1KQQA

Solution structure of the dead ringer arid-dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAALTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Dead ringer-DNA complex reveals how AT-rich interaction domains (ARIDs) recognize DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*CP*TP*GP*TP*AP*TP*TP*GP*AP*TP*GP*TP*GP*G)-3'
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kqqA00
2CXYA 2YQEA 1C20A 2KK0A 1IG6A 2LM1A 2JXJA 2JRZA 4LJXA 5CEHA 1RYUA 2LI6A 2EQYA 5K4LA 1KQQA 2OEHA 2EH9A 2RQ5A 1KN5A 1KKXA
chains in the Genus database with same CATH superfamily
3MR6A 1MQ2A 5KFJA 1UPHA 1T3QA 1ZQWA 4C4SA 1N61A 3SD7A 2PMZC 3A0BU 3C21A 5L1LA 4UB2A 2M9NA 3MDCA 4EEYA 5AKJA 4QW9A 4F2SA 1U4BA 4BXOB 2FLPA 1DXSA 2VKQA 4ED2A 4J9PA 4XRHA 3RRGA 2K89A 2EAMA 5HNKA 2DL0A 1QSLA 3QE9Y 2Y9UA 4P0PB 3IHQB 5KFFA 1PVPA 3TADC 2GLEA 5JU5A 2KHQA 3PX6A 4TURA 2IOHA 2JZBB 4ECTA 2OYYA 4EZ9A 1J2NA 2KZ3A 1OUQA 1S0NA 1ZQFA 3RH5A 4QZGA 1ECWA 2AXTU 2MA1A 2V9WA 7ICHA 2YTUA 5DB6A 3M9MB 2XCPA 3SZ2A 4DQIA 3LWMA 4DFPA 5KAIU 2WAQC 1CEZA 3AM9A 1O03A 4AP9A 4JWNA 2HHQA 8ICTA 8ICIA 4YR0A 5L1KA 3MC1A 5ALTA 3M8RA 4YMMA 5KG4A 3WK8A 3DDHA 4B9LA 3M9NB 4XA5A 2IOFA 4RNOA 1Q3VA 1ZQBA 9ICJA 4ED1A 4B9VA 2OHFA 2FE9A 3V7LA 1ZQUA 3F53A 4QWCA 2LM1A 1PVRA 3BS7A 4QZDA 2W11A 1F5SA 2B0CA 4DQPA 3OTQA 2KK0A 4F5NA 4ELTA 5AI5A 4FBUA 3AL0B 3L3FX 1TK5A 4F71A 4DLGA 2P66A 4UASA 1ZD5A 4QZBA 9ICGA 2E8MA 1ZQRA 4UAVA 4YVZA 5EWGA 3H8SA 4XUSA 4Y2SA 4DQQA 1DK2A 1D8LA 1KW4A 2BKEA 2KD1A 2K4HA 3AMZA 4CF5A 3PZPA 4YFKA 4LJXA 3SENA 3PMLA 2GWSA 4KLIA 1BNOA 5AM5A 1NK8A 4MF8A 3HX0A 2CPRA 1D8YA 2HOFA 2FDRA 2WTFA 2AJQA 2MSNA 1NNLA 2KSOA 4PL1A 4CF4A 1Q3UA 1ZQEA 1NK7A 1TK8A 2A1JA 2NYVA 4RUAA 4UAUA 3N97B 2CN1A 3RBDA 5J2CA 3GV5B 1N5WA 5ALIA 4UB1A 5AKXA 4UB4A 1BPXA 4PHAA 3RTVA 2XY6A 2WF7A 5J29A 2G5IB 3M8SA 5IIMA 1YZ7A 3PV8A 1Z4NA 3D2QA 5J0TA 3MGVA 3KFUF 3C5FA 4CRXA 4ECSA 4Z6CA 3UXOA 4Q43A 4RT2A 2W9BA 4F5RA 1L3VA 9ICTA 4DOCA 2PKEA 1T94A 2XIDA 3H0RB 2NRWA 4Y2XA 5J0RA 3ISDA 2ZIVA 4KLUA 2HHUA 1NJXA 1U45A 4UQGA 1Z00B 1NK9A 4NXZA 2GOLA 1FO4A 3QUBA 3BS5A 5L1JA 4OJ5A 4Q8FA 4YXJA 2H3VA 7ICOA 3T5JA 3RBEA 5EE0A 2G09A 5ALPA 2HBMA 4LVSA 1FIQA 4BJQA 5KG5A 2HI0A 5KFLA 4IR1A 4DL2A 3G6XA 4I2GA 7ICJA 1SV0C 5L9XA 3T5LA 1NK6A 4CF3A 2QB1A 3K1ZA 5F9NA 1COOA 4ED8A 5J2FA 1RPLA 4ICAA 3EZ5A 2BCSA 4R65A 4I2HA 1BVSA 3ISBA 1A77A 3ZDCA 2XY5A 5KFOA 1SKWA 1S97A 4KN7A 5ALMA 3FM9A 3RB3A 2G06A 3M9OB 2B21A 1JUDA 5GTIU 4B9UA 4IRDA 2AGOA 5AM2A 2FMSA 1L3TA 4F5QA 4ECYA 4QW8A 4RQ3A 4QWEA 1IIPA 2I1QA 4Y2YA 5HMMA 8ICZA 2DBYA 2XY7A 9ICAA 2KN7A 1ZXIA 2O6KA 4C7YA 4PHDA 2IHMA 4NLNA 3WK4A 1DK3A 2Y9TA 4ED6A 1B43A 1SZPA 2BCRA 2F1JA 1X66A 2YB4A 3PX0A 4ECQA 4PHPA 1ZQGA 1SB3C 8ICOA 9ICPA 2KJ5A 2E8NA 2AH5A 1ZQMA 3BZCA 2W9AA 2PXIA 5AI6A 4DOBA 4DS5A 2HVHA 1U9LA 1NOMA 3EW9A 2Y1IA 3OPXA 4NLZA 5KFPA 4DF4A 1BPZA 3RJIA 2QB0A 4RU9A 3BQ7A 4UAYA 4F4YA 3PR4A 3GIMA 3ZD8A 5EWFA 5KG7A 5DB9A 4YR3A 3NVYA 5HHIA 3TAPA 2KG5A 3MGHA 5DLGA 5KFTA 1PZNA 1QQ6A 2JH7A 4YN4A 4Y2JA 5KFVA 2BZFA 1C7YA 4NM1A 1T4GA 5AI8A 3IV6A 5DQHA 1SGGA 3PW0A 2BCUA 1QSSA 2Y0SF 5DB8A 4RQ5A 4TUPA 5DGBA 2HBKA 2R18A 4GXKA 4DO9A 2ZIVB 2ZTEA 2D3DA 1LB2B 3I28A 3RF9A 2W8KA 1NKBA 5J0PA 1ZD2P 3PSPA 1WWUA 2HW3A 3JPPA 1UCVA 3QU9A 5KG0A 4KMOB 3NVWA 4DQRA 5ALEA 8ICHA 2R8KA 7ICSA 9ICVA 4NLCA 2NRZA 4Q44A 4M9HA 3E2EA 2XVTA 4QZHA 1X42A 4PHEA 5AM4A 4KMUA 5DDYA 5EWEA 1YT3A 4GXIA 4JV0A 4RNNA 4DL6A 4AYBC 1VDVA 3QU4A 2ALZA 5AI4A 1WWVA 4A8EA 2RP5A 3MR5A 4YMOA 5KT3A 3ORYA 4WJ3B 2FPKA 2NO5A 3HPOA 4JV1A 4NL9A 4RQ4A 1XSPA 1LVHA 3UXNA 1K1QA 1S0VA 2LM4A 3RR7A 1JIHA 4ELUA 5KFAA 1L6NA 2M0NA 4GFJA 4RZRA 1ZQQA 5CJ7A 4MEXA 1RYRA 2J6UA 3BDPA 1Z00A 2KICA 1RM6C 4KTQA 2ZXHA 2C28A 5CHGA 