1KQQA

Solution structure of the dead ringer arid-dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
b'GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAALTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRREG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*TP*AP*TP*TP*GP*AP*TP*GP*TP*GP*G)-3'
publication title The structure of the Dead ringer-DNA complex reveals how AT-rich interaction domains (ARIDs) recognize DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kqqA00
1KKXA 2OEHA 1KN5A 2LM1A 1IG6A 1KQQA 2EH9A 2JXJA 1C20A 2EQYA 2YQEA 2LI6A 5K4LA 4LJXA 5CEHA 2KK0A 2CXYA 2RQ5A 2JRZA 1RYUA
chains in the Genus database with same CATH superfamily
2F77X 2J6UA 3RTVA 3V72A 4B9VA 4M0AA 1DK2A 2WFAA 4Y2UA 4R64A 5KFRA 4P0PB 2WAQC 3BQ2A 4KLHA 5AI9A 1KKXA 4F4XA 5DLFA 2KVCA 3NUQA 3MGVA 3K1RB 4O3SA 1X6IA 2KG5A 4I2EA 2KKPA 4R63A 1NK6A 4BGDA 4UQGA 2R8JA 1N48A 5L1MA 1V9PA 2P35A 3M1YA 1KRPA 2C22A 4QZ9A 5DG7A 5D4BA 2W43A 2BQUA 2W9AA 1CI4A 3C2KA 4UB3A 2ATLA 3UMGA 2LBOA 2YB1A 3KD3A 3CP8A 1B22A 2YB4A 3DV9A 2DL0A 1C7YA 2OYYA 5AKGA 5AM1A 4RNOA 3F5EA 3QUQA 5FP0A 4KLFA 5DQIA 3F5AA 2HHVA 4TQSA 4RQNA 4U6PA 3BZKA 4QZBA 5BOLA 3PSFA 5AM3A 2BPGA 1HEKA 2ZJAA 2R18A 5L1JA 2G07A 4YMMA 4OJOA 2WF9A 3JPPA 1J2MA 4UB1A 4UBBA 3JPOA 1HIWA 1TVAA 4ECYA 2Y0SF 3H0MB 4HYKA 2I6XA 1NKCA 4FBUA 5AICA 4LVSA 2H3IA 3KZXA 1ZD4A 3ZDCA 5DBBA 4MFAA 1KBUA 4DLEA 1S10A 4F5PA 3HWTA 2QARB 5AKYA 2IOFA 4QWEA 1LKYB 4EBDA 4Y2SA 1D8LA 8ICAA 3RF9A 2ZIVA 5ALRA 5CR0A 2RQ5A 4FZNA 1ZQTA 3SYZA 1L7MA 4EENA 3MFHA 3WU2U 1KFSA 4KTQA 2VANA 3RH5A 4J9SA 2K8AA 2LM1A 5EWEA 4ELTA 5J29A 4DL4A 4UATA 4CRXA 2BQ3A 4EEKA 1S97A 3ISCA 1ZQQA 2P6UA 4F5NA 2HW3A 9ICVA 4I29A 3F53A 3CW2C 1UT5A 2G5IB 2BPFA 4KLJA 5KG0A 3Q8PB 7ICGA 4I27A 3OGUA 3IP4B 1Q3VA 1L7PA 4I2GA 4B9TA 4UAYA 5ALYA 1WWVA 9ICJA 2ZIUA 2FLPA 3PNCA 9ICKA 4OJ5A 2UVUA 4IR1A 8ICJA 2PFQA 5J2HA 3M8SA 3QUBA 2KFNA 3BDPA 3Q8MA 4QNLA 2KE7A 2K4HA 2K8BB 4Y2YA 5KT5A 8ICBA 1K1QA 4QW9A 1WG8A 5EE3A 5KFIA 1S5LU 4YR0A 1KN5A 3KKAC 4DQIA 1PVRA 5CRXA 1NNLA 3FAHA 1QH9A 3NRZA 1QLNA 4GC7A 3TAQA 3C5FA 4RNNA 4ECUA 3TADC 3WKCA 3SMVA 5KFCA 2I1QA 1MC8A 2LM4A 3PSTA 4PHDA 2KN7A 3HKZF 5AM0A 1S9FA 3SZ2A 3HP6A 3RJKA 9ICFA 2H5XA 5L1IA 2KD1A 5IIIA 4RQ6A 1RYRA 5ALHA 5DBAA 4QIWC 4FS1A 4EYIB 1VLBA 4F72A 4US9A 1SL0A 1FEZA 4NL9C 3RFAA 4QW8A 2NRWA 3RAQA 1Z00B 2W9MA 2JV3A 1URJA 5KFDA 1TKDA 2KEYA 3RB4A 5KFPA 2F8KA 2XGPA 2IHMA 1YZ7A 2YMMA 2Y9TA 2LYHA 1GO3F 2CXYA 1QSYA 3LVVA 2HVHA 3M7DA 4A8EA 4M2YA 5KFSA 2HCFA 1IV8A 3FDSA 2K60A 5KNIA 3IG8A 4CE6A 3BS7A 5E79U 5HMLA 2UVVA 3WK6A 3H8MA 4GIBA 2AQ4A 7ICIA 1L7OA 2QKQA 4KLLA 5A0LA 3D2NA 5KFFA 1A6SA 5KG2A 4GXJA 2BDPA 1N60A 3F2DA 3RJJA 1T3QA 3V6KA 4PGYA 1SZHA 4O3RA 2WTFA 2G06A 3C2MA 9ICHA 3UPQA 2PKEA 3GQCA 4ED1A 1COOA 2DQNB 2H3QA 2QB0B 2BCQA 3A0HU 4ED2A 3PSIA 5KG7A 4U7CA 3OJUA 4JWNA 5KT4A 1D8BA 4PGXA 3QU5A 1BPBA 3LYSA 2LMRA 3BJYA 4Y2XA 4ACOA 2YN4A 2YY6A 2ZTDA 3RJHA 3Q8QB 2BDUA 5ALSA 5L1LA 2WB1C 3E2EA 4B9UA 2HHUA 2NO5A 4ED6A 3RAXA 2F3NA 1DK3A 1QCKA 7ICRA 2E1EA 2MUTA 4Z6EA 1NK0A 1A77A 4YR2A 4IQWA 4BXOA 2PMZF 4Z6DA 3WKBA 4F4YA 3N7SC 4EX6A 1ZQRA 4CF3A 4DEZA 3PW4A 7ICNA 4DQQA 2MRLA 3M9OB 3MC1A 5J2FA 4Y2RA 3I76A 1TK5A 4O0IA 3NRWA 2F1IA 4JB3A 4NJ8A 3RRHA 4XUSA 2NRTA 3OPXA 1HUOA 1IG6A 5KAFU 4EZ6A 3PW0A 4DQSA 9ICPA 1COKA 4F5QA 1KDHA 5JRTA 3UQ2A 1H38A 2A1JA 4F4WA 2C2EA 2XICA 1U9LA 1X2IA 2BKEA 2V9WA 4F93B 3RH4A 4XA5A 8ICGA 8ICVA 2Q4TA 2FDRA 3LDAA 3A0BU 4RZRA 1D9DA 4M6WB 5KFLA 5J2AA 3Q8LA 2NRXA 4C8KA 5AKJA 4ZH4A 1YT3A 4M9NA 2OEHA 3MDAA 2CN1A 3H4BA 9ICGA 4I2CA 8ICFA 4E0DA 2K4IA 1IM4A 2JH7A 4QZ8A 4RNMA 5EE0A 5DQGA 2C2DA 4Q8EA 4F91B 5IILA 1U4BA 2P6RA 5DQHA 3H7IA 4C80A 4M9HA 3F2BA 1SV0C 4DO9A 4DFPA 2A3VA 2W3RA 4TUPA 