1LVHA

The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
220
Chain Sequence
MFKAVLFLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title Caught in the act: the structure of phosphorylated beta-phosphoglucomutase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 75
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1lvhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1lvhA01
4CF5A 1RMQA 1Z5GA 5AI9A 1Z88A 5IT0A 1LTQA 4O8CA 3KOOA 4YH1A 5AKYA 2G06A 3QLEA 2YMPA 2AMYA 4JDPA 1WVIA 1ZD5A 3W5AA 1AQ6A 2FPUA 1WPGA 1RLTA 2DQSA 3ET4A 3EPRA 2G1AA 2C4NA 5ALRA 4CF4A 3L1VA 3AR9A 3E58A 3U13A 1JUDA 2HHLA 2YJ3A 2P27A 3L8EA 2OA0A 5ALMA 5AM2A 4C4SA 3PDWA 4KNWA 1EK1A 3R9KA 1L7MA 5AW4A 5ALTA 2ZBDA 4B6JA 2CFTA 2FPSA 2IOFK 2GMWA 3ED5A 5A3SA 1QH9A 4BNDB 3KBBA 2WFAA 3BA6A 4L57A 4AP9A 3DDHA 1CR6A 5AM4A 5AKZA 2BDUA 4OD0A 3PGLA 5AKIA 4Y2SA 1YDFA 4L6CA 3OCWA 2HX1A 4NFLA 3L8FA 4BNDA 1Q91A 3WK8A 1RLMA 5ALXA 3ZTYA 1RQNA 2GHTA 3I28A 2CFSA 3A1CA 2GFHA 3QGMA 1T5SA 3SKXA 3M1YA 2FPWA 3N07A 1J97A 4UU1A 3SKYA 2G0AA 2JGAA 2AH5A 5AKLA 4YCMA 5ALQA 4NV0A 4EELA 5AM1A 2HF2A 3NANA 5IS2A 2W11A 4I9GA 4KX3A 5ALLA 4CNQA 4HGNA 3A3YA 4NWIA 4UM7A 1FEZA 2ZOSA 2ZG6A 2YMLA 3QUCA 5ALJA 1RRCA 3ZU6A 1N9KA 3WKBA 4BYGA 1Z4NA 4Y2RA 3QXGA 3HYCA 3S6JA 3FM9A 4HGOA 3SF0A 4BKMA 3FVVA 2WM8A 2B0CA 2R8YA 5E0OA 2YJ6A 1RKUA 1YS9A 3RF6A 3KC2A 2MU2A 3ZVLA 3DNPA 4L6AA 2WF8A 5AVWA 3MMZA 2BY4A 2VKQA 1XP5A 3OCYA 3QNMA 3WKCA 2OYCA 1NF2A 3QU2A 1NRWA 4Y2QA 3HLTA 5IT4A 3ZW7A 2PQ0A 2HEGA 2EATA 3NRJA 2YJ5A 3MN1A 2YY6A 2WF5A 3AR3A 5AK6A 5AK5A 2ZBEA 1U7PA 1O03A 2NYVA 3RFUA 1KYTA 4CE6A 5FP0A 1F5SA 3L0CA 5ALNA 2YMQA 3AR2A 3ESQA 1L6RA 1WR8A 3EWIA 2I54A 4E88A 1PW5A 