1TV9A 2NRTA 2BPFA 3PW4A 3WU2U 2E1FA 5AI0A 4NLKA 2K8CB 4P0QA 3PW7A 2IBKA 2FLLA 8ICLA 1CI4A 4NJ8A 2F2AB 4QNLA 3OSNA 5KFRA 1NKCA 1A0PA 5DG8A 1SWWA 1ZQZA 7ICMA 4QIWF 2I9GA 3Q8PB 1WCNA 2E8PA 4ED0A 1URJA 4TUSA 1NK4A 4TUQA 3QX7A 5AK3A 4PPXA 1SXEA 5A0LA 4EYHB 1VJ5A 4I2EA 4O3MA 9ICKA 2NO4A 2KSOB 2Q4TA 4F93B 4Y2UA 3M1YA 4BXOA 1DGSA 1K5OA 4J9OA 2PI4A 1BGXT 4IQWA 1ZQ1C 2RRDA 5DG7A 2OXOA 4FZMA 1QTMA 9ICSA 4MFAA 4UB5A 2Z7JA 2EAPA 3MFIA 1KSPA 4O3QA 3IDWA 3NRZA 5B5EU 3M7DA 1ZQHA 2BQUA 4RQ2A 4R66A 2JMGA 3BQ0A 3O0FA 1J97A 3V7KA 4B9SA 3H0LB 1IV8A 2MU2A 4BGDA 8ICRA 1Z3EB 2XC9A 5KFYA 1DOQA 7ICVA 2ASLA 3M6KA 2K60A 3KD3A 1EXNA 5BOMA 4P4MA 1PUZA 5ALQA 4F5OA 1TAQA 1L3UA 2D8CA 4F4WA 4KLMA 2AHOB 2BPCA 1FFVA 1UT5A 3HP6A 5HMLA 7ICUA 1RG6A 3RAXA 8ICYA 3WKAA 2LPEA 5AKZA 1NZPA 3RR8A 1N63A 3N4MB 5J8YC 2PFPA 1JN3A 2HBJA 7ICPA 2C2DA 1ZOLA 1SZHA 1F44A 3MR2A 3MR3A 3T5KA 4ECXA 2F44A 1Q8KA 4ECRA 5G5HA 4UB6U 3GIJA 2H3ZA 3F2CA 2KIVA 2KNJA 3F5EA 5AKGA 1NK5A 1KEJA 1IM4A 4Z6DA 2KFNA 3QEAZ 1XC9A 3AQFA 3GIIA 4DL5A 1ZQJA 1RXVA 2OWOA 5ALHA 1ZETA 4KITB 2ASDA 2DPJA 1ZQKA 4Y2PA 4DL4A 3FC4A 4EYIB 2UVWA 7ICLA 4PGXA 4BWMA 1PK1A 4UB3A 3RB4A 3GDXA 5KFCA 4KLEA 2XGQA 3IRUA 4KLJA 2BQ3A 1MA7A 4O9MA 5KFBA 2LYAA 2Y0SC 3HKZC 4J9NA 4ECVA 3G6VA 5ALNA 2E8OA 4DFMA 2EZYA 5KFMA 5AM0A 3K75D 3Q8QB 3NVVA 4M9LA 8ICNA 2A3VA 2QKQA 2ODGA 3JPSA 3GQCA 5ALFA 4U6PA 1SXDA 1XU4A 3C1YA 2ES6A 2HHSA 2E5SA 3LVWA 3RJFA 2RDIA 2KKPA 4USAA 4YR2A 2OEHA 5C5JA 1ZQYA 4B9MA 3RJGA 8ICXA 3RB0A 4M04A 4JK1A 3GFKB 4RT3A 5AKHA 2YQEA 2W9CA 7ICFA 1S0MA 4DSFA 2ZIWB 4BX9C 1SL2A 2ZTCA 1S76D 3N7RC 5AK4A 4I2FA 2JEJA 1ZRMA 2VANA 4DQSA 3L5KA 2CXYA 2ZIXA 3EPIA 5K4LA 4KLTA 3KHGA 4UBCA 1CRXA 4Q8EA 2ZUDA 4HAIA 2MRLA 3ETLA 4DSLA 3UM9A 2AQ0A 3DV9A 4DOAA 3CYMA 2F3NA 2I5HA 2W8LA 3LDAA 4O3SA 2KV2A 5J2HA 3SMVA 3C1ZA 1MN8A 2JEFA 3Q8KA 4F4KA 2EANA 4QJFB 1KBUA 2ZJAA 1SL0A 3UMCA 4CNQA 1V97A 3SEIA 1SWVA 4PGYA 4NM2A 1TVAA 2ZJ5A 5KFQA 3N7PD 3TFRA 4FFDA 3RH4A 1D8BA 1X6JA 4F50A 1UQVA 2LMRA 2LKYA 2G07A 4KLHA 4QZEA 1ZYQA 2UVUA 5JUMA 1KKXA 1NK0A 1GO3F 2BCVA 1IXRA 3BQ2A 4I28A 3THVA 3GV8B 4JUZA 4EX6A 2WF6A 8ICCA 8ICFA 5J2AA 8ICVA 3CNHA 4KLQA 5IIOA 4RPYA 1QH9A 5KFKA 2VJ4A 4X5VA 4J9QA 1SKSA 3NUQA 3RFAA 3OJUA 5ALUA 5DKWA 5KFZA 1IG6A 3JPOA 1ZQSA 4HYKA 3KTQA 2PFQA 5AHXA 5J0OA 4OD0A 3ALRA 1NZBA 4RQ1A 2HMXA 1HUZA 4QZAA 4GXJA 1HEKA 1K1SA 1KDHA 5C0YA 1KTQA 5KFNA 1KQQA 2FMQA 4QZCA 3ZDBA 3NASA 1RQLA 5CB1A 3C2MA 1XSNA 2R8JA 1ZQNA 2BDUA 3SAFA 3QZ7A 3KBBA 2DQNB 1X2IA 5KG3A 2K8BB 5KT4A 5DLFA 1ZQTA 3ICXA 3N28A 4C4TA 2DGZA 2DWQA 9ICLA 8ICMA 2MAXA 5J0QA 3BS5B 3QEBZ 2P35A 1JMSA 3EUB2 5ALWA 4Y2QA 4O3NA 2UVVA 2KZZA 2OM6A 1TE2A 2JH1A 3RAQA 4RUCA 1A76A 4YXMA 1COKA 2JHDA 4YD2A 1U49A 1TKDA 4FE3A 2C22A 4MEYA 4R8UB 2HOIA 2JEGA 2W9BB 1TAUA 3SQIA 3RJJA 2MUTB 3UQ2A 2GH1A 1QCKA 3C5GA 5KT7A 5KTQA 3ONNA 2BPGA 2EDUA 3ZDAA 3ETRA 1ZQOA 2G0AA 3T5HA 2FPLA 5KFHA 2F8LA 1U47A 1C20A 2F8KA 3Q8RB 4US9A 4EZ6A 3UMBA 2BQRA 2ZIXB 3V6JA 4CDGA 2IA6A 1S10A 2GO7A 4I2JA 4RQNA 2HHXA 2Q0ZX 5ALJA 2RHFA 3C29A 4I2BA 4JB3A 1ED1A 2A1AA 1S9FA 1JALA 1S77D 2HDOA 4RPXA 2HBLA 4M9GA 3PO4A 4ZOHC 2VA8A 1RXWA 4ED3A 2K4EA 2F1IA 1J2MA 1Q46A 3C2KA 2Y1JA 2HHVA 4DEZA 4B9NA 4UAZA 3I1YA 5DGAA 3RB6A 1L7MA 3TKAA 2JEIA 1OXJA 2YMLA 5ALSA 3PVXA 1RYSA 2W9CB 3JPRA 8ICUA 3QZ8A 3TQ1A 1B0XA 3LK9A 1PVQA 5KFSA 5L1MA 2QB0B 4IRCA 3HJEA 1T8EA 2V4QA 2KZMA 1SV0A 5F3XB 3SAGA 1JXEA 1U48A 4F2RA 9ICOA 3S6JA 1X9SA 3VCBA 2LI6A 1LKYA 4MHVA 9ICEA 2R8HA 2WF5A 4KLSA 1N48A 1B4FA 1L3SA 5IIKA 1MC8A 3FYHA 1BPBA 4P4PA 2AQ4A 2DF4B 1ZRNA 2C2EA 2ZUCA 5ALVA 4M47A 3C23A 2ZUBA 3Q8SB 2QARB 3AEVA 4Y2RA 3F2DA 3AUOA 2H3IA 3PSTA 4BWJA 3ZI4A 3C28A 5ALZA 3NRWA 5ALLA 2UVRA 3PSFA 3M6ZA 3RH6A 5KFDA 3WK9A 2WF8A 2G08A 