2VQFB 2ZXEA 3T5HA 1N2GA 2A58A 2VUHB 4GDFA 5JD3A 1GAXA 4M0LA 1XE3A 2CZCA 4E11A 1SV4A 3V80A 4TYNA 4DQXA 1COKA 2YYSA 1Z2EA 5G3YA 1NY6A 4IQVA 1SMKA 4BB5A 2VTBB 1T2UA 2H1VA 5EGSA 5BW4A 3H9GA 4EFMA 4JYMA 3AKDA 3ZDBA 4G8JA 5JBNA 5COAA 2PNFA 2SICE 4QUKA 4WESA 1H2XA 3KJGA 1LBSA 4WCDA 3UXPA 2W70A 3ADDA 5CJJA 4PCAA 2FOXA 3VAYA 2GZAA 4Q24A 1PYDA 1O1YA 2XV1A 3CLVA 3KKNA 1X66A 1P2BA 2B1RA 2GFQA 1RZRA 3WYCA 2E5LB 3OJOA 4FGUA 5L7WA 4YHBA 3MMZA 1CEXA 2RDMA 3KHUA 1OW5A 1L5ZA 1VL8A 2VYVA 3QHAA 5CVUA 1DOAA 4RZSA 1LW6E 1NN3A 1U8FO 1KW4A 1TECE 3LI2A 4GYJA 3UGQA 3TXXA 3RAXA 1KU6A 4TRMA 1U2GC 3ELWA 4TKVB 1FLNA 1R9GA 5CM9C 3KB2A 1EM6A 1U4SA 5BN5B 3DZDA 2I78A 4QZCA 3U3RA 3F4KA 1VGRA 3EVZA 1LXCA 5EUQB 3MOIA 5TLSA 3UH1A 1THGA 2OVFA 3FYUC 1PW5A 5ICMA 2VDVE 3ITKA 5HZGA 2G67A 4CKZA 4FVTA 2LPMA 1V3UA 1U0HC 1NUUA 3F2CA 4P38A 2ZE7A 4P86A 3ZV6A 1DMRA 3I28A 2M32A 3CC8A 3BGIA 3Q72A 4QDZA 5LBTA 4C4ZA 1LI7A 2L19A 4JSTA 1I4LD 1W4AA 4DJFC 1NVUQ 4E5VA 3VPGA 4IG9A 3TN7A 2X9QA 2IZ5A 2ZTEA 5BV0A 4MW4A 4LF5B 3ME5A 4PX2A 2GPJA 3EA4A 3ZHTA 3OI7A 3EA5A 4YDRA 3VZQA 1BU8A 2QG6A 2Y1KA 3CLTC 4DSTA 1GQSA 1QP8A 2GZRA 2ZYDA 4AKSA 3MWGA 1VMEA 2HK7A 3UH0A 1I3CA 2VHQA 4UB2A 2ORWA 4WCFA 3IQDB 3TNDA 1CJCA 2BMDA 1JQEA 4W5RA 4MB0A 5EINA 1UC4B 5JHHB 1SOUA 3P96A 2CXYA 2HUNA 3IBCA 3QFHA 2XVYA 1WLSA 1WU7A 3ISCA 3LNCA 4KYUA 1TCBA 1IVYA 4W5NA 2CBGA 2GAAA 1TJYA 3BXOA 3IP3A 4Y6QA 4BFTA 4PGHA 1XZAA 4RM2A 4C7OA 1M6NA 4FI3F 3HDQA 1WV0A 4WN9A 4CU2A 3CRMA 1MC4A 4KIWA 3Q8WA 4D26A 1NSFA 1UK9A 4XUSA 1SUDA 5EA2A 4MIYA 1GZ5A 1T1JA 2OUIA 2WMYA 4CVNA 4NNPA 2QX9A 3HKEA 2QPAA 5JHGB 1NVKA 3AWIA 3PUJA 1RLOA 3PVCA 6CHYA 1KZYC 5T8KC 1E2FA 2ZAMA 1ZJNA 1KSPA 4M21A 3TADA 3QUTA 1VP3A 2O06A 2YVUA 1MN6A 4MYUA 3T38A 3OC0A 2FAXA 4YLEA 1E64A 4JLUA 2CMDA 3I53A 2E9SA 4BNWA 2P27A 2KVSA 2R8IA 5IAOA 1RQLA 3NHRA 1L4FA 1QSLA 1CY4A 2V1UA 1N9GB 3GLRA 3RAEC 1YA6A 1NOKA 4HWKA 2QR2A 3O4HA 2CDNA 4QJ5A 3HNPA 3L3FX 2VT2A 3A1WA 3ZBPA 1OUQA 2EHJA 4A8PA 5KVSA 2R8HA 2P6OA 3VR5D 1IN7A 2VA8A 2CNOA 1VLMA 4GXRA 3A9UA 2FP4B 3N70A 1E1RA 1IBKB 4JDUA 5C18A 2XT6A 1KAHA 2PRYA 3MJVA 3NBAA 5MHTA 5KG7A 2EZ8A 2H48A 2OO3A 5J4KA 5FTNA 3NHJA 4G8DA 3D6AA 1K3FA 2W6NA 4I2FA 1S3GA 3D6VA 1BRMA 2ONYA 2Q4RA 2AXNA 3EVTA 3DV0B 3QKRB 4KDCA 4LAFA 3F53A 5CT6A 4B47A 3JAMA 1H4VB 1UBKS 2WNIA 3R0IA 4Q66C 1HFKA 2G09A 2KZ3A 5KFTA 3HEAA 5I9SA 2JARA 4CUJA 4OQZA 2HT1A 1XQVA 4GSYA 1P6XA 3OE7D 5AM3A 3HB0A 1TQ6A 4UMVA 4CKCA 1ZGAA 2VQSA 2Y0CA 3Q2IA 5H2FU 1KFBB 1U6JA 1Z36A 3GR6A 2AOVA 4KLRA 2PMZF 1DC4A 2BFFA 2MR6A 2ORYA 1RPLA 1T3HA 2OYYA 2VS1A 4WY2A 3DDSA 1XYYA 4PVDA 1GCUA 4V3BA 4WESB 2JIOA 5EIBD 4ZEOA 3IAS6 4EKEA 1XU9A 2ZVDA 3L6UA 2V0GA 2HQOA 