1KQQA

Solution structure of the dead ringer arid-dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAALTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Dead ringer-DNA complex reveals how AT-rich interaction domains (ARIDs) recognize DNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*CP*TP*GP*TP*AP*TP*TP*GP*AP*TP*GP*TP*GP*G)-3'
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kqqA00
1KN5A 1RYUA 2KK0A 2JRZA 4LJXA 1C20A 1KQQA 2JXJA 1IG6A 2LM1A 2EQYA 2OEHA 1KKXA 2LI6A 2RQ5A 2EH9A 2YQEA 5K4LA 5CEHA 2CXYA
chains in the Genus database with same CATH superfamily
2P6UA 5KAFU 4IQVA 1J2NA 5ALZA 5AICA 8ICKA 2XVTA 4BX9C 5CRXA 1L3TA 2IMWP 2ZIUA 3EZ5A 4Z6EA 4MEXA 4F5QA 2H5XA 3HW8A 5H2FU 4U6PA 3TFSA 2DUYA 3RB4A 4ED7A 1TKDA 3HT3A 2CXYA 1RZTA 2LPEA 3PSPA 3BJYA 4UAYA 2JZBA 5AI6A 5KFGA 4FBTA 3ZD9A 4DOBA 3KHHA 2G07A 4XQ8A 5KFTA 1IXRA 4K4GA 2GLEA 1XU4A 2BR0A 5ALSA 3I28A 3HILA 4J9RA 4ZH4A 2XIDA 2W43A 4CCHA 2W9BA 3VCBA 1IIPA 5J2BA 3VC8A 4PHEA 2OYYA 4DSFA 4QZ8A 2OCEA 2K4HA 4NLNA 5AK3A 3RRHA 3S6JA 3HKZF 5HHIA 1RXWA 1MN8A 4M9GA 3M9NB 3WK7A 5KFHA 3A0BU 5J2JA 4TURA 3RR8A 8ICNA 2XY7A 3GV8B 4HYKA 3D6JA 3UXPA 5AI4A 5HR7A 2KTQA 1NZPA 5KFCA 3RBEA 4TQSA 1MA7A 4CE6A 5AKJA 2F1HA 2JGAA 1UCVA 4Y2UA 5AKZA 3ZDDA 4IL6U 2Z7JA 2HBKA 3GIIA 2AQ0A 3ORYA 1PK3A 4K4IA 2AGPA 2HHTA 2KN7A 5AKGA 3QU5A 1VJ5A 4EELA 2BQUA 2KJ5A 2XO7A 1CUKA 4JWMA 4I2DA 2GWSA 3MR2A 1F0MA 5AIAA 2E1FA 2UVRA 4O3QA 4NLGA 3PSFA 2FMSA 3CW2C 3NVZA 2H3IA 2ODGA 4UBCA 3DV9A 3Q8MA 4J9PA 2ZIUB 2KE7A 3SR6A 5KG0A 4RNNA 3NVYA 2FI1A 4Q8FA 4PHPA 2LM1A 1TV9A 4LZGA 1ZRMA 1FEZA 4ZOHC 3PVXA 2E1EA 3Q8KA 2W9AA 1S8OA 4YG2A 2BDPA 1M6YA 1V38A 5ALIA 2W9CA 4KLHA 3OJSA 5ALXA 5KT6A 9ICOA 3GV7B 4BUGA 3NGDA 2LBOA 5J2GA 2ZJ5A 4EBCA 1TK5A 1FO4A 1QH9A 4C4TA 1BPXA 5J2CA 4HAIA 3QEBZ 2YTUA 2OHFA 2G09A 3PW5A 4TQRA 5J0WA 1F5SA 5ALGA 3H7IA 3GQCA 2K8CB 4BWMA 4UB6U 1SKRA 1JROA 5EE0A 4DL4A 1PVRA 1ZQIA 1S76D 1X6JA 3TACB 4ED0A 8ICPA 3QUBA 4Y2RA 4YVZA 3IG5A 3K1RB 4QWDA 1KFSA 2ZUBA 4C4RA 4EZ6A 1N62A 1N63A 2R8HA 3UXOA 4RQNA 2C28A 3B0XA 9ICBA 2FMPA 2WB1F 2K60A 4QZHA 1S77D 5DGBA 2WF6A 9ICLA 2E8PA 2EANA 4DFJA 1L8OA 4MFFA 2KP7A 5J0UA 3TAPA 5HHHA 4QWCA 4C8MA 3C29A 2GH1A 5J0QA 5EOZA 2XY5A 3AM9A 1L6NA 2ESEA 2W3SA 3PMNA 3OHAA 1KFTA 4YN4A 3MGVA 2MA1A 4O5CA 4I2BA 5ALVA 3MBYA 1XO0A 2JEJA 2LI6A 4EX6A 4ECYA 2P35A 2VJ4A 1J2MA 4CF3A 4NXZA 3RJKA 3N7RC 1D8YA 3AL0B 4RT3A 1ZETA 2F8KA 4QZEA 2MSNA 4QIWF 5ALFA 4DWIA 1DOQA 1KRPA 5BOLA 4O3MA 1ZQVA 1NK5A 1XSPA 4ELTA 4RQMA 1N48A 1ZQNA 4QWBA 3RAQA 2KFZA 3T5JA 9ICXA 3PO5A 8ICLA 4RQ1A 4B9LA 3NVWA 5KL8B 1ZQ1C 1SL1A 5AK6A 5AKEA 1TE2A 3RJHA 2EZZA 4JV1A 3NTUA 5F9NA 5KNIA 2ASDA 9ICRA 3TADA 4F3OA 5KFNA 5DB7A 4KN7A 1RM6C 4IRKA 1S5LU 2KKPA 2HDOA 1RDFA 3QEAZ 2KJ8A 3GIJA 1X9MA 5KAIU 3V6KA 7ICSA 4DQPA 2WB1C 4KLQA 1WWUA 2I1QA 4RQ5A 4F2RA 4FS2A 2CPRA 2Q4TA 4PPXA 3H8MA 2G5HB 1NK4A 4UB5A 1L7MA 2W8LA 3WK8A 4KTQA 4TUQA 5GTIU 5D46A 4O0IA 3RFAA 1UA1A 4P4PA 1NNLA 4US8A 3QE9Y 3ISBA 2KNJA 4R8UB 2WAQC 4YXJA 3EWAA 2N1RA 3PNCA 1ZQOA 5B66U 4I2CA 5L1MA 4J9SA 1MQ3A 8ICCA 5AI5A 2LM4A 4PH5A 2YMLA 3HPOA 4F92B 3H0MB 2XGPA 5KFPA 2LHTA 1RYRA 2HHVA 4OJLA 5J2IA 4TUSA 1JXEA 2RLTA 4KLGA 9ICHA 5DG7A 5KT4A 3TQ1A 4Y2SA 4C4SA 4QZBA 4B9VA 4QIWC 5KTQA 1ZQWA 4PHAA 4Z6DA 4LJXA 1TK0A 2QARA 1SB3C 3LWLA 5KG2A 2RDJA 4IR1A 1S0NA 5KFKA 1HIWA 1LV5A 4RZRA 1K5OA 4DS5A 2Y0SC 4DOAA 3WK9A 1ZJMA 2ASJA 1Y88A 4ECTA 2MRLA 9ICJA 2Y1IA 5J0OA 1SZHA 1VLBA 3EPGA 4IQWA 4OJ6A 4OCZA 4Y2QA 5TZVA 1QQ6A 1CRXA 4NM1A 2V9WA 9ICEA 1JRPA 4DL2A 4JV2A 2ZTEA 3KHGA 3M6KA 4EEKA 2RHFA 8ICRA 4O3NA 4KX3A 4RPXA 5ALNA 5DLFA 3CYMA 1NJZA 1QCKA 5J2FA 5AKKA 1KSPA 4RPYA 1V9PA 2OWOA 3F5AA 5G5GA 7ICJA 3BZCA 2D6FC 1IG6A 3GIKA 2BPCA 7ICIA 