3L4PA 3HRDD 2W7OA 4M6WB 1X40A 2KKVA 4O3OA 2K8AA 3MBYA 4UBBA 1X6IA 7ICQA 3BQTA 4YQWA 4LZGA 5ALGA 2NRXA 5ALKA 2HSZA 4BUGA 3WKDA 2KJ9A 4FBTA 3AQEA 3QNMA 1P7DA 2DKZA 7ICEA 4O5CA 4QWDA 5J0XA 4C8OA 4C80A 4NV0A 3ZDDA 4I2AA 5DBCA 1XS9D 9ICIA 4ZH4A 5J8YA 1DGJA 7ICGA 1TFRA 2ZIWA 2W9MA 2W03A 4B6JA 8ICQA 4DSEA 4Q45A 2BR0A 2H5XA 2BCQA 4J9RA 4QZFA 5H2FU 1UHUA 3KZXA 2EQYA 3EYZA 4P2HA 2K4PA 8ICKA 4MFFA 2WAQF 4ECWA 3D2SA 1Z1VA 3IG8A 2H3QA 2IMWP 5IIIA 2R8IA 5AKYA 4DS4A 4FO6A 5J2BA 4DFJA 1BNPA 4FZNA 3OHBA 2OH2A 4DWIA 4M6WA 3OJSA 3SR6A 2ZTDA 3QUCA 2FLNA 2VA3A 2A1JB 2FMPA 5ALRA 4KN4A 4J9MA 2KE7A 2ZXIA 4RQ7A 3WK5A 4QZ9A 5KL8B 2BDPA 4R8UA 3F2BA 2KMDA 3C2LA 4AYBF 5D49A 2ISOA 4UARA 2YMPA 3MGIA 4I27A 3BZKA 2KTQA 4IR9A 4E0DA 2B6GA 1T7PA 9ICRA 2F1HA 3JPNA 5KG6A 1A6SA 2WFAA 4B9TA 3GV7B 3UXPA 1L7NA 3UPQA 2IHNA 2ATLA 2DFLA 3GILA 3EWAA 1PK1B 2V4RA 4FS2A 3HWTA 4P0QB 4FZLA 3JPQA 2EAOA 1NI3A 3BJYA 2PMZF 7ICIA 4C4RA 1HUOA 9ICHA 1Z1BA 4LZDA 3QYPA 4M9JA 5J2EA 5IINA 2BGWA 4NLGA 3KKAC 5J2KA 9ICCA 3TACB 3NVZA 3Q8LA 3TANA 3IN5A 3A0HU 4OJLA 3AU2A 4KLOA 1KLNA 1N60A 5AIBA 4F8RA 5KFXA 4DSKA 2YN4A 1ZJNA 2ZIUA 5TISU 5J2DA 1XSLA 1M6YA 5AICA 5J2IA 2F76X 3MDAA 3ED5A 5DBBA 5T14A 1QQ7A 3I76A 4TQSA 1X9MA 3VC8A 9ICMA 1V9PA 5D46A 3OSPA 1WCLA 1LKYB 4RQ6A 5CWRA 3PMNA 5AKIA 2DPIA 2W3RA 4C8KA 1LV5A 9ICBA 5AK5A 1L7OA 5KT6A 2EZZA 2JZBA 5AM1A 3E58A 1QSYA 3G6YA 2OCEA 2F77X 1RDFA 2DKXA 1NKEA 2G5HB 5KFUA 4EEKA 2KIWA 1JI7A 1BPYA 2ZG6A 2JV3A 1XO1A 4RQ8A 1NJYA 5JTIA 9ICWA 3KHRA 3RJHA 8ICPA 4M9NA 5CR0A 1Y88A 5KT5A 3UMGA 4C0ZA 3HILA 8ICBA 4C8LA 4EBEA 1FFUA 3MFHA 4Y2VA 4P4OA 5J2JA 2WB1F 5L1IA 1S0OA 4NWIA 4KX3A 2NRVA 3QUQA 5IIJA 4DFDA 4YD1A 3SAHA 4XQ8A 9ICUA 4G9BA 1H38A 3SV4A 3NTUA 1FEZA 1ZQXA 2PI5A 3K1RB 5EE3A 2P6UA 3MABA 1BPDA 1X9XA 4ELVA 1YZ6A 4IQUA 2VA2A 3KHHA 2HOQA 5HHHA 1S8OA 1ZQLA 1DRGA 2W55A 2VJ5A 3PR5B 4FS1A 1WYGA 2XO7A 3ZDEA 4QZIA 5J2GA 1HJPA 4OJ6A 4OCZA 3OHAA 5E79U 5ALXA 1CUKA 2PFOA 1RZTA 3PY8A 5CRXA 2JGAA 3TARA 1KRPA 4QWAA 2EZXA 4O3PA 3BQ1A 1L7PA 4F91B 4F4ZA 5KNIA 2EH9A 2RDJA 1SIJA 1MQ3A 4R64A 2NV3A 3B0YA 4EELA 1ZD3A 1JRPA 1XWLA 1VLBA 4EX7A 4O0IA 2KVSA 4NLBA 3T3FA 4GLXA 3IM1A 4YCXA 3J81j 4M2YA 3PO5A 1ZQVA 3GZFA 3V7JA 9ICNA 1SKRA 3WK7A 3H7IA 5KG2A 3HKZF 2KJ8A 5CEHA 4DL7A 2MUTA 1BPEA 2J6SA 5DG9A 1V85A 5EE1A 4Z6EA 4O3RA 1HIWA 4RPZA 4KLDA 2ZIUB 5EE9A 1KFDA 2YY6A 4IQTA 3T79A 5TZVA 8ICWA 7ICRA 1X9WA 2KHVA 3QU2A 5GTHU 1KN5A 2KVCA 4IQVA 5KG1A 2XCAA 4NL9C 4YP3A 2JR5A 3QU7A 1NJZA 2W04A 4PZOA 5HR6A 4QIWC 1Z19A 4PH5A 3H40A 3CRXA 9ICFA 3R9KA 4M0AA 5AM3A 3LYSA 8ICGA 3WKEA 7ICNA 2HCFA 8ICSA 4I29A 8ICAA 2JRZA 2YMQA 8ICJA 4DLEA 4JWMA 3NGDA 3TAQA 4US8A 2HHWA 4PGQA 4F92B 4OJPA 3PW2A 4KLLA 1UA1A 1QLNA 1V38A 1N62A 4GC7A 4KLGA 2AU0A 4ECUA 3IP4B 4ED7A 4UB8U 2WF9A 3SYZA 5J0WA 3D2NA 2W54A 1KFTA 2HVIA 1N5XA 1UA0A 1Z4OA 3GIKA 4EENA 2N1RA 3H4DA 4Z6FA 1UT8A 2L5YA 3D6JA 4C8NA 9ICXA 4F72A 3WKBA 3PSIA 2AGPA 5HP4A 3LVVA 1NJWA 4UAWA 1ZQIA 4NY8A 5AKEA 2KFZA 1B22A 5BPCA 3RJKA 3WK6A 2ESEA 1JXLA 5D4BA 4EBCA 3N7SC 2W7PA 3AU6A 3B0XA 4I2IA 3H8JA 3V6KA 2W43A 3SV3A 4OJOA 4R63A 4P0PA 3FDSA 3PX4A 1PK3A 3LWLA 1ZQAA 3K4GA 5KFGA 2KEYA 3TADA 5J0YA 5J0SA 3HT3A 2DUYA 5KFWA 4TQRA 1WG8A 4K4GA 3ISCA 3H8MA 2QARA 4DFKA 5AKKA 1T3NA 5KT2A 4CGZA 2KP7A 5AK6A 1L8LA 2WHEA 2LBOA 1ZQDA 2C2RA 5DBAA 2AGQA 1ZQCA 4MF2A 4GC6A 1O08A 3PNCA 3SI8A 3H8WA 3RRHA 5KFEA 2ISPA 2LHTA 1SV4A 2XICA 3IG5A 4KX5A 4YMNA 1S5LU 4O5EA 3AN1A 3CP8A 1XNSA 4J03A 2BHNA 2R8GA 2RQ5A 2E1EA 1N2XA 5DB7A 1QQ5A 2J6TA 5FP0A 1WUDA 2E3TA 3KKAA 4I2DA 2QLTA 3V6HA 2W3SA 2LYBA 5JRTA 4F4XA 1TK0A 3QUTA 1RYUA 4DCCA 8ICEA 9ICQA 3CW2C 4U7CA 4IS7A 2D6FC 2H3FA 3H4BA 2YMMA 4I2CA 4CE6A 4F3OA 1OW5A 2A19A 4GIBA 3JPTA 4K4IA 3DEEA 4YG2A 4CCHA 4DL3A 