3B9JA 1BPDA 4NLKA 4B9SA 4CGZA 2K8CB 2JEGA 2HHWA 4R65A 3V6JA 5CHGA 1JX4A 3ZDBA 1WCLA 8ICIA 4IL6U 4BJQA 4J9MA 5F9LA 4O3OA 2BGWA 3MGHA 1X9WA 4UB8U 3HRDD 5J0SA 1KTQA 3PZPA 5KG4A 3GIJA 2E8OA 4DFJA 5ALKA 4JV1A 3UM9A 1S76D 3PW2A 1NI3A 1DGSA 5EE9A 4RQ4A 2KSOA 3AUOA 1NKEA 1KEJA 3UXPA 8ICKA 1OXJA 4Z6CA 1F0MA 2EAPA 2FJ6A 4G9BA 2EZYA 4PHPA 4GXKA 4AYBC 2B0CA 9ICSA 4ED8A 5J2CA 3SQIA 4JK1A 3WKAA 3T5HA 4PL2A 2F2AB 3EPIA 3DDHA 2E1FA 4KLMA 9ICQA 4YN4A 1ZQZA 4ECSA 1TV9A 3PX6A 3MBYA 3UXNA 4KLIA 3B0YA 2ZIWB 4ICAA 1ZRNA 2WHEA 4P0QB 1P7DA 3LK9A 1PK3A 4EX7A 2YMQA 3K4GA 5IIKA 4KX5A 4BDPA 2ES6A 2W9CA 4GXIA 4RQ1A 1SWWA 1JIHA 4WJ3B 5J8YA 5JUMA 2HVIA 1UA0A 5KL1B 5KFHA 3TI0A 5DBCA 2C28A 4NM2A 3PW5A 5KL8B 3NVWA 8ICSA 1RDFA 1KLNA 1V97A 7ICHA 5J2GA 3TANA 2VA2A 2MU2A 2KZMA 3JPTA 1L5UA 4P2HA 5BOMA 2LYBA 3D2SA 2KJ9A 5AI8A 4NLNA 5B66U 5KG3A 4PZNA 4I2AA 2HBMA 1SXEA 2DBYA 4UASA 3NTUA 4XRHA 4CF5A 2W9BA 5KTQA 3SEIA 2GWSA 2F1JA 2AHOB 2QLTA 3ONNA 3LVWA 2W55A 1MN8A 4DSIA 2I9GA 1RYUA 4DSLA 4IQTA 5AM2A 2VIXA 3QEBZ 7ICKA 9ICAA 1XWLA 3HX0A 3H0RB 2XY5A 3GV8B 2IBKA 4DOAA 4YXMA 2D8CA 5HMMA 1BNOA 1ZETA 5AKZA 5ALEA 4J9QA 2PFPA 5L1KA 4UARA 4TUSA 3MFIA 1SZPA 5AI0A 5AM4A 8ICTA 8ICZA 1U45A 4MEYA 3C1YA 4DOBA 2ALZA 3HT3A 4ED7A 1V85A 4KLEA 9ICMA 3QX7A 5KFOA 2LPEA 5F9NA 3AN1A 2IOFK 1X66A 4Y2JA 3MABA 2EAOA 4RQ3A 4Y2VA 4C4RA 4M9JA 1D8YA 4FZLA 2HOIA 4Y2QA 4I2IA 2ZIXA 4JV2A 4TUQA 2W7OA 1YZ6A 5ALPA 2AQ0A 1ZQEA 5AI5A 3WKEA 5G5HA 3ZD8A 4B6JA 4I2FA 5ALFA 5KT3A 4FZMA 3SV3A 2DUYA 1ZOLA 9ICEA 4DQPA 1BPZA 4F2RA 2WF6A 2JEFA 2YX8A 4F71A 5G5GA 3JPRA 4QZFA 2R8GA 3E58A 5DB8A 1ZJMA 5TISU 2ZIVB 2J6TA 4C0ZA 3MDCA 3WK4A 3QNMA 5AK4A 5HNKA 1RXWA 3KHRA 4MF2A 1Z1VA 8ICYA 3L5KA 2HHSA 5B5EU 3JPSA 1XSPA 5EWGA 3M9NB 1ZD2P 4GFJA 1X9SA 4FBTA 9ICTA 2Y9UA 5DB7A 3QU9A 2PXIA 4LZDA 1KSPA 1PK1B 1OUQA 4Q45A 4F4ZA 5KFUA 4NLCA 3V7KA 1ZD3A 4ECQA 1ZQDA 3AQFA 4O3MA 3G6XA 1XNSA 5KFNA 3H0LB 1DRGA 2EH9A 5AI4A 5T14A 2HBJA 1SKSA 4RQ5A 1M6YA 4USAA 3M9MB 5KAIU 4C4TA 3WK5A 1ZQGA 3I28A 2OHFA 2W7PA 2HBLA 2PI4A 2DFLA 2E8PA 2GO7A 3R9KA 4TURA 1L8LA 2NRVA 1PZNA 4HAIA 4ELVA 4OO1J 5IIMA 1BGXT 2EQYA 3GIMA 4UAWA 4YQWA 8ICMA 2NYVA 3TACB 3TFRA 4ECWA 1TK8A 1ZQNA 1TK0A 1NK9A 2A19A 5J2JA 1ZQKA 1TAUA 5AKXA 4DL6A 2RRDA 2MSNA 2JXJA 4PH5A 4O3NA 3N97B 2ESEA 2KV2A 5DB6A 2JEJA 5CEHA 3PX0A 2KK0A 4UAZA 2K4EA 4KITB 4UB6U 3T5JA 3H8SA 1SGGA 1DGJA 4NWIA 3TARA 5HP4A 1K1SA 4NLZA 3Q8RB 1NZBA 5AK6A 1V38A 2KZ3A 4J03A 5ALZA 2KHQA 3QU7A 4R66A 3PMNA 5AKHA 5AK5A 1N62A 3WK8A 1Z1BA 2KIVA 4J9LA 3AEVA 4KLOA 3C1ZA 4KLGA 7ICOA 1FIQA 1ZQFA 1ZQXA 2W8LA 2ZTCA 4GC6A 4RT3A 9ICIA 2YMPA 3HPOA 4I2DA 3OSPA 1ZJNA 3GU3A 3C28A 1JROA 5TZVA 2ZJ8A 7ICEA 1FFUA 2QB0A 5C0YA 3RB3A 9ICXA 3RR8A 1QSLA 1TAQA 2FE9A 1VJ5A 4RPZA 3VC8A 1NK8A 2L5YA 5ALWA 2NV3A 3RR7A 1Z4NA 2OWOA 4F4KA 3H4DA 1HJPA 4B9NA 4OJPA 1JN3A 1L7NA 7ICVA 3HILA 4PZOA 5J8YC 2BZFA 1LV5A 4Z6FA 2CPRA 4YMNA 4KX3A 5ALOA 5CB1A 4UW9A 3GIIA 1UCVA 4CDGA 5KT2A 2MUTB 2DPIA 4YR3A 3SAFA 4BXOB 5AKIA 3QE9Y 3F2CA 2HBKA 2KFZA 2V4QA 8ICHA 2E8MA 2K4PA 1CRXA 1ZQWA 4J9OA 1ZRMA 4Y2TA 4M9LA 1KFTA 1ZQ1C 3QZ8A 1T8EA 4KN4A 5J0QA 7ICLA 3SAGA 4G3IA 4YVZA 1A0PA 5DB9A 5CJ7A 4DFDA 4I2BA 5DKWA 3BS5A 3K75D 4J9PA 1DXSA 1KL9A 2PFOA 3H8WA 4IS7A 3TAPA 3T79A 4BX9C 2A1JB 4Q8FA 3AU6A 4O5CA 2Y0SC 3ZDAA 4K4HA 5KFBA 4TQRA 5IINA 3NS1A 2VKQA 2XY7A 3MGIA 2ASDA 2FI1A 3T5KA 4UAUA 4P4PA 4QZAA 2ZXHA 3QU4A 1KFDA 2B6GA 1L3TA 1X42A 3PVXA 1MQ2A 2J6SA 4M6WA 1RZTA 2DWQA 1OW5A 2LYAA 2ZUCA 4R8UA 4ECXA 2C2RA 9ICUA 1Q8KA 4LZGA 3WK7A 2ASLA 5KT7A 2OM6A 3TADA 5J2KA 4O3QA 1XU4A 3Q8SB 1N5XA 2R8KA 8ICCA 2QB1A 4KLUA 2IHNA 9ICWA 4F5RA 2W3SA 1UQVA 3V7JA 2JHDA 5BPCA 2WF7A 4IR9A 2Q0ZX 5KFAA 4YFKA 2BHNA 2XI9A 3IRUA 3CYMA 3FM9A 1D9FA 2XCAA 4UB2A 4NL9A 4C4SA 