2C8KA 3MPOA 3WK5A 2FEAA 2FI1A 5AW6A 4Y2XA 5AVUA 1S2OA 5ALDA 3WK7A 2FUEA 1WZCA 4YIKA 3QU5A 3WK4A 3SD7A 4QQFA 3DV9A 4J03A 4Y2JA 4JB3A 4QJBA 5AW2A 1LVHA 2G08A 4F71A 2B82A 1TJ4A 5ALWA 2GO7A 2ODAA 3OPXA 3WGVA 5ALYA 4H1WA 3PGVA 3OCXA 1YJ5A 4UU0A 3F9RA 3EF0A 5AVTA 2YN4A 2C9MA 5AM0A 5AI6A 3L5KA 4NAVA 5AHXA 4KYTA 2ZXEA 4Y2UA 3KDPA 4OCZA 3AR4A 4G63A 5AKGA 2W43A 4BX2A 2I34A 5AW1A 1QYIA 5AICA 2Q4TA 4AS3A 3ONNA 2FDRA 5AW8A 3QU4A 3NAMA 4I9FA 2P11A 3ZUPA 2HDOA 3ZX5A 2X4DA 5AK3A 3PCTA 2R8XA 2Q4RA 4YCLA 2CFRA 4BEWA 5AW9A 3IRUA 3QUBA 4EENA 1RKVA 3L8HA 1Z4IA 4ZEVA 4GIBA 5ALGA 3FGOA 2AGVA 4HYTA 3A1DA 3U19A 3KZXA 2O9JA 2HO4A 2RBKA 4BEVA 3OTQA 4EEKA 5T41A 3L0YA 1VJ5A 4C4TA 2JAWA 5ALKA 3D6JA 3E84A 2YFYA 4KX5A 4IFTA 1NNLA 3KD3A 4Y2VA 2EAUA 5ALOA 3WK6A 5AKHA 2MU1A 2IYEA 2W4MA 3ET5A 3NUQA 2HOQA 5AM5A 1RQLA 1X42A 2G09A 3NALA 4UMFA 3ZTWA 3N28A 1SWWA 1RDFA 4MWOA 3NASA 2D2VA 4UAVA 2AUTA 2OM6A 4DCCA 5AKXA 1L7PA 4KN8A 4UATA 5AKKA 2B8JA 4MUMA 4GXTA 4UM5A 3QX7A 2B8EA 3N8GA 1ZJJA 3AR8A 3W5BA 4EX6A 1EK2A 1Z4QA 3U7GA 2P69A 5AIBA 3OCUA 2JAOA 2YBDA 1QQ5A 2ZBGA 3GYGA 5AKJA 4CF3A 5A3QA 3TLMA 4YIHA 2MSNA 3R4CA 1U02A 2Q5EA 3L7YA 2FPXA 3SMVA 4FYPA 3DAOA 4UMDA 5AVRA 1ZRMA 3EF1A 3ZVNA 1RLOA 5ALUA 3L1UA 4HGQA 4OHFA 2G80A 2R8ZA 1Z4MA 5ALSA 1QQ7A 1TJ3A 3WKEA 3QUQA 1XVIA 3FPSA 5AVXA 3QUTA 3L0BA 1RC8A 3B9RA 3ESRA 3FZQA 1RMTA 2WHEA 4UMVA 5AI0A 2WF7A 1ZD2P 1N8NA 1T9ZA 3N5KA 2JAUA 5AW3A 5AW0A 2WF9A 2B30A 4BX3A 1MH9A 1VJRA 5ALPA 5ALZA 4ZEWA 2YMMA 3CZ4A 4BX0A 2IOFA 1ZRNA 4Y2PA 5ALEA 4UW9A 3W5DA 1ZOLA 1SU4A 3SHQA 5AVYA 5AW5A 4UAUA 3IB6A 5AI5A 3ZWDA 3N1UA 3WKDA 1QQ6A 3WGUA 3FPBA 4Y2YA 2I7DA 3ZVMA 2I55A 4Y2TA 3AR6A 2RB5A 5AVZA 1U2TA 3UM9A 1CQZA 2B1QA 