4M6WB

Crystal structure of the c-terminal segment of fancm in complex with faap24
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
190
Chain Sequence
HIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia group M protein
total genus 48
structure length 190
sequence length 196
ec nomenclature
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m6wB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m6wB01
1PZNA 4QWBA 5KG7A 3PW4A 1QSLA 2KZ3A 2PFQA 1EXNA 4BWJA 5DGAA 4YMNA 5EWFA 4F5RA 3BQ0A 4ED1A 4YR3A 4F4YA 1NK5A 3T5KA 3C1YA 1BPXA 1RXVA 2P6RA 1NOMA 4I2CA 3MGHA 2J6UA 3MR5A 2JPDA 3PW0A 2ISPA 2F1JA 4QZAA 3IHQB 4F92B 3H4DA 5KFQA 4DFKA 5J2DA 7ICIA 5KFZA 2AGOA 3JPNA 5CP2A 3M9OB 3OJSA 3C2MA 2AGQA 1TVAA 8ICOA 5CJ7A 4QZHA 4TUPA 4DQPA 4ELVA 3ZDEA 1U47A 4FS2A 5L9XA 2JEJA 5KFMA 4JK1A 3H8JA 5JUMA 5HP4A 1S0MA 1Z00A 2F1HA 3JPTA 1RXWA 3FDSA 3BJYA 5KG1A 4IQUA 4PGQA 2ZIWB 4KLIA 4R8UB 3G6YA 4ED7A 3TAQA 5DB8A 1NKCA 2ZTDA 4UB2A 1BPZA 4B9TA 2AQ4A 4YCXA 5KFYA 4YR2A 1H38A 3NTUA 5J2JA 2P66A 2AJQA 1ZQSA 4X5VA 1ZQNA 4ECTA 3OHAA 3TAPA 4LZGA 7ICRA 3H7IA 2JZBA 4K4HA 4F50A 2PFPA 3PO4A 3HWTA 3MGIA 1XSLA 4UAYA 2R8HA 3T5HA 2C22A 1ZQAA 4DQQA 1U4BA 4DQIA 1S76D 4F3OA 5CR0A 5J2AA 4UB1A 4ECYA 3T5JA 1NK4A 4UBCA 4ED3A 5DG7A 4DSJA 4MFFA 2HHSA 3MR2A 3OJUA 1U48A 1NK0A 2M9NA 3V7KA 1ZJMA 4C8OA 5KT7A 5D49A 5DLFA 9ICRA 4BDPA 8ICNA 4UAWA 8ICBA 4GXIA 2JEIA 8ICJA 3GIKA 5BPCA 1TK5A 7ICQA 1B22A 1J22A 5HNKA 3RB3A 4FO6A 5KG5A 1NK8A 1NJWA 1UA0A 4O3RA 1ZQWA 4DOBA 4M9HA 8ICPA 4EBCA 3Q8LA 1S0VA 2ZJAA 1S77D 4BXOA 1J23A 2BPCA 5J0YA 4I29A 5DQGA 4IQWA 3JPSA 2FMPA 4NM2A 4ECZA 3B0XA 1WCNA 2C28A 1XO1A 4PHAA 4EYIB 5J2CA 2HVHA 5L1LA 4DF8A 2FPLA 5IILA 4F93B 1NK9A 4QZGA 5CB1A 1RYRA 2OWOA 7ICKA 1COOA 2ZUDA 2BKEA 4J9LA 4RT2A 4RNMA 4R64A 1SL1A 1N48A 3TANA 5KFFA 3EWAA 1SL2A 4M9LA 1SKWA 2V4QA 1DOQA 3RH6A 2BQ3A 2ALZA 2ZJ8A 4M47A 1XWLA 5DBCA 3JPOA 5KFEA 1NJXA 5J29A 4RPYA 5J0OA 4EEYA 4I28A 4QZIA 3UXOA 1C7YA 5HHIA 3LDAA 3EW9A 2P6UA 2C2DA 4KMUA 4I2GA 9ICLA 4YN4A 3ZD9A 4RQ6A 2PXIA 4M04A 4EZ9A 1LV5A 1KEJA 3TI0A 1ZQZA 1WCLA 2W9BA 4O3SA 3C23A 4O9MA 5KG6A 3HPOA 4DO9A 3GV8B 1U45A 4QZDA 5KFIA 2FLNA 7ICJA 5KFTA 4M9JA 8ICYA 4DFPA 4QZBA 4RQ2A 1SL0A 1CUKA 4Q45A 1HJPA 4NM1A 1XS9D 4R8UA 3UXPA 7ICMA 3UPQA 1L3UA 5L1IA 2ZUCA 3C1ZA 4PPXA 2HW3A 4O3QA 4QZFA 3PVXA 3RH4A 3PY8A 1K1QA 2XGPA 4UB4A 4ECUA 4ELTA 4J9SA 2ZUBA 4DEZA 9ICFA 9ICPA 5TZVA 4R65A 4M2YA 1ZQDA 8ICXA 2HHXA 5KFVA 3V6KA 8ICCA 3Q8QB 5KFKA 5HMMA 4RT3A 3OGUA 4I2BA 4KLFA 1KFTA 2ZJ5A 4DSLA 9ICNA 3MBYA 3NGDA 4NY8A 4BWMA 7ICLA 2C2RA 1L5UA 2IBKA 4DWIA 8ICRA 4B9VA 2AQ0A 5J0UA 3PR4A 3V72A 1D8YA 1N56A 4YD2A 4YQWA 3BQ2A 4IR1A 3C2LA 8ICHA 3AUOA 4QWEA 3G6VA 4ED6A 4MEXA 3ETLA 3GILA 4GC6A 2KZMA 3ZDBA 3V7JA 4JWMA 1HUOA 3QEAZ 8ICVA 5KFWA 5EWGA 3HW8A 4KTQA 3LK9A 2NRXA 1S97A 5KFCA 4DL5A 1ZQJA 3TFSA 1JN3A 2A1JB 4M6WA 4P4PA 1QSYA 2C2EA 1QTMA 5DLGA 1KLNA 3H40A 2JEFA 4QZEA 1D9FA 5KFUA 5DKWA 1AROP 4IQVA 3Q8SB 3MR3A 5KT2A 2BCQA 3ISBA 2VA2A 8ICIA 1S0OA 5DG9A 5J0RA 2BCRA 4KLLA 4RQ8A 3RH5A 3RJJA 3BQTA 2W8LA 4DOAA 3T3FA 2KFZA 4QW8A 4B9LA 4IR9A 4DSIA 4F4WA 3HT3A 4RUAA 9ICHA 4DL2A 2JEGA 5IINA 1BPYA 5F9LA 5KFOA 2PFNA 1Z3EB 3V7LA 4I2AA 3KHHA 1TFRA 2I1QA 2W9BB 9ICWA 3JPQA 3EYZA 3RB6A 4KN4A 1KRPA 7ICFA 7ICNA 3MABA 3JPPA 4EBEA 4BGDA 2Q0ZX 5CWRA 4ECSA 5DB6A 2ZTCA 3TARA 3B0YA 1A76A 4QWAA 3Q8PB 3GQCA 1KFSA 4KLGA 4ECXA 5J0QA 1J24A 4YG2A 3ISCA 4I2IA 4I2HA 1RZTA 4PGXA 2DFLA 3RJEA 4KLTA 1SKSA 2A1JA 3AU2A 4TQRA 3QZ8A 3ISDA 3GIMA 1KSPA 7ICTA 9ICIA 1HUZA 4RU9A 3RRHA 5HHHA 4JV1A 2R8JA 5KFGA 2H5XA 1TAQA 5IIKA 2ASLA 4MFCA 5DBAA 3SYZA 3RJFA 3HX0A 3LWMA 1JXLA 2R8GA 1L3SA 1ZQYA 5DQHA 1KTQA 1NKEA 5IIJA 1K1SA 2HHQA 4MF2A 4EZ6A 4GXKA 4RQ5A 4P4OA 4KLDA 4Z6CA 4ED2A 3RR8A 1JXEA 4DQSA 4LVSA 3GIIA 4BXOB 4F2RA 2J6SA 4J9MA 4ECQA 1LB2B 5L1JA 2UVVA 4UB5A 5F9NA 1TK8A 4I2JA 4O3PA 1JIHA 4Z6FA 5KFDA 5J0SA 3C5FA 4GXJA 3V6HA 2XY7A 2R8KA 4F8RA 7ICVA 4ED0A 4UB3A 5DB9A 3PR5B 3UXNA 4PGYA 2KN7A 2UVUA 4KLUA 5J2BA 4M6WB 9ICAA 4QW9A 5KFLA 4P0PB 4ECWA 1MSWD 2BQUA 4RZRA 3Q8KA 2XO7A 1Y88A 5KTQA 1IM4A 4M9GA 1XU4A 9ICSA 3BQ1A 4I2EA 4UBBA 3HP6A 9ICCA 8ICAA 3GV5B 2IMWP 2IHNA 9ICKA 2BR0A 2LYHA 2VANA 5KT3A 1D8LA 2XCAA 1ZQQA 4QZ9A 3PW7A 3N4MB 2GWSA 4O0IA 4YXJA 4ZH4A 1X9SA 1DGSA 4KLHA 1S0NA 3ZDDA 2HVIA 4HYKA 4NLNA 4DLEA 5IIMA 3MDCA 3V6JA 2NRVA 4YD1A 2AU0A 1UT8A 4XQ8A 3EPGA 5DGBA 5J2GA 1ZQGA 3GIJA 4C8KA 1SKRA 1XSPA 3MDAA 2FPKA 9ICJA 2BHNA 1ZQVA 1ZQRA 2V9WA 4F5NA 3RB4A 4DSKA 4C8NA 4JV0A 5C5JA 9ICBA 4P4MA 4F91B 5J2HA 5KG0A 4DL3A 1IXRA 3FYHA 5KFRA 3RJGA 4RQ4A 5J0TA 4MF8A 4PH5A 4KN7A 3PW5A 5J2KA 1NKBA 4JUZA 3GDXA 4M9NA 2KZZA 2PI5A 3E2EA 3Q8MA 2NRWA 5KT4A 3PX0A 4NLZA 3C5GA 3M9MB 7ICSA 4J9RA 4NLKA 3RBEA 4IRKA 5KFNA 4DOCA 2UVRA 1TK0A 1ZQPA 5KFXA 1XC9A 1X2IA 3KHLA 4DFJA 3OSPA 4DL6A 4F4KA 5J2IA 3H8SA 4GC7A 2DPIA 1QLNA 1BPBA 3ZD8A 4KLSA 8ICLA 1BPDA 3C21A 4B9UA 4JV2A 9ICVA 3MFIA 4J9QA 1ZQOA 3RJHA 1RYSA 5KG4A 4J9NA 3ZDCA 4B9SA 5D46A 1ZQMA 2W8KA 4XA5A 3ZDAA 8ICEA 3AU6A 3EZ5A 1UT5A 3RJKA 4F5OA 4GLXA 1L3TA 4KLQA 4YVZA 2AGPA 4O5KA 3PMNA 1MQ3A 4RPZA 