1KTVA 3EPRA 2OXCA 1QTRA 3A27A 1E1DA 5DXAA 4IOMA 1RYFA 4G63A 3K3PA 5LOVF 1GU0A 1XEXA 3G6YA 3A3KA 3F2VA 4AWAA 1U5BA 2OMKA 4PC7A 5EIFA 5A4FS 3BMXA 4DPMA 5F3WB 2HMSA 2OUKA 4KUEA 2DTDA 2JC3A 2WWTA 2YWDA 1L3IA 4Q05A 1WXHA 4Q3EA 1UZLA 1P2FA 1A2OA 1O95D 3HCBA 2PVSA 4IEEA 4JVOA 1Q50A 2DVMA 3HB1A 5AOCA 5DOVA 1F2UB 2PKQP 4GX2A 3W77A 4BE4A 5CFQA 1FS4A 4XVRA 3JYNA 4L8YA 5CDHA 2K4HA 4US1R 4Z6DA 2VCEA 2FA9A 4X3PA 2HSZA 5J9FA 2ETVA 4MDEA 1YVUA 4BX3A 2RB5A 4FW9A 2ID7A 1R18A 1I32A 3QE4A 1H4QA 3NYRA 3NIFB 1M7GA 1YS9A 3BWYA 2J3DA 1K7FB 4O2RA 4ED0A 5FP0A 3E7WA 4FZLA 2JRCA 4O3RA 2WD7B 4R9SA 1T91A 4RD4A 5JW6A 5L3SA 1OAAA 4O4HF 4ZXPA 4BKUA 5ALQA 1XL0A 3ROFA 3WYBA 4DGQA 2GRUA 2NZ8A 1TQHA 4UPVA 3OTWA 3QHQA 3TAXA 5BWLA 4C0HA 3T3IA 5I9TA 1EUCA 1GDDA 3L6EA 1DAPA 1QFXA 4GP7A 2QR3A 2YZ2A 1GYPA 3MMSA 2YOFA 4AX8A 1OVGA 4AECA 4E21A 1FTSA 2EERA 1Q3VA 2QSYA 1TVKB 4M87A 4X6LA 3QXGA 1W75A 4ASUA 4HZIA 1FFGA 1XZMA 3N74A 4Z4HA 4CJXA 3M6IA 1Z37A 2FEAA 3QVOA 5KOHA 2ZE5A 2HV8A 4U8GA 1CJSA 3P5BA 3I6IA 4M9UA 2AG0A 1OX6A 3Q6IA 1K0UA 2V6BA 4TSFD 5FBQB 3C3MA 1XS9D 1AKQA 4LRUA 1M2JA 5KYNA 4BJ1A 1K27A 4NJMB 3ECSA 5FO1A 4F5YA 2Z0MA 2CUKA 4ZXFA 4HS9A 2WWGA 3CRNA 2MJLA 3AUFA 3B1XA 4RZUA 1FFSA 4YAOA 3HJRA 4LRQA 4PPQA 1LPBB 3E6AA 1AM4D 1OCEA 1JKMA 4PGGA 5AD1A 5CA1A 4I1SA 4C7KA 2BCRA 1XOIA 2LR0A 1WTCA 3WLHA 1S02A 3UY4A 2DRIA 4QREA 1X9SA 1G2OA 3K0FA 3RASA 1VXOA 5KQRA 3DEFA 1ECPA 4RQBA 5M3BA 2JDIA 2VHTA 2QG4A 4QZEA 1PQWA 4MR7A 3T4PA 4CU5A 4EELA 4TV8F 1Z4QA 1VL2A 1AQIA 3RIXA 5CA0B 1D6NA 2DR0A 2FPSA 3G5UA 3FUTA 4BRSA 3RK0A 2P78A 4OFZA 4ZAXA 1G42A 2O2EA 1UFOA 4KRXA 4DWOA 2ERCA 4JXJA 4Q4DA 3S5JA 4RZIA 3VX3A 1H3FA 4J3FA 4UHJA 1RG6A 3U16A 4OLBA 3HGQA 2OHFA 4W8OA 3UMJA 3PC7A 3ENZA 5B58T 5HK9A 2AQ4A 3IDFA 3LMKA 3MUFA 2BFOA 5KG5A 4G6ZA 4UNQA 3LF2A 2Q3FA 1DJNA 4RFVA 4NV0A 4NESA 5I8PA 4HNUA 1EP3B 3R76A 3V3TA 1T4GA 4O0IA 2JANA 4WLVA 4OREX 3TZKA 1JI7A 2P6UA 3VA7A 5A0VA 1XTRA 1YZVA 4OUKX 1NBMA 3G5TA 3PFGA 3SK0A 2BM0A 1XLVA 2ORVA 2E1EA 4EMSA 4G1FA 7ICVA 3H0LB 3CTPA 4RLSA 2XCLA 4IRUB 1MGOA 2XCIA 1RW4A 3FXAA 3PQCA 3KT8A 3U7IA 3UVEA 1K8ZB 5C34B 3SMQA 2A84A 5B1DA 3NEAA 4QOHA 1DZIA 1QS0B 1ZMXA 2XCPA 3RANA 4B8YA 3VYSB 1RXSA 5A6VA 3O8OA 1Z4JA 3CBGA 3IV7A 2ZYIA 3KUDA 1L6RA 2ZAOA 4Q3AA 1RRVA 2XUJA 5DLQC 3TLBA 1NAIA 1ZLYA 3WBKA 2D2EA 3UT0A 3V7WA 2C9YA 4FZ3A 5KYTA 1KOJA 3H4DA 4BKOA 5EJ9A 3WB9A 2VDKB 4E03A 2BCEA 1BXGA 2DPGA 3KOYA 2L17A 3C97A 2KOBA 2ODWA 3RJTA 1W8DA 1UMDA 4QXPA 1ZH0A 4DJJA 3CBQA 3O2SB 3PUZA 2GDZA 1C4XA 2Z43A 4ZVUA 2J4FA 1E7QA 3UXOA 2O2JA 3AINA 3C8MA 3LPDA 1WZCA 1NFQA 3OCVA 4YDHB 3A6FA 4MVYA 4B81A 2KD1A 1BE8A 4DEVA 3J81k 2WU1A 1A9PA 2LM4A 4O2AF 3RD5A 3GPDG 