3CNHA 4EZEA 4YCNA 3UMCA 3NIWA 2NO5A 2IOHA 3I1YA 4RETA 5AESA 5AW7A 4IG4A 1YNSA 1Z4LA 3UMGA 1SWVA 4ZEXA 3IJ5A 3WK9A 1T5TA 2R8EA 3ZI4A 4FFDA 2B1RA 2HF7A 4XQ0A 3SLRA 5AVSA 2FPRA 4G9BA 3WKAA 3J7TA 3B8EA 3I6BA 5AI4A 1XPJA 3E81A 2HCFA 3U26A 1TJ5A 4RESA 2QYHA 2EARA 3U7HB 2HI0A 4AS2A 1Z4OA 4F72A 1Z4PX 1ZD4A 2O2XA 2FUCA 3BWVA 1U7OA 1TA0A 2YJ4A 1YV9A 2HSZA 2NO4A 1Y8AA 5AVVA 4DFDA 1Z5UA 3E8MA 1K1EA 3U7EB 1O08A 3QU7A 1Q92A 1ZD3A 2JARA 2IA5A 1L8OA 1Z4JA 3QYPA 1L7NA 2ZBFA 5ALHA 3K1ZA 1Z4KA 3W5CA 2OBBA 1VFPA 3P96A 1L7OA 1ZS9A 3VAYA 4XOUA 5AI8A 4DWOA 3QU9A 5ALIA 2GHQA 4UARA 2I33A 4C4RA 1IWOA 1J8DA 3AR5A 1S8OA 3ZWKA 1L8LA 2C88A 3M9LA 2I6XA 2WF6A 2QLTA 4YGYA 4HGPA 4BBJA 2CN1A 5AKEA 3MC1A 3L8GA 2PR7A 5ALVA 4UMEA 4UASA 4XE5A 4HGRA 1YMQA 3B9BA 2C8LA 3A1EA 1RPZA 4J2TA 4XPZA 5AVQA 5JJBA 1U2SA 5ALFA 2G07A 2PKEA 4DW8A 5AK4A 3I76A 4HAIA 4KNVA 3OCZA 3AR7A 4FE3A 2BDEA 2P9JA 2RARA 4PNHA 3ZX4A 5AIAA 5A3RA 3U7FB 4NABA 5AM3A 1RKQA 4OFZA 3R09A 1RMYA 3OCVA 1TE2A 4Y3UA 4EX7A 2RAVA 3UMBA
chains in the Genus database with same CATH superfamily
2CWWA 1VDVA 4MCIA 3U4QB 1MNQA 1JVBA 4IYRA 4XM1A 5DBOA 5FEMA 4AUNA 3FOEC 3UCFA 1LU9A 1SXGA 2PV7A 2GUWA 2NNWB 3R7BA 3PFKA 2QUAA 2JKVA 5BMVF 1E6CA 2E49A 2P4QA 3LUFA 4FYVA 3DOOA 2UVWA 1NY5A 3LD9A 3CX8A 1F4LA 3QLVC 5F73A 1VGVA 1KLNA 5CA1F 3BA6A 1TCUA 3GLSA 3VZPA 1IMOA 4DDTA 3I28A 3KDAA 2QVZX 1B8VA 3FPFA 2H2GA 3H1FA 2IHKA 2XA9A 4TYYA 5HFAA 4LYEA 1GP2A 2Z5GA 3MINB 2P2SA 3GLHB 5C0OE 1AZWA 4XWWA 2QZZA 3A0BU 4HGNA 4ESHA 5DHSA 1RRCA 4KR7A 5L9AA 5D3KA 3DT6A 1RWMA 3K0BA 2JRZA 4NENA 3REFA 4PQGA 3UXEA 2R8YA 3MLAA 2VAVA 4J3NA 1BA2A 1LDMA 1G8JA 2B34A 4I6JA 3ZKWA 1PO7A 2YW2A 4M1SA 3IQWA 3GGSA 3SS7X 2OESA 