1LVHA

The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
220
Chain Sequence
MFKAVLFLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
publication title Caught in the act: the structure of phosphorylated beta-phosphoglucomutase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 75
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1lvhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1lvhA01
3AR7A 5AW7A 1ZRNA 3N8GA 4KX3A 3HYCA 3PDWA 2IOHA 2RBKA 1RLOA 3SD7A 2RAVA 1U7PA 3N1UA 3NAMA 5AW4A 4Y2PA 2HEGA 2IOFA 5ALKA 3WKDA 2BY4A 3E81A 4DWOA 1ZRMA 2D2VA 4OFZA 4ZEVA 1PW5A 3EPRA 3SKXA 3OCXA 4AP9A 1RMTA 2YJ4A 1O08A 1YV9A 1TJ4A 1JUDA 2GFHA 5ALWA 3R09A 3ZX5A 3RF6A 3WGUA 4OD0A 1Q91A 1L7MA 1LVHA 5AKIA 3QX7A 5AI8A 2Q4RA 3TLMA 1U2TA 2FPUA 1N9KA 2G06A 2R8ZA 3J7TA 3L8HA 4HGPA 3QUQA 5AVSA 3QUCA 1L7PA 2OM6A 1Z4QA 2O9JA 3FPSA 4UW9A 1L6RA 3QU9A 4UAVA 1Z4IA 2CFSA 1XPJA 2WF7A 4JDPA 3R9KA 2HHLA 3NUQA 4AS2A 5AW2A 4UU0A 4L6AA 2FPRA 1ZOLA 2IOFK 3OCZA 4J2TA 2HCFA 3OCYA 5AIBA 2YN4A 2AH5A 4J03A 4MUMA 4NFLA 2IYEA 2GMWA 3L0BA 2ZXEA 5AVWA 3NASA 5AM5A 3P96A 2C8KA 1XP5A 2BDUA 3R4CA 1CQZA 5A3QA 4FYPA 1YMQA 4DW8A 3NIWA 1ZD3A 2WFAA 3SHQA 2WF6A 1YDFA 4HGRA 2I54A 3WKCA 1RKVA 4YIHA 1S2OA 4YGYA 4E88A 3W5DA 2NO5A 2QLTA 3ZU6A 2WF8A 1RMYA 2CFTA 5ALUA 3WK6A 4KYTA 1QH9A 5ALOA 1TJ5A 2G0AA 3UMGA 2W43A 4OCZA 3B9RA 4O8CA 3UMCA 5AM3A 2VKQA 2R8XA 3KDPA 1SU4A 4GIBA 3E8MA 3PGLA 4B6JA 5AKEA 2ZBEA 5A3SA 5AM4A 5AVZA 1L8LA 3ZVMA 2G09A 3L8FA 4BX0A 4C4SA 5AI0A 4YCMA 1WVIA 4BX3A 5IT4A 1SWVA 3A1DA 5ALJA 3KBBA 3CNHA 1Z4MA 2C88A 3ZUPA 1Z4JA 2B82A 3M9LA 4IFTA 3FVVA 1WPGA 4YIKA 4BEVA 2FUEA 1TA0A 1U02A 4OHFA 3UM9A 3L8EA 4DFDA 3OPXA 4L6CA 1U7OA 4UM5A 4BEWA 1Z5UA 3A1CA 3U26A 1RLTA 2W4MA 3L8GA 3KZXA 1NF2A 2AMYA 1O03A 2X4DA 3NRJA 4IG4A 4F71A 3AR3A 3L5KA 3QXGA 5ALPA 5ALZA 5AESA 2W11A 1RRCA 2I6XA 1Z5GA 4GXTA 4NAVA 1T5SA 4NV0A 4Y2VA 5ALGA 5AKJA 1L8OA 1N8NA 2YFYA 2YBDA 4I9GA 3ZWDA 3ZI4A 1YNSA 3ZVNA 1QYIA 3I28A 4EZEA 4EX6A 1SWWA 5ALLA 3B8EA 2O2XA 3ZTYA 4UMVA 2JARA 4Y2RA 5AM2A 1T5TA 2Q4TA 4XPZA 3WK7A 1Y8AA 2JAOA 2B1RA 2WM8A 3OCWA 2ODAA 5ALYA 2AGVA 2FI1A 1RC8A 2ZOSA 1EK2A 4Y2YA 3ET5A 3KD3A 3U13A 4BKMA 2R8YA 4BNDB 2B0CA 4EEKA 2I33A 2RARA 3DDHA 3QU4A 4C4RA 2FPXA 4NABA 4L57A 5AKKA 2JGAA 3ZWKA 1X42A 3OCUA 5ALEA 3WKAA 3U19A 4EELA 5AK5A 2MU1A 5AVQA 3WK5A 1WZCA 2I34A 3UMBA 1QQ6A 2HX1A 2IA5A 3QLEA 4UM7A 2RB5A 2YMMA 2WF5A 2YMQA 2C9MA 5ALQA 2YMLA 4NWIA 5AKHA 1FEZA 4C4TA 3PCTA 3WK4A 4QQFA 4CNQA 3AR4A 4YCLA 5ALRA 4Y2JA 3U7GA 2HSZA 5ALHA 3FGOA 5AKLA 3W5BA 3A3YA 5AW0A 2NO4A 5AI9A 1YS9A 1ZJJA 1Z88A 3GYGA 4RESA 3WGVA 3RFUA 4ZEXA 5ALTA 1YJ5A 3FZQA 4G63A 3D6JA 5AI6A 4BNDA 4Y2SA 1XVIA 5AVVA 2ZG6A 4UMDA 2PKEA 4HGQA 3QYPA 2ZBGA 3NALA 3M1YA 1RDFA 3SF0A 5ALSA 4I9FA 3SKYA 1TE2A 4KNWA 1KYTA 3K1ZA 3E84A 4UASA 3EF0A 4UAUA 5AK3A 5AM1A 1TJ3A 1Z4OA 5AW5A 2OBBA 1WR8A 2HO4A 3QU5A 2B8EA 1T9ZA 4UMFA 3U7EB 4F72A 1AQ6A 5T41A 3WK9A 3L1VA 2P11A 1QQ7A 3N5KA 5AW6A 1Z4KA 3FM9A 5AIAA 2I7DA 3IB6A 5IT0A 1EK1A 4YCNA 4XE5A 5AW9A 2B30A 2B1QA 3SMVA 1Z4LA 4HAIA 3IJ5A 4CE6A 4BYGA 5AVUA 3AR5A 4KNVA 1RKQA 2G1AA 2DQSA 3AR9A 5ALDA 3W5AA 2FDRA 2ZBFA 3FPBA 3ZW7A 5AVXA 1NNLA 1RLMA 3EWIA 4DCCA 1VFPA 2Q5EA 4KX5A 2EAUA 4HGNA 4XOUA 5AICA 3MC1A 1LTQA 1RKUA 1F5SA 2NYVA 3AR6A 2FPSA 3EF1A 1Q92A 2OA0A 3WKEA 2QYHA 2YJ5A 2PQ0A 5AK4A 2B8JA 4CF5A 4KN8A 2FUCA 2HOQA 4Y2XA 4Y2TA 3CZ4A 3AR8A 3L7YA 5FP0A 5ALFA 2JAWA 3BA6A 3L1UA 3DV9A 3ED5A 3ESRA 1VJ5A 4BX2A 3E58A 1K1EA 2C8LA 4ZEWA 2PR7A 5AVYA 4EENA 5AKYA 3OCVA 3ZTWA 4G9BA 3ZVLA 2G08A 4RETA 1CR6A 4FE3A 2OYCA 2GHQA 5AW1A 1ZS9A 4EX7A 3MN1A 3PGVA 3IRUA 3WK8A 2HDOA 2MSNA 4Y3UA 4AS3A 4UMEA 2ZBDA 3B9BA 1RQNA 5AK6A 1L7NA 2G07A 5AKGA 5AM0A 5AW3A 2WF9A 4CF3A 1ZD2P 4Y2QA 3DAOA 2HF2A 4MWOA 2CFRA 1RQLA 3L0CA 3HLTA 5ALVA 4YH1A 5A3RA 2P69A 4QJBA 3ZX4A 4PNHA 5ALIA 5AW8A 4HYTA 3KOOA 1Z4NA 4BBJA 2YY6A 3QUBA 2I55A 5ALXA 5JJBA 3QGMA 2JAUA 2FPWA 5AKXA 5AI4A 2R8EA 2G80A 2C4NA 2WHEA 2GO7A 4H1WA 5AVTA 1Z4PX 2YJ6A 3U7FB 3F9RA 4XQ0A 3N28A 2P9JA 3S6JA 3MMZA 5ALNA 3ONNA 4UU1A 4UARA 3A1EA 2AUTA 3NANA 4HGOA 2EATA 3ESQA 5AHXA 2MU2A 2EARA 3ET4A 3MPOA 3SLRA 3QU7A 5AI5A 1NRWA 5AKZA 3DNPA 4Y2UA 4JB3A 3VAYA 4UATA 3L0YA 3QUTA 5AVRA 1MH9A 4FFDA 4CF4A 3W5CA 3N07A 3KC2A 2HI0A 3U7HB 1J97A 3OTQA 3I6BA 3BWVA 2GHTA 1IWOA 5IS2A 1RPZA 1ZD4A 3QU2A 5E0OA 1L7OA 2YJ3A 3I76A 2YMPA 3AR2A 3I1YA 3WKBA 2BDEA 1S8OA 1VJRA 1ZD5A 2CN1A 1U2SA 5ALMA 2HF7A 3QNMA 1RMQA 1J8DA 2FEAA 2P27A 1QQ5A
chains in the Genus database with same CATH superfamily