1AROP 4DLGA 4O3OA 3U26A 5B5EU 5T14A 3FYHA 4F2SA 4O3RA 9ICPA 3C1ZA 2UVVA 4C8OA 1X6IA 2Y1JA 2VIXA 4GXKA 5KFIA 2DKXA 1N60A 7ICEA 3RH5A 2C2EA 1V97A 2E8NA 1T3QA 2EAPA 2EAOA 1Z00B 4Y2YA 3PW7A 3N7PD 5ALLA 4F5OA 2PMZC 5AM4A 2RRDA 3KTQA 4UAVA 5KFBA 4QW9A 8ICMA 1PVPA 3PSTA 2E5SA 4QZ9A 5ALHA 2NV3A 2E8MA 5J0XA 2HVHA 2VA8A 5DDYA 4UASA 3MR3A 5ALKA 1QSLA 5AI9A 1NK7A 4OO1J 5AKHA 2LMRA 1NI3A 3FC4A 2BHNA 8ICQA 1PK1A 2DF4B 4NM2A 5KG5A 3LYSA 3T5KA 3R9KA 1Z19A 2YN4A 9ICNA 2WAQF 3NVVA 1ZQZA 4RQ7A 5AM3A 5AI0A 1SIJA 3LK9A 3GV5B 4EYHB 2VKQA 1X9WA 1KFDA 2BCVA 2EAMA 3PSIA 1CI4A 2FPLA 4O5KA 5ALYA 4YD1A 9ICFA 1A77A 7ICPA 3MR5A 1L7NA 2WF9A 1CEZA 4F4XA 5KFVA 2HHSA 2IHMA 4YQWA 1KBUA 3OTQA 3WKEA 4DFKA 8ICXA 3IRUA 3M9OB 3AUOA 1ZQPA 1UA0A 5ALWA 4EZ9A 1YZ7A 5ALOA 4F4YA 1BPYA 2DGZA 4R8UA 3GIMA 3TI0A 2ZXIA 5D4BA 1SKWA 3DDHA 2XC9A 1FIQA 1DRGA 4F91B 3M8RA 2OH2A 2BCRA 2BQ3A 5DG9A 5KFJA 3OJUA 4JUZA 4YCXA 3FDSA 2XY6A 1NJXA 3NRZA 2H3QA 3E0FA 7ICQA 3SV4A 3RJIA 4GFJA 1Q3UA 2WF5A 4FZLA 7ICLA 2K8BB 3F5EA 1PVQA 3G6YA 2PMZF 2MUTA 5AKIA 1U45A 4P0PA 4KMUA 2KSOB 4M6WB 9ICGA 3PZPA 1XC9A 1ED1A 1KW4A 3ALRA 3FAHA 3D2SA 4JB3A 1U49A 2AXTU 2KK0A 5IILA 4B9SA 1BPEA 5K4LA 1NKBA 2B21A 4ECZA 7ICMA 3UPQA 3PW0A 4I28A 4RT2A 4F5PA 4QZDA 2H3FA 3H0LB 1BNPA 2W9CB 5KFAA 4J9KA 3LWMA 2HOFA 3PMLA 8ICZA 4I2EA 1SGGA 1X40A 3TARA 9ICSA 4J9NA 3QZ7A 2YMQA 1SXEA 1XNSA 2V4QA 5KFOA 3RBDA 3RH6A 3AEVA 2KOBA 1JMSA 4M9LA 3AN1A 2B6GA 2IBKA 4DQQA 3WKCA 2W04A 3UMBA 4KLFA 2PXIA 3JPQA 3RB6A 2KG5A 5F9LA 2DL0A 3HP6A 2KKVA 1XO1A 5DB8A 4UAWA 2XCPA 8ICUA 4DSEA 1WUDA 3E58A 1FFVA 3N7SC 3AQEA 3AMZA 1ZQBA 2LYHA 5CWRA 1N61A 4P0QA 5IIKA 3EUB2 1KTQA 3PX4A 2K4PA 4UATA 4B9NA 2ZIVB 2HOQA 4KLUA 4KLIA 3K1ZA 5ALUA 3Q8QB 7ICRA 5IIMA 3QX7A 2ZTCA 3IN5A 4MEYA 2NRWA 3JPRA 3GILA 4KLEA 3UM9A 2BKEA 4FS1A 2F1IA 3ONNA 3RTVA 4G3IA 3GFKB 3PO4A 3JPSA 2UVWA 7ICHA 5IIIA 4NWIA 1T7PA 4C8KA 4PGXA 3M8SA 1UT8A 5J8YC 5CHGA 4F5RA 4LZDA 2PI4A 4RUCA 2NYVA 4NLBA 1SL2A 4JV0A 2HSZA 3KHLA 1JXLA 4ELVA 2ZJAA 4YP3A 3KKAC 3Q8PB 5CP2A 4Q8EA 1T8EA 3M9MB 2LYAA 4P0PB 4DO9A 4R66A 4QZCA 2VJ5A 1OXJA 1BPZA 3TFRA 4C7YA 4M9JA 4DSLA 4F4ZA 2EZXA 2JHDA 4JMUA 3F2DA 2HW3A 2RQ5A 4KLSA 2BZFA 1IV8A 4JWNA 4QWEA 1P7DA 1NK0A 3V6HA 5J0SA 1FFUA 1K1QA 8ICOA 2G08A 4IC9A 4PZOA 5BPCA 5ALQA 2BPFA 4ECRA 5HR6A 2Q0ZX 3NASA 2HHQA 1GO3F 2HHWA 5L1IA 8ICIA 2YMPA 5DG8A 3QNMA 1ZD4A 1JALA 3ZDBA 1S0VA 4RQ4A 3PR4A 5DB6A 3ZI4A 4A8EA 1KL9A 1Q8KA 3M1YA 3K4GA 4ED1A 2ZJ8A 4EENA 2W8KA 4Q44A 2BQRA 1SV0C 2KMDA 1COKA 2AGQA 5CEHA 5AK5A 4YMOA 2E8OA 1XS9D 3M6ZA 4KMOB 3LVWA 1QLNA 4YMMA 5IIOA 3RRGA 2ZUDA 5KG6A 2GOLA 2E3TA 7ICOA 1U48A 4I2FA 1YT3A 1XSLA 4I2GA 4NLZA 4CRXA 5ALPA 5F3XB 5DGAA 4DEZA 1D8LA 2WF7A 2WF8A 1XWLA 3H40A 2EDUA 3QUTA 4UBBA 4AYBF 2J6SA 2NRZA 1ZQRA 2HBMA 8ICEA 3KD3A 1COOA 3CP8A 4B9TA 4F72A 3ISCA 3ISDA 4QJFB 4KLMA 2M9NA 7ICGA 5G5HA 3MDAA 2UVUA 2ZXHA 2ZIWB 3HWTA 3MFIA 5CB1A 4MFAA 2XCAA 1B22A 1ZJNA 2XI9A 2DQNB 2YB4A 5KFXA 5CR0A 3QXGA 3QU4A 4QZIA 3OSPA 5L1LA 2F1JA 3TADC 1L7PA 3Q8LA 5TISU 4KLDA 2KZ3A 2Y9TA 2ZG6A 2I6XA 1L5UA 1SZPA 5KG3A 3UQ2A 2LYBA 3K75D 1AQ6A 3L5KA 3V6JA 4F4WA 1BNOA 4O5EA 4ACOA 3H0RB 3ZDCA 3QYPA 4C8NA 2ZIXB 4QW8A 2QKQA 3TKAA 4LVSA 3H4BA 1NKEA 1JIHA 5JTIA 2IOHA 1JN3A 5DQIA 4C7ZA 5J0TA 1V85A 3LDAA 3RB0A 5DQGA 1KEJA 1PUZA 2RDIA 1N5XA 1NKCA 2Y0SF 4TUPA 5HMLA 1LKYB 1WYGA 1IM4A 3SI8A 3BS7A 4DFMA 2D8CA 4CF4A 3O0FA 4DF8A 3WKAA 4QNLA 3WKDA 8ICVA 2W3RA 4C0ZA 4O3SA 4YD2A 3T5LA 4OD0A 5E79U 1O08A 2Y9UA 4CF5A 2PFOA 2A1AA 2V4RA 9ICVA 5L1JA 4ED8A 1JI7A 2ZTDA 2G0AA 2G5IB 2HHUA 3QUQA 3WK4A 1U47A 1X9SA 3QU7A 2DPIA 1C7YA 4USAA 5KFZA 4DQIA 5D49A 1BPBA 2W55A 2F44A 3KOOA 1A0PA 3ZDAA 2PI5A 4Y2JA 4QZFA 3M7DA 5FP0A 4Z6FA 3C5FA 5GTHU 1ZQHA 1B43A 3RR7A 5JRTA 