4FQ5A 2EP7A 1YGYA 1XTIA 1RI5A 4Y6OA 3JX9A 3G5TA 4A6DA 4B3CA 1K2WA 2J3MA 3C3AA 4OYYA 1HZJA 1QIIA 5AXDA 1DC7A 4A4DA 1WHTB 1IN5A 4X5OA 2GSWA 1YULA 4EMSA 1SU6A 1Z17A 4JB3A 3KQTA 1LW7A 3IALA 3FDSA 1ZQ1C 3WJAA 5JTTA 5FBKA 1DEXA 1OT3A 5EMNA 2B6NA 3AFOA 2K6GA 2Y93A 5A7FA 1XNGA 2JAPA 3SFZA 4HUTA 5DZSA 3O8LA 2QVBA 1T9GR 1ODFA 2HJ9A 2WJWA 3MFYA 3JD4A 4FDVA 4CCYB 4DT1B 1H9BA 3LBAA 2VQ3A 3AX6A 3D6HA 4P98A 2QSZA 1XZJA 5HCIA 2D2EA 3EOZA 4IJMA 3O21A 4LZDA 5F9FA 3ER6A 1KNQA 5KFZA 3LCRA 4RNNA 4L4XA 1ZIOA 1E1QD 5J2TA 3WRXA 5CH8A 4Z4GA 4LJAA 2EJWA 2EQ5A 1N2CE 2BI4A 1E59A 1W75A 4K0KB 5LQSA 2FP3A 3AOEC 5EJAA 1NUTA 2VDVE 3BXOA 3U7GA 1I5OA 4IEFB 1J21A 2QRMA 4Y2GA 1C30B 1TIBA 4KW7A 1N3BA 2NTYC 4FFRA 3ZZTA 4LZZA 1NGSA 4ZU1X 2ZRJA 2HV9A 2YVAA 3T52A 4YRMA 3DZJA 4OHFA 2EG5A 5FAXA 3QE3A 2E3TA 2Q1UA 1BDIA 1LBSA 4DBZA 5FUMA 5KMGA 3GFVA 3ZE1B 1QKIA 5CLHA 1JPUA 1P0IA 3PQFA 5FPQA 3RVJA 1GGKA 1ZQQA 4NJOA 2ZUCA 2OGSA 1X74A 5ENVA 2AC4A 2VCYA 4B3GA 4BLTA 4NBLA 3ZIAD 4Q3DA 2V1UA 4GZ5A 3R8XA 4AK9A 2IU4A 3IIEA 3WS7A 2BCRA 2G4VA 3EDMA 2ZCUA 3LUKA 4MOWA 4AG3A 1O97C 4X9XA 1B6GA 3MTBA 5IZ4A 1E2HA 3I9LA 2WKRA 4WN9A 2I3GA 1REQB 4ER7A 4AG6A 4ZCMA 5FCDA 2D59A 1QGOA 1CQWA 4YT2A 5KFMA 1JVSA 3I6BA 1XEFA 3ICXA 1ZI9A 4HB2A 1W85B 2W03A 3P5BA 3K9CA 4IIDA 3TAXA 3RRMA 3H5WA 3ZOKA 1AE1A 3T4EA 1T3ZA 3ASUA 5IKXA 2QRNA 5E3HA 1ZS9A 4ZZ0A 3H5VA 1PG0A 3W9SA 2ZTMA 3DW1X 4KACA 2G3YA 3RSLA 2NUAB 3RSZA 2H92A 2W6CX 2E82A 3TTTA 3DMNA 1H5NA 1GCUA 3A4YA 5IDWA 2UUOA 4KWHA 3BB4A 4G5XA 4EBDA 1IEXA 4R1LA 4IHJB 4YFVA 1YR3A 4X1OA 3VPSA 3HCWA 4IOMA 3QE4A 2GF2A 3CZ5A 3SXUA 4O2AA 2PX0A 4FZ3A 5I8PA 4P4OA 2BR0A 3PMLA 1DXQA 1PWHA 3RS9A 1X2EA 1NVMB 4ER3A 7ICUA 3JQRA 5KSYA 4MR8A 1W87A 