1MO4A 5CT8A 3Q3EA 4JQCA 2CXXA 3AOGA 3GZ4A 4MQMA 2WM9B 3HU5A 3COYA 2XCSB 1SEVA 1V3TA 3FVWA 3PZBA 1XHFA 5DK6A 4KXFB 1XMPA 1KMQA 1ULZA 4JB0A 1VG1A 4TN5A 3IT3A 1DIBA 5C1OA 4OJYA 3GUZA 3OFVA 5FBVB 4WCFB 2VNSA 1H6DA 2ZXEA 2RAPA 1Y9DA 4MYHA 3PNVA 1MQSA 2GH1A 2V0NA 1BCSB 1PK1A 3R0IA 1N62A 3SHQA 4MS4A 4WOBA 3NNDA 1ETHA 4IO0A 3H5AA 3CE9A 2QTCA 2DKXA 1AMUA 2LDBA 1H0KA 1V26A 1ZJWA 4EK9A 1FYEA 3FOAA 3BL6A 5FJJA 3PX4A 4PX5A 3OWOA 1OKKA 3Q5EA 4RJIA 5TQ2A 3EVCA 3RTBA 2XI9A 1ZJ4A 1QX4A 1R8SA 4WKOA 1LLQA 4MICA 1K6JA 1VKOA 3A6ZA 3ZVMA 4NAUA 3TTWA 3L7LA 4TPKA 1FP4A 3A31A 4LVOA 3CNHA 2UZ0A 1YKSA 4GVLA 1CVRA 4PFSA 2H07A 5E4YA 3LX6A 1WSBA 1XHLA 1O54A 2IXGA 3U26A 3M8KA 2H1WA 1X3LA 1N5XA 1W25A 1H38A 4MA0A 4QZGA 1M7GA 4MVJE 4HMQA 4OHMA 5L4SA 4ZMSA 2PGLA 2BISA 4PZ0A 4E2XA 1XDUA 4CEIA 2X5OA 1B7GO 1XVLA 2K7FA 2OXCA 2DUYA 3QBTA 3GVHA 5CA1A 3ETCA 3A4NA 4TWZA 3TRJA 3MR5A 1EVYA 1ODJA 2P7HA 3ICEA 1NGSA 4DCMA 5LMCA 2JAQA 2KX7A 4N0MA 4GBGA 3U56A 2ECKA 3K32A 2VXYA 2C82A 3KOZA 1F60A 1A1VA 5E7QA 4YRNA 2PUAA 4D6YA 1NMYA 2PLNA 3PHJA 2JI7A 2FMKA 2IS6A 4QZAA 5F2NA 1P0QA 4CHGA 4KIUA 2PXCA 2OB2A 4V03A 4HMOA 3O3MB 8MHTA 1XZBA 2NO4A 2QTAA 1N9GB 5J2TA 3RIGA 3GLFB 4HDKB 1HBJA 4B09A 4H77A 5LM3A 2DPYA 2B99A 2QORA 1UKEA 3K72B 1TM2A 4P3YA 4IM7A 4WN3A 3OETA 1A2QA 2ZB8A 1Z45A 4NSNA 1KQGA 2FZKA 4KLIA 3N76A 3IB6A 4XCQA 2HLNA 4F86A 1N3YA 2OEHA 3SFTA 1RJDA 4QOJA 4YS6A 3AR5A 1RM0A 5CLHA 1Z8DA 5H4HA 4OATA 3E15A 4IIXA 3C3PA 3LKDA 3THYA 1U3FA 2FPSA 3V6LA 4B3CA 2YYSA 2KFZA 3H4VA 4ZOBA 3PSIA 1WTCA 4Y2XA 3HABA 1NI4A 4JVOA 2W2OA 3W1WA 1OZAA 3ZVKA 3MWEB 4DIDA 1LNZA 1P2BA 3ZWMA 4EI2A 4CKBB 1N7GA 2P9QA 1FYXA 1FMCA 3VR5H 5HDBB 4NZOA 3JY6A 2AX4A 1PX2A 5KQPA 2YXLA 2H5IA 1Z1VA 4RXTA 3FLEA 1GGJA 2P75A 2WT4A 5CT6A 4KU4A 1CPYA 3FFBA 1RLJA 2VYVD 1D1PA 5KFJA 2GCEA 1QIGA 1CCWA 5KYKA 1G66A 4XUSA 4KK4A 2YOFA 3LHDA 3OGUA 1E1CB 4X8HA 3FYUC 3FCSB 1TT7A 4QC2A 5C8YA 1WXIA 5E9QA 1DPGA 1HE1C 1G4UR 3RASA 4G8DA 1KAOA 2C9YA 3L0YA 2IV7A 3GZFA 4WEOA 4LE0A 1MFPA 1P33A 4LKRA 2BEKA 2IHNA 2ATLA 1JWAB 3HLKA 4JI7B 1NL3A 2OC4A 2ODPA 3N6VA 4W9NA 1TA9A 3ZY6A 1AGNA 1JEQB 1JPNA 1CUBA 5DDIP 1SIUA 3TZBA 5H5JA 1GLGA 1TO6A 3N5CA 4J4TA 2FMUA 1Z7GA 4NCAA 4PYRA 3G6YA 2JA2A 3OCXA 1J7JA 1RMTA 1QKKA 3R2JA 3DBRA 4JIMA 1PW7A 4KQHA 2PTGA 4U8GA 1FDVA 3GRAA 4ZVSA 3LUCA 4S0XA 1VP3A 3ICWA 4QDZA 4XRRA 1L5VA 4DEZA 2DPMA 2QRVB 3I01A 5EJ4A 4CLEA 4ZYXA 2PVCA 1K88A 2Q6LA 3QI7A 2W2KB 4EO9A 5IMSA 5DEIA 4V0KA 5A0TA 2P67A 5ETJA 3HBLA 2H7XA 3V4OA 4PIPA 2EJWA 3C14C 3NM6B 3C1ZA 3QWHA 2WFAA 5DXAA 2G8NA 3FTDA 1AS3A 3JZAA 3W5DA 1GQYA 1JRPA 3GIDA 4F4FA 4I3FA 1T9DA 4ME6A 4ZICA 3NX4A 2VK1A 4RD6A 3DZHA 3T7DA 2YS6A 3OU7A 4XFKA 4M2LA 4R4JA 2BHLA 4OM8A 5CCDA 3FOFC 3FNQA 5EZ6B 4B9NA 4YJGA 1EFRD 1JA0A 1Z4MA 1ZIXA 4JODA 1CUDA 1VJ1A 3CVJA 3QPWA 4MEBA 3R7FA 5G53C 1TF2A 4HAXA 3A1CA 4YUZA 2F2TA 3NHZA 4ZTBA 4KR0A 2RHWA 1WBJB 4DA9A 2BAGA 4N54A 4B9LA 4Z54A 2Y1GA 1H8HD 3RD5A 2R5FA 4H4EA 1P44A 5IDQA 2EFGA 4PGAA 4RORA 4BWYA 1Y8AA 1U2GA 2Y0EA 3MGIA 1TYCA 2C4KA 4QZBA 1G2PA 4C4RA 3IEMA 2ATXA 4NK4A 4Z4EA 1G8HA 4C4AA 2MU1A 4F9TA 4XDZA 1N1DA 2UXDB 1KVSA 3OU6A 4HEJA 1BGVA 1MB0A 1POXA 4DJAA 3WJ2A 2H8GA 2GM3A 4BVEA 5GJVC 4D9BA 1EWYA 1R8YA 3F96A 3NTUA 3VV3A 4RSMA 3ITDA 3F6CA 4TQ9A 2FMPA 2SCUA 3KU4A 1TK0A 4P0QB 3C0KA 3WV5A 3C8MA 3C97A 5DISB 2ZT7A 4F2GA 4UAZA 1ZJ5A 2BM8A 1KI4A 3FSEA 1T9ZA 3VU8A 4GI5A 1ZQRA 4CV1A 4J9MA 4IVNA 5F3WB 3SHWA 4ZZ3A 4XVHA 2ORVA 3VTKA 3WP1B 4ARZA 1Q6ZA 4MQBA 4X41A 3BB1A 2ON6A 4KNVA 1U7ZA 2DPHA 2DUUA 4LTNA 3RABA 3GA5A 1TA4A 1J22A 4Z6FA 1FBNA 2H17A 2LR0A 3CLSD 3PSHA 1YI8A 1DAOA 4DSOA 4O0IA 2IODA 3VR3A 1OX4B 3CCCA 4OXYA 5EOZA 2CLDX 1UPFA 3RWMB 4QECA 3Q85A 3IO5A 3NAGA 4FE3A 3P2IA 5BYAA 5JRDS 2GN2A 4EPXA 2XX3A 5FLXA 1J09A 1IMOA 5D51S 3C2MA 3CO0S 4LZPA 1WOYA 3HJNA 5HWSA 2JLUA 2KK0A 3GRCA 3RUEA 1U3WA 4C5BA 4ZYLA 4XD7D 1IHUA 2CB9A 1REQB 1D9FA 3NT4A 3ZZ1A 4UREA 3V46A 3VNBA 3PC7A 1UZAA 4UFOA 2MT9A 4K2AA 1N25A 4UBIA 3LZCA 4QEDA 1GXSB 1HE3A 4F3YA 4Q4DA 3SZ2A 5I7OA 3A4LA 3H9BA 5CNIA 3MUFA 3OJUA 1GPDG 2ZSJA 4TS9A 1GQ2A 2PFPA 4CIAA 2V9CA 1XF1A 2ZAMA 1NRWA 4XUDA 3QUTA 2QTHA 3NHBA 3R20A 2HJVA 3V7KA 3V7YA 3PX6A 1XQWA 1TCVA 2QXUA 2QSZA 4X20B 4NMHA 3IJRA 5E8RA 1PJRA 5K4AA 1J39A 4YP0A 1DI0A 1RLOA 5DTJA 5DTMA 3WLSA 4DLLA 2H2GA 4KPUB 2ZDQA 3D3NA 3LF1A 4N3CA 4Z9AA 4FHZA 2XEXA 3RIMA 2VTBA 5BQPA 1N9KA 1JIQA 4WEQA 3DLAA 1L7PA 3K30A 5TQ0A 4F3KA 4M0DA 1SBQA 1WF3A 1O6GA 3KQYA 1DWPA 1KVUA 3QMPA 721PA 3CEAA 4R2WA 4UUPA 1IIRA 2BFDA 3PKIA 3K9LA 1CDEA 1ABFA 2R8HA 4ZA2A 1G6Q1 5FCDA 3F6RA 4NJEA 4IEIA 3ITEA 2HTFA 3FJOA 4QYMA 2HQBA 2BBTA 2BMJA 5DYTA 5BVGA 3RB0A 4NX2A 2O3UA 4OSPA 2ZB2A 2AJTA 2ZZMA 4NYJQ 4EH1A 4MWEA 4X6UA 3PDJA 2CCGA 2PXAA 5CDYA 2ZPTX 3PWTA 4ZT5A 3F97A 2IUSA 4R01A 1DKLA 3GUCA 3VDNB 2ZIWB 1H1LB 2POQX 2Y8EA 2ZTDA 1DAKA 3K0FA 3TUZC 3LI2A 1KI3A 1RQXA 3HRDD 2QBYB 2BFWA 4RBNA 2BCGY 1BKYA 3JQFA 1G4AE 3ECSA 1VPVA 3SXPA 2YUTA 4YLGA 4C7VA 3DDOA 1A9ZA 2DHEA 5KCMA 4OLBA 3GCWA 2MUTA 2VWQA 2CEKA 2C4TA 2QL7A 1Z5NA 4R64A 2XCLA 1E6LA 4QXMA 3HSYA 1NG9A 2PLRA 9ICXA 2Y1CA 4O33A 4AKSA 5BMOA 3I2HA 1W19A 3PD1A 5CB4F 5B4TA 5KG5A 3S1AA 3AFMA 3PKJA 3HR4A 1TIPA 1H1TA 3X1DA 5CYGA 1C9JA 3QG1A 1JLKA 1MJNA 2B7BA 3KYDA 1JU9A 2W00A 3A2NA 4TSKA 4A5OA 3V80A 4BO8A 4QD3A 3F7NA 3TI9A 1H5NA 1N33B 4HTFB 1LSSA 4B6QA 3M9XA 1TQ8A 5AHWA 4IGFA 3RK4A 4Q8EA 3K0HA 2ZVJA 4C7JA 2YHIB 5LUBA 3RRZA 4E5NA 3FKSD 1P61B 3Q15C 3OHSX 4PZAA 5K8UA 2AE2A 5M04A 4RCVA 2HJRA 5CB6A 1I4WA 2ZWAA 3AWDA 3O8OA 1ZO8A 5CM9C 4KVAA 2WPDD 5T7BA 4JU8A 1QR2A 4MKXA 5FOSA 2Q6KA 3A9VA 2C2ZA 2X3UA 1PNQA 121PA 4QUHA 1U7UA 4NG4A 5BW6B 4LBZA 1K5GA 1JVBA 1BYIA 1SCBA 