3RJEA 1ZD4A 4UW9A 2IOFK 3Q8MA 5AI9A 4J9LA 4RQMA 3HW8A 2YB1A 3PW5A 4PL2A 3OGUA 4G3IA 4PJ0U 5CP2A 3ZD9A 4ACOA 3H0MB 7ICKA 3QXGA 3TFSA 4K4HA 4IRKA 3UQ0A 4JMUA 2K4IA 5ALYA 2P6RA 4QWBA 4IC9A 2XGPA 5DQIA 1JX4A 3WKCA 3KOOA 1L5UA 7ICTA 5IILA 2PFNA 4J9SA 4BDPA 4DSIA 5F9LA 4UATA 5J0UA 2HHTA 1AQ6A 4J9KA 2LYHA 5KFIA 4MFCA 5B66U 1N56A 1XO0A 5AKLA 4DF8A 5G5GA 1TAMA 2WB1C 4RNMA 4F5PA 4Y2TA 4O5KA 2KOBA 4RQ0A 1MSWD 1F0MA 2CRXA 1ZQPA 5HR7A 1KL9A 4C7ZA 4DSJA 5ALOA 3KZIU 3KHLA 4OO1J 2RLTA 1RQNA 1AROP 5KAFU 5ALDA 2YX8A 3GU3A 2FJ6A 4ECZA 5DQGA 2FI1A 1KFSA 3TI0A 1ZJMA 5AIAA 3EPGA 2XI9A 5DDMA 4C8MA 2FPMA 4EBDA 3V72A 2VIXA 1L8OA 1D9FA 3NS1A 4IL6U 2ASJA 3U26A 3F5AA 2I6XA 4JV2A 3FAHA 2JXJA 1JROA 3E0FA 4KLFA 5CA7A 2ZJ8A 4PZNA 4QZ8A 5EOZA 3QU5A 3B9JA 5BOLA 1SL1A 1D9DA 5KL1B
chains in the Genus database with same CATH topology
2CXYA 2YQEA 1C20A 2KK0A 1IG6A 2LM1A 2JXJA 2JRZA 4LJXA 5CEHA 1RYUA 2LI6A 2EQYA 5K4LA 1KQQA 2OEHA 2EH9A 2RQ5A 1KN5A 1KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXY A;  2YQE A;  1C20 A;  2KK0 A;  1IG6 A;  2LM1 A;  2JXJ A;  2JRZ A;  4LJX A;  5CEH A;  1RYU A;  2LI6 A;  2EQY A;  5K4L A;  1KQQ A;  2OEH A;  2EH9 A;  2RQ5 A;  1KN5 A;  1KKX A; 
#chains in the Genus database with same CATH topology
 3MR6 A;  1MQ2 A;  5KFJ A;  1UPH A;  1T3Q A;  1ZQW A;  4C4S A;  1N61 A;  3SD7 A;  2PMZ C;  3A0B U;  3C21 A;  5L1L A;  4UB2 A;  2M9N A;  3MDC A;  4EEY A;  5AKJ A;  4QW9 A;  4F2S A;  1U4B A;  4BXO B;  2FLP A;  1DXS A;  2VKQ A;  4ED2 A;  4J9P A;  4XRH A;  3RRG A;  2K89 A;  2EAM A;  5HNK A;  2DL0 A;  1QSL A;  3QE9 Y;  2Y9U A;  4P0P B;  3IHQ B;  5KFF A;  1PVP A;  3TAD C;  2GLE A;  5JU5 A;  2KHQ A;  3PX6 A;  4TUR A;  2IOH A;  2JZB B;  4ECT A;  2OYY A;  4EZ9 A;  1J2N A;  2KZ3 A;  1OUQ A;  1S0N A;  1ZQF A;  3RH5 A;  4QZG A;  1ECW A;  2AXT U;  2MA1 A;  2V9W A;  7ICH A;  2YTU A;  5DB6 A;  3M9M B;  2XCP A;  3SZ2 A;  4DQI A;  3LWM A;  4DFP A;  5KAI U;  2WAQ C;  1CEZ A;  3AM9 A;  1O03 A;  4AP9 A;  4JWN A;  2HHQ A;  8ICT A;  8ICI A;  4YR0 A;  5L1K A;  3MC1 A;  5ALT A;  3M8R A;  4YMM A;  5KG4 A;  3WK8 A;  3DDH A;  4B9L A;  3M9N B;  4XA5 A;  2IOF A;  4RNO A;  1Q3V A;  1ZQB A;  9ICJ A;  4ED1 A;  4B9V A;  2OHF A;  2FE9 A;  3V7L A;  1ZQU A;  3F53 A;  4QWC A;  2LM1 A;  1PVR A;  3BS7 A;  4QZD A;  2W11 A;  1F5S A;  2B0C A;  4DQP A;  3OTQ A;  2KK0 A;  4F5N A;  4ELT A;  5AI5 A;  4FBU A;  3AL0 B;  3L3F X;  1TK5 A;  4F71 A;  4DLG A;  2P66 A;  4UAS A;  1ZD5 A;  4QZB A;  9ICG A;  2E8M A;  1ZQR A;  4UAV A;  4YVZ A;  5EWG A;  3H8S A;  4XUS A;  4Y2S A;  4DQQ A;  1DK2 A;  1D8L A;  1KW4 A;  2BKE A;  2KD1 A;  2K4H A;  3AMZ A;  4CF5 A;  3PZP A;  4YFK A;  4LJX A;  3SEN A;  3PML A;  2GWS A;  4KLI A;  1BNO A;  5AM5 A;  1NK8 A;  4MF8 A;  3HX0 A;  2CPR A;  1D8Y A;  2HOF A;  2FDR A;  2WTF A;  2AJQ A;  2MSN A;  1NNL A;  2KSO A;  4PL1 A;  4CF4 A;  1Q3U A;  1ZQE A;  1NK7 A;  1TK8 A;  2A1J A;  2NYV A;  4RUA A;  4UAU A;  3N97 B;  2CN1 A;  3RBD A;  5J2C A;  3GV5 B;  1N5W A;  5ALI A;  4UB1 A;  5AKX A;  4UB4 A;  1BPX A;  4PHA A;  3RTV A;  2XY6 A;  2WF7 A;  5J29 A;  2G5I B;  3M8S A;  5IIM A;  1YZ7 A;  3PV8 A;  1Z4N A;  3D2Q A;  5J0T A;  3MGV A;  3KFU F;  3C5F A;  4CRX A;  4ECS A;  4Z6C A;  3UXO A;  4Q43 A;  4RT2 A;  2W9B A;  4F5R A;  1L3V A;  9ICT A;  4DOC A;  2PKE A;  1T94 A;  2XID A;  3H0R B;  2NRW A;  4Y2X A;  5J0R A;  3ISD A;  2ZIV A;  4KLU A;  2HHU A;  1NJX A;  1U45 A;  4UQG A;  1Z00 B;  1NK9 A;  4NXZ A;  2GOL A;  1FO4 A;  3QUB A;  3BS5 A;  5L1J A;  4OJ5 A;  4Q8F A;  4YXJ A;  2H3V A;  7ICO A;  3T5J A;  3RBE A;  5EE0 A;  2G09 A;  5ALP A;  2HBM A;  4LVS A;  1FIQ A;  4BJQ A;  5KG5 A;  2HI0 A;  5KFL A;  4IR1 A;  4DL2 A;  3G6X