2AJQA 4ECXA 3F53A 4CGZA 1QTMA 1KLNA 3F2CA 3RB3A 1L3VA 1URJA 3SAFA 2R8JA 2M0NA 5AM2A 7ICFA 4B6JA 7ICUA 1EXNA 4KN4A 1HUZA 2KZMA 5AK4A 4EEYA 2NO5A 8ICTA 1UQVA 5KFQA 4DOCA 9ICUA 1RYSA 3QU9A 4JK1A 3RJFA 2F2AB 3ICXA 5AKXA 2A1JA 1JUDA 1ZQQA 1NJWA 2IHNA 1D9DA 2ZIXA 5KT3A 1QQ5A 2JRZA 1JX4A 1HJPA 4BDPA 3RAXA 2QB0A 3SQIA 3KZXA 1ZOLA 5C0YA 1WG8A 5J2DA 4F71A 3SMVA 4QZAA 2AU0A 3GDXA 3E2EA 4RNMA 2OXOA 5EE9A 2AHOB 4DQRA 1ZD2P 3RJEA 1KQQA 2BCUA 1RG6A 1ZD3A 3NRWA 5KFWA 5AHXA 2NO4A 4QZGA 4QWAA 4DSIA 5DQHA 8ICBA 3SENA 2PFQA 1WWVA 1S9FA 2K4IA 2GO7A 5J2AA 4ICAA 3JPTA 2K89A 2NRXA 1RPLA 4RQ2A 2F3NA 2JH7A 4MF8A 2MU2A 1DK2A 3IP4B 3ZDEA 1XSNA 5KT7A 4GXIA 3IG8A 5KFSA 2R8IA 1K1SA 1X2IA 3N4MB 4YFKA 5J0PA 2O6KA 3WKBA 3HJEA 3OPXA 1ZQYA 4ECUA 4I29A 1T94A 5ALDA 1SV0A 1ZQJA 2YX8A 2MAXA 5EWEA 2KHQA 3TANA 5DBAA 3AU6A 3EW9A 3N28A 4UARA 1TAMA 4KLLA 5AKLA 3A0HU 4ECWA 2BPGA 4YR2A 1Q46A 3Q8SB 4M9HA 1D9FA 7ICKA 2FPKA 4DLEA 5J0RA 3V7KA 2FLPA 1DXSA 1MQ2A 3B0YA 8ICFA 5KT5A 4F50A 4UB8U 3PV8A 3C28A 3BQ0A 4FE3A 4YXMA 4UQGA 4RUAA 4DL3A 4U7CA 2W9MA 4I2AA 3BQTA 4FZNA 3KFUF 4XUSA 5DB9A 5KL1B 1SL0A 4ELUA 3WU2U 2EQYA 4PL1A 5L9XA 4OJPA 3OHBA 2AQ4A 4ED2A 1U9LA 2RP5A 4IQTA 4DL6A 9ICWA 2DPJA 2C2RA 3IM1A 4Q45A 4P4MA 2G06A 2WFAA 2JR5A 4EBEA 1ZQDA 2KEYA 4MFCA 5JUMA 4AP9A 2YB1A 2KFNA 4R63A 1F44A 1N56A 3MC1A 1VDVA 4IQUA 2JXJA 4BJQA 3EYZA 4M47A 3THVA 1ZQGA 2HVIA 9ICAA 1RQLA 5KT2A 1L8LA 4EYIB 9ICIA 4KLTA 2ES6A 2FDRA 3H8WA 2KJ9A 8ICGA 2ZIWA 2W7OA 4I2HA 5KFUA 4FO6A 3IHQB 1QSYA 3IDWA 2R18A 4G9BA 1NK9A 1LB2B 2FLNA 5AM0A 3V7JA 4IR9A 1TAQA 4PL2A 3PW2A 5J2KA 1NK6A 1A6SA 1N5WA 4DL7A 4OJ5A 4NJ8A 4NV0A 3G6XA 3C23A 5AM5A 4RNOA 4RQ3A 2K8AA 2OEHA 3J81j 3C2MA 2A19A 2EH9A 4M6WA 1NOMA 4IRCA 1B0XA 4MHVA 4WJ3B 7ICTA 1ZQXA 5DBBA 3QU2A 5CA7A 2J6UA 4F5NA 1C20A 4M2YA 5IIJA 4I2JA 5ALEA 5KFLA 3MGIA 1Z1BA 3H8JA 1ZQEA 1QQ7A 2L5YA 5KG4A 1H38A 1DGJA 3PY8A 3SAGA 5AIBA 4DS4A 4DF4A 4KLJA 3T79A 2A3VA 4DCCA 4NL9A 3MR6A 9ICTA 1N2XA 3N97B 2HMXA 3JPPA 1WCLA 1RYUA 5J29A 2R8KA 5J2EA 1ZQTA 4CDGA 4XA5A 4BGDA 4RPZA 3SEIA 2HCFA 3NS1A 2JH1A 4AYBC 3TAQA 2JEFA 5HMMA 5C5JA 2YMMA 2IOFA 4C8LA 3ETRA 1D8BA 3OGUA 9ICMA 4M9NA 1L3SA 8ICJA 5J8YA 2QARB 1RQNA 8ICHA 4UAUA 9ICQA 2BGWA 4RQ6A 1S0MA 2VA2A 4DFDA 2QLTA 1ZQAA 1SXDA 1RXVA 3RJGA 4ED6A 2P6RA 3V72A 5DBCA 5EE3A 1X66A 1MSWD 4K4HA 3C1YA 4PHDA 8ICAA 1UT5A 2BDUA 2YY6A 1WCNA 3L3FX 2F77X 3BDPA 4US9A 4PJ0U 5J0YA 4BWJA 3PR5B 3F2BA 1O03A 1ZD5A 3SV3A 1UHUA 3BS5A 4RQ0A 3T3FA 4YR0A 2I5HA 9ICCA 2ASLA 2XGQA 3D2QA 1KDHA 4KLOA 2DWQA 4XRHA 5KFRA 4KX5A 1BVSA 2HBLA 5KG7A 4C80A 5ALRA 5JU5A 2DBYA 4GC6A 5KFMA 3CRXA 2JV3A 3C21A 5L1KA 2ISOA 2FPMA 4Q43A 2ZUCA 5EE1A 4FFDA 4UAZA 4B9MA 3JPOA 2W54A 1B4FA 1TVAA 1ZQSA 1KKXA 4R65A 5A0LA 1UPHA 4Y2XA 2EZYA 2KHVA 1ZQCA 1NK8A 4PGYA 5HP4A 1OUQA 2KD1A 3UMCA 4FZMA 1J97A 4PGQA 4F4KA 4PZNA 2PKEA 2VANA 2HI0A 3BQ1A 3KBBA 4YMNA 4ECQA 3DEEA 3C2LA 2WHEA 2R8GA 7ICVA 3Q8RB 4M0AA 4J9LA 3PX6A 5DLGA 3V7LA 2AGOA 4P0QB 4GC7A 8ICYA 1T4GA 2ZIVA 3KHRA 4NL9C 2PFPA 3AU2A 5CJ7A 2NRTA 4F93B 2BCQA 2F76X 1Q3VA 2QB0B 4Y2TA 3RH4A 5ALTA 2JEGA 3GU3A 1SV4A 2OM6A 5IINA 3UQ0A 1LVHA 3UMGA 3PW4A 3GZFA 4UB1A 4B9UA 5AKYA 3ED5A 3KZIU 5BOMA 5EWGA 2QB1A 3BQ7A 2PFNA 4R64A 4I2IA 2DKZA 2DFLA 4DSKA 1LKYA 4UW9A 3HRDD 1ZQMA 2J6TA 1QSSA 4O3PA 2JMGA 2ATLA 4ECSA 4F8RA 3C5GA 4P4OA 3HX0A 5AI8A 1Z00A 5AM1A 1Z4NA 4IRDA 3SZ2A 3I76A 3B9JA 1ZYQA 1TK8A 3LVVA 4UB4A 4DFPA 3SAHA 3MABA 3C2KA 3PX0A 3JPNA 5KG1A 1PZNA 2W03A 1TFRA 1Z4OA 2FLLA 2W7PA 1T3NA 1S97A 2KV2A 1DGSA 1HEKA 4O9MA 4DQSA 2KIWA 2KICA 9ICKA 5ALMA 5KFFA 2C22A 1S0OA 4FBUA 4BXOA 4NLCA 8ICWA 4IS7A 2K4EA 1PK1B 3NUQA 4NY8A 1SWWA 3BZKA 2AH5A 2F8LA 2FJ6A 3RF9A 5EWFA 3MGHA 4J9QA 2H3VA 4Y2PA 4P2HA 3HKZC 1ZXIA 3IV6A 2HHXA 4MF2A 