2A8YA 5BXQC 2X8JB 2LCQA 4YR3A 3EISA 1QO0A 1EX7A 3REFA 3TSYA 3EGDA 1Y5RA 5JNVA 1IDN1 3F4LA 2VDQB 3SOZA 5F33A 4LYDA 3SXJA 4FBGA 3GDGA 5KJCA 4IDQA 4CN8A 2VJNA 3ZZUA 3RHTA 4AUNA 1M8GA 5FA5A 4GI2A 5EHQA 3A6EA 3MYRA 3PMNA 3T52A 3UKOA 1TYZA 3UANA 1N2CB 2OOKA 5E3JA 3AJ9A 1TF5A 4YX9A 3SS8A 4IIVA 2RGCA 2CJWA 2B21A 3O03A 1V38A 3ONWA 2ZTHA 1ZXIA 1M2VA 4BNHA 1FMLA 4ZOEA 1DC8A 3BEDA 1P9WA 4FFRA 4B4KA 2I76A 3M89A 2ONJA 3LY9A 4NLKA 3CLSC 3KSMA 3D43A 1ZP6A 1UDRA 3BXFA 4WLVA 2R66A 3R3HA 4TL7A 3G7NA 3MTQA 3HKCA 4EWLA 3UGQA 4JXXA 2CK3A 3O92A 4UCQA 3GJYA 3HM9A 1RI5A 4ZT7A 3KTFA 3AL2A 3QBJA 2GAFA 4AICA 2DCUA 8ICTA 2OC9A 4NYJR 4JKOA 2O9JA 1EQUA 4N6GA 4PZYA 4JD5A 2JLAA 4X3CA 2W2XA 3LHKA 6ADHA 4IUBS 3MWDB 2DZDA 1X9HA 8ICLA 4HGRA 3MGHA 2ZVDA 4K86A 4DIFA 3GCDA 1EHCA 1SEPA 4PSKA 2OHVA 4YAFA 5HIIA 5C51B 1CEXA 3WDKA 1ID1A 4B3FX 3UWSA 3WQBA 1KU0A 2G09A 2NAPA 5HUHA 5DNCA 3G9UA 4DPMA 5F4BA 1H66A 1JEOA 1G3IA 1DXYA 4OL0A 2RIRA 1I4EB 4R8VA 2HOIA 3HGMA 2Z2JA 3BG5A 5CWRA 5CYOA 4JKIA 2X4DA 3PGKA 3RVNA 1KSFX 3OEHD 5K45A 3GIMA 2QXYA 2BFEA 4EYQA 4DQXA 4QJIA 1O5IA 3M6LA 1QUFA 2QE6A 2O2ZA 4RZ3A 2HA4A 2C98A 1YB2A 2EF1A 5CFQA 1Z13A 2VPXA 1U7TA 2EGGA 4QUIA 1XD9A 3GEPA 3DQPA 5B6JA 4BNKA 5AWFC 3GN2A 1NMSA 4O5EA 2EOAA 2ZIUA 1HX7A 4LYJA 4ZU3A 2OCYC 2FEWB 2Y3IA 5EZYA 4ARUA 1Y34E 1Q77A 5ILQA 2HRZA 4H60A 4NH0A 4QL3A 2HF8A 1Z5WA 4O1MA 4Y2JA 1DQPA 3RH4A 2ZI9A 3P94A 9ABPA 4KPEC 4GYKA 3FH0A 1NNEA 3C1TA 1S77D 2H3ZA 4BVAA 3UXHA 3LWBA 1XK7A 4EZBA 3SF0A 3L3FX 2FPKA 1AQUA 3CPEA 4DLWA 2QG9A 3COVA 4EBDA 1WR8A 2EZUA 3ZD8A 2ZJAA 1YZ7A 3VHQA 1QYCA 2J6TA 1DUVG 5LFAA 1J0EA 5FRDA 2X5KO 3CNNA 4CMAA 5BR7A 4MNTA 5KNDD 2I4OA 2ZJBA 3BK1A 1X8JA 1DX4A 4FDUA 4MJLA 3FDZB 3T3EA 1ZVQA 3S70A 2WA1A 4TVKA 2RAFA 3COSA 4YMTA 3G2NA 1B8PA 2DERA 4R9UC 3KLBA 3EDYA 1G8JA 5A2GA 3VYTB 1UT5A 2JGFA 2A9RA 3Q8WA 2R9VA 3ZGXA 5KNBA 1YUNA 4B8WA 3Q9NA 3K0BA 4JOQA 2OYCA 5E38A 3PGVA 4TRRA 3IRUA 1LC0A 2NZXA 3VPCA 1ESZA 1BO6A 1N8KA 1GKKA 4K26A 5AKGA 2ZJ6A 4JIGA 3R5JA 5CFMA 3PQFA 4ACOA 1LX7A 3HLTA 3O26A 4LRUA 4LY3A 3RUCA 1KFBB 1D5CA 4CTKA 2OFOA 3JATB 3PRHA 2C2RA 3DFUA 4JVNA 4RD0A 4WV3A 4PY2A 2JEJA 1C4XA 2F90A 1NG1A 4OQPA 1MB3A 1K3FA 2P0EA 4FFSA 1I7QB 3U40A 3BTVA 3CIFA 3GGPA 4ECUA 5KT2A 3J7AC 3C4QA 1T8PA 2CMDA 1EFAA 2QD3A 4M98A 4MUYA 1E9VA 1TMOA 4N4AA 5LYYA 1XZCA 4B6SA 4EHHA 1LV8A 1T1RA 3OHAA 5MGNA 1RJ9A 5I01A 4IRCA 8ICFA 4DC9A 2RBGA 2PK3A 3PT5A 4IJMA 2LNDA 4G1MB 3D3WA 4XWTA 3E4DA 3FFTA 5ELLA 1C8BA 4KWIA 4LZDA 4QFBA 1BG6A 1PW5A 3RI3A 1YDWA 1VPDA 4JR0A 2IXBA 1WOMA 3K8OE 3JALB 2VSXA 4PIVA 2G06A 4QVIA 2QW8A 5DYGA 2W42A 5AVSA 3T4UA 4LXUA 3ZY3A 4EB3A 3I9KA 2FR0A 5BN4A 4GKAA 1Z37A 2R8OA 7ICOA 4YMLA 1QZ3A 3BZWA 3RSZA 1YI0A 3BCRA 3GEBA 1K2WA 3PW0A 4KSBA 5B2EA 5JXIA 3DXXA 3SR3A 2M0NA 1ZW6A 4GSLA 2EKLA 3BJZA 1XQ6A 4MIYA 4WMLA 4Q12A 1HDIA 3NP7A 2X2FA 2OV6A 3HJUA 2OBXA 3C5GA 4H6VA 1SBTA 3EAQA 1ENPA 2GTIA 5BPHA 4LC1A 1F7VA 3E0FA 3ONFA 4YIKA 3X2SA 1OWNA 2Y0CA 4WGGA 5HKKA 4G8CA 4W63A 1ADCA 1N63A 3RNLA 4KN5A 5TJHA 5D6OA 2I3AA 4L85A 2BVNA 4UM5A 1N6PA 4A9AA 1NW5A 4DJJA 2O8DA 3VU0A 1KFJB 1KVTA 1D1QA 4C8OA 3PWKA 2JJ1A 5AKJA 4L51A 3F5QA 2XUZA 4MLDA 3HVHA 1AKTA 2NV6A 5JHGB 3LUAA 5AM2A 2BF7A 5A7HA 4BQIA 5ICGA 2OOSA 4YPOA 3NRWA 2YR0A 4E07A 4KZPA 1EGAA 1PLJA 2I87A 4E32A 3D0QA 3AHJA 2V7XA 4JI1B 1ORRA 5ALEA 1CZLA 2QZZA 3ZWVA 2A67A 2QVCA 2I7XA 2HX1A 4JUBA 2X0JA 1TK2A 4IMIB 2IC5A 3C70A 2QUHA 1DE0A 3V7NA 4LG1A 3VSBA 4BFLA 4V24A 5ADVA 4JLSA 5EIEA 5JATA 2QQEA 2FFRA 3GZNB 5KFMA 4IYJA 2XTJA 2XWPA 4V0RA 2GDZA 1JXOA 3LXXA 2CB0A 3EF0A 1JALA 5A7FA 4Z9YA 1Z4OA 3PSTA 2PNFA 2X7XA 2Q3BA 2RGNC 1UWKA 2IPMA 4R2HA 2ZIVB 1PL8A 1QHHA 1U80A 1GAJA 5KYNA 4Z3OA 5DGBA 2YV4A 3CEHA 3CLTD 2GK3A 1B42A 1V16A 4Z0TA 4DR5B 1JXEA 3MFIA 1P72A 2ZETA 4E11A 1XZLA 1TTQB 2BFAA 1J23A 3IVMA 4RQMA 5E6UB 4EBEA 1XA0A 2HMSA 3ECAA 1E5DA 3H4MA 1PWYE 4JI6B 1EQ2A 3G1TA 4RHYA 1UBRS 3ISDA 4P33A 4DLTA 2WAMA 3T5AA 2GD2A 3OA2A 1JSZA 1GRQA 4OH7A 1QIIA 2P69A 4FO6A 3BS5A 3KPVA 3C43A 3P19A 3Q7SA 3QEMA 1X19A 3SVLA 4EF6A 4NARA 2XDQB 4W9RA 3I4FA 5IBQA 3QX8A 3S81A 4UQLA 1L8AA 4PG7A 1LRLA 3JQPA 1B3RA 5JNLA 2Y66A 3O7WA 4QQ8A 4FHFA 1CKEA 3QKTA 3JQGA 5IFLA 4LV6A 2I5PO 2WFLA 2PMBA 1FOEB 4W1SA 2FMIA 3P4UA 4D8YA 2Y1DA 3GUUA 1X0VA 1GZ5A 4NXMB 2BFCA 2HF7A 1CZOA 3GT0A 4BCCA 4CCHA 3KUXA 2IDZA 5DSXA 3HC7A 4FMCF 2AT1A 3T1VA 3UY4A 1J06A 1EJ0A 4OFZA 5EIBD 3NYQA 2XUQA 3E8XA 2W8ZA 4FMPA 1QQBA 1B41A 5KFYA 3VNSA 1CDZA 1CC1S 4X5OA 1E2EA 1NP6A 5JH7F 4UEWA 1GA1A 3UXMA 1JWBB 4LXXA 3TQIA 5ECWA 5JZVA 5C52B 3GZTB 2WZDA 3G8AA 1JDVA 4AW9A 1VYHA 2E4WA 1JLLB 2VRBA 1CB7A 1G0NA 1KFSA 3HG7A 2WW8A 1MN6A 4CCWA 1KDRA 2GARA 4FLEA 1R8QA 3SYNA 4D4LA 1ISHA 1FCJA 3O90A 2W43A 1H4TA 4QU5A 4IP0A 1OWLA 1ZVMA 1RBQA 4QOHA 2FZLA 2R8XA 3E8MA 1QP0A 2J5QA 4AUEA 3VU3A 4D97A 2VL7A 4P1ZA 5FNVF 4QM6A 4C4SA 1PSWA 4M1YA 5EWFA 1PVVA 2JDID 1IN4A 2JAHA 4DAEA 3CVVA 1SCUA 1LVGA 1NPTO 5A4KA 1SR8A 3PC3A 5G0WA 4OHFA 4PRZA 5BRJA 2HZ7A 2QTRA 1ZOSA 5FOWA 4LZZA 5KIAA 1BH2A 1M76A 4H35A 1AD2A 1G8GA 2DM6A 3K6SB 1T94A 3CTPA 3G8CA 1N5DA 4ZOQI 1E1NA 3BMNA 2PD4A 2R11A 4I2AA 