4J9OA 2XGQA 1BPEA 5IIIA 9ICMA 9ICUA 9ICTA 3QEBZ 3KHGA 2RDIA 4KITB 4TQSA 2IHMA 4YFKA 1UA1A 3M8RA 2BGWA 4ED8A 1XSNA 4F2SA 4RQ7A 5DB7A 4Q44A 2BCVA 1S10A 8ICKA 8ICZA 1ZQUA 1ZQHA 4P2HA 2B21A 1J25A 3SV3A 1CEZA 4RQ3A 2ATLA 8ICGA 3N97B 3KHRA 3PX6A 2BDPA 4DLGA 1B43A 1T4GA 2NRZA 3MR6A 5KFHA 5EOZA 4F4XA 8ICMA 3PX4A 4C8MA 2W9AA 1ZQIA 9ICOA 3QE9Y 4DF4A 4DS4A 2W9CA 3H4BA 2ISOA 2UVWA 8ICWA 1TV9A 4RUCA 3GFKB 1JX4A 2ZTEA 2XC9A 5KT6A 4YP3A 4DFMA 1ZQFA 5KFAA 4Q43A 2R8IA 2M9MA 1TAUA 1ZQEA 3MFHA 2XY5A 2J6TA 4IRCA 9ICEA 4XRHA 2MAXA 1X9WA 3GV7B 4Z6DA 1ZYQA 4RNOA 3RAQA 5J2FA 2WTFA 3KTQA 4TUSA 4UAZA 3JPRA 3IM1A 4UQGA 2XY6A 3ORYA 3QZ7A 3M8SA 4TURA 4R63A 4DS5A 3RBDA 3RB0A 4FBUA 2FMQA 1BVSA 2MUTB 4QWCA 2ZIXA 5KFJA 1ZQCA 2BCSA 1T3NA 4RQ0A 1D9DA 5EWEA 2XCPA 4F4ZA 4LZDA 2ASDA 5J0WA 5DBBA 5D4BA 4ECVA 3PO5A 1MQ2A 9ICGA 2FPMA 4M0AA 2HHTA 7ICGA 2A1IA 4K4GA 4P0QB 2ZIVB 4DQRA 4FBTA 5DG8A 2Y1IA 2PFOA 1U9LA 4J9KA 3UQ0A 9ICXA 3THVA 2ASJA 3OSNA 4YR0A 4J9PA 4F5PA 1BGXT 4MFAA 4I2DA 3G6XA 4FS1A 3T5LA 2BCUA 4I2FA 1T8EA 2FMSA 1S9FA 2W9CB 1ZJNA 1ZQTA 2BPGA 2ZIUB 4ECRA 3K75D 5CA7A 4R66A 2Y1JA 2JNWA 1ZQBA 1KDHA 8ICQA 2DPJA 2W9MA 4MEYA 4NLGA 8ICTA 4KLEA 7ICHA 5J0XA 1V9PA 3K4GA 3M9NB 2BPFA 8ICSA 2FLPA 4CCHA 2V4RA 2HHWA 2KFNA 7ICPA 1L3VA 9ICQA 5J0PA 4RNNA 4PHPA 4QWDA 3TQ1A 4C8LA 2FLLA 4DSEA 3SZ2A 4O5CA 3Q8RB 1ZQXA 4F5QA 4XUSA 2F1IA 5HMLA 4PHDA 1NK7A 4TUQA 4EYHB 1U49A 1X9MA 2IA6A 7ICUA 3PMLA 7ICEA 4O3NA 4KLMA 2BQRA 1NK6A 2I9GA 2HHVA 8ICUA 4I27A 4KLOA 8ICFA 4Z6EA 3EPIA 3PNCA 3C2KA 1Z00B 4B9MA 5BOLA 4DL4A 4B9NA 3SV4A 2PI4A 2NRTA 5KG2A 1TKDA 3BDPA 1A77A 2VA8A 4E0DA 4ELUA 4IQTA 1T7PA 1SZPA 5IIOA 4QZ8A 2HHUA 4RPXA 3H8WA 5KFPA 5J2EA 4O3OA 4IRDA 4NXZA 4Q8FA 1JMSA 3UQ2A 1ZETA 1KFDA 5DQIA 5BOMA 3RJIA 3PW2A 4Q8EA 3OHBA 2MUTA 3RAXA 3PV8A 4JWNA 2JZBB 5DDMA 4YMMA 3SI8A 1RPLA 4G3IA 4PHEA 4RQ1A 5KG3A 5KFSA 5KT5A 2RDJA 7ICOA 3TFRA 3RRGA 3RTVA 5CHGA 3LWLA 4DSFA 4O5EA 3RR7A 5L1KA 4QZCA 2KTQA 4K4IA 2VA3A 1QSSA 4YMOA 4EBDA 1NJYA 4DL7A 1NJZA 1MC8A 1ZQLA 5DDYA 4YXMA 1ZQKA 4KLJA 5KFBA
chains in the Genus database with same CATH superfamily
2CXXA 3COZA 4HG2A 2C4MA 2HN9A 4N18A 4PC2A 3TDNA 5EWFA 1DV1A 4F5RA 1M7GA 1O9GA 2GLXA 2R2GA 1OBVA 3QENA 4QBFA 1HFEL 3EDRA 3RPEA 5J2UA 1KNXA 4GF5A 4OP2A 4RZXA 5HQTA 2GSWA 2P6RA 1RYEA 1AOXA 4LJYA 4I2CA 1I9GA 2Y1OA 2REQA 1WDLA 4I1RA 2XECA 1PEAA 3GDHA 2HHLA 3SSMA 4EGAA 3FDZB 5LQRA 7ICIA 1FFAA 3LYAA 5KFZA 5ALXA 1V85A 3IUNA 3PFHA 1GVHA 4LYHA 5A4AA 1M1UA 4FFVA 2BBWA 1A4RA 2RJNA 2YWRA 1CUYA 4ZO8A 2WJGA 1KF0A 5CFMA 2ZRQA 4JODA 5LZ4A 1CJKC 4FD2A 3N76A 4D3XA 2M1ZA 1MXFA 4PRKA 4Q3KA 3S68A 1V7CA 2YYAA 2G9QA 4FFLA 2FWRA 4KBYA 3R5FA 4F2GA 3VAZA 3BRWD 2PS0A 2C9ZA 3EVCA 3L1JA 3U3RA 2CF5A 4R8UB 4YJDA 4MUXA 1JSLA 4U7WA 2XAUA 1DRUA 4U6NA 1X9HA 4H4EA 1JPJA 3FGNA 4HDMB 4OBWA 4XCQA 4FC7A 5FD8A 5J2JA 2YV3A 4R71A 2QT9A 2Q9UA 3EJWA 2XI9A 4RVCA 3A4MA 2PSEA 5HF9A 2OXFA 1CS4C 1G21A 1SB8A 2OMEA 4MRNA 1NLFA 5JSZA 2IYPA 5DCUA 5F7OA 3JAKA 2DUWA 1YR7A 3L7BA 1VLJA 2CFRA 2A92A 4H0FA 4AKEA 1NK4A 1LBTA 1ONSA 5BRJA 3DBHA 4OP1A 2JFWA 3LT0A 5JVDA 1BYIA 4LHSA 3AJRA 4CTNA 3JQPA 3I2FA 5JADA 3LIIA 1KDTA 2I4OA 4LBWA 2HHHB 4O4LF 1SA0A 1F0NA 1IEXA 3E9YA 4RPCA 3FJOA 3TUIC 5IRCD 2FQYA 2ZFUA 4YR7A 1NI5A 3OT5A 2JH3A 3EG9A 2AJ8A 1YJ5A 3QWIA 3ZDZB 4C05A 4W5NA 1GZVA 4C04A 8ICPA 2QTAA 1U3FA 1UM9A 2IS2A 2XMZA 4EMSA 4S0XA 4HQKA 4CL2A 4BXOA 4ZO9A 1WU7A 1MQAA 2FFAA 2KOBA 5AKJA 5IUKC 2H7CA 3U6KA 4IQWA 1VC2A 4J1TA 3CJTA 1OXJA 2P3SA 1FYXA 4FS8A 1NFFA 3F5QA 2B7CA 2R85A 4NABA 3HHEA 4X9XA 2Q5HA 1U1CA 4QEKA 3CPJB 4QZGA 1ONBA 1GTSA 1RYRA 4RTPA 2A0YA 4YMWA 5AVOA 2NP6A 4IL5A 1EDDA 1O9BA 1XLWA 2BP7B 1DT3A 3CUTA 5F3RA 5AVQA 3HKCA 3RK1A 3H16A 5IJ9A 2V4QA 5IZ4A 1H1DA 3FPKA 4JT9A 2PH1A 2XNDA 2ZRAA 3EB9A 1NW4A 2Q3MA 4CW7A 4KFCA 4FILA 4NDZA 4WLUA 3RSGA 1CR0A 4JKIA 3UT5A 4YYZA 3UT6A 1G19A 2WUWE 1UEJA 4RD6A 3HU1A 4K9PA 3VSCA 1GD1O 3WC4A 4TTIA 3JX9A 1ECBA 2EFHB 1N2XA 2EXXA 1J8DA 3M1YA 2H2HA 3B3JA 3OQJA 1P91A 3T1OA 4ZCMA 3HFSA 3EW9A 3VR5H 4HMPA 3P9PA 5JC8A 3VNBA 4I2GA 2O3UA 4ZC1A 3MTDA 2KS6A 2OBFA 4JXKA 4CM8A 1HMPA 3MBOA 2Z5GA 2QVXX 5JDCC 4OLAA 3I4FA 1H6BA 2HXGA 4JR0A 5TMEA 4BFCA 4G65A 2OCPA 4XGIA 5AW0A 1ZKDA 1DOAA 5LA6F 1RWXA 2XOKD 1D9ZA 1ND5A 2QZ9A 3L6UA 3OZEA 3QXJA 1ZRNA 3KJQA 1KSGA 4B74A 5EE0A 4Z99A 2QW1A 5DTEA 2QWXA 1DK3A 3QPVA 1XQ9A 2YQEA 1U81A 2F8KA 4NENB 2JGLA 3CW9A 3A37A 4EG0A 3UPQA 3HEAA 5L1IA 1JBKA 1ZCAA 2RG1A 4P86A 3U17A 3RYCA 5GADl 1JX6A 4I9FA 2JZCA 4MR9A 1BN6A 1E61A 4BLPA 1IIBA 1Z6AA 5CPBA 1NNSA 2I3AA 4ECUA 3OCXA 5FNVB 4GGMX 1PV4A 2P68A 4ISBA 1U8EA 2PZGA 3QLVA 4PONA 1NRIA 1LKYB 4M2YA 3ZE6A 5B7NA 3G0OA 1H1LA 1RWOA 8ICCA 3T41A 2FUKA 2WHPA 3Q8QB 2OHHA 5G0WA 4LRQA 4HLQB 4JXJA 2X1HA 4DSLA 1R4AA 9ICNA 4L9WA 4CQMB 4D4JA 3ANMA 3NHRA 1VIYA 4I5FA 3OKCA 4B9VA 3OETA 3TZLA 4KLCA 4XH9B 1RQPA 4Q00A 3W3ZB 4YJ2B 2C5EA 3FDIA 1L5SA 2GZ2A 4MITA 3DVLA 3VH2A 2I5HA 5ALVA 1MR3F 2I7VA 1GAEO 2NT3A 3AEUB 2GGSA 4RXTA 1CKEA 3HW8A 1A7AA 3S2GA 1L9KA 2X3YA 2NRXA 2AGVA 4UEQA 5EKTA 2P9QA 3KWFA 4DL5A 3GEEA 3ORFA 3VYUB 5BWBA 3CUKA 5DYYA 1JKFA 1FYDA 1ZUNA 