1M1ZA 4EZEA 1TUBA 4PX3A 4PZCA 3U3DA 4OQYA 4FX2A 5DX1A 1PE0A 2QKYA 5K0TA 4LXTA 3GVCA 4HLUC 4LUCA 4QQKA 3HACA 3LYAA 2W7PA 1HIWA 1GGKA 2QGNA 4J7CA 3HPQA 4TM8A 4EKYA 2V7WA 3BQ0A 4ED8A 1WHSA 3BH7A 4NQZA 3TG2A 4INPA 1MHPA 4GMXA 1XHEA 4NFYA 2HA7A 8MHTA 3SM9A 3G8YA 4CF5A 4B9NA 8ICMA 1V5FA 4E51A 4ILKA 4CMGA 5ICFA 5D00A 4DRXA 2CV0A 3KTFA 3EPIA 3OKPA 3L0YA 3HFRA 3K20A 4M3NA 4KXNA 5L53A 4ACOA 1TLLA 2BKAA 3U37A 3JQ8B 3FFBA 3B9BA 4RMGA 2AZXA 1LVUA 2G0TA 3UKDA 4D92A 2WC1A 1G20A 1V3TA 3KWMA 4N1AA 1C9NA 4CPDA 3TQCA 3QNUA 4YP7A 3B1ZA 3TB6A 5K4GA 2CD9A 9ICJA 1G8AA 1FF9A 1NNUA 3F6BX 3IKVA 3T9FA 1TKDA 2VRNA 3FYUA 4UBLA 5CB4F 1W4BA 1T2FA 2XRFA 4PBSA 5K0SA 1ZIYA 5LOVA 3PO5A 1OROA 1MXHA 2ZR9A 1UXKA 4RTQA 5BXYA 2R48A 1QBKC 5I7EA 7ICSA 3KSRA 2EZZA 4FMBB 4WNYA 2A4KA 5F7ZA 3RC7A 4JFAA 2WOOA 4D5GA 2JLXA 3KBOA 2ZRMA 5CITA 2PY6A 4C7OB 2C7BA 3DVLA 4G81A 4HYEA 2EFCB 3QU9A 2XAUA 3QBEA 2NPOA 1U0EA 3G13A 1A3CA 1Z6ZA 3N87A 3KE9A 2AGVA 3UC5A 4B75A 3CX7A 1M2HA 1H6BA 5CH3A 2WE8A 3PQ8A 1UXGA 1A4XA 5TQVA 1GZ7A 2C8VA 2NZYA 3OPQA 1SUPA 2O14A 1YQWA 2QW1A 3GVXA 5BRNA 3C43A 2EX0A 3PGLA 3T5GA 4PLWA 4D96A 3TZQA 1N5KA 1SEPA 3QXHA 5B1HA 2JEJA 4BLRA 3HCDA 5BV1A 1GCAA 4IQ4A 3OCXA 2FW7A 3R8FA 1E1YA 2EYQA 4GICA 2HVHA 1OH6A 2H4HA 3IC5A 3VYVA 1EFLA 3O21A 3OZUA 1LD3A 4IMIB 4QXRA 3BS7A 2ZPTX 8ATCA 4IJ5A 3KOMA 4RC9A 1E79D 5FOVA 4A03A 5TEWA 2OD7A 1XDWA 4S1OA 6GPBA 3DW1X 5K8IA 4MQEA 4ER3A 3Q0EA 5FQOA 1Q44A 2XLCA 1JRLA 3KTAA 4JMLA 4WHMA 5LZ5A 1FSPA 1CXZA 1DJOA 1RJEA 2PTGA 1DX4A 3A58B 4XGKA 5DBEX 4X92A 4L8VA 3HRKA 3U56A 5EIOA 5BPFA 2QN3A 1BEZA 1VJTA 3KSDO 4EQ6B 5G1PA 4GI7A 3ZE9A 3B12A 4CG0A 8ICKA 1E58A 2FSVC 1S8NA 1DOQA 1SC6A 2GO1A 3DR5A 4G4SO 1T8RA 2PGOA 1SC1A 1U7TA 4BFCA 1TTTA 1R00A 2H2GA 5FNVA 1GG5A 4IHAA 2IA6A 1L7EA 1WZEA 3OT1A 3E7FA 3A6EA 2DBVO 2WSLA 4RPYA 1XQXA 1DKUA 3B2QA 5HBGA 4DCNA 1VE9A 1YVEI 1W0JA 2ISSD 1EUCB 2XECA 3GJTA 3I8XA 3LUKA 4QYIB 3IPAA 4B44A 1B76A 1KO4A 2PGXA 1A8PA 2GWRA 2ZYVX 5FWNA 4LHEA 1GQFA 1BMTA 1KYYA 3S2YA 1NXTA 1FUYB 1Y9ZA 4B3MB 2E89A 2W4QA 3ADPA 4FZNA 5EXEA 2HGZA 3WAGA 1EDBA 3NW9A 4PFQA 4HQFA 3EXEA 1M8KA 3GH3A 4IX9A 3FPGA 5F33A 1YUBA 3T1QA 1B43A 1N5OX 4NBUA 5BR4A 1G2PA 3ANSA 4KEAA 2DQSA 3ZHXA 3B0XA 3FVRA 1MABA 1N5XA 1RD4A 3H5NA 1JKJB 4P7FA 5LYYA 1BYUA 4XYEA 4YMTA 3NCHA 3USES 3DDOA 4FFSA 4TT8A 4CHTA 4D3FA 1D9DA 1VKNA 3GJ5A 2TYSB 2IUYA 1MFZA 1Z6QA 4TLLB 2O1WA 1UXOA 2JDID 1WYGA 3NS1A 3SEIA 4UE2A 2YXPX 2OGSA 4FCWA 3YASA 4G9BA 3KAPA 3TB4A 4R8RA 5EMLA 3THSA 2K7FA 2ZYRA 1QK3A 4L5IA 3HN6A 5SY9A 1ULAA 4M8IA 2OK8A 4N03A 3Q8QB 7REQA 3W2GA 1IHUA 1ZQXA 4G23A 2VAMA 4FQ5A 5DU2A 5HF6A 5JYBA 5JXWA 4JASB 3SWWA 3LY8A 3PXBA 2X2EA 4RA6A 2IS1A 