2XA1A 4PCVA 1DRKA 1YQGA 1A3CA 2W6JD 1VMIA 2ODAA 1AUQA 4UDOA 3BMOA 4UVGA 1JFFA 4D9KA 3DBHB 2P2ZA 2UVQA 3K5PA 3N8IA 4L2IB 3BZCA 3KALA 2PBRA 1T5LA 2X1HA 3LC2O 2P6NA 4BTVA 3T9FA 1J70A 3E9ZA 3BCHA 3LUJA 4DG5A 2LYBA 3GPCA 2IVFA 4I9HA 3I3SR 4XRGA 1SBYA 3AHEA 4KUGA 2FAXA 4E14A 2C7BA 1UBCA 3EUAA 3KL4A 4BDTA 1VKHA 1E7SA 3SS9X 1CY4A 4RQUA 2OLKA 2WJYA 3NALA 4KWTA 4A73A 3REOA 3U1VA 2OAQ1 1Q11A 4HB3A 1DBIA 2FOIA 4MW1A 4HG2A 3TRDA 3KZCA 1N5WA 3EGWA 3VR6A 2CXQA 1L9KA 4P36A 3SLGA 3UKJA 1ZCAA 3FUWA 2JS7A 2WVAA 3HUTA 5JAPA 3QFFA 2C3YA 3FJYA 5TR9A 4EUEA 2VH2A 5FTWA 2Q5EA 4GXKA 2IA6A 3G2KA 4BOYA 2EU8A 4FT2A 6GPBA 4C6RA 1HDYA 4NOKA 1T36B 4RM2A 1QH1A 4R1OA 1FNMA 2KZMA 2GAJA 4LWOA 4PG4A 1C7FA 3ND5A 2DE0X 4DRZA 3CPHA 2PFGA 3EXHB 5JRJA 2QQFA 4BS9A 4D74A 5FAXA 4C7BA 3SEIA 4NXZA 1GTJ1 2HMYB 2JGJA 3QJ5A 5K0LA 1F12A 2DVMA 5LVAA 2G72A 2Y9MB 4C7ZA 3FPFA 2P4UA 2WAXA 1E4EB 1NK6A 4UOQA 1LBEA 4BQQA 4X0EA 3IP6A 4UAGA 7REQB 8AT1A 2XA2A 4I55A 4F5DA 7GPBA 3EPLA 1S2LA 4HDRB 4L15A 4MDYA 3GHHA 3UW1A 1FP7A 3N2EA 1ZQSA 3WL4A 4TYNA 4UEJA 3TRFA 1ZICA 3N74A 2YDXA 2B6HA 1JSCA 1N4DA 2J3KA 3NIFB 2VAPA 3T9CA 4LA4A 1IWOA 2IIBA 3CLTC 5CD9A 1EFDN 4NMXB 1ZRHA 1PUZA 3ITNA 2FLPA 2X22A 1VDMA 2ST1A 1JMKC 3IP3A 4QUEA 3AR7A 4AZ0A 1EGHA 1XRRA 3SD7A 2IRWA 3QSGA 3V55A 3KLNA 3LGAA 1NXSA 1WZ2A 4L8FA 5LDGA 5ALKA 3TQSA 5JQGA 3VU9A 2HTEA 2X8AA 1CY7A 4IQ0A 1V4VA 1KQPA 2C2HA 4LJXA 2I66A 3D8TA 5KTYA 3WU2U 9ICAA 1D2RA 2O1XA 1WRBA 2RGRA 1V39A 3O2SB 5J2CA 1T24A 4YDSA 2Q4OA 3V2HA 1BNCA 3PG5A 4CIXA 2DTXA 2ARKA 5E79U 2WTEA 1QRAA 1K1QA 4BNUA 1VA4A 4RZQA 4B40A 3DLIA 3A10A 5BV2P 2WTBA 1YU6A 3NVWA 1V2GA 1A6SA 4DKXA 2GK6A 3H3XA 2JVJA 3U4IA 4EJ0A 2BYTA 5L53A 3NIBA 4TMZA 2XCPA 4DBLC 5JJLA 3A70A 4URYR 3S29A 3DVAA 3H04A 4PQGA 3F6YA 3OEED 2RP5A 3RAGA 2PT7A 1YR3A 3E7XA 3ZBPA 4G07A 4UAWA 2FSSA 5LL6P 2BGWA 4YDQA 1JEYB 3P0RA 1RHMA 5JYDA 3UWDA 2CDBA 4YR7A 3MJVA 1FRQA 3EBPA 4LF8B 5BP7A 3GIKA 3EX7C 4HI0E 3MTDA 1PD0A 1JKIA 2D8MA 2GB4A 1QZZA 3K8ZA 1EIWA 3U37A 5EIBC 1M34A 4LHZA 1V85A 3NS7A 3S2SA 3KXIA 1AUVA 4Q9DA 1DTSA 2Q7XA 3N39C 2IT1A 4KLQA 1J4AA 3Q7EA 4BB6A 2ZKIA 4JI8B 1OI7A 1E2BA 4BQRA 2IEZA 2REQB 5K0CA 1TJNA 1KE1A 1ODTC 2JLCA 4EI8A 3P20A 3FNEA 3DT6A 5DP2A 3NC1C 1GN9A 4QEKA 3D2BA 4FOLA 9ICGA 3DUFB 2D74A 1Q44A 1KOLA 2C0CA 4D4IA 1NQTA 3JPNA 4K9MA 3ISCA 3MELA 2Q0QA 3EMKA 5EWMA 2JD1A 4HWRA 1JJIA 3W2IA 1U94A 1X66A 4V2IA 4L8GA 4QQFA 3SM3A 2PX5A 3IA7A 5IINA 2ORIA 2XVYA 4D3FA 3LUPA 3IOYA 2MSLA 4ZEXA 2FWBA 2YZKA 4JJZA 1KMCA 1QM5A 1C1HA 4B7ZA 1W5BA 2QW0X 4I9FA 3MBYA 4G1EB 3NXSA 2WIBA 2N47A 1CWUA 3L4PA 1Y6JA 2FYTA 1KSHA 3FNBA 1FU8A 4K8OA 4MWBA 1XZJA 3VR2A 2YN0A 4MQFA 2B1QA 1TU0A 4L50A 5F7XA 4ILKA 4CE6A 4YAGA 8ICOA 1WDTA 5CCXA 4ZHSA 2JJ2A 4BX9A 4ZVTA 5T8KA 5E1DA 3KHTA 3T7AA 1FDRA 1ZQ9A 4KWEA 1VGRA 1G17A 3PF8A 2E1RA 3FPHA 1U0NA 3TLAA 1Z18A 5I8PA 1TVCA 3ADBA 2OQIA 2FPPB 2DPXA 3VPDA 4AXXA 4MK4A 4AS3A 1UJMA 1SQ5A 5KNDH 4DCVA 5FUWA 2TSYB 3HFSA 2R7LA 4TYYA 3ZDDA 3HDVA 1QGED 3WA6A 2C8JA 5HFAA 4CQLA 3VJKA 1K4YA 1L4EA 1RWQA 4C1NA 4H17A 5JSYA 5JZ9A 4D02A 1G38A 1YUBA 4V38A 4BE7B 2MRLA 1FJHA 1ULSA 3MCTA 1RQPA 3TDNA 3ZIUA 4JB3A 1GG8A 4WHMA 2HK8A 4C2TA 1M34E 1RPZA 4XCXA 4LFBB 5ERXA 2YJ3A 1HE8B 1VM6A 2FNAA 3OVMA 5CFNA 4FB4A 4RTNA 2B37A 3QFRA 4YMNA 1MBZA 3G9TA 1DKMA 3Q8SB 4R8MA 5JXHA 2H16A 3JQDA 2AHRA 2G1PA 2IYQA 4RS3A 3GROA 4RGYA 2JBHA 1WBDA 1VGQA 4R2LA 1AGPA 4XVRA 5DZSA 2CMHA 2FSVA 1B6TA 2IDJA 3RIEA 1ZM7A 4AJ4A 4N41A 2R84A 3ZX5A 1V11B 5U4QA 5KG0A 4CFSA 5LYJA 1VYVA 3X1XA 2DL0A 4X3OA 1D7OA 1SRRA 4RLSA 3QUCA 3MTBA 3OZVA 3F2DA 2Q9UA 4M87A 3OG9A 1UIRA 2WF7A 5H3CA 4X1KA 4JLKA 3Q8PB 4UE6A 2HCFA 3W7BA 3DZCA 3BFXA 3O8QB 3OT1B 3GLRA 4B5LA 1NJFA 4XR4A 1JAYA 3IQZA 4LXGA 1N7JA 1V5IA 3WAKA 2IYVA 3SJ7A 2CFTA 4YMOA 2BEWB 3ESXA 2DT8A 2AJCA 3PDHA 5AP9A 3C2KA 1E3WB 1P1CA 3MDAA 2HFJA 4OCZA 2ODEA 2EANA 5GZ1A 5KYYA 4A8HA 1RIIA 1QGUA 1T8RA 4XJSA 3BEOA 1EWKA 2PVSA 4CMEA 3FLAA 2HIAA 2K60A 3EZNA 3G17A 1YDHA 4P4SB 3VNQA 3RW9A 2LM4A 3LTNC 1XZGA 1Y81A 1OYWA 3L7KA 3QXSA 2LW7A 3NOOA 4KTTE 3PB3A 4WNAA 1GG5A 2VRCD 1Y6GA 4L6CA 4KLTA 4D9GA 2HO5A 4O3NA 3AG6A 3TL6A 2J46A 4MUHA 1XSNA 1IRIA 5I4CA 3D6FA 1N34B 1ZMBA 1SPXA 3ZWYA 1XEFA 4OHBA 2I1QA 3G2IA 4EJSB 4JR2A 1CS0B 3GHYA 2HWYA 4FFPA 2EJTA 4OKSA 3TM4A 4MV0A 2C1XA 1MX5A 3I2JA 4HC4A 4RKQA 1G3MA 4WUTA 2FE9A 4D8XA 4COOA 1TZJA 4NMLA 1EHIA 1ZU4A 5ALYA 2GZSA 2EWWA 5L1JA 4BKMA 3S2GA 5BOLA 3KNZA 4MLCA 1Z34A 4C0JA 1A1SA 3WKAA 5C8XA 5CM8B 3RAJA 4P35A 1FNBA 3KWJA 1U8TA 2Y77A 4HSEA 4FWIB 3TR0A 2Z83A 1N1MA 4MV4A 2IPOA 4AY4A 2M98A 3E48A 3ED1A 4CGZA 2XYPA 1OQAA 4XCVA 2AN5A 1LDYA 3UHFA 4ZI7B 3OOWA 4CR7A 3LNCA 4X1OA 2DH5A 1TK5A 1FO4A 3F5AA 2ZK7A 1O9BA 2Q6TA 2ZTSA 3EDOA 4ICIA 1DMSA 1QOQB 1PTJC 2AVNA 2BPGA 4WWHA 1C20A 3V2GA 4KLSA 1KWGA 2XW6A 1RKQA 3TL3A 1U99A 5L45A 4OAOA 1TM3E 4GGOA 3TZ6A 2Z95A 3MTEA 4O3RA 3IYLW 1Z08A 1ENYA 1GA4A 4LOKA 1IEXA 3JPSA 3BGVA 4EB8A 3TEFA 2C3MA 2ZSKA 3KKNA 4KMRA 4RXMA 4IOJA 4WK4B 4JYBA 3AF6A 5KX5B 1ZQUA 3MILA 4LJ5A 2D2XA 5LJIA 4UBLA 2VHUA 4Z9BA 3QEOA 2C3OA 1K89A 3JPWA 4UB4A 2FZEA 4O4LA 4LY6A 5A5VA 4FSHA 3AUSA 