4NV0A 2W8KA 1S0MA 5KFWA 4RT2A 2UVRA 2KTQA 2M9NA 4O9MA 5AIBA 3C23A 5KFGA 5EOZA 4DSKA 2EDUA 4C8LA 1JUDA 2E3TA 2AGQA 1BVSA 4MF8A 1L3VA 2PI5A 9ICBA 1JI7A 1ZD5A 3JPNA 2JEIA 2ZUBA 4PL1A 4OCZA 1X6JA 4GLXA 3KTQA 2AJQA 2W04A 2KSOB 4QIWF 2F8LA 1WCNA 4DL5A 2VJ5A 5KG5A 5AHXA 3MR6A 3GILA 3RRGA 2OCEA 2KVSA 4Q44A 1X40A 3LWMA 1RQNA 3L3FX 5ALXA 3HKZC 3VCBA 2HHQA 4EZ9A 4NXZA 2XGQA 2JZBA 4BWJA 1FFVA 1TAMA 4KLQA 4F92B 4F50A 2HHTA 3CRXA 2K89A 2ZG6A 3V6HA 2HSZA 2XIDA 4BUGA 8ICLA 2AH5A 5HHIA 2KZZA 2RDJA 3BQ0A 3WK9A 5ALLA 1JALA 4QWDA 4P4OA 1LB2B 1K5OA 3FC4A 1XO1A 1ZQPA 5IIJA 3C2LA 5KFJA 2BPCA 3U26A 1B4FA 3IV6A 4YCXA 4DSEA 4DOCA 1AROP 4RUAA 5GTHU 1HUZA 4MFCA 2W9CB 2ZTEA 2JR5A 8ICNA 9ICLA 2NRZA 3C5GA 3RJEA 3PR4A 1BNPA 4DS4A 3M6KA 4QZCA 3QUTA 4QWCA 7ICTA 3RBDA 4JV0A 5DG9A 2ISOA 3EZ5A 5F3XB 5KFVA 4JMUA 4MHVA 1UA1A 4OD0A 5AKLA 4O5EA 8ICEA 3QU2A 4P0PA 4KLTA 5J0WA 3NGDA 1QTMA 2R8HA 1ZQHA 3RH6A 1AQ6A 1WWUA 2FPLA 3J81j 2F1HA 3ORYA 2VA8A 5J2BA 1JXLA 2RDIA 2M0NA 5AM5A 2W9BB 3N28A 2KMDA 4DFKA 2YTUA 2KHVA 2WB1F 8ICXA 3OTQA 4UB5A 5J0XA 4UAVA 3ZI4A 3RB6A 1O08A 5J0UA 7ICMA 3RJFA 1Y88A 5ALGA 2E5SA 3PR5B 2KJ8A 2PMZC 5J2IA 4LJXA 1XSNA 2H3ZA 5ALQA 4NLBA 3KZIU 2CRXA 1SWVA 2G0AA 2GOLA 5DGAA 1SV4A 4DL2A 5J0YA 3M8RA 2AGPA 5L9XA 4K4GA 4YD1A 3GFKB 3KFUF 1S8OA 1MSWD 2YQEA 2E8NA 2P66A 3PW7A 2ZIXB 3BQ7A 1NK4A 4PHAA 4I2HA 3G6VA 3WKDA 1SV0A 2QARA 2A1AA 1LKYA 1UHUA 3CNHA 4PJ0U 1N5WA 3GDXA 4YXJA 4KLDA 3SV4A 1N63A 5KT6A 4C8NA 4MFFA 4IC9A 4OJ6A 5DGBA 1JXEA 5KFEA 1S0VA 4BWMA 3KHGA 2DPJA 3PO4A 1ZQMA 2HMXA 5KFXA 2ZJ5A 3N7PD 1CEZA 4XQ8A 2OXOA 1PUZA 3OSNA 5GTIU 4PGQA 2W54A 4DWIA 3PO5A 4RQ7A 1NOMA 3ED5A 3C29A 1S0NA 2RP5A 1N56A 1NJYA 2ZIUB 1NKBA 1PK1A 3IHQB 3PSPA 2XCPA 1A76A 4PPXA 5ALMA 4US8A 5HR7A 1ZQVA 2GH1A 4ELUA 8ICUA 2JGAA 3GZFA 3GV5B 3BZCA 8ICRA 1SB3C 2WF8A 1ZQIA 2UVWA 5ALJA 4I28A 5D46A 3RBEA 1S77D 4P4MA 3MR2A 4EBCA 4DSJA 8ICOA 2LKYA 5HR6A 1ZQYA 3D6JA 3KBBA 2AU0A 2BCSA 4MEXA 5ALTA 3BQ1A 1PVPA 2XO7A 3QUCA 4ED3A 3JPQA 5ALUA 5KG6A 3QEAZ 4DL3A 2IA6A 4AYBF 5DDYA 2AGOA 1S0OA 2H3VA 4KMUA 3NVZA 1X9MA 2ISPA 4ECZA 3EUB2 3V7LA 1Z4OA 2G5HB 2ZXIA 3QYPA 1KQQA 4YP3A 4KMOB 1SL1A 3AMZA 2Y1JA 5CP2A 7ICSA 8ICPA 5KFYA 3SD7A 1XO0A 2O6KA 3G6YA 1SKRA 1ZYQA 1RXVA 3FYHA 3EW9A 4QWBA 3TKAA 5KG1A 1Z00A 2WF5A 4J9KA 1RPLA 4J9RA 5DLGA 5H2FU 4DCCA 2KP7A 4C7ZA 4CF4A 1QQ7A 4RU9A 3EWAA 3B0XA 1ECWA 3O0FA 1ZQCA 3KHLA 1F44A 1JMSA 2XVTA 1SKWA 3UQ0A 5J0RA 5DG8A 5J0PA 4DL7A 3ISDA 4DFMA 2IOHA 3EPGA 2KIWA 3PMLA 5KFMA 3RJGA 4B9LA 4F2SA 1L3UA 2WAQF 3UMBA 2LI6A 4RPXA 8ICWA 5AKKA 5CA7A 2FLLA 4QZHA 2RHFA 1L6NA 5J2DA 4Q43A 4M9GA 3MR5A 1Z19A 1KW4A 4C8OA 1CUKA 4YG2A 2BCRA 4K4IA 1ZQBA 7ICUA 5AI6A 4F5OA 2D3DA 1Q46A 3RJIA 2XC9A 4KLSA 1C20A 3SR6A 1B0XA 4FO6A 2EZZA 1ZQJA 3BQTA 2B21A 1X9XA 5JTIA 5KFKA 3T3FA 5HHHA 4NY8A 4ECRA 4IRKA 5JU5A 2KKVA 1QQ6A 4DS5A 3PY8A 3L4PA 2W11A 3SENA 5CWRA 3AL0B 3NVVA 4CCHA 1T7PA 2H3FA 3I1YA 5EWFA 7ICPA 4EYHB 4UB4A 2AXTU 3AM9A 1ZQSA 3N4MB 4DF4A 1J97A 2OH2A 4IRDA 4NM1A 1NJZA 5ALNA 4ECTA 3SI8A 4O3PA 1Z3EB 2FPMA 1XS9D 1EXNA 3PX4A 1UPHA 4DF8A 1RQLA 2KICA 2BQRA 4JWMA 3H8JA 2FMSA 2BCUA 4UBCA 4PHEA 4NLGA 4QZEA 1ZQAA 4DLGA 4ED0A 1XC9A 1LVHA 1L8OA 2FMQA 1WYGA 4JUZA 3C21A 3KHHA 9ICRA 2KNJA 4IRCA 1UT8A 3BS5B 4CNQA 2JH1A 4O5KA 1SXDA 1O03A 2HOQA 2LHTA 2I5HA 1SL2A 1QSSA 3TQ1A 5KFQA 2BR0A 2FPKA 2KOBA 2F44A 4DSFA 3NASA 7ICJA 2DGZA 3ALRA 3MR3A 3THVA 2PFNA 1BPEA 2W03A 9ICOA 1Q3UA 1N61A 4M47A 5AKEA 1WUDA 3KKAA 1MA7A 3IN5A 5KFTA 3ZDEA 2N1RA 9ICCA 2BCVA 4RPYA 2RLTA 3ETRA 3IG5A 3T5LA 2GLEA 4F8RA 1SIJA 1MQ3A 1ZQUA 1ZQOA 5C5JA 3K1ZA 4FFDA 2IMWP 3PV8A 3RB0A 4EBEA 4QJFB 4R8UB 2EANA 3ISBA 2JRZA 4RQMA 4AP9A 3N7RC 1RYSA 3QZ7A 1J2NA 2Z7JA 3KOOA 1IIPA 1NZPA 1NK5A 2JMGA 2MA1A 9ICNA 2ASJA 1FO4A 