2SCUB 1A9YA 2NZVG 1EE2A 2QZJA 3AXTA 4AVYA 2ATEA 2M0NA 1JU9A 3C6QA 3L8DA 2YWEA 2G28A 4KQKA 1LS1A 5CXSA 3PNMA 4AYTA 1CBUA 2CLKB 4DBLC 1LZLA 2PH5A 3TBHA 1VXOA 3AHFA 4F56A 1A04A 4KLLA 1JLHA 4XCVA 2AWNA 2Y27A 4Q15A 1LU9A 3E15A 1E9BA 4H0CA 3SZ3A 3TD2A 4OL0A 1XALA 2DECA 2YXPX 2NZ8A 3MWYW 4TKVA 5BN1A 3D3JA 3DA8A 1UZLA 3HDJA 4HI0E 3NNNA 1LDMA 4EPYA 1NUHA 2GK3A 5A06A 1H42A 5ALEA 5IINA 5F9LA 1J2YA 1ISGA 4CCSA 1V26A 1WOMA 1GRVA 2VYND 3PX7A 3RB6A 1VIVA 3RJMA 4DLVA 1PJCA 1RAHA 5L8VA 4MUAA 1DLIA 1SOMA 2E3JA 4KPUB 4NYIR 3FYUA 3KFUF 4RQUA 4ALNA 1NQOA 2AEJA 4B31A 4R1NA 4OK6A 2C00A 3AEQA 1M54A 3MCUA 2XXJA 1QC5A 3KVVA 1PQPA 2EAPA 1TVKA 2D0DA 5BYJA 4YG2A 4M9RA 3A4NA 3NB0A 5HQJA 2O8DB 2V7QD 3NHPA 2G09A 1SKSA 2FPIB 1YB7A 4PEVA 3S1AB 2AKYA 9ICIA 1D1TA 1LKYA 1PVVA 1QAOA 4LJAA 2WE8A 4WASA 5BWOA 2HJ9A 1GPBA 1LLDA 4HQFA 1W19A 3VSDA 1SC1A 3ONWA 5EWMB 3SE7A 4UFOA 2H5XA 1TAQA 3ZHVA 2ASLA 4HB0A 2BR4A 2EX4A 4I1UA 3L4JA 4HVTA 1K8RA 1N9GB 2WU0A 1JXLA 3C87A 3EPRA 3CP8A 1ZXXA 3RTAA 2JFUA 5AHRA 4EVRA 4ZI7F 1WM1A 1AGRA 2EZ4A 1E62A 1RCFA 5CB4B 2Q27A 3H2HA 2H51A 4L4SA 1JR2A 2O7NA 2YXEA 4G5OA 1T0HB 5IMBA 3D6VA 2FW6A 3DVSX 3LC7O 1O6GA 1SVNA 1SKMA 1L1EA 1MH9A 2C9DA 2J6SA 1GXSA 1OX5A 1QYRA 1ZP6A 2RH9B 3NOXA 5HG0A 3LZCA 4GXJA 2ZUFA 4WPGA 1RWQA 2GOYA 2JBWA 1QHIA 2BEWA 2R62A 3SN6A 4AQYB 4G5FA 3OEWA 1PZFA 4DLAA 2O06A 4UEKA 3G1WA 2RJOA 1SIJA 3ORHA 3PZBA 2JH1A 1UPBA 4JDUA 3AR7A 1I1QB 2J6CA 5G40A 2LDBA 5CDYA 1K5HA 4MV7A 4KR6A 1ZMOA 1OB5A 2PKYX 3O74A 2BEUA 5H9WA 1OH8A 2QTWB 3QA3E 5H8WA 3BTUA 4HGYA 5J4LA 4GOLD 5BV1A 1B0AA 4NEGA 8ATCA 3LQ4A 5GOZA 2R6DA 2V9CA 2E87A 4INAA 5BMOA 3L7JA 5HGXA 1O4VA 4NVRA 4KUHA 3J81k 1HNWB 4CKZA 4CLOA 1KBQA 3OM9A 4DIUA 5M2QA 4O0IA 1KP2A 1FK8A 4JJIA 3PJFA 3PUIA 5CU7A 1JZQA 2DUMA 4W5HA 3NUGA 5IEBA 2J48A 4V2IA 2B9EA 3QVVA 5LZ7A 1KO7A 4FWBA 4QECA 5BUCA 4IILA 5E2BA 2Q1WA 1UT8A 1T5LA 2QLFA 4KTTE 1IWBB 4WK0B 5F73A 3SHQA 2ZJ2A 1HEYA 1N2JA 1PWXA 2FTKE 4CNQA 2FRXA 2O2DA 3FC4A 1GCOA 1MZVA 1XQYA 4G24A 3UAWA 4EHJA 5ABPA 4RKYA 1JILA 4FB4A 1ZHHA 1Y33E 4B4KA 3T5MA 1DK2A 5C31A 1U99A 2PMDA 1XEFA 2VKTA 2JLUA 5EI5A 3N8NA 1SCNE 4EIWA 3F9RA 4OXIA 4TZ0A 1IEWA 1NR1A 5J0TA 1ESCA 4JLNA 3RV3A 2ZYVX 3O26A 4L4XA 1IHPA 4ZAXA 2WSIA 2R1VB 1NKBA 2AJBA 2XGMA 5JZMA 5D87A 3ANNA 1Q1NA 5D01A 3WGVA 2O0KA 1MENA 1A2OA 3PUJA 5SYAA 4CKWA 5LLTA 1Q14A 2ZXEA 3P0IA 2YV4A 2O3RA 1T36B 2FGJA 3K2IA 4HYTA 1SOVA 1CULC 5C8YB 2OQ2A 1T0IA 3M4JA 4MUNA 2VDPB 1SN7A 2MOKA 2C3UA 5A62A 1W7AA 3H2JA 3T3MB 3UJBA 4YAWA 1WY5A 4OP3A 1EQUA 1QHEA 1OAOA 1VHJA 3PQCA 3ZD8A 4EYOA 1XLVA 2Z2XA 3N3AC 3N86A 2UYGA 3O8QB 4IDEA 3RS9A 4BVBA 4CVNA 4DYHA 2XGOA 3SM3A 5GJCA 2E8PA 1EDBA 2YNMA 3ZDCA 3B53X 4PPGA 3NRWA 1ICEA 1UWLA 2NPIA 5IT9A 2CMDA 5K2OA 4Q4AA 1YZHA 3DOIA 4ER6A 1QE5A 2ZYWX 3AM3A 3V1UA 2QRPA 3ZDYB 3JYLA 3HSSA 3X2SA 1DAHA 3FCAA 4EA7A 4HZGA 4AS1A 2OEHA 1MQ3A 3OO1A 5FPYA 1X8KA 1EXVA 1Q0PA 2C57A 4QO8A 5DTMA 3UH0A 4TPKA 5ILGA 5LD2C 1FC0A 4V38A 4OBBA 1SIUA 1XSNA 3H2SA 3OTWA 4I55A 4P2HA 4P22A 5JYEA 4HGRA 4BAGA 1DP4A 1RJGA 4TZKA 5K3DA 3FKSD 3PX6A 4QPPA 4HWRA 3R9KA 1QG2A 4LJ7A 5TJHA 5HF6A 3M70A 4ZZIA 2J7KA 1AZLA 1E2JA 2C97A 3VO2A 4BNVA 5FTJA 1H2FA 1H93A 1QIGA 2QTMA 1VE1A 3QEJA 3N2LA 3Q85A 3F8WA 4OSOA 5CYFA 3G8AA 5CPFA 4CR8A 2DTXA 3RYFA 1KQOA 1NP6A 3NOQA 4MQMA 4G0WA 2AKAB 2ZJ7A 4PLWA 3ZHXA 4D98A 3W4JA 4CV2A 5CD9A 3HNPA 3L1UA 1UT6A 1V95A 4XYEA 3ZKWB 2YJTD 5LYJB 1LLQA 4AQDA 1J1ZA 3SZLA 2I4NA 2WTFA 1JHYA 1QG4A 2QZPA 2AJDA 4X1YB 5T4EA 5K6RA 4DV2B 1J4AA 2ECQA 4HLUA 1YL5A 4AQ7A 3K35A 4RLSA 1J39A 5KFJA 5ALDA 2C5LA 1OC4A 2V6BA 1YFLA 2V7UA 2XCPA 3JQ9A 4W7HA 3EA4A 3CY6A 4II3A 3SF0A 4AJ2A 4YCMA 2QK4A 1NN1A 1GTZA 2WUFA 4ND7A 5SZHB 4RUKA 4OQPA 2YN0A 3QOFA 1UC5B 4DIOA 2ZWAA 2I54A 3W5AA 4CMKA 4L78A 2YHBA 3N7PD 2GVDC 4ZP1A 3AQIA 1BE0A 2XIQA 1Z12A 4HWTA 1YVUA 2DZDA 2FSFA 3UFXB 4EI2A 1N77A 4KX3A 2F8TA 1PVPA 2IZ7A 4JX9A 3F4LA 1C8KA 2QYTA 1U63A 1BHQ1 4MIYA 1Q0UA 1YB1A 1JXAA 1FMJA 3KP1A 5L3SA 3TVTA 1AB6A 3WA6A 4MPJA 2AE1A 5CA7A 1U0OC 1XDWA 4D4MA 1STOA 1PR2A 4LQDA 3V32A 3N6RA 3OD1A 3DQZA 1NF3A 1C1YA 1XU7A 4KLEA 1RWMA 1Z9BA 1TMGE 1ZIOA 3FI0A 3R77A 1KFEB 4URYR 3M6UA 3UGTA 4PGGA 4YCBA 1P0PA 2YV1A 3FROA 1L3VA 1CUAA 3SXJA 3HCOA 1E3MA 2ZWVA 2H3VA 2PGAA 5JSYA 3CN9A 4EPTA 4C8LA 1UQRA 2J4CA 1KEEA 5EIOA 1X70A 3H4TA 3OUTA 1XQ6A 2NQTA 1W2GA 3OPYA 4MCHA 4W6ZA 4Z0PA 3L1VA 2GK6A 1EX7A 4B79A 5B2EA 3I4LA 1NDQA 1M2HA 1HOTA 4NYJR 2DTDA 2TECE 2VP5A 4F96A 3NYRA 4X94A 3FPAA 1G5HA 1R37A 2IHBA 4YDHB 5EQFA 5FWYB 2IOHA 4C3ZA 4Z7QB 2JR5A 4UE3S 3O9MA 4HQLA 4DL4A 5ALZA 2K8BB 2PI4A 3T6KA 3N7RC 3T3NA 2XOEA 3WHKA 4KVGA 4ELUA 3V8EA 3Q15C 4P53A 1GLGA 3HKZC 1GQQA 5JFTA 4P08A 2QUZA 3EGEA 1OILA 3KJXA 4B0OA 1HEIA 1LVGA 1D2EA 4R4JA 4NXZA 4R8KA 2GRAA 2QRKA 1UXOA 4DUPA 5JAHA 4ZPXA 1HSZA 3KU1A 4LSMA 5SICE 4RWEA 1DXSA 2MUTA 4JWNA 4PYJA 5K6AC 2I3ZA 3PQEA 5EQJB 4Z7OB 4FNAA 3WFIA 2WJ3A 3CLTD 1UBOS 1UKVY 2PNJA 1Q3VA 3T7SA 1DEKA 4WZAE 4LECA 4BHTA 4E70A 4RQ1A 1II0A 10MHA 2I6TA 3P8ZA 1A5BB 1AGNA 4OHCA 1EMDA 2GKOA 4ZQFA 4LHWA 3ZZUA 5L1KA 3A3PA 4H1UA 3ZBQA 3ZXSA 1R0CA 1GZDA 4EY5A 3UWDA 2OT3B 