5JTTA 3CEJA 3L04A 4ZCSA 6ABPA 4L8VA 4J76A 1GNTA 4PHAA 3CMMA 4U7CA 2NUPB 2RHJA 3Q3CA 2AI2A 3N97B 4AZWA 5GGYA 4TXJA 4A26A 4BVKA 3IBSA 4MS1A 5BQ5A 2BLNA 1LSUA 5A6VA 2WSSA 3ZJ5A 5LZ8A 2N0SA 2F77X 1F2TA 4FZRA 4Z6KA 5B12A 1JT9A 4E09A 1JJAA 2ORYA 3K5WA 4RCZA 1T1JA 1TIKA 2M6SA 1W6RA 3P9KA 3I76A 1E62A 1S0VA 4OMUA 2LV8A 3G2LA 3AQ4A 1IONA 4H7PA 1SY7A 2PMKA 1M0TA 2PV0A 2Q9AA 4C3UA 2CVFA 5U1PA 2XMBA 4G5FA 2PZLA 4GI3A 3OJEA 3QQ5A 2FWMX 1N77A 2VNJA 4DMMA 2FPUA 1D8LA 1RVDA 3D2NA 4HP8A 2X2OA 5HOEA 5J47A 2BGLA 1W4AA 3O4RA 3TG2A 4FLMA 4WT7A 2QRJA 1YQ9A 3HUUA 4XZ3A 4MUFA 1RIFA 1PZNA 2CFOA 1PKXA 4HNVA 3QJGA 1R4AA 3ZXIA 5B4VA 5A3QA 1AHNA 4QFDA 1E32A 5G41A 1OWPA 5H4GA 4AZ3A 2OB1A 1FRVA 2OORA 1UXIA 1Z3EB 4LF5B 1F6BA 4KREA 4YO7A 1QH9A 3JVIA 1OYVA 4CLDA 1X6IA 4KFRA 2ZQZA 2RDJA 5EXTA 4BKPA 3IVXA 2V8OA 4HUJA 2ILVA 4MVCA 3TO5A 5H16A 5G3ZA 1VMEA 3BPSA 4UHCA 4ZVNA 2G04A 3AU6A 4OQLA 2JIPA 2JANA 3HCPA 2VXCA 3FBGA 1MEJA 3KTAB 1UADA 2GO1A 3RS4A 4S24A 1QMPA 4RQ3A 1RLTA 1I3MA 1EFPA 1UCVA 2VHWA 3RFTA 3KFLA 3QW2A 1GZHB 4YV2A 2B4YA 4MCAA 2NQ8A 5L40A 1Z00A 2BRUC 4Q19A 2ISQA 1T5TA 1P91A 2IEYA 3FDXA 1Q0UA 4R1LA 1KQOA 4F3RA 4D92A 2GXSA 1B74A 2W2PA 3W3AA 3GT7A 1B73A 5KEIA 2VPZA 4EEKA 4LX0A 2ACKA 3VR1A 4DJFC 2V4UA 3RB6A 1EK0A 3PUIA 4S1OA 1SQGA 1KQNA 2P78A 3T5CA 2R65A 4RNNA 5FUXA 4PTYA 3PJDA 2J9FB 2RB5A 4MR9A 1P9OA 1EYZA 4JUZA 4TROA 1P2DA 4J90A 3BOSA 3SAHA 4C5AA 1SHKA 2PX0A 4GD3Q 2A9OA 2VT6A 1PR1A 4E2WA 2ZI6A 3H1FA 3HE3A 4GUAA 3ALRA 5FKJA 3UN1A 4O4IB 3RFUA 4DFMA 1Q1BA 1QQAA 1IQUA 1PT5A 3UPUA 3HU3A 2IH2A 2J3HA 3H16A 2QLMA 3M1AA 2XHZA 2PLFA 3FMIA 2M6LA 3M4ZA 4UMFA 1CUIA 2ZJZA 3WK9A 3N5KA 5E9JA 3UAVA 5GP1A 1ZCJA 2BI7A 1JLSA 1PVOA 2IHYA 2K8BB 4HAIA 3W2EA 2GEVA 2ZTEA 3MLBA 3R0VA 2NG1A 5KQSA 4CU5A 2IZZA 2NYVA 2PKWA 1CU1A 3HMKA 4Y2GA 4JX8A 4UBNA 1LKYB 5TX7A 2PAFA 2I29A 4R84A 4DQVA 3FMVA 2KPOA 4Q7MB 3BTOA 2XY4A 3L1UA 4GPEA 4G4IA 5GONA 1P73A 1WHSA 1TU4A 2HF9A 4O3OA 1Q0LA 3KLOA 3KZOA 2CMFA 1ADGA 3M49A 4OF4A 3UT5B 1O57A 2I4TA 4NNOA 3EAFA 3MMNA 4Y2QA 3OURA 2IY8A 4KYIB 3NGMA 3H0LB 1PV1A 1XV5A 1O95A 5ALVA 4L4SA 5A3RA 1HMYA 2EERA 4NBVA 1C1DB 3HWRA 1XQ1A 1KRWA 4MJXA 3ESBA 3V32A 4EBBA 2K2QB 1TYAE 4Z4CA 3ELYA 4Y6LA 4G41A 1YQQA 1EE2A 3SC2B 3I9V6 3Q3VA 1YS7A 5BN5B 1LC3A 1LS6A 3D8UA 2VYNA 4XIFA 2X15A 4TL9A 4MUAA 5KTTA 1THTA 3KDAA 2HHTA 2PKYX 3RS7A 4JLOA 1B4FA 1ZQDA 4I19A 5FULA 4CEJB 2XDWA 1UPUA 2I2AA 4IDOA 3EN0A 1ZQCA 4IXNA 2FHPA 3R3VA 1G7RA 5ENVA 4W5HA 4EPVA 3EZ2A 1EX9A 2Z2IA 4FFWA 3PX7A 4BNXA 3UAOA 4J0DA 4RE6A 3RQIA 1XCOA 2H51A 2VO1A 4D9NA 4WSOA 1DRVA 2O8EB 5A71A 3JQBA 3MS4A 5BUZA 2AGQA 1ZY2A 2HADA 1L3CA 2C78A 5COAA 5DVZA 4FGLA 2PZJA 2H4WA 2Z04A 3LC1O 8ABPA 4KLAA 4LOIA 1H05A 4KDCA 1ZSYA 4N6NA 4OQYA 4ASUA 2XKAA 3OZWA 4IUCS 1IQRA 1E8MA 4BN4A 1WL8A 3AINA 5JSUA 4D44A 1TAHA 4QZEA 3O84A 2QT0A 1M6VB 4YUWA 3PWZA 3P96A 3G82C 1BXRA 2FZCA 1YMQA 1CE8A 3GELA 3ZU6A 4N5DA 3ROPA 2Z1NA 5KTPA 3T3MB 3MAGA 5FWXB 3BORA 4M37A 1WJGA 3BMCA 4GOLD 2AMFA 1NQOA 5MN6A 4OUDB 2VKQA 3T1OA 4YCAA 4UU7A 2J3QA 1HZZA 4QDKA 5DCWA 1LB2B 3M7DA 1Y5IA 4FVTA 3U3ZA 1VDZA 3R77A 3CCBA 1HFJA 5FPPA 4EGAA 2R1VB 2H4XA 3WGIA 2A1UB 4YG2A 3AFNA 4UTVA 3GGSA 3SYRA 3E3MA 1YJAA 3B1JA 4WY5A 2R6HA 1BSVA 2OZVA 5CVTA 4MB2A 1VRVA 3FMGA 3B0YA 3WK7A 2EBUA 2QG6A 1IY2A 4JJKA 3PWSA 4Y2YA 1TKDA 1VL2A 3DUWA 5JBIA 3KIPA 2JRLA 1I2BA 1MRZA 2FPXA 3W2FA 1JI3A 2NVOA 4R81A 1Q95A 4IVRA 5EUQB 5DJ5A 1SKWA 3I53A 3W06A 5BWBA 2ZYGA 1AKMA 5DLGA 5CBKA 3PA8A 3KKQA 3AVVA 1JQJC 5JNRA 4R8UA 2IP4A 4G9GA 4EIWA 1UDWA 1OGYA 5J59A 1LDEA 1E5XA 1QNFA 5H70A 1U98A 3PKZA 1NRJB 5IYZA 1QGOA 2JLRA 4ZVVA 3LCUA 3ASVA 2WIFA 3VBCA 4GZ6A 4JVLA 1PJ8A 3CB2A 1GSAA 2J5RA 2NM0A 2PL9A 4IILA 3GUHA 1IPFA 1Y9EA 4YGXB 3VDQA 3RTDA 4ZAVA 2ZI5A 4DT1B 2NLOA 4PLZA 3W34A 2GD6A 3BRSA 2GJKA 4NMWA 2H1IA 3GGCA 4LJSA 3RTGA 4LE1A 4NLCA 3LIPA 3WLKX 4JN6B 3UNXA 2O6KA 3AUUA 3EA5A 3ED5A 4KBGA 1EGVB 2Z5FA 5A4MS 3NTVA 1PK3A 1ZUHA 1QIEA 3ZHUA 1SCJA 3W6ZA 4FKBA 4ZHQB 3OA0A 1KQFA 3CJRA 1FUIA 4LWZA 2WF9A 1NV8A 2GVZC 4FI3C 4PAWA 1IYZA 3NHUA 5JT1A 4ZIRA 3IUNA 4BAZA 2RONA 3K6JA 1A88A 2FLWA 3GLUA 5FPTA 2XRMA 4IDEA 3WWEA 3BRWA 2UZ1B 3NPMA 2OBLA 2G67A 3FWZA 4F4HA 2QUBA 3LW7A 5JTIA 3WDMA 3MINA 3VAAA 1DHRA 4JFAA 1AKEA 4I2NA 5DBFA 4U7PB 1N60A 2GK4A 2P35A 2XNKA 3IPRA 5IUJC 4K9KA 1E2KA 3FCYA 1EXVA 2J9RA 3DW3X 4UNSA 3EVZA 3SS7X 1YZLA 3H1BA 1BEZA 3NIDB 4RWEA 2OZLA 1U5AA 3ZGOA 3AVOA 4NVRA 1A9QA 2NUTA 1CFZA 3OQJA 1CSEE 2W2TA 5K01A 5EP1A 5DTEA 2PZEA 1SKBA 4WH0A 5REQB 1I30A 1EZ4A 1C3JA 2MMGA 5GWXA 1EWQA 2BHNA 4CN9A 3BWDD 3C45A 4BX8A 1ISIA 3DDWA 2D2VA 1AKYA 1R16A 4G65A 2V7QA 2DC1A 2OHIA 3DEJA 1CY8A 1GFSA 1PWXA 1NFRA 3WIOA 2RDMA 4OAQA 3K0CC 4LX8A 1UOEA 2OBNA 1LI5A 2HIMA 2WDZA 1TMGE 4I6EA 4GP7A 5IH3A 3I4CA 4TKLA 4LYFA 3HJAA 4C4PA 1XP5A 4CMKA 2XE7A 1L6NA 1T0PA 1KMHA 4MR8A 5B36A 2IIPA 4DS3A 4BDPA 1OLSB 1OROA 7ICGA 3KB1A 3C5WP 5AQ1A 1YZQA 4ES6A 5F1YA 3AP2A 4PLWA 5EP4A 1UP7A 2KP7A 3LT5A 4MPRA 3RFFA 1OBOA 3H8MA 5EZSA 4YRIA 1YBHA 1YCFA 4IKOA 4JR1A 4BP8A 1WVIA 4MDFA 1KJWA 5J2UA 3MEQA 5LOVA 5A0LA 1PS9A 1D5WA 3JWEA 1IG3A 2ODQA 4GWLA 