1DT5A 2PANA 1QQ6A 4TZ0A 2ECFA 4AL4A 1T9CA 4QJ4A 2BFCB 3C7TA 1N3IA 2J4CA 4JIGA 1IB0A 3I62A 1NC3A 3PKZA 3SYKA 3VZRA 2ZCUA 1YBFA 2B7LA 2D7DA 3X2SA 2JAWA 4X8LA 1EUZA 4EL5A 5K8UA 1NBMD 3GYBA 1KXJA 1FLVA 4TUPA 1VPVA 3F90A 3P9IA 1YRHA 1VTKA 3SC2B 4R31A 3GUZA 2D1YA 3AJEA 3G8CA 2V7TA 2VLIA 5LZ4A 2ECQA 3E53A 2ZXFA 1LBEA 1ZH8A 4Q7KA 1N1GA 4HDMA 4XIFA 3C7KA 3DYIA 2BDPA 4CGZA 3ULKA 1XJWA 2DX7A 3I5UA 1IK4A 1EA7A 8ICWA 4RNDB 1DXQA 4NFSA 3IBGA 1MG0A 5CFPA 3QZ8A 2IHJA 4HVLA 3OIGA 1UZAA 3B8HA 3AB7A 1NUTA 4K9NA 1CEZA 2C5GA 1PZFA 2VNSA 4LWQA 4LRSB 4PEVA 2H52A 4RK0A 2ECPA 1ZN7A 3GPCA 1VLBA 4BNDB 2YZNA 4L9WA 3KQWA 1AQJA 4I2VA 4CT4B 3PV0A 1H6AA 2J4DA 4MROA 5IJ0B 3FTNA 1SG6A 3PPIA 4ZV7A 1WXGA 2GK6A 2OCPA 1JZQA 3NBQA 2EL7A 2XE6A 5C80A 2QMHA 1HURA 1XWLA 3NHWA 3E61A 3HHPA 4LHXA 5A2QA 1YJXA 2BGKA 1AK1A 5T3UA 2CFRA 3M6AA 1KI3A 2EJUA 2C4TA 2WKRA 4I5DA 1QH1A 1K68A 2BM1A 1U6IA 2WM9B 3COVA 4NJEA 1FYEA 2CRXA 3FCAA 4ZRDA 3B0YA 5J2KA 1IZ9A 1GTZA 3HGMA 3JQ7B 3GDOA 3HZOA 4X7PA 4JUZA 1OLXB 1SCKA 3BJIC 1KBOA 2J3IA 3R7WB 1GRVA 4CM9A 5AUOB 3KCQA 5LQAA 3T1TA 4XIYA 2R18A 1ZISA 3GT0A 2Z8YA 4YJ3A 1A5SB 5CLHA 3T1VA 2UXBB 4ZU3A 2R7NA 3RYCA 1E6CA 4NXMB 4QJBA 5CCBA 1BCRB 1T5HX 2I8CA 2JEOA 4Y3UA 5EPOA 3GAMA 1SUIA 3QMWA 5BT9A 5KNDA 1U7PA 2GESA 1Z4LA 2XVMA 3HU1A 5A04A 1ZQUA 1KYWA 1Z68A 2WYOA 3AP2A 3FAZA 3GQBA 3KPVA 3MOSA 1C3EA 2Z83A 2BV3A 3DFFA 4NK5A 4YREA 5ALIA 3DMTC 4IGIA 2WWVD 1EX6A 1L5RA 3OLCX 1BCSB 3CKYA 4E22A 2OZEA 2IIPA 3R40A 4ID9A 5EXDA 2BFMA 3ELUA 3EYAA 3PSHA 3H5VA 2J07A 4M9NA 4IAOA 3OQOA 2A5DA 4Q4AB 2NMVA 3MFIA 3FETA 2ZB8A 4DLEA 1OGYA 2I2BA 2OYCA 4Q47A 5F52A 3VAZA 3X1XA 5HVNA 2I76A 3HO1A 2BTQB 2KNJA 3QLUA 1LS6A 2WHPA 3WGZA 1WZUA 3PLAE 4YR7A 1G1AA 1MQ9A 4TKZA 3KAQA 2XJ9A 4QO7A 4EPYA 4O5EA 4DFPA 1A72A 4AQ7A 2TMKA 4ERXA 2HRZA 4OQNA 3HVJA 2PU5A 3OZGA 3HBMA 3CUSA 1Q92A 2ZJ6A 3LQ2A 4PIVA 4H77A 4CZ2A 5I51A 3IHKA 4NBWA 4MP8A 3AVVA 5J0YA 4IZIA 4L8GA 3K70D 1ZQQA 1SUEA 2HRRA 3LFUA 3CRW1 3D6FA 3W05A 2VO1A 1E6LA 3WMWA 4DAOA 4EHJA 1T2CA 1UL1X 2ZTVA 2YMMA 2ZDQA 3QF7A 5IUNC 3CLUD 1WXEA 3OETA 2NSLA 5JS8A 3MG9A 4KO2S 4Z53A 2QRVA 1SXJC 4WLOA 2GJAA 4QRDA 3VNRA 1Z5PA 3JRWA 1P0CA 3W8NA 1GGMA 3NR2A 1PL8A 2Y0DA 1CUYA 5CX1B 4QPZA 2QLMA 4N5NA 2Y6UA 3UXNA 1SM4A 5ALEA 4I9FA 3JQQA 4R8LA 5L3RA 4AMVA 1YULA 4ECAA 1DCTA 5IFLA 1SZDA 1U8XX 3FMPB 4PTYA 4BP1A 4N76A 4KQCA 1VHDA 1CIJA 9ICWA 4YRLA 2GM4A 1MIHA 2HIMA 3L8EA 3HO6A 4BMVA 3PWSA 4LJKA 3KPWA 3W0LB 2X6RA 4HLCA 1GUFA 4GX0A 2D54A 1YIOA 3CEJA 3K16A 5KNLA 1RIFA 4O4IB 3WGGA 2Z2KA 2WP8J 3IQWA 5AVKA 1X1AA 1A4UA 3K0CC 4MUKA 1ZIPA 4OI4A 3LVVA 2JAQA 1C3OA 3KXLA 3W4JA 5JQWA 1FMJA 1I5EA 3DGEC 3ILVA 3TPZA 1PFKA 2V97A 3LCRA 