4BFWA 3N2IA 4C5CA 2PXCA 4EBDA 1A9XB 4J1TC 4K28A 2VTDA 3UHOA 3G5TA 3RT7A 3AF6A 3LA8A 1T9BA 4X1IB 5GJWC 2AFHB 4OXKA 1T9HA 1XK6A 3NYWA 1QYDA 2DUUA 3JATA 3N6XA 4B6QA 4FM9A 1A9ZA 4ITVA 2P2ZA 2Z6VA 4NG4A 5KQSA 4PFSA 2V0GA 5JU5A 4YR3A 3EOBI 4TRMA 2G08A 3COVA 4OREX 3STWA 2DPXA 4B6GA 2HKIA 3T1NA 1BA3A 4MUHA 4RPKA 2VQFB 4BIIA 1T9AA 3B1KA 1R12A 3WRXA 1HLFA 1SC4A 2GCNA 4EMTA 4HTFA 4ZN6A 1E1KA 3N75A 2AGOA 2IYSA 4R9RA 2VLIA 3CGGA 4FR2A 5AOAA 2IV2X 4J29A 4JOQA 2ZUUA 4ARBA 4Y2PA 4BE4A 5L51A 3KQLA 2RSLA 5MHTA 1FRNA 1BW9B 3LHIA 3C39A 2AZMA 5JTIA 1VYHA 2JGIA 4JA0A 2HO5A 4LZJA 4DLWA 4QARA 4JUFA 3K2EA 1TJNA 1KJJA 5HK9A 4JK1A 1IM5A 1C9KA 3PR2B 3P9ZA 4K0RA 4RZSA 3SOPA 4CDRA 5GZ3A 2J3MA 2GFHA 5C4GB 4EY4A 1M6WA 4LX8A 5DBOA 1EVYA 4HHEA 5KG1A 1KJYA 1P17A 1JHRA 3SWWA 2BMDA 1WW8A 4A0FA 3IRVA 4CIVA 1JAYA 4U2FA 3WLEA 1MN6A 2NTYC 2BF7A 2CLOB 1X1BA 4K0KB 3BILA 4Z3DA 3I5YA 1EEXB 1BPZA 2ZTDA 3OX3A 3R9IA 2WB2A 1M0EA 1FVOA 4YR2A 4A23A 4GQIA 5AESA 1N5KA 1KBOA 2EIHA 7MDHA 4RVHA 4DBZA 3N53A 3O8BA 1PKEA 2CRXA 1NSTA 5KYUB 2Z95A 5DBFA 3T9DA 2I6XA 4A82A 5EZ6B 1F7VA 1ODKA 2C1ZA 3AW9A 3BHIA 1GTVA 2HHJA 4OQZA 1GAXA 4Q9AA 1ZQAA 1C20A 5AH0A 3QI2A 1C7EA 3UHAA 3ZBPA 4JBGA 4QULA 3FNIA 5T4HA 3TVYA 3FWPA 2YFQA 4YP0A 4KU4A 3SAJA 4NBTA 4FDVA 2P1ZA 2XT6A 2M9NA 4MLPA 4I66A 4IS2A 1ZJMA 1RI5A 2PD6A 3JVDA 3DEKA 1MV8A 1XWFA 4BDPA 1M2WA 4UAWA 3H5VA 5JNSA 2ZZMA 1TK5A 3ORRA 1L1RA 3M6VA 3AFNA 3RWMB 3AEZA 3UJ3X 1G2IA 1SKYE 1MD9A 2XQJA 2AYXA 1PK9A 4NK5A 5AMXA 4LUCA 2R1UA 3W7VA 1RJWA 3HV2A 3NBZC 4EBCA 3HC7A 1Z3CA 1UK9A 2A3NA 3KYDB 2FK8A 4NE9A 1GKKA 2I8LA 3NBMA 3W9YA 4BAZA 1AKVA 3W3AA 1Y3FE 4RMJA 5J0YA 4ZVMA 5E38A 4ZQBA 4BNNA 1P33A 4AJJA 1LVHA 1SUWA 4TTTS 2HCFA 4RTKA 4NCBA 3ENNA 4BZWA 2ZJ6A 2JARA 3ZGOA 1Z8DA 2BLLA 3D7RA 3G0BA 1U2GC 1GP2A 3HKZF 1TKAA 2BFWA 3MGBA 4J9UE 1M2VB 3VPXA 2YB1A 4MHSA 2WU8A 2E4XA 5CB1A 3D4IA 1SVSA 1ZJZA 3KSMA 3HR7A 4R64A 3K2QA 4HDCA 3TW0A 4M9XA 3GJ8A 4BX0A 4LMAA 4F45A 4IH1A 4QSMA 3ZHZA 3CCBA 3R6DA 4N6NA 5CRIA 4ZQCB 1DJOA 3E23A 2VSYA 1W5EA 4ITUA 2JGDB 3VYTB 2O2ZA 5DLDA 2PEYA 1X80B 5KAMA 3PNOA 4RGBA 2NSDA 4P4NA 3LHDA 4U3JB 1X2EA 1JR3E 3ZIAA 2PMFA 1G60A 1VKNA 3G2MA 5CX1B 5F1KA 4ARAA 5MFPA 1C7YA 1WIWA 1U2ZA 3HU2A 3AU9A 3HYSA 1KZ1A 1RC0A 4Q7EA 3VNAA 3ZWNA 1U04A 4BLUA 5JCXA 3U5TA 4RY8A 3BMCB 3ZNNA 5B4VA 5I9BA 4MUYA 4JQCA 1ZQZA 2YHIA 1KQFA 1LEHA 1NQXA 2R00A 3KOWA 4H4DA 4HGZA 2I6QA 2XTNA 3H5WA 4C22A 1K7EB 4OJQA 3G0IA 2DR2A 4LGVA 3ISJA 3VJLA 2ZYUX 1MPXA 1HR0B 3A9UA 4QTXA 3P7MA 3OMXA 2CMKA 3L06A 4G4SO 1M10A 3CRW1 2XWQA 3JQCA 2WYWA 3OLVA 1KVUA 2YV5A 1U3CA 3CWQA 4IYRA 1F4PA 3SXPA 1XS9D 2R4UA 4ENWA 3MTBA 2CYBA 1S2GA 1OUMA 5ERGB 2WPNA 2GWHA 3V4LA 1TZKA 4PPXA 2O2HA 4RVUA 3DVAB 5G3ZA 1XKQA 5IZCC 3WLQA 2R96A 2JIMA 5EFZA 1YCHA 2PKEA 2XGPA 3G0CA 3O4VA 3ZJ4A 2G6TA 5CG1A 4MINA 1M2JA 4UTVA 4A6XA 3AIMA 1UKEA 4H08A 1KEVA 5KNCA 5TZVA 5E79U 1U3VA 3T4PA 4K46A 3OJEA 8ICXA 1NKVA 3EGXB 4IUDS 4KVFA 5KOHA 5LU9A 3ZIUA 3NS7A 4TYMA 5DTIA 2FR0A 3OJFA 3I2HA 1E2GA 2IU6A 4KLFA 2H00A 3A28A 3H9GA 4R7GA 3A1WA 3BS5A 4ER3A 3BIXA 1YJ8A 4WCDA 5D7NA 4Y18A 3K0KA 4F5EA 1PWEA 3VNVA 4EW2A 2JCSA 3RROA 4BC0A 1N56A 3OA0A 3GFPA 4MS1B 4C76A 3P9YA 4DPLA 1BHJA 1F8UA 3AUOA 1PQYA 1VGVA 1VLZA 1ZSYA 2FMTA 7ABPA 5LP6F 3F6PA 3TEFA 3VPDA 3RKSA 3GV0A 4KQ2A 1MPTA 3ZI0A 1S97A 1SXPA 5LP6C 3B7WA 1IPHA 1AX9A 5ER9A 1ZCFA 2YDYA 1D0VA 2E21A 3BDAA 4MVJG 4U2EA 4D8TA 1RRFA 2UUOA 1T8SA 1LPMA 4TKUA 3COJA 4MWOA 4C4SA 3EAGA 4DA8A 3OI7A 2Q8NA 1Y34E 3I04M 2DPMA 1L5HA 1BHSA 1WD5A 5J0RA 4DV7B 2ZEJA 3D8HA 5AVVA 2I6UA 4AN1A 4TM7A 5LC1A 4G0VA 2F43A 2A33A 4B9LA 3DMGA 2QSYA 5TGDA 2FJUA 1GQ2A 1A2QA 1CRPA 3UAZA 4RUAA 3G5AA 4FNGA 3U81A 1RFLA 5LXTB 3W5VA 3T5CA 4OJNA 3MGAA 4RO0A 4I7EA 3ZU6A 2Q6OA 3JAKB 2MSNA 2C2OA 2DM6A 4MKHA 3AESB 4WOCA 4IGFA 2FZVA 4UQLA 3I83A 3MWLA 3JPPA 3T1VA 1WHSA 5IDVA 3FFWA 1ZD8A 3FN4A 3NFRA 2E4WA 3K4HA 2ZTCA 2BBOA 2AA3A 1ZIYA 3IX7A 1NPTO 3W6UA 4QWAA 1YZYA 2AJLI 3R5KA 3HSYA 1UAGA 3VDXA 4CMBA 1LC0A 4J1QA 1KXJA 3W3AH 1MMFB 2NWQA 2OBYA 4BATA 3ISCA 4DQVA 3HN6A 2E5LB 2JATA 2FUG1 2WWXA 3AI3A 5TEWA 4EPWA 4CIYA 3Q7EA 4YP9A 1M0TA 3EGDB 5HE9A 3RYFB 2Q1UA 3WRYA 4F38A 4RZQA 3UFBA 4EB0A 3F8SA 2BP7A 3DMDA 4YP1A 2QUAA 4D8VA 1ZD5A 1DG1G 1ZD9A 5IMSA 3WGGA 2C84A 4C6RA 2PPVA 1MU0A 5AJUA 5K3AA 4JOSA 3RVOA 3ZV6A 3AVOA 3L9XA 3JVIA 4C3UA 1B6TA 3K3PA 4IOKA 4ZI5A 5A05A 2XCTB 4PTLA 1P8AA 1IU9A 2HB6A 4UOEA 1N1GA 3RTBA 2W71A 5KQGA 4WBNB 3GFRA 5AM3A 4PY2A 3CPHA 3PEVA 1CUGA 2A59A 2YJ5A 3E2IA 1IQUA 3GWGA 3EF1A 3BM5A 3D5TA 1PBNA 4LWQA 4XEUA 3SP1A 3TZKA 4P3XA 1RZ3A 1FY2A 1IY0A 2WHYA 3DUFB 3GPDG 3ITDA 4H9GA 4OMFG 4MI6A 1TO1E 3IV9A 1ZVJA 2IYFA 4I2JA 2XTZA 3C5FA 1FNDA 1QYXA 1T0BA 1IC6A 1NVUQ 4X00A 2NUAA 2CE2X 5BNFA 4PTZA 3OY7A 4DCJA 3V80A 3EYAA 4FCTA 4XGRA 5HIAA 3PR5B 5TQVA 2XODA 2FRVA 3UCFA 5AYVA 2W3RA 1O6CA 3JALB 4KWEA 5C8YF 5KAIU 1UQVA 2IUSA 2QLJA 3U0VA 5JXGA 5CJ2A 4UAVA 3C5HA 4Q7JB 3RSQA 4YT8A 2VKQA 2JI4A 4RU1A 2X19A 4BO3A 1Y88A 1IM4A 2KLHA 3VJRA 4BZZA 2ODTX 5HRAA 2UYOA 3OCUA 3HP6A 2ZAMA 2IMWP 2PRIA 4IZ6A 1Z38A 4R8VA 2RGNA 2LYHA 4FDUA 5DM0A 4X20A 1YQXA 1E4OA 