3WK6A 1S10A 1NJYA 2LKYA 2IOFK 3D2NA 3WK5A 2W11A 3H8SA 1NZBA 4E0DA 4RQ8A 3L4PA 2KVCA 1Z3EB 4RU9A 4OJOA 2FMQA 2WTFA 2XICA 2CRXA 1U4BA 2VA3A 1X9XA 2CN1A 2D3DA 3EPIA 5HNKA 1HUOA 4I27A 2BCSA 8ICSA 2H3ZA 2HBJA 2ISPA 4UB2A 5DKWA 2FE9A 1ZQKA 4J9OA 2C2DA 4J9MA 3QUCA 2P66A 1X42A 3I1YA 2KZZA 4KITB 7ICNA 4CNQA 4Y2VA 4EBDA 3RJJA 3KKAA 3OSNA 4YR3A 5ALJA 2MUTB 1KN5A 4EX7A 1BPDA 4GXJA 4GLXA 2JZBB 2KSOA 1SWVA 4ECVA 1ZRNA 2YQEA 3H4DA 2A1JB 2W9BB 4DL5A 1L7OA 2IA6A 1ECWA 1A76A 2NRVA 4GIBA 1ZQFA 3MFHA 3ZD8A 3G6VA 5J2HA 3BS5B 3BQ2A 1SKSA 2HOIA 1MC8A 3QZ8A 1YZ6A 5KFEA 1TAUA 4J03A 4DSJA 5DDMA 2KVSA 3SD7A 4UB3A 2ALZA 3T5HA 2B0CA 4NLKA 1Z1VA 4M04A 1ZQLA 5KFDA 5KFYA 3UXNA 1OW5A 4Z6CA 3SYZA 2JEIA 2KIVA 4X5VA 4BXOB 3AQFA 1L3UA 4ED3A 3ETLA 1BGXT 2I9GA 3MDCA 1DK3A 3FM9A 1ZQUA 3CNHA
chains in the Genus database with same CATH topology
1KN5A 1RYUA 2KK0A 2JRZA 4LJXA 1C20A 1KQQA 2JXJA 1IG6A 2LM1A 2EQYA 2OEHA 1KKXA 2LI6A 2RQ5A 2EH9A 2YQEA 5K4LA 5CEHA 2CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  1RYU A;  2KK0 A;  2JRZ A;  4LJX A;  1C20 A;  1KQQ A;  2JXJ A;  1IG6 A;  2LM1 A;  2EQY A;  2OEH A;  1KKX A;  2LI6 A;  2RQ5 A;  2EH9 A;  2YQE A;  5K4L A;  5CEH A;  2CXY A; 
#chains in the Genus database with same CATH topology
 2P6U A;  5KAF U;  4IQV A;  1J2N A;  5ALZ A;  5AIC A;  8ICK A;  2XVT A;  4BX9 C;  5CRX A;  1L3T A;  2IMW P;  2ZIU A;  3EZ5 A;  4Z6E A;  4MEX A;  4F5Q A;  2H5X A;  3HW8 A;  5H2F U;  4U6P A;  3TFS A;  2DUY A;  3RB4 A;  4ED7 A;  1TKD A;  3HT3 A;  2CXY A;  1RZT A;  2LPE A;  3PSP A;  3BJY A;  4UAY A;  2JZB A;  5AI6 A;  5KFG A;  4FBT A;  3ZD9 A;  4DOB A;  3KHH A;  2G07 A;  4XQ8 A;  5KFT A;  1IXR A;  4K4G A;  2GLE A;  1XU4 A;  2BR0 A;  5ALS A;  3I28 A;  3HIL A;  4J9R A;  4ZH4 A;  2XID A;  2W43 A;  4CCH A;  2W9B A;  3VCB A;  1IIP A;  5J2B A;  3VC8 A;  4PHE A;  2OYY A;  4DSF A;  4QZ8 A;  2OCE A;  2K4H A;  4NLN A;  5AK3 A;  3RRH A;  3S6J A;  3HKZ F;  5HHI A;  1RXW A;  1MN8 A;  4M9G A;  3M9N B;  3WK7 A;  5KFH A;  3A0B U;  5J2J A;  4TUR A;  3RR8 A;  8ICN A;  2XY7 A;  3GV8 B;  4HYK A;  3D6J A;  3UXP A;  5AI4 A;  5HR7 A;  2KTQ A;  1NZP A;  5KFC A;  3RBE A;  4TQS A;  1MA7 A;  4CE6 A;  5AKJ A;  2F1H A;  2JGA A;  1UCV A;  4Y2U A;  5AKZ A;  3ZDD A;  4IL6 U;  2Z7J A;  2HBK A;  3GII A;  2AQ0 A;  3ORY A;  1PK3 A;  4K4I A;  2AGP A;  2HHT A;  2KN7 A;  5AKG A;  3QU5 A;  1VJ5 A;  4EEL A;  2BQU A;  2KJ5 A;  2XO7 A;  1CUK A;  4JWM A;  4I2D A;  2GWS A;  3MR2 A;  1F0M A;  5AIA A;  2E1F A;  2UVR A;  4O3Q A;  4NLG A;  3PSF A;  2FMS A;  3CW2 C;  3NVZ A;  2H3I A;  2ODG A;  4UBC A;  3DV9 A;  3Q8M A;  4J9P A;  2ZIU B;  2KE7 A;  3SR6 A;  5KG0 A;  4RNN A;  3NVY A;  2FI1 A;  4Q8F A;  4PHP A;  2LM1 A;  1TV9 A;  4LZG A;  1ZRM A;  1FEZ A;  4ZOH C;  3PVX A;  2E1E A;  3Q8K A;  2W9A A;  1S8O A;  4YG2 A;  2BDP A;  1M6Y A;  1V38 A;  5ALI A;  2W9C A;  4KLH A;  3OJS A;  5ALX A;  5KT6 A;  9ICO A;  3GV7 B;  4BUG A;  3NGD A;  2LBO A;  5J2G A;  2ZJ5 A;  4EBC A;  1TK5 A;  1FO4 A;  1QH9 A;  4C4T A;  1BPX A;  5J2C A;  4HAI A;  3QEB Z;  2YTU A;  2OHF A;  2G09 A;  3PW5 A;  4TQR A;  5J0W A;  1F5S A;  5ALG A;  3H7I A;  3GQC A;  2K8C B;  4BWM A;  4UB6 U;  1SKR A;  1JRO A;  5EE0 A;  4DL4 A;  1PVR A;  1ZQI A;  1S76 D;  1X6J A;  3TAC B;  4ED0 A;  8ICP A;  3QUB A;  4Y2R A;  4YVZ A;  3IG5 A;  3K1R B;  4QWD A;  1KFS A;  2ZUB A;  4C4R A;  4EZ6 A;  1N62 A;  1N63 A;  2R8H A;  3UXO A;  4RQN A;  2C28 A;  3B0X A;  9ICB A;  2FMP A;  2WB1 F;  2K60 A;  4QZH A;  1S77 D;  5DGB A;  2WF6 A;  9ICL A;  2E8P A;  2EAN A;  4DFJ A;  1L8O A;  4MFF A;  2KP7 A;  5J0U A;  3TAP A;  5HHH A;  4QWC A;  4C8M A;  3C29 A;  2GH1 A;  5J0Q A;  5EOZ A;  2XY5 A;  3AM9 A;  