2GMWA 4X66B 3AFMA 2C2EA 3W3AD 3RSQA 3DL0A 3QRWA 2EZ8A 4D8WA 2VFAA 3RANA 2HPVA 2QRVA 4QPDA 4B0OA 3ZE2B 2HV8A 4RFVA 3I2IA 4EDHA 2K4HA 2FSUA 1KI3A 4WNIA 2OWEA 1UWCA 3HEMA 4HLQB 4CM1A 3AQIA 1HMYA 1TYAE 2H2AA 5JS2A 4M47A 5GWXA 2Y0DA 1XTQA 1P3Y1 1OW3B 5J29A 1DG1G 1YH3A 2E7ZA 1NZFA 4QU9A 1JYFA 4EJ6A 2D4AA 3BRQA 4NE2A 3P9XA 8ATCA 4GWGA 5LIPA 1Q1EA 1OHHA 2XODA 3M4JA 2YS7A 5CXQA 4X8LA 1TFRA 1PT9A 2C8KA 1QOZA 2Q9BA 5KG4A 3DCNA 1S4MA 3L7DA 1EA7A 2CEAA 3SF8B 2VYND 4I6EA 1XB2A 4F5NA 1FK8A 1CY0A 4G0YA 3COYA 3T3NA 4LYJA 2ZXIA 3EF0A 2F1KA 2R6CA 3LF2A 5EWGA 3DJYA 4DJTA 2H5XA 4CM9D 5THXA 2NTEA 4D45A 4NMHA 4KRGA 5J2UF 3I5XA 3KUKA 2EOAA 4F8EA 3H4TA 2YWRA 5TJHA 2I1WA 4F6LA 4PZOA 4IVNA 1WF6A 1NN0A 7ICGA 4BEVA 4Q05A 5KSWB 2PTGA 2VWQA 3M6MD 5CB1A 4BL5A 1PDOA 4F5DA 4ZOQI 1CDZA 4X1YA 3TPFA 5HJ7A 4MDHA 5JVDA 1VKZA 1P7ZA 4ZOLF 1PLLA 1H9AA 1VA5A 2R7MA 2BEKA 2R85A 2XRFA 3WJ2A 4IIJB 2IHNA 3MWGA 1ZA1A 4ZHQF 3HDJA 2G63A 4EG4A 3AZQA 2AN9A 4R0NA 3F7TA 1MG0A 4CF3A 3GZJA 3K6SB 3BMCB 3ULKA 3RTGA 1F4PA 4UVDA 1VYVA 3G8YA 2OD2A 2XMPA 2NACA 5IKPA 4MRNA 4Z8XA 2HWUA 2BFFA 3NTOA 1C0IA 3M82A 5KTRA 3O3NB 3L4BC 5IYZB 3G0IA 3ZDYB 4G24A 5AW0A 3VR5H 4R98A 1JFRA 4TV8F 2C31A 3G2JA 5JBIA 1I94B 2GAOA 3PHCA 4P32A 2VJCA 1ZOLA 1U2EA 2D2XA 2AOXA 4EP1A 4I4CA 2E1FA 3OJ0A 4P08A 3OLVA 2J9XB 3OC6A 1AGPA 4EJSA 2W2KB 1MIOA 2K87A 4IDDA 3HYLA 4MLZA 3BX1A 4W63A 1UQVA 4X84A 1W5TA 3LBIA 3GLRA 2Z57A 4Q4JB 4BWFB 5DNCA 3QOWA 3CYMA 3SS8A 4BWYA 4JJKA 4YJ2A 4MR9A 3W2TA 1PUXA 2IXDA 5C8ZA 1GNSA 5DLQC 1OLUA 4ECEA 5B3JA 5HKBA 3WHLA 4RK1A 3RGGA 3RRJA 4CM6A 2VBCA 2W9AA 2HBKA 1QM5A 4L27A 3OECA 1JG3A 4JUZA 1VFPA 2Y71A 5F78A 2QYSA 5JIBA 1F2VA 3IJPA 5FOSA 1E8MA 1DEAA 1JKJA 3Q7RA 