2P2DA 1FDUA 3PVZA 3W78A 5BSWA 1H2HA 3OTHA 3V4RA 2CV2A 2ZBDA 1CHNA 3SKXA 1VHDA 1GA6A 4OQFA 4BO6A 3LLSA 2HVIA 2XNSA 4XRRA 3SR0A 1C1XB 2B36A 2CVPA 3QKIA 1YZTA 4TROA 1KBUA 4IXNA 3UWOA 4IF4A 4Q1DA 3RVMA 4M9SA 4ICAA 4GSLA 4JSRA 4DLXA 2GXAA 3T06B 3HS3A 4IUYA 4NF2A 1NG9A 3O75A 3OHMA 5BR1A 3HK2A 2FXVA 4TTVA 3D59A 1OJ7A 1ST3A 2ZYDA 3E1SA 5E3JA 4D46A 2Y9MB 5K5EA 1YAHA 2O8CA 3OFND 4KXYA 4JWTA 1K5GA 1OV4A 3IB6A 5EXSA 3MLBA 5FWXA 1HSOA 3ZKAA 4YXFA 2FW0A 3M6AA 1NJGA 1ZNYA 4HXEB 2UVPA 1YB5A 1O5TA 4GXTA 4WMLA 3RT1A 5UKDA 4DDMA 4B9EA 1C3OA 2IHUA 1U3WA 4JLOA 3GUUA 1Z37A 2J3DA 2ZRKA 4OB7A 1PR9A 3DJFA 3SI7A 3W06A 1UOOA 3BOSA 4IVPA 2CF6A 4LY0A 2WF9A 3VA7A 5JECA 2R1ZA 3OP1A 5KFXA 1TOAA 4HDNA 3BK1A 4MRSA 4RNCA 1HI9A 2WP0A 2IPLA 4LSGA 4X84A 4ALMA 1KHHA 3IESA 2P2YA 2IOQA 2YWCA 2DPIA 3EDYA 3LUHA 3X3HA 2A86A 4RPJA 5JAUA 3KL4A 3D1JA 3BRSA 3ICCA 1OSNA 2QP3A 4RHYA 4C78A 4J9QA 3EMKA 2W22A 5I9MA 4OAOA 1U8CB 4N7BA 5AKYA 1ZQMA 1LK0A 1VHLA 1VOTA 4UCXA 3SHWA 4Y1GA 3U09A 4WN9B 4GLXA 5FNZA 4XR4A 1G6HA 1RYFA 2ZRCA 3F4KA 4S1NA 2QRQA 4L85A 1BFUA 4K8OA 5TT1A 3OTIA 8AT1A 3WQSB 3U4DA 2WAOA 4ZQGA 3ZS8A 3TQRA 4DUYB 2PQ0A 3MGKA 3V55A 2G72A 3VC7A 3WLNA 1JBEA 2ZIVA 4ENRA 1H2XA 2PZLA 721PA 1T1IA 4EG1A 1VIDA 4RQ3A 1Q1AA 1NUTA 3EUWA 2QD5A 4E5SA 2TMKA 1QKJA 4ZMRA 3IEVA 3UHPA 2ZSDA 2ZIGA 4F1WA 4F4XA 2W2XA 5I7EA 4OQYA 1ECCA 2JFOA 4ZARA 2VDKB 2Y05A 1NONA 1NV8A 1VFNA 2B1GA 5FNVA 3W77A 5HJEA 3PXGA 2DP4E 1UAAA 3U4CA 3V7WA 1KAHA 1KH1A 1ZM9A 5KT6A 4YP3A 3JQ6A 5HUHA 2FWNA 2IY9A 5FO1A 1Z68A 4L6AA 1ZQEA 1PX2A 1UBJS 2Q4EA 3IOBA 4Y2VA 1N2SA 3D54D 3K1AA 5DXAA 4C5AA 5IJAA 1URPA 1Z7EA 2CJFA 2QIOA 2KWIA 3L04A 2LP4Y 2W8ZA 3EFEA 2JL1A 1BX1A 5JFOA 4R63A 2QTLA 3AYZB 1BVSA 2Z5LA 3CLHA 5E2IA 3PSHA 4MA5A 2F9LA 1UHUA 2CYCA 1QCKA 2GBCA 3B2EA 2RHLA 3D0KA 3THSA 4EGFA 1E5QA 2A3RA 3W2GA 1CZRA 4ECVA 1HRKA 2CL7X 3OFJA 4MUMA 1FW6A 1JRLA 1MIHA 1GPDG 4PO3X 1UMDB 2YFKA 5L7YA 4YQFA 2CJWA 2A0FA 1MO4A 2D00A 3G2JA 5F52A 4EB6A 4F3NA 2MU1A 1OOEA 3A9VA 3LKVA 4QRDA 5LZ8A 3W3AD 1QAQA 2IGTA 4Z53A 3UQ0A 4UJ3A 2HNKA 3EASA 4V02A 1YK0A 5FB3A 2AOUA 2BCUA 3QVOA 3O73A 5JISA 1AKRA 1NBAA 1T3GA 2OCDA 4M88A 4Y30A 3MQ4A 1F1BA 1HKUA 5KU7A 4PQEA 3W6NA 4YJFA 2VSXA 3I1IA 4X45A 4Y7DA 1G64A 1UWVA 2F3UA 3C5EA 3QPDA 3SYRA 4Z2YA 3GFGA 2G06A 3R7NA 5IVIA 4IGAA 3GFSA 1Z5PA 2QYSA 4RK7A 3BE8A 3P94A 2DKZA 4OAPA 5CM8B 3EF3A 4CT4B 1VJGA 2M6RA 3NBQA 1BXGA 3L8GA 2JA1A 4O5CA 4OJ5A 1J42A 4OIFA 1DCKA 4S35A 1WY7A 3UB4A 1FDWA 3ICPA 3PHBE 4I4TB 1Q74A 1RC8A 4Y2JA 2AUTA 1Q3HA 2NSHA 2P9ZA 2NN3C 2Y0SF 2HQ1A 2DY1A 4EMBA 2XYRA 5FOQA 4MWZA 1YKFA 3NHYA 4HX9A 4N3NA 4D79A 1CY7A 1B8NA 5K0TA 4IHKA 3MJEA 2VQEB 2HL6A 2IYWA 1PK8A 3H0CA 4WI1A 4Q1EA 1XAIA 2ZIEA 4IV8A 4R1SA 4ANFA 4DV0B 2R11A 2I66A 1RDFA 1Q44A 1GGMA 3AINA 5FTWA 1WWKA 3VHLB 3H8WA 4GOKA 3K71B 1XQ1A 4UHFA 4Y2XA 5BMVA 3UMYA 1MG0A 2PNFA 4ZOLB 4NCKA 4O5OA 1RI3A 2O3SA 3EUAA 2BY4A 2PGLA 4C0BA 5JBIA 4L5IA 4Q8EA 1ISFA 3OHBA 1T2VA 3G8CA 3P9SA 1XCOA 4G5GA 1ZNQO 5FIUA 3VVBA 4EFMA 2IH5A 1LBIA 2EBWA 2FP4B 4CHGA 1RRCA 2FMUA 2DWOA 3DQQA 5KFSA 2HJRA 4M3NA 4BGEA 1M83A 2Q0HA 2FR1A 4MQLA 5IKMA 3N2YA 4D81A 4WKCA 4WIAA 3HCWA 4KHZA 2L82A 4NK4A 2J3KA 4NLBA 3TGPA 3JU3A 2QKYA 5I7WA 3N87A 2ZQZA 4IGKA 5H59A 1NJZA 4JVLA 4CLHA 3LO5A 5CGQB 3PEWA 2VDRB 4JVSB 1U6JA 2LNDA 4LX0A 2PFQA 4MQFA 3SHOA 3JQ7B 4FYIA 1EXNA 2CXRA 4GE0A 2OVBA 2BWJA 3IHKA 3BQ0A 1SXJB 3IKLA 3AMVA 3K7EA 1WVIA 4QYXA 4F4JA 4YFVA 1IVYA 1C2TA 4O0LA 5E6SB 3VKWA 3EC1A 4HOYA 1UAYA 1GZHB 4C0LA 1YNOA 3IHQB 3MC1A 2EBHX 1X8XA 5T8KC 2FRDA 1XTIA 2NLOA 1T10A 1S02A 1E0DA 1XJ0A 5CP2A 5HSGA 3R0JA 2H85A 4A0GA 3AHHA 1TPYA 2OWEA 4XPZA 5TE9A 2IUEA 3VMMA 4TUPA 1L8QA 3LVRE 1XSEA 1QQ6A 3W8DA 2XMRA 1ZHOA 1A7KA 1XJ5A 2PLNA 2PWPA 1Z8NA 3HVUA 5L3ZA 5GAJA 3S27A 4RQBA 5TGTA 4EENA 3E3NA 5D6NA 2XBMA 2BFDB 1YQWA 3PWTA 2C5BA 4JLPA 2R6FA 4FQ8A 4D8UA 3KKAC 5IFKA 2Q6KA 5IVHA 2HDNB 4PZUA 5B1SA 3IGFA 4RJKA 4IIJA 3ZXUB 3LGAA 4YMTA 1I3MA 3DVRX 2EVWX 3BMQA 3F6RA 2FN3A 2C7PA 2WTNA 1H38A 2QA5A 4QGAA 2FDCA 3PNSA 1UMBB 5ALYA 3H0KA 3W5BA 1VQ1A 3MCZA 4Y0VA 3EEYA 1CQIA 2HJHA 2WMOB 1YV9A 3K0AA 4EX7A 3E2EA 4YV0A 1RZRA 4FIZA 4ARCA 1H22A 1TTHA 4ZICA 1G7CA 4CEJB 4OJOA 1LPNA 1NUAA 2FJPA 1O95D 4FWIB 4HPJB 5EVJA 2PZ8A 2B7BA 2QVLA 1JZSA 3MR2A 3DBOB 1EM8A 2FEMA 1RI2A 2ODPA 1O5IA 3IE1A 2R5WA 4BBAA 3GCWA 2UVPB 4R31A 3SQOA 2HA7A 4HUQB 4E15A 2NVOA 3GHHA 1J22A 1T5OA 1FDIA 3K9FC 3P20A 2G17A 1BVUA 5JROA 3QBJA 1NJWA 3KOZA 5BYBA 2Z8YA 1K2WA 4ICIA 5K4LA 4BO9A 1EK0A 1BE6A 1J00A 1HFWA 1Q91A 1Z7YA 3FKSA 5CVCA 3I52A 3MCTA 1PG5A 1J23A 2EX1A 3AZOA 4I8DA 3WYNA 4BZXA 4J7AA 2VBCA 2W2VA 4CFSA 1HQDA 2GN8A 5EUBA 1F38A 1ISHA 1ICIA 3A6KA 4GG1A 3RVDA 1SXHA 4NM2A 1U6IA 3F6EX 3DS8A 2FUNB 1GYPA 1N2OA 3RUFA 2IXEA 5JJKA 1XX6A 3DF9A 4LZNA 5LA6B 3REFA 3INRA 1CK4A 4F93B 2FZEA 5FX2A 1K9SA 3R8FA 5ALOA 1I32A 1PYOA 1COOA 3EEQA 1E96A 1BEUB 1V16B 4LZWA 3IJ5A 3V5NA 1DHTA 2DQNB 1TD9A 3O4HA 5HA5A 3Q5EA 2VJBA 4EL5A 2MU2A 2B6HA 3V2IA 4BKUA 3KU4A 3Q12A 4OJLA 2BQ3A 2CFOA 3DZDA 4IPTA 1L8AA 1ZUNB 2DWPA 2IGBA 1CY6A 2SCUA 3JQFA 1BNPA 3VTAA 5DI3A 3RFFA 4M9ZA 5GZ1A 3ZVNA 3JALA 