4YD2A 1T4GA 1IXRA 4FS2A 2DF4B 4QZIA 4B9MA 4J9NA 2VJ4A 3DEEA 1BPYA 4IQUA 2MAXA 2Y1IA 4OJLA 4C7YA 4C8MA 5AK3A 4RQ8A 2FMPA 5J2EA 1QQ5A 4QZDA 2FLNA 2YMLA 4F3OA 3IDWA 5J0TA 3Q8KA 1B43A 2NO4A 7ICFA 1RM6C 3HJEA 4RQ2A 2HHXA 2HDOA 2F76X 1NJWA 1RG6A 3SAHA 3H40A 3E0FA 3IM1A 2KJ5A 7ICQA 4DQRA 3ETLA 2V4RA 2ODGA 4Y2PA 1NJXA 4M04A 4X5VA 3S6JA 1U47A 3D2QA 1ED1A 2R8IA 5D49A 1TE2A 1NK7A 3ICXA 3GIKA 2G08A 5ALIA 4RQ0A 3GV7B 4ZOHC 3M6ZA 4QWAA 2G09A 2JZBB 1VDVA 4QZGA 2EZXA 4EEYA 2VA3A 3QXGA 4FE3A 4EELA 4ECVA 2ZIWA 3ZDDA 4IQVA 4P0QA 5DDMA 4YMOA 3EYZA 1U48A 3HW8A 2DKXA 8ICQA 5ALVA 1ZXIA 2XY6A 1DOQA 1F5SA 3ZD9A 1U49A 3UXOA 4I2JA 5ALDA 1BPXA 3UMCA 2D6FC 2EAMA 3AQEA 1PVQA 4RUCA 1T3NA 1L3SA 3NVYA 1TFRA 3LWLA 3OJSA 3TFSA 5K4LA 2HOFA 3OHBA 3OHAA 1N2XA 2ZUDA 4KN7A 5IIOA 1T94A 2HI0A 1XSLA 1JRPA 3AU2A 5EE1A 1ZQLA 5AIAA 2DKZA 5J0OA 5KFZA
chains in the Genus database with same CATH topology
1KKXA 2OEHA 1KN5A 2LM1A 1IG6A 1KQQA 2EH9A 2JXJA 1C20A 2EQYA 2YQEA 2LI6A 5K4LA 4LJXA 5CEHA 2KK0A 2CXYA 2RQ5A 2JRZA 1RYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKX A;  2OEH A;  1KN5 A;  2LM1 A;  1IG6 A;  1KQQ A;  2EH9 A;  2JXJ A;  1C20 A;  2EQY A;  2YQE A;  2LI6 A;  5K4L A;  4LJX A;  5CEH A;  2KK0 A;  2CXY A;  2RQ5 A;  2JRZ A;  1RYU A; 
#chains in the Genus database with same CATH topology
 2F77 X;  2J6U A;  3RTV A;  3V72 A;  4B9V A;  4M0A A;  1DK2 A;  2WFA A;  4Y2U A;  4R64 A;  5KFR A;  4P0P B;  2WAQ C;  3BQ2 A;  4KLH A;  5AI9 A;  1KKX A;  4F4X A;  5DLF A;  2KVC A;  3NUQ A;  3MGV A;  3K1R B;  4O3S A;  1X6I A;  2KG5 A;  4I2E A;  2KKP A;  4R63 A;  1NK6 A;  4BGD A;  4UQG A;  2R8J A;  1N48 A;  5L1M A;  1V9P A;  2P35 A;  3M1Y A;  1KRP A;  2C22 A;  4QZ9 A;  5DG7 A;  5D4B A;  2W43 A;  2BQU A;  2W9A A;  1CI4 A;  3C2K A;  4UB3 A;  2ATL A;  3UMG A;  2LBO A;  2YB1 A;  3KD3 A;  3CP8 A;  1B22 A;  2YB4 A;  3DV9 A;  2DL0 A;  1C7Y A;  2OYY A;  5AKG A;  5AM1 A;  4RNO A;  3F5E A;  3QUQ A;  5FP0 A;  4KLF A;  5DQI A;  3F5A A;  2HHV A;  4TQS A;  4RQN A;  4U6P A;  3BZK A;  4QZB A;  5BOL A;  3PSF A;  5AM3 A;  2BPG A;  1HEK A;  2ZJA A;  2R18 A;  5L1J A;  2G07 A;  4YMM A;  4OJO A;  2WF9 A;  3JPP A;  1J2M A;  4UB1 A;  4UBB A;  3JPO A;  1HIW A;  1TVA A;  4ECY A;  2Y0S F;  3H0M B;  4HYK A;  2I6X A;  1NKC A;  4FBU A;  5AIC A;  4LVS A;  2H3I A;  3KZX A;  1ZD4 A;  3ZDC A;  5DBB A;  4MFA A;  1KBU A;  4DLE A;  1S10 A;  4F5P A;  3HWT A;  2QAR B;  5AKY A;  2IOF A;  4QWE A;  1LKY B;  4EBD A;  4Y2S A;  1D8L A;  8ICA A;  3RF9 A;  2ZIV A;  5ALR A;  5CR0 A;  2RQ5 A;  4FZN A;  1ZQT A;  3SYZ A;  1L7M A;  4EEN A;  3MFH A;  3WU2 U;  1KFS A;  4KTQ A;  2VAN A;  3RH5 A;  4J9S A;  2K8A A;  2LM1 A;  5EWE A;  4ELT A;  5J29 A;  4DL4 A;  4UAT A;  4CRX A;  2BQ3 A;  4EEK A;  1S97 A;  3ISC A;  1ZQQ A;  2P6U A;  4F5N A;  2HW3 A;  9ICV A;  4I29 A;  3F53 A;  3CW2 C;  1UT5 A;  2G5I B;  2BPF A;  4KLJ A;  5KG0 A;  3Q8P B;  7ICG A;  4I27 A;  3OGU A;  3IP4 B;  1Q3V A;  1L7P A;  4I2G A;  4B9T A;  4UAY A;  5ALY A;  1WWV A;  9ICJ A;  2ZIU A;  2FLP A;  3PNC A;  9ICK A;  4OJ5 A;  2UVU A;  4IR1 A;  8ICJ A;  2PFQ A;  5J2H A;  3M8S A;  3QUB A;  2KFN A;  3BDP A;  3Q8M A;  4QNL A;  2KE7 A;  2K4H A;  2K8B B;  4Y2Y A;  5KT5 A;  8ICB A;  1K1Q A;  4QW9 A;  1WG8 A;  5EE3 A;  5KFI A;  1S5L U;  4YR0 A;  1KN5 A;  3KKA C;  4DQI A;  1PVR A;  5CRX A;  1NNL A;  3FAH A;  1QH9 A;  3NRZ A;  1QLN A;  4GC7 A;  3TAQ A;  3C5F A;  4RNN A;  4ECU A;  3TAD C;  3WKC A;  3SMV A;  5KFC A;  2I1Q A;  1MC8 A;  2LM4 A;  3PST A;  4PHD A;  2KN7 A;  3HKZ F;  5AM0 A;  1S9F A;  3SZ2 A;  3HP6 A;  3RJK A;  9ICF A;  2H5X A;  5L1I A;  2KD1 A;  5III A;  4RQ6 A;  1RYR A;  5ALH A;  5DBA A;  4QIW C;  4FS1 A;  4EYI B;  1VLB A;  4F72 