5HJEA 3ELDA 3ZCSA 1DIBA 4UUPA 1P2UA 1IRIA 1LLFA 2GZRA 4M1KA 1JDBB 5TQ0B 1H05A 4YYZA 1R8JA 4TKUA 2FLLA 1UOPA 3UMBA 3WNBA 3GD5A 5A9SA 3HS3A 1GAJA 3RSCA 3ZD9A 1NP6A 5CB4B 1R66A 4ETMA 4D26A 4E15A 2J07A 1YKSA 4HEA1 4M9QA 3TZBA 3NEYA 5JXHA 3REQA 4ZYYA 5LP6A 2MYPA 3LW7A 1R6TA 1J20A 4JR2A 1AC5A 5AJYA 1B0XA 2Q45A 1C0PA 4QODA 3ESBA 1WYGA 3JQDA 4Y2SA 3PDCA 4C4ZA 2ZEJA 3LO8A 3Q85A 3Q8XB 2B3TA 1KDVA 3V6MA 3C45A 4GYWA 2O3UA 1FSZA 4XLLA 2CV2A 4B3TB 1UJ2A 2JL1A 1M2NA 3NANA 5FBHA 3PVCA 1PU2A 3A06A 5D5QA 4S2EA 1BG6A 3O31A 1XI2A 1BVYF 1XDWA 1M66A 2YDYA 2SECE 3OT5A 3N2GA 2H3EA 5FTKA 4QHTA 4B75A 1Y3CE 1T3SA 1L7EA 4J2HA 2BUBA 1AD2A 2RIRA 1U3GA 8ICFA 3G5LA 3U6BA 2IEZA 2Y92A 3OMXA 4KK3A 3HCNA 4LJXA 5KNCA 2VJ5A 4B7UA 2V3VA 2EAOA 3MTQA 1I36A 3OZFA 2DWUA 4DLXA 1EQUA 1P2FA 5LA6A 1W25A 3WK5A 2H7YA 1K08A 2ZT5A 3GGPA 4HFMA 1FP1D 3ROKA 1OVMA 2HXYA 1KEEB 1KEVA 2PS3A 4HDNA 5MFPA 3PE6A 1MC1A 3ZDQA 5ERGB 4WNCA 4IXTA 1K7FB 4ZYUA 1YT5A 3AJAA 4WOPA 3TNFA 3E3AA 2NYRA 5EUBA 2OMEA 3VNAA 1W46A 4PGGA 8ICVA 2L69A 3WYNA 2EJBA 4L76A 3T5TA 1DBRA 3MMPA 1DX6A 2CXTA 3N0XA 3OM9A 4DN6A 1NUSA 3BERA 4XB6B 5CD9A 4J91A 4E6EA 3KQHA 5F7ZA 4D6PA 2JZCA 3DAGA 1VJ5A 3DMGA 1ATIA 1IUKA 1WCV1 3DT9A 2QRKA 3TQIA 1M0EA 2VPQA 4YD2A 4Q8FA 2AT1A 4V3BA 2VPWA 1Q1GA 3DQZA 3SC2A 4INPA 3WV5A 3WV4A 2DFKB 3MAJA 1NM5C 3MABA 4EPTA 2B25A 1WSDA 3GZNB 5MDHA 4JEMA 3ONFA 4M9RA 2PUVA 5KNBD 2VTBB 3C28A 3DEFA 4WLUA 4TLEA 4I2JA 3UKDA 3W5VA 4TRRA 4AO8A 3SJZA 4Z4QA 4YRKA 1EX6A 2PS9A 5E8JA 1NBWB 1CUBA 4FX5A 5EIFA 1FRFS 4IV0A 2Y76A 3EIOA 3GT7A 1YVUA 1NK9A 1B26A 5D3MA 4TT8A 2V59A 4G4SO 4WEOA 2CHGA 3Q40A 1DXOA 1TMYA 5KYWB 4EJ2A 2RGBA 1JR3D 4J0DA 3IDFA 2XYHA 1E7WA 3Q3HA 4FSDA 1JI3A 4QJIA 