A;  4I2G A;  7ICJ A;  1SV0 C;  5L9X A;  3T5L A;  1NK6 A;  4CF3 A;  2QB1 A;  3K1Z A;  5F9N A;  1COO A;  4ED8 A;  5J2F A;  1RPL A;  4ICA A;  3EZ5 A;  2BCS A;  4R65 A;  4I2H A;  1BVS A;  3ISB A;  1A77 A;  3ZDC A;  2XY5 A;  5KFO A;  1SKW A;  1S97 A;  4KN7 A;  5ALM A;  3FM9 A;  3RB3 A;  2G06 A;  3M9O B;  2B21 A;  1JUD A;  5GTI U;  4B9U A;  4IRD A;  2AGO A;  5AM2 A;  2FMS A;  1L3T A;  4F5Q A;  4ECY A;  4QW8 A;  4RQ3 A;  4QWE A;  1IIP A;  2I1Q A;  4Y2Y A;  5HMM A;  8ICZ A;  2DBY A;  2XY7 A;  9ICA A;  2KN7 A;  1ZXI A;  2O6K A;  4C7Y A;  4PHD A;  2IHM A;  4NLN A;  3WK4 A;  1DK3 A;  2Y9T A;  4ED6 A;  1B43 A;  1SZP A;  2BCR A;  2F1J A;  1X66 A;  2YB4 A;  3PX0 A;  4ECQ A;  4PHP A;  1ZQG A;  1SB3 C;  8ICO A;  9ICP A;  2KJ5 A;  2E8N A;  2AH5 A;  1ZQM A;  3BZC A;  2W9A A;  2PXI A;  5AI6 A;  4DOB A;  4DS5 A;  2HVH A;  1U9L A;  1NOM A;  3EW9 A;  2Y1I A;  3OPX A;  4NLZ A;  5KFP A;  4DF4 A;  1BPZ A;  3RJI A;  2QB0 A;  4RU9 A;  3BQ7 A;  4UAY A;  4F4Y A;  3PR4 A;  3GIM A;  3ZD8 A;  5EWF A;  5KG7 A;  5DB9 A;  4YR3 A;  3NVY A;  5HHI A;  3TAP A;  2KG5 A;  3MGH A;  5DLG A;  5KFT A;  1PZN A;  1QQ6 A;  2JH7 A;  4YN4 A;  4Y2J A;  5KFV A;  2BZF A;  1C7Y A;  4NM1 A;  1T4G A;  5AI8 A;  3IV6 A;  5DQH A;  1SGG A;  3PW0 A;  2BCU A;  1QSS A;  2Y0S F;  5DB8 A;  4RQ5 A;  4TUP A;  5DGB A;  2HBK A;  2R18 A;  4GXK A;  4DO9 A;  2ZIV B;  2ZTE A;  2D3D A;  1LB2 B;  3I28 A;  3RF9 A;  2W8K A;  1NKB A;  5J0P A;  1ZD2 P;  3PSP A;  1WWU A;  2HW3 A;  3JPP A;  1UCV A;  3QU9 A;  5KG0 A;  4KMO B;  3NVW A;  4DQR A;  5ALE A;  8ICH A;  2R8K A;  7ICS A;  9ICV A;  4NLC A;  2NRZ A;  4Q44 A;  4M9H A;  3E2E A;  2XVT A;  4QZH A;  1X42 A;  4PHE A;  5AM4 A;  4KMU A;  5DDY A;  5EWE A;  1YT3 A;  4GXI A;  4JV0 A;  4RNN A;  4DL6 A;  4AYB C;  1VDV A;  3QU4 A;  2ALZ A;  5AI4 A;  1WWV A;  4A8E A;  2RP5 A;  3MR5 A;  4YMO A;  5KT3 A;  3ORY A;  4WJ3 B;  2FPK A;  2NO5 A;  3HPO A;  4JV1 A;  4NL9 A;  4RQ4 A;  1XSP A;  1LVH A;  3UXN A;  1K1Q A;  1S0V A;  2LM4 A;  3RR7 A;  1JIH A;  4ELU A;  5KFA A;  1L6N A;  2M0N A;  4GFJ A;  4RZR A;  1ZQQ A;  5CJ7 A;  4MEX A;  1RYR A;  2J6U A;  3BDP A;  1Z00 A;  2KIC A;  1RM6 C;  4KTQ A;  2ZXH A;  2C28 A;  5CHG A;  1TV9 A;  2NRT A;  2BPF A;  3PW4 A;  3WU2 U;  2E1F A;  5AI0 A;  4NLK A;  2K8C B;  4P0Q A;  3PW7 A;  2IBK A;  2FLL A;  8ICL A;  1CI4 A;  4NJ8 A;  2F2A B;  4QNL A;  3OSN A;  5KFR A;  1NKC A;  1A0P A;  5DG8 A;  1SWW A;  1ZQZ A;  7ICM A;  4QIW F;  2I9G A;  3Q8P B;  1WCN A;  2E8P A;  4ED0 A;  1URJ A;  4TUS A;  1NK4 A;  4TUQ A;  3QX7 A;  5AK3 A;  4PPX A;  1SXE A;  5A0L A;  4EYH B;  1VJ5 A;  4I2E A;  4O3M A;  9ICK A;  2NO4 A;  2KSO B;  2Q4T A;  4F93 B;  4Y2U A;  3M1Y A;  4BXO A;  1DGS A;  1K5O A;  4J9O A;  2PI4 A;  1BGX T;  4IQW A;  1ZQ1 C;  2RRD A;  5DG7 A;  2OXO A;  4FZM A;  1QTM A;  9ICS A;  4MFA A;  4UB5 A;  2Z7J A;  2EAP A;  3MFI A;  1KSP A;  4O3Q A;  3IDW A;  3NRZ A;  5B5E U;  3M7D A;  1ZQH A;  2BQU A;  4RQ2 A;  4R66 A;  2JMG A;  3BQ0 A;  3O0F A;  1J97 A;  3V7K A;  4B9S A;  3H0L B;  1IV8 A;  2MU2 A;  4BGD A;  8ICR A;  1Z3E B;  2XC9 A;  5KFY A;  1DOQ A;  7ICV A;  2ASL A;  3M6K A;  2K60 A;  3KD3 A;  1EXN A;  5BOM A;  4P4M A;  1PUZ A;  5ALQ A;  4F5O A;  1TAQ A;  1L3U A;  2D8C A;  4F4W A;  4KLM A;  2AHO B;  2BPC A;  1FFV A;  1UT5 A;  3HP6 A;  5HML A;  7ICU A;  1RG6 A;  3RAX A;  8ICY A;  3WKA A;  2LPE A;  5AKZ A;  1NZP A;  3RR8 A;  1N63 A;  3N4M B;  5J8Y C;  2PFP A;  1JN3 A;  2HBJ A;  7ICP A;  2C2D A;  1ZOL A;  1SZH A;  1F44 A;  3MR2 A;  3MR3 A;  3T5K A;  4ECX A;  2F44 A;  1Q8K A;  4ECR A;  5G5H A;  4UB6 U;  3GIJ A;  2H3Z A;  3F2C A;  2KIV A;  2KNJ A;  3F5E A;  5AKG A;  1NK5 A;  1KEJ A;  1IM4 A;  4Z6D