1L6N A;  2ESE A;  2W3S A;  3PMN A;  3OHA A;  1KFT A;  4YN4 A;  3MGV A;  2MA1 A;  4O5C A;  4I2B A;  5ALV A;  3MBY A;  1XO0 A;  2JEJ A;  2LI6 A;  4EX6 A;  4ECY A;  2P35 A;  2VJ4 A;  1J2M A;  4CF3 A;  4NXZ A;  3RJK A;  3N7R C;  1D8Y A;  3AL0 B;  4RT3 A;  1ZET A;  2F8K A;  4QZE A;  2MSN A;  4QIW F;  5ALF A;  4DWI A;  1DOQ A;  1KRP A;  5BOL A;  4O3M A;  1ZQV A;  1NK5 A;  1XSP A;  4ELT A;  4RQM A;  1N48 A;  1ZQN A;  4QWB A;  3RAQ A;  2KFZ A;  3T5J A;  9ICX A;  3PO5 A;  8ICL A;  4RQ1 A;  4B9L A;  3NVW A;  5KL8 B;  1ZQ1 C;  1SL1 A;  5AK6 A;  5AKE A;  1TE2 A;  3RJH A;  2EZZ A;  4JV1 A;  3NTU A;  5F9N A;  5KNI A;  2ASD A;  9ICR A;  3TAD A;  4F3O A;  5KFN A;  5DB7 A;  4KN7 A;  1RM6 C;  4IRK A;  1S5L U;  2KKP A;  2HDO A;  1RDF A;  3QEA Z;  2KJ8 A;  3GIJ A;  1X9M A;  5KAI U;  3V6K A;  7ICS A;  4DQP A;  2WB1 C;  4KLQ A;  1WWU A;  2I1Q A;  4RQ5 A;  4F2R A;  4FS2 A;  2CPR A;  2Q4T A;  4PPX A;  3H8M A;  2G5H B;  1NK4 A;  4UB5 A;  1L7M A;  2W8L A;  3WK8 A;  4KTQ A;  4TUQ A;  5GTI U;  5D46 A;  4O0I A;  3RFA A;  1UA1 A;  4P4P A;  1NNL A;  4US8 A;  3QE9 Y;  3ISB A;  2KNJ A;  4R8U B;  2WAQ C;  4YXJ A;  3EWA A;  2N1R A;  3PNC A;  1ZQO A;  5B66 U;  4I2C A;  5L1M A;  4J9S A;  1MQ3 A;  8ICC A;  5AI5 A;  2LM4 A;  4PH5 A;  2YML A;  3HPO A;  4F92 B;  3H0M B;  2XGP A;  5KFP A;  2LHT A;  1RYR A;  2HHV A;  4OJL A;  5J2I A;  4TUS A;  1JXE A;  2RLT A;  4KLG A;  9ICH A;  5DG7 A;  5KT4 A;  3TQ1 A;  4Y2S A;  4C4S A;  4QZB A;  4B9V A;  4QIW C;  5KTQ A;  1ZQW A;  4PHA A;  4Z6D A;  4LJX A;  1TK0 A;  2QAR A;  1SB3 C;  3LWL A;  5KG2 A;  2RDJ A;  4IR1 A;  1S0N A;  5KFK A;  1HIW A;  1LV5 A;  4RZR A;  1K5O A;  4DS5 A;  2Y0S C;  4DOA A;  3WK9 A;  1ZJM A;  2ASJ A;  1Y88 A;  4ECT A;  2MRL A;  9ICJ A;  2Y1I A;  5J0O A;  1SZH A;  1VLB A;  3EPG A;  4IQW A;  4OJ6 A;  4OCZ A;  4Y2Q A;  5TZV A;  1QQ6 A;  1CRX A;  4NM1 A;  2V9W A;  9ICE A;  1JRP A;  4DL2 A;  4JV2 A;  2ZTE A;  3KHG A;  3M6K A;  4EEK A;  2RHF A;  8ICR A;  4O3N A;  4KX3 A;  4RPX A;  5ALN A;  5DLF A;  3CYM A;  1NJZ A;  1QCK A;  5J2F A;  5AKK A;  1KSP A;  4RPY A;  1V9P A;  2OWO A;  3F5A A;  5G5G A;  7ICJ A;  3BZC A;  2D6F C;  1IG6 A;  3GIK A;  2BPC A;  7ICI A;  1ARO P;  4DLG A;  4O3O A;  3U26 A;  5B5E U;  5T14 A;  3FYH A;  4F2S A;  4O3R A;  9ICP A;  3C1Z A;  2UVV A;  4C8O A;  1X6I A;  2Y1J A;  2VIX A;  4GXK A;  5KFI A;  2DKX A;  1N60 A;  7ICE A;  3RH5 A;  2C2E A;  1V97 A;  2E8N A;  1T3Q A;  2EAP A;  2EAO A;  1Z00 B;  4Y2Y A;  3PW7 A;  3N7P D;  5ALL A;  4F5O A;  2PMZ C;  5AM4 A;  2RRD A;  3KTQ A;  4UAV A;  5KFB A;  4QW9 A;  8ICM A;  1PVP A;  3PST A;  2E5S A;  4QZ9 A;  5ALH A;  2NV3 A;  2E8M A;  5J0X A;  2HVH A;  2VA8 A;  5DDY A;  4UAS A;  3MR3 A;  5ALK A;  1QSL A;  5AI9 A;  1NK7 A;  4OO1 J;  5AKH A;  2LMR A;  1NI3 A;  3FC4 A;  2BHN A;  8ICQ A;  1PK1 A;  2DF4 B;  4NM2 A;  5KG5 A;  3LYS A;  3T5K A;  3R9K A;  1Z19 A;  2YN4 A;  9ICN A;  2WAQ F;  3NVV A;  1ZQZ A;  4RQ7 A;  5AM3 A;  5AI0 A;  1SIJ A;  3LK9 A;  3GV5 B;  4EYH B;  2VKQ A;  1X9W A;  1KFD A;  2BCV A;  2EAM A;  3PSI A;  1CI4 A;  2FPL A;  4O5K A;  5ALY A;  4YD1 A;  9ICF A;  1A77 A;  7ICP A;  3MR5 A;  1L7N A;  2WF9 A;  1CEZ A;  4F4X A;  5KFV A;  2HHS A;  2IHM A;  4YQW A;  1KBU A;  3OTQ A;  3WKE A;  4DFK A;  8ICX A;  3IRU A;  3M9O B;  3AUO A;  1ZQP A;  1UA0 A;  5ALW A;  4EZ9 A;  1YZ7 A;  5ALO A;  4F4Y A;  1BPY A;  2DGZ A;  4R8U A;  3GIM A;  3TI0 A;  2ZXI A;  5D4B A;  1SKW A;  3DDH A;  2XC9 A;  1FIQ A;  1DRG A;  4F91 B;  3M8R A;  2OH2 A;  2BCR A;  2BQ3 A;  5DG9 A;  5KFJ A;  3OJU A;  4JUZ A;  4YCX A;  3FDS A;  2XY6 A;  1NJX A;  3NRZ A;  2H3Q A;  3E0F A;  7ICQ A;  3SV4 A;  3RJI A;  4GFJ A;  1Q3U A;  2WF5 A;  