2CF5A 4N9WA 2VZ0A 5IKEA 1ONNA 3LD9A 1Z8FA 4YBRA 4DCGA 3RTBA 1SHLA 1U7UA 2G7ZA 3CLSD 4M38A 2DY1A 2XB8A 5KYYA 2OCBA 4J1TC 3WV5A 2WSYB 1ZDMA 3IAM6 2W11A 1W0JD 3MMNA 4ON9A 5KTQA 1FX1A 4OHUA 4TURA 1WP4A 1XV5A 1UADA 2NO7A 1HE8B 2X58A 5IFKA 1PVVA 4G3IA 4WK6A 1C0EA 4DFKA 2CMHA 4Q9IA 5HDBB 3TNFA 5KC8A 5L4SA 1USKA 2WDZA 2JRLA 2PWZA 1Z39A 3LQ1A 3KD3A 4XX1A 4MUBA 1X8XA 1DHTA 1GO2A 1RHKA 4H4CA 3W8RA 4E7PA 3AY3A 3FTDA 3A0BU 1A04A 2DFVA 1KI9A 1I3KA 1WM1A 3K05A 1BFUA 2SCUB 3WB1A 3RRBA 3AKEA 4RD1A 2QQGA 1PL0A 2IL1A 4R41A 2C9CA 1IAQA 4AKTA 3V1TC 4YAUA 2NSYA 2C1EA 2J85A 2D5AA 3L5OA 3PENA 1T36A 3OU6A 4DWVA 4US9A 1UDCA 5JYDA 1DT3A 1SG0A 2QIOA 5FFFA 5AXAA 2UUAB 3NTXA 4GUDA 1ANKA 4WI1A 4JC5A 4FFPA 2QM8A 3RBZA 1A1SA 3W8DA 4ZTUB 1HDOA 2BSAA 4ZJUA 2FUG6 4XVQA 1U1DA 2W6MA 4TMTA 2DHQA 3T0IA 2R00A 4HN9A 4B7CA 1ADCA 4TTQA 2JAOA 3KXPA 2Y9PB 3B6JA 2ZB7A 4KGZA 3H2HA 4QKQA 2Z9BA 3HCCA 3JPQA 2ZSIA 3NBZC 2ZJ8A 3M6KA 5EQFA 4UM7A 2P68A 4Y0VA 3OFKA 4OD0A 1QJCA 2HWKA 1CJBA 1ZMRA 2JIPA 3FBGA 1RYSA 1XZEA 3R7BA 2RGAA 1DI0A 3Q7SA 1T3TA 4G9EA 3OM0A 5IDYA 5KYUA 1ORDA 1N6KA 1X15A 2D5CA 4JBYA 1MB0A 4JLSA 5FI3A 2C77A 3T1HB 3WX0A 4B7AA 1CB7A 4HYTA 4IXDA 2G6BA 1N2OA 4F3KA 4HMOA 2IELA 2B6HA 8LDHA 1G2IA 1D7AA 2D1FA 5EHQA 1NF8A 1MJGM 1OXXK 4D9BA 1SQ6A 3D3WA 4K40A 4NVRA 3B5IA 3TAHA 1S7CA 1GNTA 1OW3B 2OTCA 4AQDA 4N41A 5DMXA 2XDQB 2YINC 4WLFA 1H2EA 2HGSA 1SVNA 4KP7A 3I9OA 2W9XA 1Y8QA 4AO7A 4OGFA 4OQDA 1YT5A 5JSYA 3VTFA 3HXPA 1ZM2A 5IAAA 2B35A 3A31A 5DPMA 4WEQA 1Q1AA 1W8IA 1Z13A 2DSNA 4YMNA 2PS9A 1IEVA 2Z04A 4KQJA 5LU8A 4NLNA 1E1QD 1WDLA 3ZCQA 1ATIA 1NJGA 3DE4X 3U3ZA 1NWHA 3CGGA 2RG7A 5DM2A 3ZI0A 1UWVA 1TK5A 3BS5A 3EUEA 2P79A 3GEBA 5B12A 3LH5A 1V35A 2C9OA 5DK4A 5L40A 4J16C 3AVWA 5H16A 2GKGA 4BNDA 1MF7A 4YCAA 4K2HA 2V4RA 1RWWA 3AI3A 4IIYA 1FNDA 4GYKA 1S0NA 1SBNE 3B70A 3NHBA 2WIJA 1JEYA 2UXCB 1TJPB 3COWA 2H2DA 3O1JC 2NGRA 2I3BA 3RJGA 4YI5A 3WGQA 5LB4A 5KT2A 4RVNA 5A7FA 4TS3A 4HATA 3EVAA 2NADA 3SHVA 1QR6A 3UHFA 1MOPA 3FPSA 2QZZA 5DMHA 5J2IA 3JQFA 1Z00A 1TTPB 2LNDA 4L9SA 4MYSA 3ESBA 1C4OA 1DKLA 4QDXA 1QHHA 4OJ5A 2G63A 4BVFA 3JPTA 4RZRA 4K5QA 5BO5A 3TCNA 1TEZA 2IZZA 3ZQJA 1MH9A 5A03A 4AFNA 4FPXA 4CEJB 4JJ4A 1CLEA 2AC2A 2GHRA 3GP3A 5E9AA 2X2FA 2PZFA 1ICIA 1YD7A 3BC1A 2Z09A 4EEXA 2J46A 5ECGC 1NU8A 2Q45A 2VWQA 221PA 4M86A 2RGCA 3LYHA 4AB1A 4MQEB 1MORA 4QTTB 3UIEA 3WHLA 4ED6A 5ITSA 2YHBA 2G77B 4K9SA 4EUKA 2A59A 2O3JA 3FNFA 5IAKA 1STOA 4IM7A 4H6VA 1A9QA 4LZNA 5K3DA 4HGQA 2C2OA 3I4CA 3M5CA 1AX9A 3FC4A 1D0SA 4HXYA 1JXEA 3BIOA 2V6IA 2A0WA 4L6IA 2E8NA 3BAFA 5AH0A 3RIYA 3RR2A 3ZOKA 1Z8NA 3G8DA 3GVPA 3ILSA 2H0RA 2QD4A 4J43A 4OX9B 1B93A 2KJ8A 2NN3C 3HY6A 1SKYB 4GBGA 