4Z1MA 4DJDC 2IW3A 5BOMA 4GMKA 2Z09A 1Q83A 4C7MA 3G0BA 1Z7YA 3T7SA 5JOQA 4MR7A 1G2OA 2CLOB 3VZDA 4IS2A 1DL5A 3ZI4A 4GLJA 5C1IA 3RNOA 5AUQA 3MCUA 1JMSA 3HXTA 5G1PA 1NAIA 2PMCA 1DWOA 3TG8A 2A3VA 5DTIA 2AWOA 2IZOA 3EC1A 1FDIA 2BQ3A 5MDHA 2FWIA 3QE9Y 3LQ4A 3W04A 5FTNA 1MC8A 3BL5A 3PX2A 2GPSA 2C4HA 2BCUA 3M9WA 5AHOA 3D4PA 1JQBA 7ICQA 2XMPA 4EBCA 1P1KA 3IMCA 2RG1A 4TV8F 1C0KA 1H1DA 4QPPA 4FBMA 2BC9A 4QPZA 3ABQB 2D8CA 3OUZA 2I4RA 3A3YA 4OHXA 1Y9AA 4KOAA 4ZD6A 1NYQA 5AJXA 1W29A 3INYA 3RWBA 4MCHA 2H29A 4INJA 5LLSA 3C6ZA 3PLNA 1H2BA 3PEUA 4A0QA 4IY1A 2XYGA 4HYKA 7MHTA 2C0PA 1O94D 3A4VA 4LDAA 4Y1RB 9ICIA 4C0XA 5FTLA 4QNRA 3ABIA 3ITKA 2B94A 3OPYI 5L4LA 4MRVA 3ZW8A 3P1JA 4FZNA 4DSZA 2QVYX 3I8OA 2HIGA 1QTRA 1RKUA 5JPDA 1HT1E 4CLRB 1NOJA 2NU9A 3FTPA 5C9ZA 2G82A 1VXOA 2W8LA 2CDRA 3FOBA 4PNEA 3AVTA 4I29A 1XX6A 3L0IB 3NHFA 4JOBA 4I8DA 5DLDA 1SIBE 3AEUA 3L7DA 4NQRA 3DFMA 3GGJA 2X9VA 3VC2A 2VUTA 4ZAWA 3OJLA 2VQFB 5SYNA 3FHJA 4A6PA 2I6GA 4CQMD 5K3EA 5GZ6A 3AVYA 4RYLA 4RTLA 5EERA 2D7JA 1R0BA 1ZVVA 3EFOB 3M70A 3W7VA 1E3QA 3AU9A 2Z5VA 1C4OA 1NVAA 2P41A 2LZ0A 1CUHA 2W6PA 5AVTA 2K4EA 4YASA 2AGOA 4FDTA 2PPVA 2AC2A 4FEAA 4WJ3B 1O2DA 1YRLA 3PFKA 4GEGA 4UJ5A 2Q4BA 3FW1A 2F3QA 3H5LA 2PXHA 2VXBA 1F17A 3IBGA 4DLYA 2C83A 3ZDZB 3H65A 1LSJA 4ZALA 1WPQA 1IOLA 2A2ZA 1VCMA 3BFVA 3FYUB 2IPLA 1A72A 1X7ZA 3GRUA 2J6CA 4HZUA 1XCJA 5E6SA 5KFEA 4O2AF 3R7NA 3EGCA 1NBAA 3FMOB 3OP1A 3BGSA 3VYRB 4C21A 2YN2A 1WKCA 9ICWA 1SKYE 3R3JA 3P9NA 2JCXA 3GMTA 1QP4A 3WKDA 3E81A 3RJ9A 1L7VC 2ZXHA 2ATEA 2IHTA 3QLVC 4OQFA 1E9RA 4KLMA 4OYRA 1LNQA 1TJ4A 3R09A 1RYBA 3VMMA 4DQPA 4LF6B 2WTAA 1N2EA 5B37A 5K8JB 5K0FA 4PO9A 1WVGA 2OMEA 4DCNA 1L9XA 4LNUB 3R9KA 2TS1A 3NUQA 4ENVA 4UU0A 3EGVA 3TW6A 5LA6B 2OD9A 5ED0A 4E2ZA 4V0SA 2IY9A 2B36A 3I0ZA 3NIWA 1U48A 5IJZA 3S3TA 3QVKA 3T4XA 4YGYA 2BKUA 4A0RA 1FDWA 1WBBA 1E20A 2IEGA 1BOOA 2H2IA 4CFZA 4DTIA 1ZBQA 2ADFA 2I5HA 3U9LA 3RSHA 4EECA 2ODGA 1ICIA 4JZYA 2JH7A 1OAOC 2DFKB 5A6SB 5IJ9B 2XOKD 2X0NA 1T2CA 3KKAC 3HX0A 3ABZA 1GARA 5EA2A 1P1JA 2CXOA 3JSAA 2IH5A 4QQNA 3FIJA 1B16A 4IV8A 1CY2A 2NO6A 4ED2A 1PKEA 4H0NA 4D45A 3CY6A 3HY3A 1XMVA 3O8DA 3BQ1A 3E18A 1VL5A 3NRJA 3L18A 3MBIA 4EEZA 1AZLA 3CRNA 3CN7A 3PGA1 1O9GA 2E8MA 2W11A 5KVAA 4F6RB 1L8OA 3OEWA 4ZCQA 4J2HA 2PQ2A 2IGBA 1EDOA 3L05A 1C9DB 3A3NA 4X61A 4HPJB 5BSRA 3U44A 1BA2A 3ZBTA 4DA8A 1ZXLA 2O6LA 4E51A 5EE0A 4HQOA 5A9SB 1CIJA 3GWGA 4U7WA 4PR3A 3DT8A 2CLLB 3ONEA 1XO1A 4M6WA 2BM9A 1MABA 4U1RA 4EELA 3KUCA 5HILA 1IE3A 4N7RA 2G63A 3GY0A 1QVWA 2WIAA 3HVIA 1TEZA 3OP4A 3WE7A 3IEPA 4UHHA 1T34A 1G7SA 5F5NA 3RS3A 1P9LA 4RO0A 4ND8A 1QHXA 2J07A 3AB3A 4Q3KA 4YFYA 2F1OA 2QU8A 4WAUA 1LK0A 2WYHA 3IDFA 1W96A 3QNUA 1KYTA 4GRDA 3PXEA 1CTQA 3QZ8A 3GD7A 3T79A 5TQJA 3ICOA 5HRCA 2Y2UA 4G84A 3MR3A 4OHOA 3N87A 1KP9A 4QUDA 2GFIA 3FLMA 3A6FA 5BMVB 1NW7A 3EG5A 1VI5A 1X1QA 4NZZA 1TB4A 3ZU3A 2X4LA 4NYMQ 2YX8A 4AG6A 3BD8A 2C7VA 1TMKA 1AKWA 5F21A 4YCXA 4BNWA 4RY9A 3K1AA 1RCFA 3M83A 2OMKA 4ECRA 3LY7A 3OLWA 3AY7A 2C2GA 1Z6TA 5TPZA 5KTMA 1IOWA 5IDVA 2HSDA 3LHFA 3JCZA 2JD2A 4HADA 1LBTA 1Y5MA 5JCOC 4P3PA 1K1EA 4ZEWA 1RWVA 3PNKA 1RPNA 1WX1A 3DT9A 1SUIA 1LXCA 5EE9A 2RGYA 2DMRA 3TVTA 2HBLA 2EG9A 2IYYA 2XZDA 4YJ2B 1JG7A 1MAAA 1JFRA 1AS2A 1NJXA 3C85A 4DL5A 1V2HE 2Y1FA 4CEHB 4NBNA 3WLPA 4DLNA 4YT2A 4Z9XA 3KT8A 2G80A 4ZPXA 2GTHA 3IDZA 5CLJA 5EMNA 1SL0A 2PLAA 1CULC 4E1AA 1SVWA 4OSOA 1Z3IX 4XJTA 1R8XA 1HNNA 3H8VA 4ZREA 3HW8A 5HKOA 4UNIA 1A8IA 1LBHA 1O94C 3M9MB 4P3KA 4CV0A 2EAPA 1GVNB 4LJRA 2Z1DA 3S68A 5CBPB 4RVOA 5DHRA 3SIRA 3CRZA 1N78A 2GD1O 3Q2OA 4M83A 5IM5A 1GL7A 4TTAA 2R25B 3A8TA 3EEFA 1TLLA 5LQRA 1NUPA 3SYLA 3I8SA 3AG5A 2I4MA 4GOND 1NTRA 4DIBA 3UHJA 1A9SA 1CUGA 3AU2A 1MQ2A 2W71A 4IL5A 1SO8A 1FP1D 3VYSB 1NVTA 4AMGA 2J31A 4RQ0A 3LLUA 1YQTA 3L6CA 4DYDA 3H83A 5HR5A 5JFGA 5JR3A 3ZK9A 2ZAOA 3U80A 4KN6A 3UOWA 3P4XA 3IVRA 4LOLA 4V3CA 1DIRA 2OPHA 1M6YA 4XWWA 4XM1A 1C9YA 5JE8A 3KOXA 1P9RA 2X40A 2O5RA 3ZOZA 13PKA 1TZBA 3KHGA 1T10A 4BL5A 1CUWA 1UMDA 3AB7A 4QXAA 3AERA 5LIPA 3T5HA 1YVEI 3WRYA 5FR1A 4UUNA 2XSZD 3S44A 4OXXA 3B9RA 2ZJ1A 1CQJB 5JCJA 3EOBI 3AF5A 3GP8A 4MWGA 4PZOA 1TYBE 3VTFA 4F96A 2IYOA 1H23A 1DBSA 7ICNA 3FAHA 4ZZIA 1STOA 3PNMA 4BLSA 1ZGBA 4KGVA 3JZFA 3QLJA 5FT9A 4DOCA 3J80A 3LL7A 1KEWA 3NKLA 4JJ6A 2A35A 1FU4A 5CA0B 3FI9A 4ZO7A 5TMEA 2W4MA 1VHTA 1XALA 1Y8QA 3VDRA 5HTOA 3QY9A 3HP4A 3QBDA 4F0JA 3I9JA 3AL3A 2ZJYA 2ZW9A 2WVGA 4I9GA 1Y3FE 3OZDA 4PSCA 9ICTA 4FZJA 1YZHA 2HXSA 1TEXA 4KLDA 1RHUA 2ZR0A 5ER6A 2ZR8A 3M1LA 2PFSA 5KWSA 4MA5A 1KU6A 4X5VA 1OLUA 4PYLA 3QITA 2W22A 5EJGA 4YQEA 1L7DA 2GX6A 2QD2A 1FY2A 3EVAA 1NJ1A 2UUAB 4TQSA 1XCPA 1XTQA 4YRCA 4NYMR 4DM4A 4GFDA 4Q15A 4OJMX 2HW8A 4RNMA 4BCDA 3NWBA 3P45A 3ZHYA 3TVDA 3SJAA 4PO1A 3D8RA 3W5BA 4S1PA 3F3YA 3INTA 1PGOA 4PX9A 4O2BF 8ICVA 4U5XA 2BH9A 2H2HA 5IVIA 3V3KA 1F8GA 5HDQA 2PBLA 1RG6A 2H2WA 3IUMA 2CHUA 4NIMA 5TGDA 1LTKA 4F8YA 3I3OA 3LYUA 1A4IA 5IT0A 1XEWX 1S9HA 3HSKA 2XGJA 1BEUB 3B3JA 3ZWAA 2LYAA 2IVZA 3DL2A 2P68A 1XWFA 1X7WB 2EAUA 5DPMA 4HTAA 3EQ2A 5DF1A 2JF0A 2N75A 4L22A 1TM4E 5EI5A 4B80A 4I2HA 