4FZL A;  7ICL A;  2K8B B;  3F5E A;  1PVQ A;  3G6Y A;  2PMZ F;  2MUT A;  5AKI A;  1U45 A;  4P0P A;  4KMU A;  2KSO B;  4M6W B;  9ICG A;  3PZP A;  1XC9 A;  1ED1 A;  1KW4 A;  3ALR A;  3FAH A;  3D2S A;  4JB3 A;  1U49 A;  2AXT U;  2KK0 A;  5IIL A;  4B9S A;  1BPE A;  5K4L A;  1NKB A;  2B21 A;  4ECZ A;  7ICM A;  3UPQ A;  3PW0 A;  4I28 A;  4RT2 A;  4F5P A;  4QZD A;  2H3F A;  3H0L B;  1BNP A;  2W9C B;  5KFA A;  4J9K A;  3LWM A;  2HOF A;  3PML A;  8ICZ A;  4I2E A;  1SGG A;  1X40 A;  3TAR A;  9ICS A;  4J9N A;  3QZ7 A;  2YMQ A;  1SXE A;  1XNS A;  2V4Q A;  5KFO A;  3RBD A;  3RH6 A;  3AEV A;  2KOB A;  1JMS A;  4M9L A;  3AN1 A;  2B6G A;  2IBK A;  4DQQ A;  3WKC A;  2W04 A;  3UMB A;  4KLF A;  2PXI A;  3JPQ A;  3RB6 A;  2KG5 A;  5F9L A;  2DL0 A;  3HP6 A;  2KKV A;  1XO1 A;  5DB8 A;  4UAW A;  2XCP A;  8ICU A;  4DSE A;  1WUD A;  3E58 A;  1FFV A;  3N7S C;  3AQE A;  3AMZ A;  1ZQB A;  2LYH A;  5CWR A;  1N61 A;  4P0Q A;  5IIK A;  3EUB 2;  1KTQ A;  3PX4 A;  2K4P A;  4UAT A;  4B9N A;  2ZIV B;  2HOQ A;  4KLU A;  4KLI A;  3K1Z A;  5ALU A;  3Q8Q B;  7ICR A;  5IIM A;  3QX7 A;  2ZTC A;  3IN5 A;  4MEY A;  2NRW A;  3JPR A;  3GIL A;  4KLE A;  3UM9 A;  2BKE A;  4FS1 A;  2F1I A;  3ONN A;  3RTV A;  4G3I A;  3GFK B;  3PO4 A;  3JPS A;  2UVW A;  7ICH A;  5III A;  4NWI A;  1T7P A;  4C8K A;  4PGX A;  3M8S A;  1UT8 A;  5J8Y C;  5CHG A;  4F5R A;  4LZD A;  2PI4 A;  4RUC A;  2NYV A;  4NLB A;  1SL2 A;  4JV0 A;  2HSZ A;  3KHL A;  1JXL A;  4ELV A;  2ZJA A;  4YP3 A;  3KKA C;  3Q8P B;  5CP2 A;  4Q8E A;  1T8E A;  3M9M B;  2LYA A;  4P0P B;  4DO9 A;  4R66 A;  4QZC A;  2VJ5 A;  1OXJ A;  1BPZ A;  3TFR A;  4C7Y A;  4M9J A;  4DSL A;  4F4Z A;  2EZX A;  2JHD A;  4JMU A;  3F2D A;  2HW3 A;  2RQ5 A;  4KLS A;  2BZF A;  1IV8 A;  4JWN A;  4QWE A;  1P7D A;  1NK0 A;  3V6H A;  5J0S A;  1FFU A;  1K1Q A;  8ICO A;  2G08 A;  4IC9 A;  4PZO A;  5BPC A;  5ALQ A;  2BPF A;  4ECR A;  5HR6 A;  2Q0Z X;  3NAS A;  2HHQ A;  1GO3 F;  2HHW A;  5L1I A;  8ICI A;  2YMP A;  5DG8 A;  3QNM A;  1ZD4 A;  1JAL A;  3ZDB A;  1S0V A;  4RQ4 A;  3PR4 A;  5DB6 A;  3ZI4 A;  4A8E A;  1KL9 A;  1Q8K A;  3M1Y A;  3K4G A;  4ED1 A;  2ZJ8 A;  4EEN A;  2W8K A;  4Q44 A;  2BQR A;  1SV0 C;  2KMD A;  1COK A;  2AGQ A;  5CEH A;  5AK5 A;  4YMO A;  2E8O A;  1XS9 D;  3M6Z A;  4KMO B;  3LVW A;  1QLN A;  4YMM A;  5IIO A;  3RRG A;  2ZUD A;  5KG6 A;  2GOL A;  2E3T A;  7ICO A;  1U48 A;  4I2F A;  1YT3 A;  1XSL A;  4I2G A;  4NLZ A;  4CRX A;  5ALP A;  5F3X B;  5DGA A;  4DEZ A;  1D8L A;  2WF7 A;  2WF8 A;  1XWL A;  3H40 A;  2EDU A;  3QUT A;  4UBB A;  4AYB F;  2J6S A;  2NRZ A;  1ZQR A;  2HBM A;  8ICE A;  3KD3 A;  1COO A;  3CP8 A;  4B9T A;  4F72 A;  3ISC A;  3ISD A;  4QJF B;  4KLM A;  2M9N A;  7ICG A;  5G5H A;  3MDA A;  2UVU A;  2ZXH A;  2ZIW B;  3HWT A;  3MFI A;  5CB1 A;  4MFA A;  2XCA A;  1B22 A;  1ZJN A;  2XI9 A;  2DQN B;  2YB4 A;  5KFX A;  5CR0 A;  3QXG A;  3QU4 A;  4QZI A;  3OSP A;  5L1L A;  2F1J A;  3TAD C;  1L7P A;  3Q8L A;  5TIS U;  4KLD A;  2KZ3 A;  2Y9T A;  2ZG6 A;  2I6X A;  1L5U A;  1SZP A;  5KG3 A;  3UQ2 A;  2LYB A;  3K75 D;  1AQ6 A;  3L5K A;  3V6J A;  4F4W A;  1BNO A;  4O5E A;  4ACO A;  3H0R B;  3ZDC A;  3QYP A;  4C8N A;  2ZIX B;  4QW8 A;  2QKQ A;  3TKA A;  4LVS A;  3H4B A;  1NKE A;  1JIH A;  5JTI A;  2IOH A;  1JN3 A;  5DQI A;  4C7Z A;  5J0T A;  1V85 A;  3LDA A;  3RB0 A;  5DQG A;  1KEJ A;  1PUZ A;  2RDI A;  1N5X A;  1NKC A;  2Y0S F;  4TUP A;  5HML A;  1LKY B;  1WYG A;  1IM4 A;  3SI8 A;  3BS7 A;  4DFM A;  2D8C A;  4CF4 A;  3O0F A;  4DF8 A;  3WKA A;  4QNL A;  3WKD A;  8ICV A;  2W3R A;  4C0Z A;  4O3S A;  4YD2 A;  3T5L A;  4OD0 A;  5E79 U;  1O08 A;  2Y9U A;  4CF5 A;  2PFO A;  2A1A A;  