2A1JB 1EVYA 1GEEA 3LDHA 4J7UA 3RU9A 2H1IA 3I0MA 3VTAA 2PK3A 1L5FA 3VSCA 3WL4A 4ER0A 3SZUA 2X1LA 1TM7E 4QBHA 2XUFA 3WOVA 3C3WA 1CR2A 2XB6A 4FB4A 5D6NA 2FG5A 4IDDA 4KWTA 4C6TB 1JBKA 2OZPA 1M5TA 2Q07A 2V5VA 5HHIA 3GW8A 3OOEA 4CR6A 2AC4A 2CC2A 5KFOA 2HFJA 2YRFA 2W9BB 1SA0B 2R6FA 2Q1TA 2HMWA 2HSEA 4EZIA 3BHIA 3DR3A 5CA0F 4QULA 2IU3A 1VM6A 3E22A 5A6SB 3KQLA 2PWPA 4G5RA 2NNWB 2RAVA 3WKDA 1TYDE 2J9RA 2P1ZA 3WGLA 4EY4A 2O8BB 4JT9A 1VSTA 1QQTA 2F3QA 3CF4A 4UU8A 4V0OA 1KO8A 4US2R 1OX4B 3DG9A 3AG5A 3K1JA 1U8AA 3BMOA 4HX9A 1J56A 4OHXA 1HDXA 3TFSA 5ER9A 5I45A 2KV2A 1J00A 5TE9A 3SKYA 1KL7A 3HPRA 3GGSA 2JH7A 1AGPA 1B8UA 5E4YA 4KR9A 2ATEA 4FZMA 1KPGA 2FF7A 2QAGB 3KU1A 3PUYA 1NI5A 4TUYA 5JD6A 3MJTA 4OJYA 4PHHA 4FFRA 4DCJA 3THWB 5DNEA 3TR6A 3GL9A 3KB8A 5HKKD 2ZTDA 1ZQAA 2W2XA 3CH4B 2NWQA 4B3FX 3BL6A 1D8AA 2FX2A 3IP1A 4TL7A 3EGCA 4S1TA 1XTJA 2F3UA 1UDAA 3AHJA 4HH3C 3BSYA 3IDQA 5GV7A 2A1UB 2D4AA 4X91A 2NV2B 4NLLA 5G0SA 1KY5A 1V7QA 3BCRA 3I1JA 1WUKS 5D49A 4PBTA 3WRVA 3KEMA 4TQ9A 1P62B 4U02A 3R8CA 1OBCA 3CP8A 1QSYA 2AMLA 4LXIA 3HKZF 4PAWA 2P7IA 1C8VB 4G1EB 4R81A 1J8FA 1U1CA 2QRHA 3F9RA 2R8BA 1BRTA 2WSMA 2OG1A 3QVKA 3QXCA 5B3LA 2PH7A 1TB4A 3IODA 1XK6A 1CY1A 1MPXA 4X20B 3GAZA 2WY2D 2PAAA 4QTZA 4BO3A 3OQMA 1SUWA 3N39C 1XRRA 4JEIA 1XZQA 4M8SA 4MV6A 3E23A 4XA5A 2XKJE 2ZVPX 4A2PA 3JV7A 5BPCA 5LXTA 1T0BA 3V8PA 2C5SA 5KYVA 5E1DA 4ZVRA 3K7EA 3JCZA 3TADC 2BCUA 2AFHA 3PIIA 2AS0A 3F2DA 1Y3DE 3QHPA 2AVNA 1TW2A 4MI1A 4P7GA 4Y1EA 1U5BB 2CEAA 3I5MA 4MI9A 3VR2A 1R0BA 2XGMA 3M8RA 3Q3HA 1GQQA 1QYRA 4ER5A 4YQZA 1V2GA 1D4ZA 1ENYA 2W2LD 2E8PA 3DC7A 3N3AC 3GJ3A 3V9AA 1GAQA 2NO0A 4X1IB 4RPXA 1BH2A 1JHDA 2CFIA 3MRSA 1KIFA 2XZTA 4DUPA 2H1LA 3QFSA 1KERA 5J4YA 2RAUA 4JXKA 1V97A 2W58A 3TSYA 1C9EA 2Q3JA 1WSAA 4MGZR 4BQRA 2WQZA 2H4JA 4REOA 1PK3A 3FB1A 5CEEA 1EFAA 4UHKA 5JSZA 1S9HA 4MLZA 3ISDA 1EU1A 1J8VA 3G02A 4LK2A 4TLCA 3U6BA 3VYRB 2MA1A 1ZD4A 3HFSA 2ZT7A 2KQUA 3FPHA 4JX8A 2EZXA 3QJ5A 4MUGA 3W9UA 1JDBC 4UULA 4WOKA 5BVHB 9ICMA 1RTKA 5T4FA 3ZJ4A 2JFBA 3KZIU 4C87A 3S2ZA 1GG2A 5JZ9A 5LJLA 1NJZA 1GAJA 3B1KA 1VCOA 4H6PA 4HGPA 3V1NA 4URXR 3HDVA 1EJBA 4LZZA 2ZIWA 3HFJA 3TJZA 4XB2A 2NVWA 4TV8A 1KY3A 4NLKA 1XD8A 3H1AA 3SFTA 2WJPA 3CU5A 5K7SA 4A73A 3EC1A 2OOKA 3WO0A 1SKQA 4YRJA 3U4IA 1S5LU 2NTVA 3G9XA 2FFJA 3SQNA 2X42A 2UKDA 3OEEA 5JBQA 4YPFA 5CXQA 3LVQE 2ZB2A 3MINB 3A4LA 3PD1A 1XRPA 4NATA 3L4EA 4IUDS 1AHPA 4DA7A 1V71A 2O8EB 3WIBA 2FRDA 1JLLB 1DFHA 1QGUB 2B4QA 5FOQA 4LY6A 5DT9A 3V7YA 1Z0AA 3CEAA 1ND5A 4ZMSA 5L3ZA 4UDYX 4ZVTA 1Y5RA 3L1JA 2QD2A 1E3EA 2IF2A 2QTMA 1OTHA 4Y2RA 3N2GA 3GILA 1Y4SA 3OZBA 3BEOA 4KLQA 1YU6A 3EQ2A 3RRHA 4FHZA 4ML3A 2E4WA 2AFHE 