4DCMA 2I7DA 5K8UA 4BTEA 5IH7A 1QIKA 5KSPA 2OFWA 1Q74A 5CA7A 3RVNA 1E1QA 1I7PA 4QSMA 1NXSA 3R3SA 3HB9A 4XPIA 2G5GX 1PCXA 2QRJA 5J1SB 4KITB 2NXCA 2HCFA 1EHYA 1ADYA 2BFDA 2K5UA 2HRRA 2QZSA 3L0PA 1A9YA 5KFQA 4CIVA 1PUZA 4IM7A 2QRQA 1P72A 4MIOA 1AQYA 5B57C 2Q41A 5F2NA 3IDZA 5G53C 1YB6A 1QYWA 1IYZA 5FWXA 4XCXA 3N58A 5KQGA 2AQ4A 1OFUX 4RC9A 3W3AH 2J9ZB 3I53A 4KQ6A 2WV9A 1YDHA 4DQVA 4EB3A 4G4GA 3K9GA 2ZSAA 1RYNA 1NP3A 3DZGA 1XEWY 5EWFA 2CHEA 5A0FA 1HKHA 3MVEA 4UHHA 2AGOA 4GBMA 2FRDC 3QPDA 3ZWAA 1J06A 3HHEA 1DAKA 4O8ZA 4CG1A 3OTIA 1RKQA 3BB1A 2ZJ6A 4K9PA 3QFHA 5C7OO 2BM0A 4BE7B 3SICE 2Q5QA 4TX1A 5HCNA 4X8HA 2JKZA 3ZIAA 4NYJQ 5C8YA 4M49A 3H5OA 5CJJA 4JB2A 2EG9A 4V2UA 1R0YA 4RDCA 3FOFC 2NG1A 2HQBA 4NC9A 2FG5A 3HA7A 1A5ZA 1FRVA 4WK4B 1QJ4A 1YOVA 3IOCA 3B1WA 2BTQA 2FMFA 4G26A 2OORC 1OASA 3SKXA 5ERYA 1Z8NA 2YVQA 1FLNA 5AKLA 5LZ2A 2QTFA 3ZE8A 3ZJVA 3L7KA 1KC3A 1P2GA 1DDGA 1Q0RA 3DM9B 3BF8A 1JKMA 2IKSA 5D2CA 4U7HA 2JFVA 3ZWQA 4X7RA 3SQIA 3AEUA 3U0BA 1PS9A 4AP5A 5HTOA 3GT3A 4OL9A 4TXHA 3TVYA 4D46A 3VU9A 4CLOB 3D5QA 2VG8A 3Q7PA 3GBPA 5K3OA 2DBYA 2P8JA 1QHNA 5I9MA 1IAVA 2MYTA 4QOEA 4KYUA 1TU4A 1GPH1 2Q3LA 4QPZA 4HADA 1U2RA 1N5LA 5LKRA 1E7SA 1W2GA 2GRAA 2EFCB 1NDUA 4MS4A 4QW8A 5F2EA 2GSDA 2VYVA 3JY6A 1XN1A 1X7DA 4DJJA 5AXAA 3ZCVA 1EVJA 4K9DA 3U49A 1KBUA 1M1YE 1I6KA 2JI8A 1KSFX 1C3OB 4RUKA 3C6XA 2G08A 1PQYA 1X15A 4FBTA 2RGNC 1EP3B 3DB1A 4K6KA 3FYHA 3LQ1A 2LR0A 1Q21A 4KMOA 1WY5A 3M1AA 4JP3A 4RHTA 4WXEA 3WB2A 1DG3A 1JNYA 2O0KA 2EF0A 1V45E 4OOEA 2A7QA 4FYWA 4J0IA 3QYFA 3EZYA 3KYDA 2WNSA 4LGCA 4LPSA 5ED4A 5KT2A 3EZFA 3AB7A 4BQEA 2XH8A 1GKIA 3TTVA 3Q7IA 1NY6A 3IP4B 1QO0D 1PUIA 1UBEA 4GQIA 2J9RA 4NKRA 5AKHA 3SZGA 3IHWA 