2ECQA 5FP0A 4UQOA 1WXQA 2NX2A 2H31A 4Q3OA 3BL8A 3BF8A 2WQZA 2E8OA 2NU6B 2PEYA 5KOYA 4BQEA 2AFHB 4L7VA 2A86A 1K6MA 4QUJA 1DADA 5JDIC 4KH1A 3B3GA 2UYQA 3C48A 4N5IX 1NJSA 1FPMA 4IBOA 3MGVA 1P4RA 3ONVA 4BMPB 1UF9A 2HLDA 1W59A 4XPIB 1F2DA 4KE8A 2WU1A 4QA9A 1I1QB 1MV8A 4HUQB 3K0AB 4LHWA 2A84A 2PSEA 3MPOA 4LJYA 1OHHA 2PGJA 1DARA 3QBEA 4BO6A 1JNYA 2VCHA 2YZNA 5J9FA 2Q9BA 5GZ3A 3V9PA 1C5KA 5H9WA 3O1IC 2PLWA 4ROSA 1DEKA 3O47A 4G0PA 3TAQA 3H8SA 5ICSA 5E6RB 3ZJ4A 4A10A 1QF9A 3N70A 1HYEA 1CQXA 5DG9A 5E4JA 4UB6U 4D0SA 1DEXA 4EUFA 3SEAA 3RIHA 5C35A 1E61A 1PIWA 3V8EA 1KY2A 5FR2A 5D00A 3WMRA 3DAYA 3UAXA 4EZ9A 2JVIA 4WVLA 3JRXA 3UFXA 4AP9A 5HRUA 4J4BA 3GDOA 3FYDA 4N01A 2BF4A 3WYFA 1OKKD 1A4XA 5J2JA 3VH4A 4KE6A 3GOHA 1AQNA 2P9ZA 4J0QA 5IIJA 4ZK2A 2Q2OA 1XOIA 1L5SA 1X1BA 4MEAA 3AVWA 2HCRA 1S2MA 5HJEA 1PG5A 1IM8A 4B9EA 4NM1A 2R00A 3TRHA 4FLFA 4TTSA 1PT7A 3I6YA 4P7FA 2ASEA 3C5FA 3D64A 2J08A 4W5WA 1YD7A 4G85A 1Z0DA 2XXBA 2O05A 3G02A 2B92A 2VP9A 2G36A 3NB0A 3PGLA 1U90A 4P4OA 1YE3A 1YRYE 4QLBA 2JFOA 3HHPA 2H7VA 3VOAA 4GX1A 1ZSVA 2TRSB 4IFTA 3OPQA 1F1BA 2W9BA 4DWIA 1TUBA 2KN7A 1KYXA 1P8AA 3BB4A 1ABEA 2FGKA 4JS0A 4RVHA 4KQJA 4TS4A 1P4GA 5KO2A 2VG8A 4WGFA 4L75A 2ZUTA 2C2BA 1ZKMA 5JPCA 1K5PA 4DC1A 3EODA 4NJMB 2NYRA 4DIMA 3GVCA 4EZEA 2XICA 4Q01A 2ZDHA 3UJAA 1L5LA 1F3LA 3MDCA 2NV2B 1NK4A 2PJUA 2GBFA 2PMFA 4P92A 5JHHB 5HNKA 1IV8A 3DE7X 3U13A 2HLPA 3HRHA 1LPNA 1MIOB 3UTCA 5G4KA 1VKJA 2VPQA 2GNOA 1N92A 3C3DA 2Q2WA 3IV7A 1DJQA 1FYDA 4LIPD 4LSZA 2ZT6A 3P9YA 1LTHR 1TUEA 1ZUNA 1ZNXA 3QVVA 3WS7A 3VSCA 3H6GA 1ZNYA 5HUJA 2EVWX 1AB5A 5HHTA 4BB5A 4IDPA 4OREX 3GYGA 5JQWA 4HXEB 5DHFA 4IXMA 1NURA 4PNPA 3EZGA 3EZ6A 1XVIA 3PX3A 3Q0TA 1SVKA 2ETVA 3OZRA 5EESA 5AUOB 4G1CA 4JJ7A 3OIVA 2VA9A 4R98A 1P80A 3OZEA 4EQ6B 2XGPA 4O4HF 1X40A 5KYWA 1IUKA 5JS2A 4URHA 2AKAB 1EVQA 1NJ2A 2X42A 4C7KA 1VJDA 3D1LA 5HIJA 5C32A 3F8WA 3GLGA 4LHYA 1N2HA 2UAGA 5FO1A 4L5JA 1CHDA 3G0OA 2BV3A 4PNZA 1BTOA 3EXFB 3OFJA 3AMVA 1EIZA 2C5BA 4M8LA 4KV9A 6CHYA 4R5MA 2PR7A 3QVUA 1ECGA 3NVYA 5K0SA 1T2UA 4IYRA 1E2FA 3DJYA 4NMMA 3LWLA 5K3BA 3ZE0B 2F43B 1GLVA 5ENDA 1CJSA 3ESAA 1KTQA 1L7NA 4B9MA 4G0NA 4C9BA 1W88B 3QLUC 3GCXA 1ZZEA 1ULUA 2O2SA 1AUXA 5SZJA 3TIFA 1BWQA 4OQQA 2BFNA 4PYKA 4YP5A 1GAQA 1PZXA 4LYEA 4MQLA 3EDMA 1XROA 4FU0A 3BHNA 3VZCA 2R48A 1A5BB 3DBOB 3FB1A 1ODCA 4LY0A 3K9NA 1V1MA 1CZHA 1UBGA 1O9HA 4F5EA 5JMTA 4FQ7A 4CIDA 4P93A 1E8NA 1BN6A 2AHOA 4PV7A 1DDIA 4RLFA 4FYVA 4M9RA 2BGKA 4JL6A 4FUTA 2BEVA 3D5QA 1OBFO 3QOYA 3ZIAD 1R8JA 4AP6A 1YIAA 1R4MB 2VNHA 3M5DA 4C0QC 2QT9A 5A5FA 3H87A 4I2VA 4QW8A 5F78A 1G8YA 1RKBA 3MHPA 2XB9A 3X1WA 5CFRA 3IRVA 4Y2PA 4FYMA 4PCUA 3PJEA 4F11A 2GBLC 4MGHA 3T7JA 5DIZA 1ZRMA 221PA 4ADSG 1AB6A 5KWIA 2F3UA 4HV4A 2GCNA 3HCDA 3U3OA 2OCEA 4MWSA 1VBMA 4CDGA 4KFSA 3JAWB 4J8PA 3A7EA 3L4BC 4BVLA 3E1KA 4UW9A 1PRYA 2IJGX 2GYWA 2HSGA 4HFJA 3YASA 3I04M 5KKCA 2IXFA 4IIBA 3VPHA 1D09A 5LXTF 4Q1VA 3I1IA 1U0RA 3LP5A 1X1SA 4XDGA 1H94A 1UXJA 3K0EA 2Q5LA 1YL6A 2PGOA 4U00A 4HDMB 4WZBE 4GXQA 4ZI3A 5B1EA 1ZETA 1P7CA 4AY2A 3D54D 2WYVA 2GN0A 4YFVA 5A2QA 1ZUWA 1LPBB 3IFSA 5L3SA 3NOVA 2Y1IA 3GLGE 3NDPA 2Y0SC 4ZRDA 3BBPA 2DWPA 2R6GA 4N48A 1NE2A 3HR8A 1WP9A 1BDMA 4E33A 1VSVA 4LGCA 4V1CI 4C8LA 1UHUA 1PQPA 2DKOA 2OCGA 3EUB2 3P9QA 1O03A 2RCYA 4OYYA 2EKZA 3B20A 2O8BA 2IU4A 2XTAA 3H17A 4HDOB 2CNBA 2O8VA 3PC2A 3D8SA 3WWPA 3DBLA 4UKDA 2QD1A 1PUIA 4E0BA 5K8IA 3I5YA 5KOIA 4NCNA 3I5MA 3EH2A 3QOWA 4KWCA 1QJ4A 5EHIA 1MRNA 4OHKA 5CJ7A 3TI0A 3B12A 3F73A 4GI1A 4AYBC 2KW5A 1DLIA 1XZHA 3DA8A 1WXWA 1XLTC 4EFMA 2E18A 2Y27A 1BHSA 2DF4B 4NECA 1CQWA 5JISA 2RH8A 4ED3A 3PDIA 2WYUA 3QX9A 4E21A 4EMTA 3H5NA 1KGDA 4WOJA 1U47A 2Q5IA 2WK1A 1CERA 4N47A 3LPCA 2H1OA 3KEGA 4PZEA 4JP2A 4BFUA 2WUDA 2LKYA 4LISA 1NRXA 2BFBA 5CIYA 5JSZB 4I2CA 4QIHA 2O0HA 4Q4JA 3HZOA 3TBHA 2Z8YM 5AMXA 2IKQA 2J4DA 3O4JA 2BCQA 1M8FA 5HK8A 4F5YA 4K9OA 2UXCB 1WHTB 3HFRA 4OPMA 3O91A 1H6BA 2WJ6A 3I61A 4M1EA 1KMMA 3OOSA 2J4FA 3C7CB 3A27A 4CI0B 1JWLA 3DTVA 3BIOA 4LFCB 4FJ1A 2HBKA 3RYFB 2W04A 1Q92A 2NV0A 5G0VA 2J0VA 2H57A 3EIQA 1FTYA 1J2RA 2HH9A 2A57A 5ALFA 3REQB 4PWYA 2C9OA 5AUPB 4BY9E 4GP6A 3ZXYA 4UE3S 4RDCA 1CR0A 1B6GA 2DAPA 4KK3A 2E8NA 1CR6A 3DXYA 3A4IA 3Q9UA 4JLDA 3R7BA 1DG3A 2CT8A 4EMUA 1YA6A 2D1QA 1NXPA 3IMGA 5EQJB 3GB9A 3Q7QA 4DGQA 3I6MA 5AW8A 4DL3A 4C03A 2P9FA 5A4DA 3BE6A 2A1IA 1L7AA 1MD9A 4LDZA 4FJ0A 4II7A 2VSNA 3U7FB 1TC2A 4G56A 4BWVA 2VA3A 1YKFA 4LDPA 3NANA 3MFQA 3WRVA 3NBUA 4US2R 3WGJA 3C41J 1S76D 3T5MA 1PI3A 4JI4B 3T0IA 2MINB 1KH2A 2PL5A 2WU0A 3WGGA 4KE7A 1FDUA 4G86A 1IZZA 4LTMA 4PTLA 1PVRA 2VP5A 1QU2A 4X65B 5F98A 2ZRCA 1A9RA 4QDXA 2JK0A 2E1PA 1ZK2A 3MT9A 3BTUA 4YRGA 2CEAA 3WYEA 5DMHA 2CL6X 1C9NA 2AZMA 2GK7A 3LZ6A 2PS0A 1HXHA 4RADA 2HEGA 2ZIGA 4OQNA 2XNJA 3KV3O 3L7IA 3Q9LA 3BCUA 4HXGA 1U0OC 2VR1A 3DO8A 1V95A 3A6JA 1CF9A 4PIMA 1QH8A 1Y3AA 2OXOA 3A4MA 2IS4A 2YOGA 3MJTA 3AEQA 1WWUA 2A7XA 3NR2A 4W9NC 5KQMA 5K6AA 1VP9A 3I45A 5DN9A 2C54A 2FGJA 3LYLA 5C4MA 4ATNA 4R68A 1H2YA 3ZXXA 5JXJA 3HCCA 1GFIA 5EE5B 2WJZB 1OXUA 4ZCRA 4MV7A 4KLOA 5KSZA 5LQUA 4F2WA 