3N05A 2AD5A 2NTVA 5ARBA 1M73E 1HO3A 3ENQA 1QH0A 5HRUA 3EC2A 5KSPA 3ESZA 4NCNA 2ORVA 4ZREA 1GITA 1NJSA 2LKYA 3GHYA 3KLBA 5GGXA 1UMBA 2Z9BA 2IEZA 4FFBB 1QIIA 4RCZA 5AVWA 1L5OA 2DKFA 1FRFS 2QSZA 4JI6B 2KHQA 1IB6A 2ZSUA 3FR8A 3PQ8A 4LRXA 3C5CA 2VP4A 2IA5A 3PEEA 1I1HA 3PFIA 4J0QA 4R3NA 8ICYA 4D57A 1NNI1 1L5RA 5DLPA 1SK8A 5IVDA 5CRXA 5TQJA 4BEWA 2FZGA 2Y67A 4NM1A 2DQYA 4R8UA 1UWCA 3BE6A 4XIYA 1Z4LA 1Y3HA 1RPAA 2VPQA 4L8LA 3VX3A 1QKIA 3C48A 3IVAA 1NFQA 4NMWA 1KZYC 3KIPA 4Q3OA 2YBDA 4HCJA 3HJEA 1EX9A 4N76A 3QLUA 2DAPA 1EBUA 3Q5DA 4RH3A 2X6QA 1R6VA 5BWLA 2UYCA 3GZFA 2HRZA 3QLEA 4F6LA 1ZQDA 3RC7A 2VF8A 3SC2B 5JAPA 2F9FA 4E11A 3CHYA 3ZV3A 1L7EA 1LW6E 5GTHU 3E3MA 3EXG1 1KFTA 1B8PA 3OGUA 1NJ2A 1Q7RA 2I2XB 4PCUA 5BQOA 2Q5EA 4YAEA 3UUFA 5FTKA 4D3YA 4LZAA 2PU7A 4AF8A 3G5LA 3WO0A 3FUWA 2GN1A 3UM9A 5KNIA 3PR4A 2FLWA 3FDJA 3SHVA 1Z74A 3ZE7A 5ESDA 4LV6A 4U6QA 4YQWA 2B7LA 2YWXA 3LCMA 4GKVA 3IIEA 1CUIA 2HSEA 4GRDA 2E3TA 3GILA 1H3FA 4GC6A 2B6NA 2WU4A 3FTDA 2H2WA 1JA0A 1HUOA 1S3FA 2J9GA 2ODAA 1CY8A 1WX1A 1QRAA 2M6SA 2XA2A 3DXYA 3ZX5A 3CX7A 3MAGA 2E1EA 5HR7A 4PGAA 5DM2A 2A1JB 4M6WA 1B76A 3Q10A 1JSZA 1QORA 4QZEA 1RT9A 4NPHA 2HPHA 1Z13A 1KQ3A 4ZMBA 2PLRA 1N6HA 1YT5A 5KYXB 3CXRA 1JIJA 4BCCA 2IX9A 3TQSA 1YVDA 3M7DA 1EUCA 1EWTA 1CY1A 2PD4A 1PR5A 2XSZA 3DE0X 5F77A 5U9CA 4IZIA 3I6IA 2W8LA 1I51A 3I6MA 3K92A 1DU4A 1OLUB 1W8IA 3SZGA 1OZ0A 1Z45A 2PSSA 4G0OA 5A02A 2G71A 2JGMA 2ZYTX 2OCLA 3FE2A 1GILA 1IAQA 4EFNA 3GPLA 4RCVA 2Q7DA 4MV6A 4G8DA 4DL2A 3FOZA 3QFRA 2P91A 5IHPA 2H0AA 4MV1A 5KSYA 1XTRA 1U4NA 2H8KA 1M6NA 1K5PA 3JPQA 1EX1A 4GI7A 1XZQA 2I87A 3FPHA 3RJTA 4XQCA 4R2XA 3M6XA 3C3KA 4H6PA 4YQEA 5LP6B 2NP7A 1CFZA 4ECSA 3AKCA 3HEMA 5I48A 2ZJ1A 1ZD4A 5GWXA 3FTFA 1KEPA 3CTPA 3GVHA 3RSFA 4TUYB 1F8YA 1ZR2A 1K89A 2V59A 4QD3A 1RPJA 4LXTA 4EKEA 1TZ2A 1V1RB 3FNQA 2VJ5A 4W7SA 4XB2A 1YC5A 4BBJA 1UKBA 1JPVA 2H3FA 3WU2U 1JDBB 1O4WA 2AOXA 3QELB 1E64A 4I50F 1MV5A 1UODA 3IQDB 1CJTC 2Z56A 4TKMA 3BQ9A 3TZ6A 1YIAA 4S1OA 1N75A 4MFCA 2QPTA 3HKEB 1SXJD 1ZJ6A 4OKNA 1TGVA 1YTLA 3LWMA 1FF9A 3BE4A 5FLEX 3KCQA 2XCLA 2LXNA 3L6EA 2WJJA 3WGLA 4OHXA 4DR1B 1LVUA 2WTAA 4R16A 1S2NA 2OTCA 4IUCS 4EZ6A 4HNRA 5HEKA 4DAOA 2QZSA 4G9EA 3LP6A 4DQSA 3WLIA 3KJFA 3KHKA 5HTOA 4HS9A 3FUVA 2B5WA 3PENA 4BMZA 8ICJA 5KFDA 1N5OX 4OXQA 1OGIA 5KOJA 1FUEA 3C3PA 4Q3AA 3ZOZA 2CFTA 2DETA 3VR2D 1LNZA 2H1OA 1BXRB 4Z9FA 5AW6A 5FI3A 1RBYA 4DG8A 2OO3A 3DMPA 5AM4A 1NLZA 4IO0A 4YT5A 1W88A 3SIPA 1U0TA 1ZCJA 2RBKA 5C37A 3TRDA 1I6WA 3RSZA 1WBDA 9ICKA 1FEZA 3H1GA 1B74A 2BZ1A 3AY3A 1QH1A 3Q5GA 1CJVC 4R6WA 1J5EB 1VPWA 1QCYA 4MARA 1MGPA 4MICA 2C8VA 4DIDA 3JRXA 5D51S 1SU7A 1X7WA 2EANA 3AEKA 4JJFA 3WRWA 4X7MA 4R83A 4MI3A 6GPBA 3K1JA 3SKYA 5IM4F 2FPWA 4NEQA 3GOHA 3NRZA 1X1RA 2W5UA 1IQRA 4N9QA 4TV9A 3LX8A 4V0SA 3ZBTA 1Q57A 4XQ8A 3PS9A 3AP1A 4BB0A 1DHRA 2CK3A 4GBGA 4ZEVA 4D3SA 1L4FA 4EO9A 2D7DA 3B12A 3DKVA 3KUKA 1DBSA 2HMAA 4MRRA 4KH0A 4HN9A 1BIFA 1SVWA 1UXJA 4B80A 1T3SA 4N8DA 4U7JA 4E5NA 1PK3A 3OTGA 1M1YB 1K0UA 5AJYA 1EHIA 4IZHA 4I1PA 1HEUA 3FYHA 3BIJA 4IINA 4OYYA 4CM6A 2VF7A 4WY8A 4AF6A 4CMEC 3QLTA 4QXQA 4GZ3A 4WGFA 3EDQA 3X43A 3L40A 2QB5A 3E18A 3Q0EA 2RAVA 1XLTA 4BNYA 3GDXA 3AF3A 4I1VA 2P79A 1Z2AA 2Z43A 1T1EA 3IBTA 7ICSA 2NO5A 4J9RA 2UZ0A 4D02A 4LG1A 4DOCA 1TK0A 1TAGA 3FNRA 3KKOA 4NNOA 1XC9A 3PX3A 5ESRA 1KQQA 3ZS9A 3EPHA 1C7ZA 2PVPA 4S2UA 1E92A 3KOOA 1BPBA 4IMPA 4KLSA 3E2MA 5E9AA 3WR5A 4CM8B 4EF5A 3G2NA 3ZLBA 2ATXA 1O7JA 4QQKA 2P2SA 3IQEA 2FWPA 2CY0A 1YGYA 3VOTA 4Y2QA 1W48A 4B6EA 4I5EA 2ID7A 2QVZX 1IK4A 1XU9A 2KBFA 4QVKA 1F4LA 5I45A 2H1FA 2ZSEA 3BH0A 1Q7BA 4RF2A 4UHBA 1S6YA 2G0TA 2Y4OA 3ZDAA 2E4UA 3ZQUA 3FMVA 1YCDA 3TJMA 2FCAA 5KNDA 2YXNA 3HB0A 1EFRA 2AGPA 3FH0A 4G0XA 1N0UA 3NEJA 4ZVSA 3VZPA 3D9QX 5C5CA 4RJ2A 4RA9B 2H18A 1T9GS 2QXTA 2QRJA 3OF5A 3FWNA 3AEYA 2A84A 1IBRA 2Q2OA 1HURA 1TW3A 3HLKA 1K0FA 3TZQA 4ED8A 2OCKA 3GD7A 4FEAA 4OYRA 3SZOA 3VYSB 3WLMA 2CHQA 1TIKA 2W6JD 5HDBB 5JWHA 3T99A 5MN5A 4E3ZA 1KI8A 3LHKA 4DYDA 4IO1A 4J0KA 4BYGA 2QX9A 4FD3A 3BJZA 2BM1A 4I1YA 4AYXA 4WY5A 1T4GA 4NV3A 5EOZA 1W581 4GPEA 1L5HB 3PX4A 1JWBB 1XVAA 2ZDGA 4TLEA 1AV6A 2PO7A 1HTTA 1BMFA 2F6RA 2FP3A 2QN6A 2RCYA 3ND9A 4MW9A 1EA7A 2PKXA 4PU0A 4YRIA 3UH1A 3DE7X 3HNOA 1R8XA 2GD1O 2CUZA 3I01M 2QTRA 2HGSA 1E59A 3DR5A 3GNTA 2L2QA 1HNZB 3EVFA 4RBNA 1I14A 1OI7A 3M82A 4UTNA 5KNLA 1PJRA 4C2AA 2OBBA 4C4OA 3QWHA 1FRVA 1Q7EA 2C61A 1TAUA 4P7BA 3P4UA 2AL7A 3OJXA 3Q9UA 2GCGA 2RKWA 1E1CA 3I32A 4PZ9A 3U2QA 3ANSA 4Q9DA 3GV7B 4Y7CA 4JN6B 4RNOA 3SF8B 3TINA 3IQHX 1TECE 5CFQA 1URJA 3RBDA 4J0IA 1B00A 1L3BA 1F2UA 1X77A 2PRYA 3N2KA 2IQIA 4V0RA 3WLLA 3LTNC 3L3BA 1PZHA 5DVZA 4Q3DA 4YLYA 3SMVA 4WKPA 2FSUA 4CIBA 3ZJVA 4ENUA 2ZR9A 5D5QA 1GA1A 2XF2A 2CVZA 4IQ8A 3KAKA 3KNZA 1W85B 1ZM4A 3O1IC 4RC9A 1MC5A 2CDCA 2KQUA 4H7JA 3V46A 1FP2A 3E7WA 3EYWA 2HRDA 4L16A 4KXLA 2D6FA 2EJVA 3PGKA 2GUGA 5DE3A 3HY6A 4EKDA 4O63O 1VPDA 1V4VA 3A0BU 2P27A 3TIFA 3GLIA 9MHTA 4FBTA 1K97A 3G1UA 3QF4B 4S24A 5CIQA 1RLJA 1HWYA 3VAAA 9ICXA 5L4LA 2PL5A 4JENA 3H2IA 5ITZB 4KR2A 4WW0A 4I2DA 2HK7A 4PPQA 2G9RA 5A9SA 