A;  4US9 A;  1SL0 A;  1FEZ A;  4NL9 C;  3RFA A;  4QW8 A;  2NRW A;  3RAQ A;  1Z00 B;  2W9M A;  2JV3 A;  1URJ A;  5KFD A;  1TKD A;  2KEY A;  3RB4 A;  5KFP A;  2F8K A;  2XGP A;  2IHM A;  1YZ7 A;  2YMM A;  2Y9T A;  2LYH A;  1GO3 F;  2CXY A;  1QSY A;  3LVV A;  2HVH A;  3M7D A;  4A8E A;  4M2Y A;  5KFS A;  2HCF A;  1IV8 A;  3FDS A;  2K60 A;  5KNI A;  3IG8 A;  4CE6 A;  3BS7 A;  5E79 U;  5HML A;  2UVV A;  3WK6 A;  3H8M A;  4GIB A;  2AQ4 A;  7ICI A;  1L7O A;  2QKQ A;  4KLL A;  5A0L A;  3D2N A;  5KFF A;  1A6S A;  5KG2 A;  4GXJ A;  2BDP A;  1N60 A;  3F2D A;  3RJJ A;  1T3Q A;  3V6K A;  4PGY A;  1SZH A;  4O3R A;  2WTF A;  2G06 A;  3C2M A;  9ICH A;  3UPQ A;  2PKE A;  3GQC A;  4ED1 A;  1COO A;  2DQN B;  2H3Q A;  2QB0 B;  2BCQ A;  3A0H U;  4ED2 A;  3PSI A;  5KG7 A;  4U7C A;  3OJU A;  4JWN A;  5KT4 A;  1D8B A;  4PGX A;  3QU5 A;  1BPB A;  3LYS A;  2LMR A;  3BJY A;  4Y2X A;  4ACO A;  2YN4 A;  2YY6 A;  2ZTD A;  3RJH A;  3Q8Q B;  2BDU A;  5ALS A;  5L1L A;  2WB1 C;  3E2E A;  4B9U A;  2HHU A;  2NO5 A;  4ED6 A;  3RAX A;  2F3N A;  1DK3 A;  1QCK A;  7ICR A;  2E1E A;  2MUT A;  4Z6E A;  1NK0 A;  1A77 A;  4YR2 A;  4IQW A;  4BXO A;  2PMZ F;  4Z6D A;  3WKB A;  4F4Y A;  3N7S C;  4EX6 A;  1ZQR A;  4CF3 A;  4DEZ A;  3PW4 A;  7ICN A;  4DQQ A;  2MRL A;  3M9O B;  3MC1 A;  5J2F A;  4Y2R A;  3I76 A;  1TK5 A;  4O0I A;  3NRW A;  2F1I A;  4JB3 A;  4NJ8 A;  3RRH A;  4XUS A;  2NRT A;  3OPX A;  1HUO A;  1IG6 A;  5KAF U;  4EZ6 A;  3PW0 A;  4DQS A;  9ICP A;  1COK A;  4F5Q A;  1KDH A;  5JRT A;  3UQ2 A;  1H38 A;  2A1J A;  4F4W A;  2C2E A;  2XIC A;  1U9L A;  1X2I A;  2BKE A;  2V9W A;  4F93 B;  3RH4 A;  4XA5 A;  8ICG A;  8ICV A;  2Q4T A;  2FDR A;  3LDA A;  3A0B U;  4RZR A;  1D9D A;  4M6W B;  5KFL A;  5J2A A;  3Q8L A;  2NRX A;  4C8K A;  5AKJ A;  4ZH4 A;  1YT3 A;  4M9N A;  2OEH A;  3MDA A;  2CN1 A;  3H4B A;  9ICG A;  4I2C A;  8ICF A;  4E0D A;  2K4I A;  1IM4 A;  2JH7 A;  4QZ8 A;  4RNM A;  5EE0 A;  5DQG A;  2C2D A;  4Q8E A;  4F91 B;  5IIL A;  1U4B A;  2P6R A;  5DQH A;  3H7I A;  4C80 A;  4M9H A;  3F2B A;  1SV0 C;  4DO9 A;  4DFP A;  2A3V A;  2W3R A;  4TUP A;  3B9J A;  1BPD A;  4NLK A;  4B9S A;  4CGZ A;  2K8C B;  2JEG A;  2HHW A;  4R65 A;  3V6J A;  5CHG A;  1JX4 A;  3ZDB A;  1WCL A;  8ICI A;  4IL6 U;  4BJQ A;  4J9M A;  5F9L A;  4O3O A;  2BGW A;  3MGH A;  1X9W A;  4UB8 U;  3HRD D;  5J0S A;  1KTQ A;  3PZP A;  5KG4 A;  3GIJ A;  2E8O A;  4DFJ A;  5ALK A;  4JV1 A;  3UM9 A;  1S76 D;  3PW2 A;  1NI3 A;  1DGS A;  5EE9 A;  4RQ4 A;  2KSO A;  3AUO A;  1NKE A;  1KEJ A;  3UXP A;  8ICK A;  1OXJ A;  4Z6C A;  1F0M A;  2EAP A;  2FJ6 A;  4G9B A;  2EZY A;  4PHP A;  4GXK A;  4AYB C;  2B0C A;  9ICS A;  4ED8 A;  5J2C A;  3SQI A;  4JK1 A;  3WKA A;  3T5H A;  4PL2 A;  2F2A B;  3EPI A;  3DDH A;  2E1F A;  4KLM A;  9ICQ A;  4YN4 A;  1ZQZ A;  4ECS A;  1TV9 A;  3PX6 A;  3MBY A;  3UXN A;  4KLI A;  3B0Y A;  2ZIW B;  4ICA A;  1ZRN A;  2WHE A;  4P0Q B;  1P7D A;  3LK9 A;  1PK3 A;  4EX7 A;  2YMQ A;  3K4G A;  5IIK A;  4KX5 A;  4BDP A;  2ES6 A;  2W9C A;  4GXI A;  4RQ1 A;  1SWW A;  1JIH A;  4WJ3 B;  5J8Y A;  5JUM A;  2HVI A;  1UA0 A;  5KL1 B;  5KFH A;  3TI0 A;  5DBC A;  2C28 A;  4NM2 A;  3PW5 A;  5KL8 B;  3NVW A;  8ICS A;  1RDF A;  1KLN A;  1V97 A;  7ICH A;  5J2G A;  3TAN A;  2VA2 A;  2MU2 A;  2KZM A;  3JPT A;  1L5U A;  4P2H A;  5BOM A;  2LYB A;  3D2S A;  2KJ9 A;  5AI8 A;  4NLN A;  5B66 U;  5KG3 A;  4PZN A;  4I2A A;  2HBM A;  1SXE A;  2DBY A;  4UAS A;  3NTU A;  4XRH A;  4CF5 A;  2W9B A;  5KTQ A;  3SEI A;  2GWS A;  2F1J A;  2AHO B;  2QLT A;  3ONN A;  3LVW A;  2W55 A;  1MN8 A;  4DSI A;  2I9G A;  1RYU A;  4DSL A;  4IQT A;  5AM2 A;  2VIX A;  3QEB Z;  7ICK A;  9ICA A;  1XWL A;  