2YZ7A 4QWAA 2PUWA 3PP8A 2DPJA 1Z0JA 8ICZA 2FU5C 4IZIA 1EVZA 3KELA 1W1UA 2A6PA 1T4CA 4DZZA 5KYXB 1IQ0A 1OFUX 2HJHA 2WMNB 2WV9A 5JBQA 4ISBA 3CP8A 3VNRA 1BMFA 2Z0MA 3B1YA 5SICE 1E0JA 1XWIA 3TX2A 4PYQA 2PU5A 1CUYA 2O8FB 2ZUWA 1ZD8A 4OJOA 2Q3LA 3I9V1 1R4NA 1T15A 2ZRAA 3X1ZA 4NTZA 4KQ6A 4E70A 3ZU5A 2GM9A 3M9NB 1SU8A 4FSXA 2J09A 2YH2A 1T5IA 4ECWA 2JJMA 5CPBA 1H9BA 2CLIB 2CNLA 3ZH9B 5K8TA 1IXRA 3OE5A 3P9CA 5DKFA 3VSEA 3C6QA 3X1YA 1F8UA 1H3FA 5FLYA 4QZDA 1KJ9A 3IPLA 2ZYTX 1N57A 2R751 3KD3A 3CSDA 4C6TB 3TCNA 5COQA 5PGMA 3UPQA 4PPFA 1U6KA 1YKGA 1CF2O 1WDMA 1U63A 2QT1A 2WOOA 3M5WA 2FTKE 3JQAD 4HLUC 4DKJA 5LP6C 3U7IA 3CF4A 4MPJA 1SUPA 2P9CA 3WGQA 3L41A 3MR6A 4TWIA 5GJCA 5AW0A 1U2GC 3FDIA 2CSUA 3B7WA 3GT4A 4H6PA 3KPYA 1YRQA 1V9LA 4CM9A 1SZDA 3MRVA 2PH1A 4BDSA 4MF8A 1P4SA 4G67A 5TC4A 1GZVA 3G9XA 1NKBA 2IWHA 5L3QA 5FFNA 2XAUA 5B30A 4NENA 5DB8A 5B6PA 2VP0A 2G9NA 2HUPA 3PYLA 3VR4D 1L4MA 3N2KB 3BFPA 1B0PA 1TZ2A 2JFXA 4YRAA 3ETHA 2FUCA 4HYYA 3PW5A 3BREA 2I1VB 3EZXA 4GR5A 1UC8A 2C8LA 4PRLA 5JTUA 3RSOA 3U4DA 3ZWCA 3ZJYA 3ZVLA 1SOMA 4MAMA 4KLGA 3R0XA 1PK8A 2E0IA 3GFBA 4JWKA 2NU7B 4ZVUA 3ZY2A 3EHEA 3PPIA 1SOWA 3H5IA 3RUFA 1TTHA 4GO1A 5GADl 4WDRA 3ID6C 2BR4A 3QUBA 3DOEA 4BV9A 2WM3A 4KIFA 2IUFA 1YVDA 4F38A 4KAFA 1CZNA 3TN7A 2VF2A 3SPXA 1VSUA 4KQIA 4HS9A 2DQKA 1UBKS 2KZ3A 5I9LA 4NBKA 5JJCA 1BFDA 3QKRA 4BCBA 2HJSA 1HLGA 3T35A 4BPBA 3K09A 1Q1NA 2Y76A 1RRFA 2EZYA 1OBHA 4A1OA 4L4ZA 1XTRA 2AI1A 1WXDA 3NTRA 4B4DA 3M6IA 1U2DC 2PXIA 4FYYA 2HCBA 3WBBA 2VH5R 4YRMA 1Q3TA 2PYDA 3EG9B 3JYHA 4R16A 2EX1A 4ZDIA 1WXXA 4GBED 2IUYA 5ALWA 1C1XB 2LIPA 2YFKA 4DA7A 1XEWY 4BBPA 1Q0HA 2CBZA 3VPSA 4AJNA 3KAPA 3KEQA 2CLEB 1XKQA 2B1JA 1RXVA 5KSWB 4YYEA 3JYLA 1C2YA 3OE4A 2IYEA 5C34B 1A50B 4PZNA 2SKCA 4JCCA 1OH7A 2A5DA 4K3VA 2IUTA 2WYOA 4HFMA 2ERYA 4YAKA 4B2PA 4ZYWA 1SL1A 1RNLA 1K1SA 5BUSA 3ZLVA 5IK2A 2NIPA 3B89A 2OESA 3G59A 2VPTA 5JJ5A 3ZJVA 4O8ZA 4C0KA 3KZVA 3SBXA 5KL8B 7MDHA 1WXEA 3O38A 5FWYA 3HGQA 4TMWA 4BX3A 2FG5A 2OWDA 1SWVA 4N5MA 3AY3A 3SZRA 2VANA 3ZUPA 1RZRA 2ZRDA 3DV0A 3F71A 3TF5A 1H4VB 3JD0A 4HNQA 1P6XA 1E6MA 3Q88A 4LXYA 3UK1A 2HK7A 2EKBA 1YOVB 4LQ4A 1GTSA 4CMBA 1RC0A 2I7CA 5A1JA 4ER5A 3BD6A 2OBFA 4CQNA 3PL5A 1D4FA 1GPYA 2Z2XA 3KKMA 1PUXA 3ESDA 2LDXA 1ATZA 4QARA 3GJ6A 5BOSA 2WIDA 1XMJA 3WHIA 3TAXA 1ZM4A 1R10A 1P1FA 2C92A 5B1SA 7ICFA 2IS2A 4TLCA 1W0JD 3IQWA 1G7CA 2JGAA 3R44A 3W0LB 1X42A 3U19A 2C2MA 1RWWA 4AY6A 4YJ3A 2N46A 2JCBA 4ZQFA 2KZZA 1U2PA 2CYCA 3JQFC 5DHTA 4MUJA 4FNOA 4IGAA 1DFHA 4ZJYA 1UFKA 5C8ZA 1E2HA 3FPGA 2VPWA 5KNBD 3HJEA 1OXKB 5JRTA 3DBVO 4E5SA 4PYMA 4IGIA 2O1EA 4OYHA 2DQNB 1LWOA 3DM9B 1UAAA 2RD2A 4U6SA 3BQ7A 4B48A 3SMVA 3E2MA 1XA3A 3AR9A 3OQIA 1S0UA 4B82A 3T15A 2A9JA 4XOUA 4HGNA 3DYBA 3ZK7A 2XE6A 3D2AA 3CRQA 2Z43A 3AFHA 1GO2A 1Z5OA 2Y4NA 1TRHA 2QY9A 4P2GA 4B3MB 3PNSA 5C0OE 2RI1A 1ISFA 5JNSA 1UBSB 2XVTA 3FCXA 4HWOA 4LHEA 2W2LD 2AXNA 4BFYA 3FTCA 3E7WA 5E3IA 4O3SA 1W6UA 5JARA 4RZUA 2O7SA 4BASA 1EEXB 2EL7A 3RJTA 4JBHA 1ND6A 2PGIA 3WGLA 2OCPA 3ABSB 2AZDA 5TSDA 3L4JA 4NR0A 4URZR 1SXJD 4YQYA 3H11B 4GXNA 2I22A 4LDJA 2PWZA 3TEMA 1JR3A 3RFXA 4AAYA 3AI7A 3HYSA 3TQCA 4JC8A 4Q7QA 4OB6A 4RV9A 2R8EA 3WMEA 1XC7A 4PGQA 1OBVA 2Z8ZA 1KEJA 1PNRA 3H7AA 1OF1A 5AI5A 1PZGA 4W9MC 4KKVA 3OBBA 1ZNQO 1MAWA 3IAXA 4DY4A 5JSQA 2ZM5A 2WUGA 3BDPA 5CB1A 3OZXA 2O3SA 3PS9A 4XLTA 3VRHA 3TAUA 1EVKA 2J0SA 1NJYA 4B0PA 4ND2A 5G02A 3TW8B 4MHTA 1XYGA 2BJVA 4UFPA 4F5QA 2YZMA 1IEWA 2IP2A 821PA 1JDSA 3HLYA 1UDAA 4TTPA 3OM0A 2F3NA 2NRTA 1GGKA 2O20A 2KI5A 2BBWA 5AI8A 4I1RA 2HB6A 4F60A 1DC5A 2ZT8A 5DNUA 4OGGA 3SCZA 5F51A 3H5WA 4DLSA 2ZYWX 4EKEA 3TIGA 1YZUA 5HZMA 2YXEA 3SIWA 3U3RA 5CVJA 2J1LA 4I4TF 2KE5A 1UBTS 4XB2A 1DBQA 2J9XB 2C8KA 5BQOA 4N8DA 2GYYA 2R6AA 4MYDA 4J1NA 5IKMA 4P5EA 3DLHA 1QS0B 4JU9A 4UPEA 2QLTA 2VUUA 3OZIA 1E5LA 5KTNA 1PVQA 1M83A 5KWEA 1A8UA 3WLLA 3M5CA 5T64A 4LMAA 1D4ZA 4FD2A 1N6NA 1Y7TA 3AGQA 2I2FA 3ZJUA 3D2CA 2IU6A 2JKYA 3D8NA 5IT4A 2OXRA 3EUWA 1KEZA 2RKBA 1UPBA 3LX4A 1L4NA 3OJOA 3RFVA 4OMCA 3U17A 1Z6QA 5DBBA 1PGNA 4ECQA 2R2GA 2FJUA 4GC5A 4ABYA 4KQWA 1E99A 2BD0A 1VGVA 4RTSA 4F71A 2PJZA 2WAYA 3BQ9A 3D2LA 2BKLA 3A0UA 3MM4A 1JSLA 3EFEA 1V9CA 4PANA 3RVMA 4FXOA 3FPAA 3RC9A 4F3NA 1IQPA 3IP1A 2GLEA 3RR7A 4MVJM 1XJ0A 4MI3A 5J8YC 1U9IC 3MBOA 4GUDA 3JPPA 5CXXA 2XITA 1V43A 1Y5NA 2SKEA 4RMHA 4L0MA 2X19A 3EZFA 4F3CA 3TDMA 1JR3E 4PM4A 5K3CA 4K4GA 4JLWA 3E35A 4QZ8A 1TT5A 3TGPA 1PD1A 2QIPA 4DV6B 4U2KA 4NV3A 5ICEA 1GRVA 4NXNB 3KQKA 4QRDA 4CG0A 3MWKA 2F4VB 3NEJA 4C4TA 1WUYA 4H1VA 4WKGA 1ZIPA 3OESA 3THWB 4OGFA 8ICMA 1JU4A 1H0RA 4OGLA 4CETA 3MFYA 1RWPA 4L5YA 2AKEA 4G63A 4R6XA 3GFQA 2AFVA 4L78A 4PSAA 1CJUC 2GXQA 3I5UA 4FIZA 4RPCA 2PANA 3IHWA 1K86A 2VBIA 3P7MA 2P11A 1BRTA 5FIUA 1G18A 3HU1A 4CMCA 4XEUA 5BUQA 4Q4AB 5HG0A 1DFGA 1OT5A 2C0QA 1IEVA 3P8ZA 4DRXB 5J2DA 4QYXA 4A0HA 3LL4A 3W5JA 2XRFA 3P5SA 2YYYA 2D2EA 3K31A 4Y67A 3QMMA 3WQQA 2O0JA 1OPRA 1QDLB 4LW8A 3U3KA 5DO9A 2QYHA 3G6WA 4QUGA 3CQ9A 2CF5A 4G81A 3HU2A 1SCQA 1R66A 3PGJA 1DVRA 2JAPA 2UVDA 1ZL0A 4RK7A 1UT8A 3JVVA 4C80A 5FWNA 1XPUA 4RIHA 3N8NA