5SZKB 3R0XA 5IH3A 5D7BA 1XCJA 2ZRMA 2GT1A 4E1VA 1EGHA 4XD7D 4HAYA 5DTRA 5AW9A 4B3BA 1H4VB 2AK3A 1TU4A 2POQX 2AK2A 4MUBA 5IBCA 1ZH8A 2QMQA 4RK4A 1AKUA 2KVCA 1XRLA 2R6R1 3N5KA 2BPFA 3A9RA 1I7LA 2GMWA 2WJ4A 5CB8A 1L8OA 4FI3C 4IVRA 1QRRA 3D3WB 3HRDD 2C2XA 3G9QA 3MLAA 4PFJA 4PHPA 2J0VA 4WOJA 1YZQA 5ANRB 4B7UA 4BKQA 1IBMB 1LPPA 3K9HA 3FLAA 5GOTA 1M67A 1LKZA 1C3OB 2JEYA 2ZBQA 4EG7A 2FJ0A 4IQ0A 2WFAA 1P7DA 3NTXA 3O1LA 4QDUA 3PL5A 4KLMA 1YZLA 4G25A 3UKDA 3KBBA 2HHVA 3IAM6 1Z1BA 4GLFA 4M8KA 4F4DA 1P60A 1NAHA 2A58A 3HGTA 4ZT2A 3TQOA 2EW8A 3Q3CA 1KKXA 4WACA 5EHNA 1P4RA 4NLLA 2JVJA 3EVZA 4B3RB 4ALJA 4JMPA 5B3LA 2X9NA 2XMBA 4MJ3A 5EJ2A 2QQFA 4AX8A 1OW5A 4IQTA 4MGEA 4UUQA 3S2FA 1Z2EA 2ZSHA 3QHPA 4BPBA 3GRZA 2ILVA 3AGQA 5KFPA 1E6KA 1I4TD 2IUFA 3VR4D 4P54A 3NNSA 4KLRA 4EUKA 3CX4A 4A8HA 3DFMA 3MUOA 3DLTA 1ULBA 4D5EA 1P9OA 4OPMA 3OZXA 2EG9A 1ULAA 2GYUA 3LQYA 5CITA 3JRWA 4LYEA 3DZFA 3CO0S 4CTKA 5CM9C 5DDMA 2D54A 5BQXA 3HUDA 3OE5A 1IOVA 4D9IA 2BZ0A 2WM2A 2XPCA 2K7ZA 3CIOA 3OIDA 1T94A 1PR0A 2X7JA 4R1UA 3RKUA 3JVVA 5EGSA 2Y3IA 2F77X 4KG7A 3HY4A 3LC0A 3D2NA 1PV2A 2FOXA 4J7XA 4MULA 5JOQA 2EWWA 1ILWA 4AJPA 3VJMA 1F6WA 3GGJA 2WFLB 3RC2A 3STHA 5A03A 1NJYA 2P62A 1MC8A 3RTCA 4A0QA 3WHPA 4KLJA 1E2DA 3GGOA 4KH1A 2VUTA 1JLLA 1S2DA 1J21A 1TQ6A 1ZD3A 2H63A 2VYNA 3CEAA 4NBVA 3RGWS 4AZTA 5BQ3A 1A50B 1IBCA 3GPCA 1E3QA 3DWFA 3HB1A 3IPXA 2KX7A 4ZHSA 1ZR4A 5EXTA 2E1FA 4ERXA 2GESA 3MGHA 3DTVB 3H2BA 5IXJA 3SYKA 3PFCA 2Q9BA 3EH2A 4DSOA 4QQNA 3F49S 4EG6A 2DQZA 3DAFA 3IMKA 4HEHA 1B0UA 1XZDA 4EJ0A 1VB3A 3DCIA 5JNUA 1K6XA 1ZL2A 4DN6A 3CISA 1NR7A 4QRHA 1LFAA 1G8PA 1QP8A 2OENG 4AW9A 5DHFA 4LMPA 2RRDA 4UCQA 1K66A 2QUKA 3S55A 5A1TA 1CUBA 2PQ2A 1SG0A 3I1YA 2HMXA 1U1DA 3OZAA 1JDNA 2OAGA 2QN8A 4IAOA 2EERA 4N03A 4YDSA 3VI3B 2EKPA 1P73A 3Q9NA 5AT1A 3SSAA 5HX7A 3QXGA 2EU8A 4OU5A 4TX1A 1MCZA 2I4RA 2CD9A 4PGQA 4JLMA 5EGNA 3BZKA 3SQNA 3KV1A 3VO9A 3PFFA 1PNRA 4UAUA 1NRWA 5DTJA 2YWHA 2ZSFA 3CRZA 3NHZA 3QVJA 3T5GA 3CWCA 4U5XA 2KJ8A 1FYFA 4B9TA 1JZTA 1ZK2A 3DLBA 2WKWA 3MTGA 4C7MA 4CKBA 4CQNA 5AHXA 4YDQA 2FFRA 2SHKA 4WERA 2NVWA 3RRFA 1AT1A 5KAPA 5JR3A 1THMA 1HT2E 2IL1A 3M7IA 5BV0A 3J80A 3C1UA 1YA8A 2VXYA 2C9CA 2BJHA 2ERYA 2VJNA 3B2NA 1SUPA 2YTZA 3T5HA 3JW8A 3QIAA 4DQIA 4NMXB 4RFVA 4BUZA 4FGWA 1JI0A 1NXSA 1W93A 2J3LA 2CNDA 2OSVA 3OJUA 1KW4A 3JD3A 4HGPA 4NJEA 4RIIA 1E9VA 5BOVA 5IS2A 3IS3A 5BPFA 2EQAA 2JLCA 3DDWA 3UF0A 1N2CA 5JEDA 4JFRA 4OXYA 8ICBA 2JEIA 1BKYA 4N7JA 2W2NA 1SY7A 4F3KA 4UPEA 3QW4B 5DGIA 4FO6A 4II2A 3K53A 3UVEA 4ZHQA 4ZRNA 4JLKA 3REQA 4O3RA 2F4NA 1OTHA 4RANA 4JGGA 1PX0A 4KWHA 2PJZA 4AZ3B 2O6KA 1S77D 5AW3A 2PMZC 2O5EA 4YX9A 3ZTWA 2OM6A 1JI3A 3RTDA 4AY3A 3DO8A 2A57A 3M1AA 4LHZA 1NOJA 2CCGA 4OY3A 4Z3OA 2P9FA 2X77A 3EIOA 2J32A 4TWZA 4YEDA 5B3KA 3KZXA 4EYIB 1Y5RA 3D8SA 3GMTA 1IXKA 4OXRA 4BNWA 2ZANA 1DINA 2REQB 2XOXA 4NYMR 3U4HA 1DAKA 4DUZB 2B5VA 4GR5A 4IHAA 4C06A 3BCSA 1O96A 1GYQA 3H7AA 3NGXA 1SU4A 1N48A 1PD1A 1XK7A 2BGUA 1N1MA 1Y82A 2X76A 5ALUA 1NR5A 1NVEA 4GP6A 1TZJA 3VH3A 1DOQA 5BRAA 1Q21A 4IICA 5LLSA 1CUCA 4GUAA 5DBCA 2EW1A 1Q83A 5IEJA 4DCUA 4HNTA 5J0OA 1PWHA 4M7RA 4CIXA 2VPWA 4EAQA 1C81A 3U0BA 3EVDA 2OVFA 3I5UA 3ICWA 3MRSA 4OUDB 4DKJA 3M6ZA 2C29D 1GGEA 4RD3A 3WQBA 2HT1A 1SC3A 1X8JA 1XN1A 3LDAA 2IY7A 1XZAA 3IR7A 2P6UA 1I10A 5A6SB 2OV8A 2QVYX 1S8FA 3OPVA 1NT4A 2B4YA 2H8GA 3EX7C 1WKCA 3ZD9A 3WZ2A 4BMOB 1W4RA 4EZ9A 3VKHA 4BRSA 3NDRA 4EHDA 1LV5A 3TI0A 1WCLA 3GLTA 4BB5A 5H7XA 2HA2A 2OKCA 1N6KA 4HNSA 3QTBA 4JKYA 5ERYA 4OB8A 4EFDA 2CLCX 1EVKA 2Q6IA 4KFSA 3DHEA 3ASUA 5KFIA 5SY6A 2GNAA 5JPDA 3ANLA 3NONA 5FR1A 3SOZA 3WADA 4LE0A 1E2UA 1WQ1R 1GSIA 4QZBA 1ZUD1 2CXPA 3PXEA 3TL2A 5FBQB 3I6YA 5IP5A 1PS0A 3JASA 2C9OA 2GHQA 1CLEA 3C1ZA 5K03A 3KWJA 4B44A 3TL6A 4B82A 1Q3TA 1ZOIA 5PGMA 2Z2ZA 2X13A 4FDAA 3H8MA 1GZ6A 3G2IA 3HVHA 5EWMA 3SNHA 3W1EA 5L9AA 4CETA 2PANA 3IDWA 1LSSA 1NN3A 2QNRA 2W6OA 3GVIA 3H6HA 4LF4B 2IVZA 3A1VA 1NMYA 3VO8A 2AI2A 5FAXA 1JXQA 1FSSA 1G0OA 1D6JA 5HMMA 1M74A 4FYWA 4BQFA 3SXUB 3IL2A 2YJZA 3SJCA 3NGDA 1SBZA 5LQCA 4BNIA 1UJ6A 1YMUA 1FTQA 3Q7PA 4MR7A 1QHGA 1FW8A 5J0UA 1P45A 1ISPA 2Q5IA 2R65A 2P6NA 1NE2A 2ZS9A 3OIYA 4QEZA 4IR1A 1A69A 3EH1A 5DF1A 4KMOA 3F1KA 2ENWA 3SDZA 5KINB 4REQB 1IMOA 2X8BA 5DNEA 3LXUX 3N2GA 3TNFA 5ELXA 3OSZA 1W0KA 2VF2A 4IDCA 1IQ0A 3VYVA 4ER7A 1KFKB 2PGNA 4YWJA 2XKBA 3EMDA 2Y1WA 4TWRA 5LDHA 1ZI6A 3TFSA 1E5TA 4P4PA 2A4MA 5ENDA 3RG8A 1JFSA 1RYNA 2JEFA 3UUWA 4WKBA 3E9ZA 2ZP1A 1FU8A 1FTYA 3BQNB 4CE6A 2Q4BA 1Z34A 4IQVA 3Q8SB 2O2YA 3FPEA 2OCBA 1P18A 1DAEA 3F5DA 4KXXA 2BCRA 3F2VA 3ZYZA 1KGDA 4C0ZA 2VG8A 2OD2A 5EJEA 1BNOA 4NJOA 1SR8A 4O4HB 5K99A 3BAZA 3WWEA 3RFCA 2GPTA 9ICHA 5LBIA 5JPCA 3DR3A 3LPDA 1NQTA 3K9GA 3OOHA 3ACBA 4L73A 3DM5A 1CZKA 1IXSB 2EX0A 1J8QA 3DB2A 1M34B 3OJCA 4N5NA 5EP2A 1UKZA 1VBKA 4USAA 2IYYA 3K1ZA 2KNJA 1NLUA 3C45A 3DSRA 3R2JA 2HBQA 1GNVA 4JBWA 3WHLA 4ARVA 4B1FA 3PE4A 5DXFA 1JSCA 3JYHA 1KFSA 1EHCA 3GU3A 4KMRA 1KI9A 3PE6A 4YH1A 4IIJB 3ETRA 4RPHA 1JR3D 3NMUF 5KTKA 3DW3X 1J24A 3ROMA 3W1VA 3QE3A 1YE3A 1RZRD 1KMCA 3QZ8A 2D0IA 1U9JA 1RWWA 3LPCA 