4DMUB 3PNQA 1NY5A 3WTCA 3FOWA 4L74A 4YB8A 2N0SA 4TXLA 5KDOA 1Y5MA 2WM8A 3HUDA 3ZD7A 4RFSA 3U5TA 1CQIB 1HLPA 3O73A 3R9WA 3AUKA 1TTHA 4JJIA 4ZI7F 1S76D 2ADOA 5JQGB 1Y5NA 1DGQA 4L2IB 1JR6A 2XMRA 4ENVA 2QD1A 3DM5A 5G02A 3SNKA 2LV8A 3BHNA 4E2WA 2HMXA 3O1IC 4RUKA 4O3FA 3IB6A 1R0XA 2X0IA 3MILA 1QGYA 4MWBA 4C8KA 4R2JA 1F06A 4MRNA 5CJ2A 3GP8A 2FPPA 3HJCA 2W8LA 2O2GA 2XCTB 4PLTA 4M0AA 9ICSA 2HM7A 3D0RA 2HBRA 1ZI8A 1YZ6A 1FTGA 2C0CA 2RHBA 3EEFA 3OQPA 2X77A 3VI3B 5KWJA 3CZPA 2AX3A 3P52A 2KSOB 4FS3A 4P98A 4BMZA 4CKEA 3R6WA 3GGOA 4DMHA 2ZJBA 2PRIA 4YCBA 4CEJA 3D2NA 3G68A 3UHPA 4PYRA 2AFIE 2YY5A 4TZTA 4TOIA 1FVXA 4Y0AA 4ELTA 2VWHA 1G20E 5EWJB 1HLFA 4YXWA 4RH0A 3WL7A 3N86A 2WUVA 5IWCA 5JZBA 2FWRA 1QM5A 4JJ7A 4BV8A 3BGSA 2EP5A 4YRPA 2Q3CA 3LX5A 4FYVA 2VJLA 1CUSA 1GTL1 4L08A 3U0BA 2NVUA 2IU4A 3ZIUA 2PT5A 1L9XA 2JFPA 2KIVA 2ON6A 5K6AC 3Q8SB 3K72B 2WPDD 2IUUA 1ZINA 4PO3X 3GPLA 4OKSA 1WPRA 1YDHA 2PI4A 3M4XA 3FOAA 4WERA 5A4IS 3ZWAA 5EHXA 1V6AA 5BSFA 4FYKA 2EAPA 2BFWA 4F92B 1HQKA 1HZJA 1MJNA 2HK9A 3DOUA 1EEXB 1P19A 4G0UA 3RRGA 4MR8A 1G5PA 3BXFA 4P4LA 3KKAC 3MB5A 4RGBA 2SCUA 4F6LA 1ZQLA 1VI6A 4O0MA 4DC0A 3RFFA 4FB5A 5AQEA 2H1WA 4HVTA 3TDKA 4F4JA 2YFHA 1GJRA 3KKEA 1T24A 3WK9A 4IRCA 3JR3A 2BKVA 3C6BA 5EKUA 2QWXA 3KIPA 1XMOB 2Y99A 1R0YA 2MAXA 2ODAA 2A35A 2GCEA 2JGIA 3F4BA 3H97A 4CTOA 4EBEA 4B3CA 2I9PA 4FDVA 1E9VA 5GONB 2J7KA 1HEKA 1XO1A 1R4MA 2A30A 2AD5A 2R7AA 3KO8A 2GCPA 4IILA 3WKEA 1GITA 4NCHA 3MTEA 3ZH2A 3K9LA 5BXQC 4JEMA 4MVJE 4TLMB 5G4KA 4UEQA 3VR1A 5ALNA 3L41A 3H5WA 1QX3A 1JLMA 4I9HA 1ZM7A 5DBGA 4EYSA 4MR8B 4Z0PA 5I4IA 3Q9LA 2DY0A 1NWCA 2ESEA 1X7WB 3LBHA 4M37A 3VPDA 3BGVA 2I2CA 3TZBA 2XQKA 5AOBA 1EGQA 3KQTA 3ZXSA 4BNZA 2GEKA 2W98A 3T9EA 5C1BA 5CEHA 2C04A 3IGFA 2RHCA 3AONB 2I9GA 1YONA 5F9LA 1GKUB 3B3QA 4JD5A 3ZGYA 1PJRA 3C2LA 1E9CA 1G5TA 4QFCA 1VPTA 3WXMA 1NFRA 1DB3A 3GYGA 5ALTA 1WRBA 4L27A 4YJKA 4Q1CA 3A4MA 1MRNA 3C39A 5E6SB 5H4HA 2Y27A 5T64A 1ZD1A 2GOYA 1J0EA 2OEHA 1GU7A 4K88A 2EJCA 1HV8A 3OKFA 3FA2A 1ZCFA 1AUXA 1Z7GA 4XPIA 3OTGA 1VG8A 5AJVB 3ZE1B 8ICQA 1A9RA 2C3MA 2FZVA 1B3BA 1ESMA 2A92A 1N5JA 4HS4A 2FLWA 4C7ZA 2W6PA 5KFNA 4TLBA 3COJA 4WY5A 1ZOOA 3SKXA 4EG3A 2GS9A 2Z30A 4ND2A 3J80A 1PP4A 1VG0B 2HHSA 2J45A 4PG7A 4UDNA 2WKQA 2VJPA 2GPTA 5KTRA 1YVRA 4MUFA 1AO3A 4YONB 2QZ4A 4YY3B 2C2EA 4GC6A 2GN1A 4G0ZA 4OJMX 4OQLA 5E2IA 3IT1A 5F2EA 5A06A 5IF3A 8ICYA 1IOLA 3C7DB 4GBJA 4RTSA 2J9ZB 4UNPA 4QE3A 2FWNA 3NC1C 2O1XA 3K4GA 3OEHA 4P93A 3DNPA 3RG8A 2Q6OA 3T5BA 4ZYLA 1QRSA 2CK3D 3F74A 4DLBA 1EE9A 3KUUA 3WO1A 7YASA 4Q34A 4R71A 3VHLB 2M9NA 1PJAA 5DHQA 3WSTA 5EIXA 3AR7A 3IAXA 4LZAA 3RAFC 3AIKA 2NUPA 2GVZC 1R64A 5JNVA 3M33A 