A;  2KFN A;  3QEA Z;  1XC9 A;  3AQF A;  3GII A;  4DL5 A;  1ZQJ A;  1RXV A;  2OWO A;  5ALH A;  1ZET A;  4KIT B;  2ASD A;  2DPJ A;  1ZQK A;  4Y2P A;  4DL4 A;  3FC4 A;  4EYI B;  2UVW A;  7ICL A;  4PGX A;  4BWM A;  1PK1 A;  4UB3 A;  3RB4 A;  3GDX A;  5KFC A;  4KLE A;  2XGQ A;  3IRU A;  4KLJ A;  2BQ3 A;  1MA7 A;  4O9M A;  5KFB A;  2LYA A;  2Y0S C;  3HKZ C;  4J9N A;  4ECV A;  3G6V A;  5ALN A;  2E8O A;  4DFM A;  2EZY A;  5KFM A;  5AM0 A;  3K75 D;  3Q8Q B;  3NVV A;  4M9L A;  8ICN A;  2A3V A;  2QKQ A;  2ODG A;  3JPS A;  3GQC A;  5ALF A;  4U6P A;  1SXD A;  1XU4 A;  3C1Y A;  2ES6 A;  2HHS A;  2E5S A;  3LVW A;  3RJF A;  2RDI A;  2KKP A;  4USA A;  4YR2 A;  2OEH A;  5C5J A;  1ZQY A;  4B9M A;  3RJG A;  8ICX A;  3RB0 A;  4M04 A;  4JK1 A;  3GFK B;  4RT3 A;  5AKH A;  2YQE A;  2W9C A;  7ICF A;  1S0M A;  4DSF A;  2ZIW B;  4BX9 C;  1SL2 A;  2ZTC A;  1S76 D;  3N7R C;  5AK4 A;  4I2F A;  2JEJ A;  1ZRM A;  2VAN A;  4DQS A;  3L5K A;  2CXY A;  2ZIX A;  3EPI A;  5K4L A;  4KLT A;  3KHG A;  4UBC A;  1CRX A;  4Q8E A;  2ZUD A;  4HAI A;  2MRL A;  3ETL A;  4DSL A;  3UM9 A;  2AQ0 A;  3DV9 A;  4DOA A;  3CYM A;  2F3N A;  2I5H A;  2W8L A;  3LDA A;  4O3S A;  2KV2 A;  5J2H A;  3SMV A;  3C1Z A;  1MN8 A;  2JEF A;  3Q8K A;  4F4K A;  2EAN A;  4QJF B;  1KBU A;  2ZJA A;  1SL0 A;  3UMC A;  4CNQ A;  1V97 A;  3SEI A;  1SWV A;  4PGY A;  4NM2 A;  1TVA A;  2ZJ5 A;  5KFQ A;  3N7P D;  3TFR A;  4FFD A;  3RH4 A;  1D8B A;  1X6J A;  4F50 A;  1UQV A;  2LMR A;  2LKY A;  2G07 A;  4KLH A;  4QZE A;  1ZYQ A;  2UVU A;  5JUM A;  1KKX A;  1NK0 A;  1GO3 F;  2BCV A;  1IXR A;  3BQ2 A;  4I28 A;  3THV A;  3GV8 B;  4JUZ A;  4EX6 A;  2WF6 A;  8ICC A;  8ICF A;  5J2A A;  8ICV A;  3CNH A;  4KLQ A;  5IIO A;  4RPY A;  1QH9 A;  5KFK A;  2VJ4 A;  4X5V A;  4J9Q A;  1SKS A;  3NUQ A;  3RFA A;  3OJU A;  5ALU A;  5DKW A;  5KFZ A;  1IG6 A;  3JPO A;  1ZQS A;  4HYK A;  3KTQ A;  2PFQ A;  5AHX A;  5J0O A;  4OD0 A;  3ALR A;  1NZB A;  4RQ1 A;  2HMX A;  1HUZ A;  4QZA A;  4GXJ A;  1HEK A;  1K1S A;  1KDH A;  5C0Y A;  1KTQ A;  5KFN A;  1KQQ A;  2FMQ A;  4QZC A;  3ZDB A;  3NAS A;  1RQL A;  5CB1 A;  3C2M A;  1XSN A;  2R8J A;  1ZQN A;  2BDU A;  3SAF A;  3QZ7 A;  3KBB A;  2DQN B;  1X2I A;  5KG3 A;  2K8B B;  5KT4 A;  5DLF A;  1ZQT A;  3ICX A;  3N28 A;  4C4T A;  2DGZ A;  2DWQ A;  9ICL A;  8ICM A;  2MAX A;  5J0Q A;  3BS5 B;  3QEB Z;  2P35 A;  1JMS A;  3EUB 2;  5ALW A;  4Y2Q A;  4O3N A;  2UVV A;  2KZZ A;  2OM6 A;  1TE2 A;  2JH1 A;  3RAQ A;  4RUC A;  1A76 A;  4YXM A;  1COK A;  2JHD A;  4YD2 A;  1U49 A;  1TKD A;  4FE3 A;  2C22 A;  4MEY A;  4R8U B;  2HOI A;  2JEG A;  2W9B B;  1TAU A;  3SQI A;  3RJJ A;  2MUT B;  3UQ2 A;  2GH1 A;  1QCK A;  3C5G A;  5KT7 A;  5KTQ A;  3ONN A;  2BPG A;  2EDU A;  3ZDA A;  3ETR A;  1ZQO A;  2G0A A;  3T5H A;  2FPL A;  5KFH A;  2F8L A;  1U47 A;  1C20 A;  2F8K A;  3Q8R B;  4US9 A;  4EZ6 A;  3UMB A;  2BQR A;  2ZIX B;  3V6J A;  4CDG A;  2IA6 A;  1S10 A;  2GO7 A;  4I2J A;  4RQN A;  2HHX A;  2Q0Z X;  5ALJ A;  2RHF A;  3C29 A;  4I2B A;  4JB3 A;  1ED1 A;  2A1A A;  1S9F A;  1JAL A;  1S77 D;  2HDO A;  4RPX A;  2HBL A;  4M9G A;  3PO4 A;  4ZOH C;  2VA8 A;  1RXW A;  4ED3 A;  2K4E A;  2F1I A;  1J2M A;  1Q46 A;  3C2K A;  2Y1J A;  2HHV A;  4DEZ A;  4B9N A;  4UAZ A;  3I1Y A;  5DGA A;  3RB6 A;  1L7M A;  3TKA A;  2JEI A;  1OXJ A;  2YML A;  5ALS A;  3PVX A;  1RYS A;  2W9C B;  3JPR A;  8ICU A;  3QZ8 A;  3TQ1 A;  1B0X A;  3LK9 A;  1PVQ A;  5KFS A;  5L1M A;  2QB0 B;  4IRC A;  3HJE A;  1T8E A;  2V4Q A;  2KZM A;  1SV0 A;  5F3X B;  3SAG A;  1JXE A;  1U48 A;  4F2R A;  9ICO A;  3S6J A;  1X9S A;  3VCB A;  2LI6 A;  1LKY A;  4MHV A;  9ICE A;  2R8H A;  2WF5 A;  4KLS A;  1N48 A;  