2V4R A;  9ICV A;  5L1J A;  4ED8 A;  1JI7 A;  2ZTD A;  2G0A A;  2G5I B;  2HHU A;  3QUQ A;  3WK4 A;  1U47 A;  1X9S A;  3QU7 A;  2DPI A;  1C7Y A;  4USA A;  5KFZ A;  4DQI A;  5D49 A;  1BPB A;  2W55 A;  2F44 A;  3KOO A;  1A0P A;  3ZDA A;  2PI5 A;  4Y2J A;  4QZF A;  3M7D A;  5FP0 A;  4Z6F A;  3C5F A;  5GTH U;  1ZQH A;  1B43 A;  3RR7 A;  5JRT A;  2AJQ A;  4ECX A;  3F53 A;  4CGZ A;  1QTM A;  1KLN A;  3F2C A;  3RB3 A;  1L3V A;  1URJ A;  3SAF A;  2R8J A;  2M0N A;  5AM2 A;  7ICF A;  4B6J A;  7ICU A;  1EXN A;  4KN4 A;  1HUZ A;  2KZM A;  5AK4 A;  4EEY A;  2NO5 A;  8ICT A;  1UQV A;  5KFQ A;  4DOC A;  9ICU A;  1RYS A;  3QU9 A;  4JK1 A;  3RJF A;  2F2A B;  3ICX A;  5AKX A;  2A1J A;  1JUD A;  1ZQQ A;  1NJW A;  2IHN A;  1D9D A;  2ZIX A;  5KT3 A;  1QQ5 A;  2JRZ A;  1JX4 A;  1HJP A;  4BDP A;  3RAX A;  2QB0 A;  3SQI A;  3KZX A;  1ZOL A;  5C0Y A;  1WG8 A;  5J2D A;  4F71 A;  3SMV A;  4QZA A;  2AU0 A;  3GDX A;  3E2E A;  4RNM A;  2OXO A;  5EE9 A;  2AHO B;  4DQR A;  1ZD2 P;  3RJE A;  1KQQ A;  2BCU A;  1RG6 A;  1ZD3 A;  3NRW A;  5KFW A;  5AHX A;  2NO4 A;  4QZG A;  4QWA A;  4DSI A;  5DQH A;  8ICB A;  3SEN A;  2PFQ A;  1WWV A;  1S9F A;  2K4I A;  2GO7 A;  5J2A A;  4ICA A;  3JPT A;  2K89 A;  2NRX A;  1RPL A;  4RQ2 A;  2F3N A;  2JH7 A;  4MF8 A;  2MU2 A;  1DK2 A;  3IP4 B;  3ZDE A;  1XSN A;  5KT7 A;  4GXI A;  3IG8 A;  5KFS A;  2R8I A;  1K1S A;  1X2I A;  3N4M B;  4YFK A;  5J0P A;  2O6K A;  3WKB A;  3HJE A;  3OPX A;  1ZQY A;  4ECU A;  4I29 A;  1T94 A;  5ALD A;  1SV0 A;  1ZQJ A;  2YX8 A;  2MAX A;  5EWE A;  2KHQ A;  3TAN A;  5DBA A;  3AU6 A;  3EW9 A;  3N28 A;  4UAR A;  1TAM A;  4KLL A;  5AKL A;  3A0H U;  4ECW A;  2BPG A;  4YR2 A;  1Q46 A;  3Q8S B;  4M9H A;  1D9F A;  7ICK A;  2FPK A;  4DLE A;  5J0R A;  3V7K A;  2FLP A;  1DXS A;  1MQ2 A;  3B0Y A;  8ICF A;  5KT5 A;  4F50 A;  4UB8 U;  3PV8 A;  3C28 A;  3BQ0 A;  4FE3 A;  4YXM A;  4UQG A;  4RUA A;  4DL3 A;  4U7C A;  2W9M A;  4I2A A;  3BQT A;  4FZN A;  3KFU F;  4XUS A;  5DB9 A;  5KL1 B;  1SL0 A;  4ELU A;  3WU2 U;  2EQY A;  4PL1 A;  5L9X A;  4OJP A;  3OHB A;  2AQ4 A;  4ED2 A;  1U9L A;  2RP5 A;  4IQT A;  4DL6 A;  9ICW A;  2DPJ A;  2C2R A;  3IM1 A;  4Q45 A;  4P4M A;  2G06 A;  2WFA A;  2JR5 A;  4EBE A;  1ZQD A;  2KEY A;  4MFC A;  5JUM A;  4AP9 A;  2YB1 A;  2KFN A;  4R63 A;  1F44 A;  1N56 A;  3MC1 A;  1VDV A;  4IQU A;  2JXJ A;  4BJQ A;  3EYZ A;  4M47 A;  3THV A;  1ZQG A;  2HVI A;  9ICA A;  1RQL A;  5KT2 A;  1L8L A;  4EYI B;  9ICI A;  4KLT A;  2ES6 A;  2FDR A;  3H8W A;  2KJ9 A;  8ICG A;  2ZIW A;  2W7O A;  4I2H A;  5KFU A;  4FO6 A;  3IHQ B;  1QSY A;  3IDW A;  2R18 A;  4G9B A;  1NK9 A;  1LB2 B;  2FLN A;  5AM0 A;  3V7J A;  4IR9 A;  1TAQ A;  4PL2 A;  3PW2 A;  5J2K A;  1NK6 A;  1A6S A;  1N5W A;  4DL7 A;  4OJ5 A;  4NJ8 A;  4NV0 A;  3G6X A;  3C23 A;  5AM5 A;  4RNO A;  4RQ3 A;  2K8A A;  2OEH A;  3J81 j;  3C2M A;  2A19 A;  2EH9 A;  4M6W A;  1NOM A;  4IRC A;  1B0X A;  4MHV A;  4WJ3 B;  7ICT A;  1ZQX A;  5DBB A;  3QU2 A;  5CA7 A;  2J6U A;  4F5N A;  1C20 A;  4M2Y A;  5IIJ A;  4I2J A;  5ALE A;  5KFL A;  3MGI A;  1Z1B A;  3H8J A;  1ZQE A;  1QQ7 A;  2L5Y A;  5KG4 A;  1H38 A;  1DGJ A;  3PY8 A;  3SAG A;  5AIB A;  4DS4 A;  4DF4 A;  4KLJ A;  3T79 A;  2A3V A;  4DCC A;  4NL9 A;  3MR6 A;  9ICT A;  1N2X A;  3N97 B;  2HMX A;  3JPP A;  1WCL A;  1RYU A;  5J29 A;  2R8K A;  5J2E A;  1ZQT A;  4CDG A;  4XA5 A;  4BGD A;  4RPZ A;  3SEI A;  2HCF A;  3NS1 A;  2JH1 A;  4AYB C;  3TAQ A;  2JEF A;  5HMM A;  5C5J A;  2YMM A;  2IOF A;  4C8L A;  3ETR A;  1D8B A;  3OGU A;  9ICM A;  4M9N A;  1L3S A;  8ICJ A;  5J8Y A;  2QAR B;  1RQN A;  8ICH A;  4UAU A;  9ICQ A;  2BGW A;  4RQ6 A;  1S0M A;  2VA2 A;  4DFD A;  