5L7WA 1N3BA 1WSDA 2CNWD 4F3CA 3PEYA 4JQSA 3E22A 4HDSB 4JV1A 5CYGA 1QCZA 2V65A 2C07A 4QOHA 5KOJB 4L0CA 1LUAA 1N1DA 2CEAA 1MOPA 3RJFA 1AIPA 4PIMA 4RY2A 1GIAA 1ZONA 4TYPA 4MOWA 4A8PA 5EYPB 5C51B 1R5BA 3EEFA 3HCNA 4K9LA 3EY9A 2EP5A 3WI7A 1VI6A 121PA 1LBSA 3EVGA 2ZTSA 4C07A 4FOSA 4LVSA 2C3YA 3GIIA 4R2JA 4Q9JA 3I61A 4GMDA 3UG7A 1PBTA 2NZUG 4ENQA 4FXOA 4ISCA 1GARA 3AI1A 3QLVC 4KLNA 3AM5A 4O3PA 3IP8A 4QIHA 3X1YA 1F17A 4L72A 1QZ3A 1DUIA 3GLGE 2C2GA 5H4HA 2VNSA 1GPWB 3MVEA 1GPYA 3F5FA 4GKBA 5KVCA 2FNAA 4Q4JB 5C5IA 2EG5A 1K7YA 3OQHA 3ROXA 2QQ0A 4PR0A 3TX6A 9GPBA 2JFBA 2V6MA 1MO3A 1E7QA 1POWA 1B4FA 9ICCA 1UMCA 2WOJA 3C8DA 3HDVA 5JJ5A 2FA9A 1P6QA 1XL0A 3DNMA 4F5YA 5DHTA 1Z6TA 3I0ZA 4JIMA 2HSWA 4RESA 3N8HA 4EYSA 5A6VA 1KQPA 3OOWA 3I0NA 2QG9A 2YIDA 2P8SA 1T5DX 1W5AA 1CRXA 3H4VA 4GL2A 4RMNA 4TTPA 1SQ0A 3WV5A 2K2QB 4OQNA 1S0NA 2LR0A 4G5SA 4KJZA 2WSSD 3V6JA 4G8JA 4E4TA 1TRHA 3X2FA 3AEXA 4UAJA 2VSFA 4IDFA 2A0KA 2ZCUA 1TYDE 3E3OA 9ICJA 1S8NA 5GV8A 4WNYA 1M6EX 4LXHA 4IFTA 1U2RA 3DOEA 3TR5A 4ZIRB 4BVJA 3RIGA 4YGXB 3O7WA 4JV0A 4PG6A 4NBNA 4QE3A 4B3TB 4BEBA 3KE8A 9ICBA 4MVJP 4P4MA 2VYFA 1X0XA 1Z5ZA 2F8MA 5J2HA 2A1TR 3F7NA 3Q7RA 4P4SA 1IN7A 1QHYA 4U63A 1MAUA 3GRAA 5F12A 1H8EA 2IYZA 1J7JA 2CLFB 4MGHA 5GM1A 2GO1A 2P9GA 4PXYA 4C7OB 4JUZA 2QGNA 3IAM1 5EAIA 2ZCJA 2ABWA 3WYGA 3T52A 4HTFB 3T3IA 4E30A 3SDBA 2R8BA 4G41A 2X9VA 5E6UA 3JR7A 3NG1A 2IHKA 1TIBA 4UNNA 4NLKA 1W5FA 5EJGA 1JI7A 4ZAFA 1ZVMA 4LYGA 6LDHA 2BELA 3JCZA 3BFXA 2QU7A 3DHNA 5JJBA 2NACA 3D0OA 1X9XA 4CR7A 4GC7A 5CYPA 2XA9A 4YMVA 3A3NA 3QWBA 4QUDA 2JDIA 3G49A 3WWCA 2Q5OA 5JXIA 2D2IA 3WA7A 1FTNA 1BZYA 4LJ5A 3QPAA 1WHTA 4U2DA 2BH2A 3TJRA 1JQBA 4UTXA 3HUEA 3HQ4O 4A73A 3NEYA 1FTGA 2QQEA 3G79A 3JQDA 2ZU0C 3LP5A 3MJRA 3MXOA 4NV1A 1ORWA 4W99A 3S7ZA 1EUCB 3AFIA 4EHBA 2W58A 3V8MA 3SX4A 1V0JA 1RRMA 4TQAA 2Q8QA 1JHUA 4DQKA 2HF9A 3WB9A 5IIIA 4NXNB 3W2FA 2REXB 3LOPA 3NC4A 1U7DA 2IHMA 5I9LA 3SAHA 8ICKA 3KZ1E 1GGKA 4MUEA 1W0JA 1NBEA 3WGMA 5JCJD 4DDUA 2I80A 3MINB 4TMWA 3N8GA 4QT0A 3ON5A 3H1EA 1X7XA 2W8BB 5BMVF 1D9XA 2X2FA 1XEAA 2IZOA 4C6TA 3TXYA 3Q4GA 3ESBA 2XYHA 1CS0B 1TE2A 2OORC 3K0CC 4TQ9A 5LJLA 2Q3FA 2AOWA 3QE9Y 1SQ6A 4BE9A 1J0CA 2PAFA 4XOIA 3BMQB 5B53A 4CUJA 3WKAA 4BNGA 1V35A 2GPNA 4K40A 4H1WA 5B6JA 2JJQA 3SC2A 3USES 1DL5A 1AUXA 3V7UA 4IKOA 4L22A 4XUGB 1AS3A 2M9MA 3LW8A 4Y6GB 2QRGA 2G76A 3YASA 5I8WA 3UB2A 4IRCA 1GUDA 1Z2NX 2GM4A 1VSBA 2GBLA 3KSAC 1X7HA 3H4IA 1BCRB 4DWJA 2G5IB 3U26A 4BNDB 1I7NA 5GONF 3STVA 2C3PA 3TIGA 5C4IA 1ZN9A 4LC9A 1T35A 5IJWA 3C3MA 2Q4RA 1SPXA 3E4CA 2CJXA 2BGNA 2QR2A 4MB0A 3RJZA 1D9DA 4UVIA 2CXQA 3HJTA 3FETA 3HBMA 5I7SA 1R4MB 1L5WA 2VVTA 3B3AA 4OFZA 3IDSA 2LHTA 3K5IA 4BQOA 4NFLA 5A3SA 3FOFC 1EFTA 3HADA 3DZCA 4FLFA 3SYLA 1GNQA 5KSWB 4L4ZA 1MQSA 3AERB 2B94A 3L02A 3WBBA 3ZD7A 4AYBF 1X80A 3DW1X 3G7UA 5B1IA 3AYXB 4E32A 1QMGA 4E4YA 1A9XA 2IH4A 3NHLA 1U9LA 1R4NA 1XNHA 1G7RA 2OCIA 2WFZA 1Y8CA 1U7PA 3HBLA 2ASJA 2PQMA 1DBQA 1KJWA 2GPYA 4GLOA 3TOSA 5CFNA 3CVOA 3T5TA 1DCMA 1YVRA 1Z19A 1M5TA 4KYVA 1AQYA 1L5YA 5LOVF 1I9CA 4OJ6A 3KT8A 3NR2A 1JHOA 1TA0A 3R3HA 2PUAA 3G0HA 3PF9A 4HAZA 1GPKA 1X86B 1ZQBA 2IYVA 3ET5A 2A94A 4PFQA 3VZDA 3PDWA 2R4QA 2H3IA 1M2NA 3DNFA 1WU8A 1V16A 4MK4A 2CXYA 3AWDA 5KAFU 1E3LA 3H86A 4P3OA 3IODA 3IBCA 4CCHA 3IOEA 1MKYA 2E89A 2QN2A 3IV6A 4JOCA 5CEFA 5KHOC 1G59A 3OEED 1T36A 3PFWO 4A10A 4Q4DA 4E07A 1L3IA 3IP3A 4HAUA 2Z5FA 4WNAA 1FSZA 4XM1A 4C7ZA 1VXRA 2I3DA 2JFHA 1TT5B 4EYHB 2NUBA 3AJAA 3OZWA 1L0BA 4Q34A 4P5PA 4R9SA 2ISQA 3B52X 4INJA 3T1QA 4ZI7B 4HDRA 5I7AA 2IYEA 4O4LA 1Q12A 4AJKA 3FKQA 5IT5A 5KOHB 1CD5A 4FOTA 4I5DA 1P5FA 4G0ZA 1JXMA 2X1LA 1IRXA 2FRDC 3W34A 3U19A 3DWIA 2BBSA 1ACMA 4XB6B 3VBEA 4CI0B 3TIXB 3DDZX 3UWMA 1WULS 3GRUA 1JN0A 1SM4A 1XV5A 1OH7A 1VRVA 5J58A 5EKDA 4EYEA 2JLQA 2AJTA 4MLCA 3NM4A 3WG9A 1W4LA 1T2EA 3JD4A 2ZRHA 3QVGA 1XP5A 4GPBA 4WKNA 1G8JA 1RABA 2YQZA 4G1VA 3C5WP 1B15A 5TMDA 4GWLA 4BLWA 3BXHA 4Y6RA 2NO7A 2JRCA 3UMBA 4JOBA 1F2DA 3B9QA 4W82A 3TSOA 1Q0QA 2BT4A 5EVCA 2Y0SC 3T54A 4ZDJA 5AVTA 1KZ9A 5G0VA 4Q82A 1P72A 1XCGB 3H9QA 1BOFA 4J0JA 3O4IA 3U9SA 3VZBA 1ECLA 2ZB2A 4HYYA 1X1CA 5EIHA 4DSFA 3WLPA 4DKXA 4N41A 4F3YA 4K5QA 1GAWA 3WK6A 1Q17A 2HOQA 5EHGA 1Z4MA 1B3BA 4CEHA 1E6UA 4N40A 3WZLA 1P7YA 3HDHA 3UFXA 3BXPA 3W2TA 2JJ2D 4G89A 2NXJA 4QU8A 5EUMA 1C50A 4JXZA 2XHEA 3T1YB 1LK7A 4LA4A 3C74A 2HYDA 2GHIA 4WNIA 4QWBA 1PJBA 4YALA 4LE2A 5LMUB 3TYXA 1EVLA 1O9HA 1JFRA 1UXHA 3CT6A 1KL7A 3QF7A 5CT6A 5EKXA 3UZUA 2QMHA 4YJ2A 1I4WA 4P7FA 1NK5A 1YQEA 3SX2A 3CIFA 5AUOB 1EVIA 2HQRA 2KMLA 3C1YA 1G21B 3KPJA 3RRZA 3SZRA 4E6EA 2AC2A 1Q6ZA 3OAAD 5JSFA 3G2KA 1HDCA 3HYTA 4YMIA 3F0TA 1JDPA 2BKXA 4XSHA 3LYLA 5FBHA 1RQ2A 4GZ5A 4J1NA 1IZ8A 1Q2UA 2OCGA 4NYMQ 4UUAA 1XEWY 2B2CA 3D6FA 1M8JA 2C77A 3P2KA 1UBUS 4MXDA 3JTMA 1UBNA 1EUYA 4MYDA 5BMVB 3A32A 2AGQA 3GK3A 2ZXIA 8ICOA 3FWYA 3H5NA 3HO6A 3L0PA 4LJ8A 2P3OA 1CF2O 1NU8A 1WLSA 2KHZA 2RIRA 3CZPA 3KUXA 4UJ5A 1PZEA 3FMFA 3KO8A 4G85A 1NXQA 5BSHA 2KG5A 1Y8RB 5CFLA 4FMCF 4TOIA 3SSNA 5DNYB 1HDIA 4KQMA 4RWZA 2ETXA 3TR6A 3BL5A 1B42A 4GOJA 1A9TA 3TMYA 3K70D