1B4F A;  1L3S A;  5IIK A;  1MC8 A;  3FYH A;  1BPB A;  4P4P A;  2AQ4 A;  2DF4 B;  1ZRN A;  2C2E A;  2ZUC A;  5ALV A;  4M47 A;  3C23 A;  2ZUB A;  3Q8S B;  2QAR B;  3AEV A;  4Y2R A;  3F2D A;  3AUO A;  2H3I A;  3PST A;  4BWJ A;  3ZI4 A;  3C28 A;  5ALZ A;  3NRW A;  5ALL A;  2UVR A;  3PSF A;  3M6Z A;  3RH6 A;  5KFD A;  3WK9 A;  2WF8 A;  2G08 A;  3L4P A;  3HRD D;  2W7O A;  4M6W B;  1X40 A;  2KKV A;  4O3O A;  2K8A A;  3MBY A;  4UBB A;  1X6I A;  7ICQ A;  3BQT A;  4YQW A;  4LZG A;  5ALG A;  2NRX A;  5ALK A;  2HSZ A;  4BUG A;  3WKD A;  2KJ9 A;  4FBT A;  3AQE A;  3QNM A;  1P7D A;  2DKZ A;  7ICE A;  4O5C A;  4QWD A;  5J0X A;  4C8O A;  4C80 A;  4NV0 A;  3ZDD A;  4I2A A;  5DBC A;  1XS9 D;  9ICI A;  4ZH4 A;  5J8Y A;  1DGJ A;  7ICG A;  1TFR A;  2ZIW A;  2W9M A;  2W03 A;  4B6J A;  8ICQ A;  4DSE A;  4Q45 A;  2BR0 A;  2H5X A;  2BCQ A;  4J9R A;  4QZF A;  5H2F U;  1UHU A;  3KZX A;  2EQY A;  3EYZ A;  4P2H A;  2K4P A;  8ICK A;  4MFF A;  2WAQ F;  4ECW A;  3D2S A;  1Z1V A;  3IG8 A;  2H3Q A;  2IMW P;  5III A;  2R8I A;  5AKY A;  4DS4 A;  4FO6 A;  5J2B A;  4DFJ A;  1BNP A;  4FZN A;  3OHB A;  2OH2 A;  4DWI A;  4M6W A;  3OJS A;  3SR6 A;  2ZTD A;  3QUC A;  2FLN A;  2VA3 A;  2A1J B;  2FMP A;  5ALR A;  4KN4 A;  4J9M A;  2KE7 A;  2ZXI A;  4RQ7 A;  3WK5 A;  4QZ9 A;  5KL8 B;  2BDP A;  4R8U A;  3F2B A;  2KMD A;  3C2L A;  4AYB F;  5D49 A;  2ISO A;  4UAR A;  2YMP A;  3MGI A;  4I27 A;  3BZK A;  2KTQ A;  4IR9 A;  4E0D A;  2B6G A;  1T7P A;  9ICR A;  2F1H A;  3JPN A;  5KG6 A;  1A6S A;  2WFA A;  4B9T A;  3GV7 B;  3UXP A;  1L7N A;  3UPQ A;  2IHN A;  2ATL A;  2DFL A;  3GIL A;  3EWA A;  1PK1 B;  2V4R A;  4FS2 A;  3HWT A;  4P0Q B;  4FZL A;  3JPQ A;  2EAO A;  1NI3 A;  3BJY A;  2PMZ F;  7ICI A;  4C4R A;  1HUO A;  9ICH A;  1Z1B A;  4LZD A;  3QYP A;  4M9J A;  5J2E A;  5IIN A;  2BGW A;  4NLG A;  3KKA C;  5J2K A;  9ICC A;  3TAC B;  3NVZ A;  3Q8L A;  3TAN A;  3IN5 A;  3A0H U;  4OJL A;  3AU2 A;  4KLO A;  1KLN A;  1N60 A;  5AIB A;  4F8R A;  5KFX A;  4DSK A;  2YN4 A;  1ZJN A;  2ZIU A;  5TIS U;  5J2D A;  1XSL A;  1M6Y A;  5AIC A;  5J2I A;  2F76 X;  3MDA A;  3ED5 A;  5DBB A;  5T14 A;  1QQ7 A;  3I76 A;  4TQS A;  1X9M A;  3VC8 A;  9ICM A;  1V9P A;  5D46 A;  3OSP A;  1WCL A;  1LKY B;  4RQ6 A;  5CWR A;  3PMN A;  5AKI A;  2DPI A;  2W3R A;  4C8K A;  1LV5 A;  9ICB A;  5AK5 A;  1L7O A;  5KT6 A;  2EZZ A;  2JZB A;  5AM1 A;  3E58 A;  1QSY A;  3G6Y A;  2OCE A;  2F77 X;  1RDF A;  2DKX A;  1NKE A;  2G5H B;  5KFU A;  4EEK A;  2KIW A;  1JI7 A;  1BPY A;  2ZG6 A;  2JV3 A;  1XO1 A;  4RQ8 A;  1NJY A;  5JTI A;  9ICW A;  3KHR A;  3RJH A;  8ICP A;  4M9N A;  5CR0 A;  1Y88 A;  5KT5 A;  3UMG A;  4C0Z A;  3HIL A;  8ICB A;  4C8L A;  4EBE A;  1FFU A;  3MFH A;  4Y2V A;  4P4O A;  5J2J A;  2WB1 F;  5L1I A;  1S0O A;  4NWI A;  4KX3 A;  2NRV A;  3QUQ A;  5IIJ A;  4DFD A;  4YD1 A;  3SAH A;  4XQ8 A;  9ICU A;  4G9B A;  1H38 A;  3SV4 A;  3NTU A;  1FEZ A;  1ZQX A;  2PI5 A;  3K1R B;  5EE3 A;  2P6U A;  3MAB A;  1BPD A;  1X9X A;  4ELV A;  1YZ6 A;  4IQU A;  2VA2 A;  3KHH A;  2HOQ A;  5HHH A;  1S8O A;  1ZQL A;  1DRG A;  2W55 A;  2VJ5 A;  3PR5 B;  4FS1 A;  1WYG A;  2XO7 A;  3ZDE A;  4QZI A;  5J2G A;  1HJP A;  4OJ6 A;  4OCZ A;  3OHA A;  5E79 U;  5ALX A;  1CUK A;  2PFO A;  1RZT A;  3PY8 A;  5CRX A;  2JGA A;  3TAR A;  1KRP A;  4QWA A;  2EZX A;  4O3P A;  3BQ1 A;  1L7P A;  4F91 B;  4F4Z A;  5KNI A;  2EH9 A;  2RDJ A;  1SIJ A;  1MQ3 A;  4R64 A;  2NV3 A;  3B0Y A;  4EEL A;  1ZD3 A;  1JRP A;  1XWL A;  1VLB A;  4EX7 A;  4O0I A;  2KVS A;  4NLB A;  3T3F A;  4GLX A;  3IM1 A;  4YCX A;  3J81 j;  4M2Y A;  3PO5 A;  1ZQV A;  3GZF A;  3V7J A;  9ICN A;  1SKR A;  3WK7 A;  3H7I A;  5KG2 A;  3HKZ F;  2KJ8 A;  5CEH A;  4DL7 A;  2MUT A;  1BPE A;  2J6S A;  5DG9 A;  1V85 A;  5EE1 A;  4Z6E A;  4O3R A;  1HIW A;  4RPZ A;  4KLD A;  2ZIU B;  5EE9 A;  1KFD A;  2YY6 A;  4IQT A;  3T79 A;  5TZV A;  8ICW A;  7ICR A;  1X9W A;  2KHV A;  3QU2 A;  5GTH U;  1KN5 A;  2KVC A;  4IQV A;  5KG1 A;  2XCA A;  4NL9 C;  4YP3 A;  2JR5 A;  3QU7 A;  1NJZ A;  2W04 A;  4PZO A;  5HR6 A;  4QIW C;  1Z19 A;  4PH5 A;  3H40 A;  3CRX A;  9ICF A;  3R9K A;  4M0A A;  5AM3 A;  3LYS A;  8ICG A;  3WKE A;  7ICN A;  2HCF A;  8ICS A;  4I29 A;  8ICA A;  2JRZ A;  2YMQ A;  8ICJ A;  4DLE A;  4JWM A;  3NGD A;  3TAQ A;  4US8 A;  2HHW A;  4PGQ A;  4F92 B;  4OJP A;  3PW2 A;  4KLL A;  1UA1 A;  1QLN A;  1V38 A;  1N62 A;  4GC7 A;  4KLG A;  2AU0 A;  4ECU A;  3IP4 B;  4ED7 A;  4UB8 U;  2WF9 A;  3SYZ A;  5J0W A;  3D2N A;  2W54 A;  1KFT A;  2HVI A;  1N5X A;  1UA0 A;  1Z4O A;  3GIK A;  4EEN A;  2N1R A;  3H4D A;  4Z6F A;  1UT8 A;  2L5Y A;  3D6J A;  4C8N A;  9ICX A;  4F72 A;  3WKB A;  3PSI A;  2AGP A;  5HP4 A;  3LVV A;  1NJW A;  4UAW A;  1ZQI A;  4NY8 A;  5AKE A;  2KFZ A;  1B22 A;  5BPC A;  3RJK A;  3WK6 A;  2ESE A;  1JXL A;  5D4B A;  4EBC A;  3N7S C;  2W7P A;  3AU6 A;  3B0X A;  4I2I A;  3H8J A;  3V6K A;  2W43 A;  3SV3 A;  4OJO A;  4R63 A;  4P0P A;  3FDS A;  3PX4 A;  1PK3 A;  3LWL A;  1ZQA A;  3K4G A;  5KFG A;  2KEY A;  3TAD A;  5J0Y A;  5J0S A;  3HT3 A;  2DUY A;  5KFW A;  4TQR A;  1WG8 A;  4K4G A;  3ISC A;  3H8M A;  2QAR A;  4DFK A;  5AKK A;  1T3N A;  5KT2 A;  4CGZ A;  2KP7 A;  5AK6 A;  1L8L A;  2WHE A;  2LBO A;  1ZQD A;  2C2R A;  5DBA A;  2AGQ A;  1ZQC A;  4MF2 A;  4GC6 A;  1O08 A;  3PNC A;  3SI8 A;  3H8W A;  3RRH A;  5KFE A;  2ISP A;  2LHT A;  1SV4 A;  2XIC A;  3IG5 A;  4KX5 A;  4YMN A;  1S5L U;  4O5E A;  3AN1 A;  3CP8 A;  1XNS A;  4J03 A;  2BHN A;  2R8G A;  2RQ5 A;  2E1E A;  1N2X A;  5DB7 A;  1QQ5 A;  2J6T A;  5FP0 A;  1WUD A;  2E3T A;  3KKA A;  4I2D A;  2QLT A;  3V6H A;  2W3S A;  2LYB A;  5JRT A;  4F4X A;  1TK0 A;  3QUT A;  1RYU A;  4DCC A;  8ICE A;  9ICQ A;  3CW2 C;  4U7C A;  4IS7 A;  2D6F C;  2H3F A;  3H4B A;  2YMM A;  4I2C A;  4CE6 A;  4F3O A;  1OW5 A;  2A19 A;  4GIB A;  3JPT A;  4K4I A;  3DEE A;  4YG2 A;  4CCH A;  4DL3 A;  3RJE A;  1ZD4 A;  4UW9 A;  2IOF K;  3Q8M A;  5AI9 A;  4J9L A;  4RQM A;  3HW8 A;  2YB1 A;  3PW5 A;  4PL2 A;  3OGU A;  4G3I A;  4PJ0 U;  5CP2 A;  3ZD9 A;  4ACO A;  3H0M B;  7ICK A;  3QXG A;  3TFS A;  4K4H A;  4IRK A;  3UQ0 A;  4JMU A;  2K4I A;  5ALY A;  2P6R A;  4QWB A;  4IC9 A;  2XGP A;  5DQI A;  1JX4 A;  3WKC A;  3KOO A;  1L5U A;  7ICT A;  5IIL A;  2PFN A;  4J9S A;  4BDP A;  4DSI A;  5F9L A;  4UAT A;  5J0U A;  2HHT A;  1AQ6 A;  4J9K A;  2LYH A;  5KFI A;  4MFC A;  5B66 U;  1N56 A;  1XO0 A;  5AKL A;  4DF8 A;  5G5G A;  1TAM A;  2WB1 C;  4RNM A;  4F5P A;  4Y2T A;  4O5K A;  2KOB A;  4RQ0 A;  1MSW D;  1F0M A;  2CRX A;  1ZQP A;  5HR7 A;  1KL9 A;  4C7Z A;  4DSJ A;  5ALO A;  3KZI U;  3KHL A;  4OO1 J;  2RLT A;  1RQN A;  1ARO P;  5KAF U;  5ALD A;  2YX8 A;  3GU3 A;  2FJ6 A;  4ECZ A;  5DQG A;  2FI1 A;  1KFS A;  3TI0 A;  1ZJM A;  5AIA A;  3EPG A;  2XI9 A;  5DDM A;  4C8M A;  2FPM A;  4EBD A;  3V72 A;  2VIX A;  1L8O A;  1D9F A;  3NS1 A;  4IL6 U;  2ASJ A;  3U26 A;  3F5A A;  2I6X A;  4JV2 A;  3FAH A;  2JXJ A;  1JRO A;  3E0F A;  4KLF A;  5CA7 A;  2ZJ8 A;  4PZN A;  4QZ8 A;  5EOZ A;  3QU5 A;  3B9J A;  5BOL A;  1SL1 A;  1D9D A;  5KL1 B; 
#chains in the Genus database with same CATH homology
 2CXY A;  2YQE A;  1C20 A;  2KK0 A;  1IG6 A;  2LM1 A;  2JXJ A;  2JRZ A;  4LJX A;  5CEH A;  1RYU A;  2LI6 A;  2EQY A;  5K4L A;  1KQQ A;  2OEH A;  2EH9 A;  2RQ5 A;  1KN5 A;  1KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...