3HX0 A;  3H0R B;  2XY5 A;  3GV8 B;  2IBK A;  4DOA A;  4YXM A;  2D8C A;  5HMM A;  1BNO A;  1ZET A;  5AKZ A;  5ALE A;  4J9Q A;  2PFP A;  5L1K A;  4UAR A;  4TUS A;  3MFI A;  1SZP A;  5AI0 A;  5AM4 A;  8ICT A;  8ICZ A;  1U45 A;  4MEY A;  3C1Y A;  4DOB A;  2ALZ A;  3HT3 A;  4ED7 A;  1V85 A;  4KLE A;  9ICM A;  3QX7 A;  5KFO A;  2LPE A;  5F9N A;  3AN1 A;  2IOF K;  1X66 A;  4Y2J A;  3MAB A;  2EAO A;  4RQ3 A;  4Y2V A;  4C4R A;  4M9J A;  1D8Y A;  4FZL A;  2HOI A;  4Y2Q A;  4I2I A;  2ZIX A;  4JV2 A;  4TUQ A;  2W7O A;  1YZ6 A;  5ALP A;  2AQ0 A;  1ZQE A;  5AI5 A;  3WKE A;  5G5H A;  3ZD8 A;  4B6J A;  4I2F A;  5ALF A;  5KT3 A;  4FZM A;  3SV3 A;  2DUY A;  1ZOL A;  9ICE A;  4DQP A;  1BPZ A;  4F2R A;  2WF6 A;  2JEF A;  2YX8 A;  4F71 A;  5G5G A;  3JPR A;  4QZF A;  2R8G A;  3E58 A;  5DB8 A;  1ZJM A;  5TIS U;  2ZIV B;  2J6T A;  4C0Z A;  3MDC A;  3WK4 A;  3QNM A;  5AK4 A;  5HNK A;  1RXW A;  3KHR A;  4MF2 A;  1Z1V A;  8ICY A;  3L5K A;  2HHS A;  5B5E U;  3JPS A;  1XSP A;  5EWG A;  3M9N B;  1ZD2 P;  4GFJ A;  1X9S A;  4FBT A;  9ICT A;  2Y9U A;  5DB7 A;  3QU9 A;  2PXI A;  4LZD A;  1KSP A;  1PK1 B;  1OUQ A;  4Q45 A;  4F4Z A;  5KFU A;  4NLC A;  3V7K A;  1ZD3 A;  4ECQ A;  1ZQD A;  3AQF A;  4O3M A;  3G6X A;  1XNS A;  5KFN A;  3H0L B;  1DRG A;  2EH9 A;  5AI4 A;  5T14 A;  2HBJ A;  1SKS A;  4RQ5 A;  1M6Y A;  4USA A;  3M9M B;  5KAI U;  4C4T A;  3WK5 A;  1ZQG A;  3I28 A;  2OHF A;  2W7P A;  2HBL A;  2PI4 A;  2DFL A;  2E8P A;  2GO7 A;  3R9K A;  4TUR A;  1L8L A;  2NRV A;  1PZN A;  4HAI A;  4ELV A;  4OO1 J;  5IIM A;  1BGX T;  2EQY A;  3GIM A;  4UAW A;  4YQW A;  8ICM A;  2NYV A;  3TAC B;  3TFR A;  4ECW A;  1TK8 A;  1ZQN A;  1TK0 A;  1NK9 A;  2A19 A;  5J2J A;  1ZQK A;  1TAU A;  5AKX A;  4DL6 A;  2RRD A;  2MSN A;  2JXJ A;  4PH5 A;  4O3N A;  3N97 B;  2ESE A;  2KV2 A;  5DB6 A;  2JEJ A;  5CEH A;  3PX0 A;  2KK0 A;  4UAZ A;  2K4E A;  4KIT B;  4UB6 U;  3T5J A;  3H8S A;  1SGG A;  1DGJ A;  4NWI A;  3TAR A;  5HP4 A;  1K1S A;  4NLZ A;  3Q8R B;  1NZB A;  5AK6 A;  1V38 A;  2KZ3 A;  4J03 A;  5ALZ A;  2KHQ A;  3QU7 A;  4R66 A;  3PMN A;  5AKH A;  5AK5 A;  1N62 A;  3WK8 A;  1Z1B A;  2KIV A;  4J9L A;  3AEV A;  4KLO A;  3C1Z A;  4KLG A;  7ICO A;  1FIQ A;  1ZQF A;  1ZQX A;  2W8L A;  2ZTC A;  4GC6 A;  4RT3 A;  9ICI A;  2YMP A;  3HPO A;  4I2D A;  3OSP A;  1ZJN A;  3GU3 A;  3C28 A;  1JRO A;  5TZV A;  2ZJ8 A;  7ICE A;  1FFU A;  2QB0 A;  5C0Y A;  3RB3 A;  9ICX A;  3RR8 A;  1QSL A;  1TAQ A;  2FE9 A;  1VJ5 A;  4RPZ A;  3VC8 A;  1NK8 A;  2L5Y A;  5ALW A;  2NV3 A;  3RR7 A;  1Z4N A;  2OWO A;  4F4K A;  3H4D A;  1HJP A;  4B9N A;  4OJP A;  1JN3 A;  1L7N A;  7ICV A;  3HIL A;  4PZO A;  5J8Y C;  2BZF A;  1LV5 A;  4Z6F A;  2CPR A;  4YMN A;  4KX3 A;  5ALO A;  5CB1 A;  4UW9 A;  3GII A;  1UCV A;  4CDG A;  5KT2 A;  2MUT B;  2DPI A;  4YR3 A;  3SAF A;  4BXO B;  5AKI A;  3QE9 Y;  3F2C A;  2HBK A;  2KFZ A;  2V4Q A;  8ICH A;  2E8M A;  2K4P A;  1CRX A;  1ZQW A;  4J9O A;  1ZRM A;  4Y2T A;  4M9L A;  1KFT A;  1ZQ1 C;  3QZ8 A;  1T8E A;  4KN4 A;  5J0Q A;  7ICL A;  3SAG A;  4G3I A;  4YVZ A;  1A0P A;  5DB9 A;  5CJ7 A;  4DFD A;  4I2B A;  5DKW A;  3BS5 A;  3K75 D;  4J9P A;  1DXS A;  1KL9 A;  2PFO A;  3H8W A;  4IS7 A;  3TAP A;  3T79 A;  4BX9 C;  2A1J B;  4Q8F A;  3AU6 A;  4O5C A;  2Y0S C;  3ZDA A;  4K4H A;  5KFB A;  4TQR A;  5IIN A;  3NS1 A;  2VKQ A;  2XY7 A;  3MGI A;  2ASD A;  2FI1 A;  3T5K A;  4UAU A;  4P4P A;  4QZA A;  2ZXH A;  3QU4 A;  1KFD A;  2B6G A;  1L3T A;  1X42 A;  3PVX A;  1MQ2 A;  2J6S A;  4M6W A;  1RZT A;  2DWQ A;  1OW5 A;  2LYA A;  2ZUC A;  4R8U A;  4ECX A;  2C2R A;  9ICU A;  1Q8K A;  4LZG A;  3WK7 A;  2ASL A;  5KT7 A;  2OM6 A;  3TAD A;  5J2K A;  4O3Q A;  1XU4 