2QLT A;  1ZQA A;  1SXD A;  1RXV A;  3RJG A;  4ED6 A;  2P6R A;  3V72 A;  5DBC A;  5EE3 A;  1X66 A;  1MSW D;  4K4H A;  3C1Y A;  4PHD A;  8ICA A;  1UT5 A;  2BDU A;  2YY6 A;  1WCN A;  3L3F X;  2F77 X;  3BDP A;  4US9 A;  4PJ0 U;  5J0Y A;  4BWJ A;  3PR5 B;  3F2B A;  1O03 A;  1ZD5 A;  3SV3 A;  1UHU A;  3BS5 A;  4RQ0 A;  3T3F A;  4YR0 A;  2I5H A;  9ICC A;  2ASL A;  2XGQ A;  3D2Q A;  1KDH A;  4KLO A;  2DWQ A;  4XRH A;  5KFR A;  4KX5 A;  1BVS A;  2HBL A;  5KG7 A;  4C80 A;  5ALR A;  5JU5 A;  2DBY A;  4GC6 A;  5KFM A;  3CRX A;  2JV3 A;  3C21 A;  5L1K A;  2ISO A;  2FPM A;  4Q43 A;  2ZUC A;  5EE1 A;  4FFD A;  4UAZ A;  4B9M A;  3JPO A;  2W54 A;  1B4F A;  1TVA A;  1ZQS A;  1KKX A;  4R65 A;  5A0L A;  1UPH A;  4Y2X A;  2EZY A;  2KHV A;  1ZQC A;  1NK8 A;  4PGY A;  5HP4 A;  1OUQ A;  2KD1 A;  3UMC A;  4FZM A;  1J97 A;  4PGQ A;  4F4K A;  4PZN A;  2PKE A;  2VAN A;  2HI0 A;  3BQ1 A;  3KBB A;  4YMN A;  4ECQ A;  3DEE A;  3C2L A;  2WHE A;  2R8G A;  7ICV A;  3Q8R B;  4M0A A;  4J9L A;  3PX6 A;  5DLG A;  3V7L A;  2AGO A;  4P0Q B;  4GC7 A;  8ICY A;  1T4G A;  2ZIV A;  3KHR A;  4NL9 C;  2PFP A;  3AU2 A;  5CJ7 A;  2NRT A;  4F93 B;  2BCQ A;  2F76 X;  1Q3V A;  2QB0 B;  4Y2T A;  3RH4 A;  5ALT A;  2JEG A;  3GU3 A;  1SV4 A;  2OM6 A;  5IIN A;  3UQ0 A;  1LVH A;  3UMG A;  3PW4 A;  3GZF A;  4UB1 A;  4B9U A;  5AKY A;  3ED5 A;  3KZI U;  5BOM A;  5EWG A;  2QB1 A;  3BQ7 A;  2PFN A;  4R64 A;  4I2I A;  2DKZ A;  2DFL A;  4DSK A;  1LKY A;  4UW9 A;  3HRD D;  1ZQM A;  2J6T A;  1QSS A;  4O3P A;  2JMG A;  2ATL A;  4ECS A;  4F8R A;  3C5G A;  4P4O A;  3HX0 A;  5AI8 A;  1Z00 A;  5AM1 A;  1Z4N A;  4IRD A;  3SZ2 A;  3I76 A;  3B9J A;  1ZYQ A;  1TK8 A;  3LVV A;  4UB4 A;  4DFP A;  3SAH A;  3MAB A;  3C2K A;  3PX0 A;  3JPN A;  5KG1 A;  1PZN A;  2W03 A;  1TFR A;  1Z4O A;  2FLL A;  2W7P A;  1T3N A;  1S97 A;  2KV2 A;  1DGS A;  1HEK A;  4O9M A;  4DQS A;  2KIW A;  2KIC A;  9ICK A;  5ALM A;  5KFF A;  2C22 A;  1S0O A;  4FBU A;  4BXO A;  4NLC A;  8ICW A;  4IS7 A;  2K4E A;  1PK1 B;  3NUQ A;  4NY8 A;  1SWW A;  3BZK A;  2AH5 A;  2F8L A;  2FJ6 A;  3RF9 A;  5EWF A;  3MGH A;  4J9Q A;  2H3V A;  4Y2P A;  4P2H A;  3HKZ C;  1ZXI A;  3IV6 A;  2HHX A;  4MF2 A;  3WK6 A;  1S10 A;  1NJY A;  2LKY A;  2IOF K;  3D2N A;  3WK5 A;  2W11 A;  3H8S A;  1NZB A;  4E0D A;  4RQ8 A;  3L4P A;  2KVC A;  1Z3E B;  4RU9 A;  4OJO A;  2FMQ A;  2WTF A;  2XIC A;  2CRX A;  1U4B A;  2VA3 A;  1X9X A;  2CN1 A;  2D3D A;  3EPI A;  5HNK A;  1HUO A;  4I27 A;  2BCS A;  8ICS A;  2H3Z A;  2HBJ A;  2ISP A;  4UB2 A;  5DKW A;  2FE9 A;  1ZQK A;  4J9O A;  2C2D A;  4J9M A;  3QUC A;  2P66 A;  1X42 A;  3I1Y A;  2KZZ A;  4KIT B;  7ICN A;  4CNQ A;  4Y2V A;  4EBD A;  3RJJ A;  3KKA A;  3OSN A;  4YR3 A;  5ALJ A;  2MUT B;  1KN5 A;  4EX7 A;  1BPD A;  4GXJ A;  4GLX A;  2JZB B;  2KSO A;  1SWV A;  4ECV A;  1ZRN A;  2YQE A;  3H4D A;  2A1J B;  2W9B B;  4DL5 A;  1L7O A;  2IA6 A;  1ECW A;  1A76 A;  2NRV A;  4GIB A;  1ZQF A;  3MFH A;  3ZD8 A;  3G6V A;  5J2H A;  3BS5 B;  3BQ2 A;  1SKS A;  2HOI A;  1MC8 A;  3QZ8 A;  1YZ6 A;  5KFE A;  1TAU A;  4J03 A;  4DSJ A;  5DDM A;  2KVS A;  3SD7 A;  4UB3 A;  2ALZ A;  3T5H A;  2B0C A;  4NLK A;  1Z1V A;  4M04 A;  1ZQL A;  5KFD A;  5KFY A;  3UXN A;  1OW5 A;  4Z6C A;  3SYZ A;  2JEI A;  2KIV A;  4X5V A;  4BXO B;  3AQF A;  1L3U A;  4ED3 A;  3ETL A;  1BGX T;  2I9G A;  3MDC A;  1DK3 A;  3FM9 A;  1ZQU A;  3CNH A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  1RYU A;  2KK0 A;  2JRZ A;  4LJX A;  1C20 A;  1KQQ A;  2JXJ A;  1IG6 A;  2LM1 A;  2EQY A;  2OEH A;  1KKX A;  2LI6 A;  2RQ5 A;  2EH9 A;  2YQE A;  5K4L A;  5CEH A;  2CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...