4K6KA 4L5YA 4U7HA 5CDFA 3KT3A 4JSRA 2DPIA 2R9VA 2K5UA 1RKXA 3LUHA 2CXUA 2GDJA 4DN6A 1ZNQO 1FDWA 3RS0A 1QIGA 1RBYA 4EQ6A 3OM8A 1HMPA 4WZBA 5KNBA 2A19A 1TLFA 1E5XA 3NIWA 3SGLA 3A37A 1KZ4A 5CTJA 4BNMA 2QBYA 1XF1A 3L0PA 4WNCA 1JMKC 2XDWA 3FKSA 1KL9A 3HKCA 3RYIA 2G9UA 3UMGA 2ZT6A 3FNHA 1X6VA 4N5DA 4B5LA 4KNYA 1L7VC 4KVFA 3TBKA 3NASA 2GM3A 1T4CA 5AW8A 1ODCA 2P9EA 3WLPA 3GIKA 1G3QA 1NVGA 3TFWA 4QUEA 1DKNA 4DWJA 5IDQA 4LWOA 3FPEA 3D6NB 5J0SA 3KKQA 3VYTB 4MWZA 4BUJA 4E5YA 1T35A 5U4XA 1HSZA 3P9YA 2Y0PA 1P73A 2N47A 2FE9A 3G2MA 4QL3A 4YRQA 4R6XA 1U9IA 1JL3A 4BEBA 3DVQX 2WFLA 3T79A 3OWOA 2ZSKA 1Z5UA 2OBBA 4R01A 5DIZA 4BIMA 4GDMA 4BE7B 1X7XB 3DFMA 1Y9DA 3G8BA 4Y67A 3H8SA 3PYMA 1BVSA 1TU0A 2RHFA 3PY8A 1ZBDA 3F96A 1G64A 3QYPA 3VHRA 2YQEA 3KK0A 4IIDA 4NDNE 1UBCA 4P2HA 4BFVA 2PX6A 4FMCB 1C1YA 1Y80A 3EK2A 4D0RA 5CYOA 1IM2A 3M4ZA 3KSMA 1RPTA 4NTZA 4R9VA 4PTLA 5K51A 4YLYA 3TTTA 2BYTA 3NYIA 3AF5A 4ZKDA 1XVLA 2WINI 4UM9D 2XJ4A 3DBLB 1SVOA 1Q0RA 3CUVA 1W4CA 1Z0IA 2I2AA 2OV6A 3JQ8A 2O0LA 2I3GA 4WLEA 3Q3EA 3TL2A 7ICLA 1L4NA 2BMWA 5FNVF 2I1VB 4DY4A 1YQXA 1LV7A 3RVSA 3IDWA 3GLIB 3LWNA 4PHFA 4FS1A 3RS7A 4G8CA 3IBSA 5DBIA 3DMDA 3GJSA 3GZJA 4B3IA 4ZJPA 821PA 2ZSHA 1E2QA 2OBFA 3FLBA 3K1ZA 4QU0A 5LOVB 3U31A 2PGIA 4LJXA 1UWCA 3QJYA 2VDWB 2PGDA 3UK1A 2ST1A 4HVAA 5KHOC 4CG1A 5SYAA 3KQOA 1NHGA 1SU4A 3HYLA 1P44A 1U2TA 1TM3E 4OGWA 2XCUA 2Q8PA 1JHZA 3OPYA 4HH1A 5FPSA 4RTPA 2GPNA 1RLTA 1VJCA 1P5RA 1XCOA 4IRXA 4PX9A 3PTAA 5E0OA 2QE7D 3K8QA 2GF9A 4FEEA 1WDWB 3A4NA 1ZXXA 1FNCA 2A94A 2KI5A 2X3UA 4RL6A 4URYR 5CK5A 1Z0DA 5CT4A 5BYJA 4HUQB 4J4TA 4RH3A 2BKEA 3PPWA 1E60A 1ZQJA 2OHVA 3RSZA 2HBJA 5KMGB 3ZZNA 1HX7A 3PV8A 3CM0A 2XEXA 1NYRA 4MWOA 5A9SA 1BXRA 3T7RA 3MT9A 3DMNA 2DUWA 1XD2A 2NU7B 3OMLA 1SL1A 4GE0A 3TNJA 1QTIA 3HO8A 5AKYA 2WKWA 2B5OA 3DZCA 1JH8A 4WGFA 2I9KA 4DSLA 1XEWY 3D0QA 4PAGA 1FQOA 5CGQB 3ET5A 1GTRA 3KQPA 3SNHA 2J0UB 5DDIP 2HQSA 1VDZA 1YHZA 5JXGA 3VVLA 3FVQA 4Q39A 4RK4A 4BNJA 3EGDA 4RPZA 1QU3A 2H3FA 5LLDA 4EI7A 1OLSB 2MSDB 1JQBA 3TD9A 3WWCA 3ZNPA 3KAJA 1SWWA 2LDBA 3QLUC 4DS3A 3Q7RA 5DLPA 2CXOA 1BGXT 4J9SA 1ZWKA 4I4CA 4MVJF 3RYIB 3FI0A 4MV1A 3RNOA 3VPAA 1JDUA 2Y05A 3DTTA 3F47A 1QG6A 5HIKA 4G5OA 4HZUB 4QJ3A 3H8WA 3CVUA 1XJ5A 3T5TA 5C32A 3IUPA 2FU5C 3TZHA 3OCUA 3BTUA 3G2HA 4HOYA 5J1TB 4AJ9A 2Z56A 3HM2A 4FBLA 1W46A 2HJ9A 2JGFA 2AGPA 2AD1A 4NK4A 1NVMB 1P17A 1VCNA 3D4PA 3L1IA 3LXMA 2NUPB 2UVUA 1K1SA 1MAHA 2JGLA 1C29B 2VT6A 1O77A 3MERA 1M10A 4E4RA 2NZJA 1CY2A 3I9MA 4YIHA 1GFSA 3EBLA 3RVDA 1HY3A 4PFKA 4IDHA 4PLCA 1KAMA 3H0EA 2J6UA 1X1QA 1AIPA 4J0JA 4K1XA 2AYZA 5AW3A 4H3HB 1EBBA 3SIWA 2NM0A 2VSFA 4B2PA 2RHWA 4QQRA 2Q3BA 3FZGA 3IFSA