A;  3Q8S B;  1N5X A;  2R8K A;  8ICC A;  2QB1 A;  4KLU A;  2IHN A;  9ICW A;  4F5R A;  2W3S A;  1UQV A;  3V7J A;  2JHD A;  5BPC A;  2WF7 A;  4IR9 A;  2Q0Z X;  5KFA A;  4YFK A;  2BHN A;  2XI9 A;  3IRU A;  3CYM A;  3FM9 A;  1D9F A;  2XCA A;  4UB2 A;  4NL9 A;  4C4S A;  4NV0 A;  2W8K A;  1S0M A;  5KFW A;  4RT2 A;  2UVR A;  2KTQ A;  2M9N A;  4O9M A;  5AIB A;  3C23 A;  5KFG A;  5EOZ A;  4DSK A;  2EDU A;  4C8L A;  1JUD A;  2E3T A;  2AGQ A;  1BVS A;  4MF8 A;  1L3V A;  2PI5 A;  9ICB A;  1JI7 A;  1ZD5 A;  3JPN A;  2JEI A;  2ZUB A;  4PL1 A;  4OCZ A;  1X6J A;  4GLX A;  3KTQ A;  2AJQ A;  2W04 A;  2KSO B;  4QIW F;  2F8L A;  1WCN A;  4DL5 A;  2VJ5 A;  5KG5 A;  5AHX A;  3MR6 A;  3GIL A;  3RRG A;  2OCE A;  2KVS A;  4Q44 A;  1X40 A;  3LWM A;  1RQN A;  3L3F X;  5ALX A;  3HKZ C;  3VCB A;  2HHQ A;  4EZ9 A;  4NXZ A;  2XGQ A;  2JZB A;  4BWJ A;  1FFV A;  1TAM A;  4KLQ A;  4F92 B;  4F50 A;  2HHT A;  3CRX A;  2K89 A;  2ZG6 A;  3V6H A;  2HSZ A;  2XID A;  4BUG A;  8ICL A;  2AH5 A;  5HHI A;  2KZZ A;  2RDJ A;  3BQ0 A;  3WK9 A;  5ALL A;  1JAL A;  4QWD A;  4P4O A;  1LB2 B;  1K5O A;  3FC4 A;  1XO1 A;  1ZQP A;  5IIJ A;  3C2L A;  5KFJ A;  2BPC A;  3U26 A;  1B4F A;  3IV6 A;  4YCX A;  4DSE A;  4DOC A;  1ARO P;  4RUA A;  5GTH U;  1HUZ A;  4MFC A;  2W9C B;  2ZTE A;  2JR5 A;  8ICN A;  9ICL A;  2NRZ A;  3C5G A;  3RJE A;  3PR4 A;  1BNP A;  4DS4 A;  3M6K A;  4QZC A;  3QUT A;  4QWC A;  7ICT A;  3RBD A;  4JV0 A;  5DG9 A;  2ISO A;  3EZ5 A;  5F3X B;  5KFV A;  4JMU A;  4MHV A;  1UA1 A;  4OD0 A;  5AKL A;  4O5E A;  8ICE A;  3QU2 A;  4P0P A;  4KLT A;  5J0W A;  3NGD A;  1QTM A;  2R8H A;  1ZQH A;  3RH6 A;  1AQ6 A;  1WWU A;  2FPL A;  3J81 j;  2F1H A;  3ORY A;  2VA8 A;  5J2B A;  1JXL A;  2RDI A;  2M0N A;  5AM5 A;  2W9B B;  3N28 A;  2KMD A;  4DFK A;  2YTU A;  2KHV A;  2WB1 F;  8ICX A;  3OTQ A;  4UB5 A;  5J0X A;  4UAV A;  3ZI4 A;  3RB6 A;  1O08 A;  5J0U A;  7ICM A;  3RJF A;  1Y88 A;  5ALG A;  2E5S A;  3PR5 B;  2KJ8 A;  2PMZ C;  5J2I A;  4LJX A;  1XSN A;  2H3Z A;  5ALQ A;  4NLB A;  3KZI U;  2CRX A;  1SWV A;  2G0A A;  2GOL A;  5DGA A;  1SV4 A;  4DL2 A;  5J0Y A;  3M8R A;  2AGP A;  5L9X A;  4K4G A;  4YD1 A;  3GFK B;  3KFU F;  1S8O A;  1MSW D;  2YQE A;  2E8N A;  2P66 A;  3PW7 A;  2ZIX B;  3BQ7 A;  1NK4 A;  4PHA A;  4I2H A;  3G6V A;  3WKD A;  1SV0 A;  2QAR A;  2A1A A;  1LKY A;  1UHU A;  3CNH A;  4PJ0 U;  1N5W A;  3GDX A;  4YXJ A;  4KLD A;  3SV4 A;  1N63 A;  5KT6 A;  4C8N A;  4MFF A;  4IC9 A;  4OJ6 A;  5DGB A;  1JXE A;  5KFE A;  1S0V A;  4BWM A;  3KHG A;  2DPJ A;  3PO4 A;  1ZQM A;  2HMX A;  5KFX A;  2ZJ5 A;  3N7P D;  1CEZ A;  4XQ8 A;  2OXO A;  1PUZ A;  3OSN A;  5GTI U;  4PGQ A;  2W54 A;  4DWI A;  3PO5 A;  4RQ7 A;  1NOM A;  3ED5 A;  3C29 A;  1S0N A;  2RP5 A;  1N56 A;  1NJY A;  2ZIU B;  1NKB A;  1PK1 A;  3IHQ B;  3PSP A;  2XCP A;  1A76 A;  4PPX A;  5ALM A;  4US8 A;  5HR7 A;  1ZQV A;  2GH1 A;  4ELU A;  8ICU A;  2JGA A;  3GZF A;  3GV5 B;  3BZC A;  8ICR A;  1SB3 C;  2WF8 A;  1ZQI A;  2UVW A;  5ALJ A;  4I28 A;  5D46 A;  3RBE A;  1S77 D;  4P4M A;  3MR2 A;  4EBC A;  4DSJ A;  8ICO A;  2LKY A;  5HR6 A;  1ZQY A;  3D6J A;  3KBB A;  2AU0 A;  2BCS A;  4MEX A;  5ALT A;  3BQ1 A;  1PVP A;  2XO7 A;  3QUC A;  4ED3 A;  3JPQ A;  5ALU A;  5KG6 A;  3QEA Z;  4DL3 A;  2IA6 A;  4AYB F;  5DDY A;  2AGO A;  1S0O A;  2H3V A;  4KMU A;  3NVZ A;  1X9M A;  2ISP A;  4ECZ A;  3EUB 2;  3V7L A;  1Z4O A;  2G5H B;  2ZXI A;  3QYP A;  1KQQ A;  4YP3 A;  4KMO B;  1SL1 A;  3AMZ A;  2Y1J A;  5CP2 A;  7ICS A;  8ICP A;  5KFY A;  3SD7 A;  1XO0 A;  2O6K A;  3G6Y A;  1SKR A;  1ZYQ A;  1RXV A;  3FYH A;  3EW9 A;  4QWB A;  3TKA A;  5KG1 A;  1Z00 A;  2WF5 A;  4J9K A;  1RPL A;  4J9R A;  5DLG A;  5H2F U;  4DCC A;  2KP7 A;  4C7Z A;  4CF4 A;  1QQ7 A;  4RU9 A;  3EWA A;  3B0X A;  1ECW A;  3O0F A;  1ZQC A;  3KHL A;  1F44 A;  1JMS A;  2XVT A;  1SKW A;  3UQ0 A;  5J0R A;  5DG8 A;  5J0P A;  4DL7 A;  3ISD A;  4DFM A;  2IOH A;  3EPG A;  2KIW A;  3PML A;  5KFM A;  3RJG A;  4B9L A;  4F2S A;  1L3U A;  2WAQ F;  3UMB A;  2LI6 A;  4RPX A;  8ICW A;  5AKK A;  5CA7 A;  2FLL A;  4QZH A;  2RHF A;  1L6N A;  5J2D A;  4Q43 A;  4M9G A;  3MR5 A;  1Z19 A;  1KW4 A;  4C8O A;  1CUK A;  4YG2 A;  2BCR A;  4K4I A;  1ZQB A;  7ICU A;  5AI6 A;  4F5O A;  2D3D A;  1Q46 A;  3RJI A;  2XC9 A;  4KLS A;  1C20 A;  3SR6 A;  1B0X A;  4FO6 A;  2EZZ A;  1ZQJ A;  3BQT A;  2B21 A;  1X9X A;  5JTI A;  5KFK A;  3T3F A;  5HHH A;  4NY8 A;  4ECR A;  4IRK A;  5JU5 A;  2KKV A;  1QQ6 A;  4DS5 A;  3PY8 A;  3L4P A;  2W11 A;  3SEN A;  5CWR A;  3AL0 B;  3NVV A;  4CCH A;  1T7P A;  2H3F A;  3I1Y A;  5EWF A;  7ICP A;  4EYH B;  4UB4 A;  2AXT U;  3AM9 A;  1ZQS A;  3N4M B;  4DF4 A;  1J97 A;  2OH2 A;  4IRD A;  4NM1 A;  1NJZ A;  5ALN A;  4ECT A;  3SI8 A;  4O3P A;  1Z3E B;  2FPM A;  1XS9 D;  1EXN A;  3PX4 A;  1UPH A;  4DF8 A;  1RQL A;  2KIC A;  2BQR A;  4JWM A;  3H8J A;  2FMS A;  2BCU A;  4UBC A;  4PHE A;  4NLG A;  4QZE A;  1ZQA A;  4DLG A;  4ED0 A;  1XC9 A;  1LVH A;  1L8O A;  2FMQ A;  1WYG A;  4JUZ A;  3C21 A;  3KHH A;  9ICR A;  2KNJ A;  4IRC A;  1UT8 A;  3BS5 B;  4CNQ A;  2JH1 A;  4O5K A;  1SXD A;  1O03 A;  2HOQ A;  2LHT A;  2I5H A;  1SL2 A;  1QSS A;  3TQ1 A;  5KFQ A;  2BR0 A;  2FPK A;  2KOB A;  2F44 A;  4DSF A;  3NAS A;  7ICJ A;  2DGZ A;  3ALR A;  3MR3 A;  3THV A;  2PFN A;  1BPE A;  2W03 A;  9ICO A;  1Q3U A;  1N61 A;  4M47 A;  5AKE A;  1WUD A;  3KKA A;  1MA7 A;  3IN5 A;  5KFT A;  3ZDE A;  2N1R A;  9ICC A;  2BCV A;  4RPY A;  2RLT A;  3ETR A;  3IG5 A;  3T5L A;  2GLE A;  4F8R A;  1SIJ A;  1MQ3 A;  1ZQU A;  1ZQO A;  5C5J A;  3K1Z A;  4FFD A;  2IMW P;  3PV8 A;  3RB0 A;  4EBE A;  4QJF B;  4R8U B;  2EAN A;  3ISB A;  2JRZ A;  4RQM A;  4AP9 A;  3N7R C;  1RYS A;  3QZ7 A;  1J2N A;  2Z7J A;  3KOO A;  1IIP A;  1NZP A;  1NK5 A;  2JMG A;  2MA1 A;  9ICN A;  2ASJ A;  1FO4 A;  4YD2 A;  1T4G A;  1IXR A;  4FS2 A;  2DF4 B;  4QZI A;  4B9M A;  4J9N A;  2VJ4 A;  3DEE A;  1BPY A;  4IQU A;  2MAX A;  2Y1I A;  4OJL A;  4C7Y A;  4C8M A;  5AK3 A;  4RQ8 A;  2FMP A;  5J2E A;  1QQ5 A;  4QZD A;  2FLN A;  2YML A;  4F3O A;  3IDW A;  5J0T A;  3Q8K A;  1B43 A;  2NO4 A;  7ICF A;  1RM6 C;  3HJE A;  4RQ2 A;  2HHX A;  2HDO A;  2F76 X;  1NJW A;  1RG6 A;  3SAH A;  3H40 A;  3E0F A;  3IM1 A;  2KJ5 A;  7ICQ A;  4DQR A;  3ETL A;  2V4R A;  2ODG A;  4Y2P A;  1NJX A;  4M04 A;  4X5V A;  3S6J A;  1U47 A;  3D2Q A;  1ED1 A;  2R8I A;  5D49 A;  1TE2 A;  1NK7 A;  3ICX A;  3GIK A;  2G08 A;  5ALI A;  4RQ0 A;  3GV7 B;  4ZOH C;  3M6Z A;  4QWA A;  2G09 A;  2JZB B;  1VDV A;  4QZG A;  2EZX A;  4EEY A;  2VA3 A;  3QXG A;  4FE3 A;  4EEL A;  4ECV A;  2ZIW A;  3ZDD A;  4IQV A;  4P0Q A;  5DDM A;  4YMO A;  3EYZ A;  1U48 A;  3HW8 A;  2DKX A;  8ICQ A;  5ALV A;  1ZXI A;  2XY6 A;  1DOQ A;  1F5S A;  3ZD9 A;  1U49 A;  3UXO A;  4I2J A;  5ALD A;  1BPX A;  3UMC A;  2D6F C;  2EAM A;  3AQE A;  1PVQ A;  4RUC A;  1T3N A;  1L3S A;  3NVY A;  1TFR A;  3LWL A;  3OJS A;  3TFS A;  5K4L A;  2HOF A;  3OHB A;  3OHA A;  1N2X A;  2ZUD A;  4KN7 A;  5IIO A;  1T94 A;  2HI0 A;  1XSL A;  1JRP A;  3AU2 A;  5EE1 A;  1ZQL A;  5AIA A;  2DKZ A;  5J0O A;  5KFZ A; 
#chains in the Genus database with same CATH homology
 1KKX A;  2OEH A;  1KN5 A;  2LM1 A;  1IG6 A;  1KQQ A;  2EH9 A;  2JXJ A;  1C20 A;  2EQY A;  2YQE A;  2LI6 A;  5K4L A;  4LJX A;  5CEH A;  2KK0 A;  2CXY A;  2RQ5 A;  2JRZ A;  1RYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...