1D6NA 2VPZA 2HKIA 1V2GA 4EI8A 5EHXA 5GGXA 1T0IA 4U6SA 1A97A 4JS0A 2AHOA 4DMUB 1L7PA 2LPMA 3HGQA 1JF8A 4XX0A 3ZOZA 1N9ZA 1JXAA 2I67A 3N7UA 4AD8A 3KNZA 2G9ZA 3PWSA 2GAIA 5DRYA 2I8LA 4C0AC 3UJ3X 3MLEA 4KBFA 5BT9A 3DDCA 3I4CA 4Q9JA 4BUZA 4M0KA 3RARA 1G9TA 2XE6A 1Y1TA 3EY9A 1XCPA 2VPYA 4W9RA 2GPNA 1XNQB 4XWYA 2H8GA 1OKKA 2QD5A 3I2JA 4QGGA 2AFVA 4PG7A 1EUCA 3CKLA 1Z9BA 4Q8EA 4F4KA 3WDLA 1COOA 1M6HA 5KVQA 1SUEA 2C9YA 4G89A 2O6HA 2POQX 4YPVA 5DBEX 4FDAA 4I55A 3K8YA 1DARA 1HYEA 2EVWX 5CEHA 1CETA 2ADMA 3JZIA 1HSZA 3KYBA 1BXGA 1AVTA 2W6PA 3CRW1 3V2IA 3WK9A 3Q72A 5AWFC 4DXAA 4M99A 1N2HA 3W90A 1UODA 4Z9FA 3CLTC 5CCEA 3E0XA 1BNCA 4ZMSA 3PSPA 2AF3C 1G9XA 4WACA 2BUCA 4YMGA 3VI4B 3QVOA 4QGBA 1KJ8A 1AKUA 4MRPA 4TTTS 2C7PA 3NFYA 4J9MA 3E9ZA 4R2XA 5FYQA 1E1LA 1IVYA 3MTEA 1QDEA 2QU8A 3L4JA 5BW4A 3UBTA 1W47A 4JSRA 5BMOA 3JWGA 5B36A 4EK9A 1A5AB 2Z5VA 1ZNYA 1L5HB 1DDIA 3AEKA 1JXQA 4PZPA 1CY7A 3BWCA 4F4IA 3FDZB 4F4FA 5EJMA 4KAFA 1CUHA 4EKGA 1T15A 2BP7B 1FP2A 4LCEA 1Y98A 1RRMA 3JYQA 5BNIA 1CEYA 3T7DA 1Y81A 3G8DA 2WT8A 4KO3S 3BEDA 4LV5B 1F0YA 1ZN2A 3UWPA 4FW8A 2IYFA 1P29A 1QQAA 1PEAA 2GJ8A 3PYXA 4O4JB 1Z0AA 4A8JC 3B6MA 5HF8A 2Q0SA 5A0TA 1B14A 3R3YA 5E7IA 2JCBA 1PV4A 3FYCA 4RQ8A 3IQFA 3EA4A 2CCGA 1KR5A 4OP3A 1C8LA 1CRXA 1DAGA 1HFKA 5BP7A 1U4SA 5E6RA 1T1SA 1L5SA 3M83A 4C7OB 5E2IA 1HE3A 5JNWA 4JL6A 1L8QA 1SCKA 1NBEA 2TMGA 4B2LA 2X5OA 1GZUA 3U48A 4QDUA 2VJAA 4B84A 2AQIA 5ENDA 4DL7A 1NXTA 2KIWA 4BUGA 3PWTA 3PSHA 1WUIS 3MFQA 2X77A 4M37A 3IPRA 1SN7A 1NMYA 1XP8A 1GYPA 3IDQA 3FYDA 4ZARA 3KJXA 3R6WA 5KTSA 2RK4A 5AXBA 2PIAA 2OV1A 4N5LA 5JU6A 4ZO8A 3TLZA 2WFLA 4OFXA 3NBAA 4XEHA 2NVUA 4TLDA 2DG2A 1WP9A 5HKKD 3P0FA 5KNBH 1YQWA 2EKQA 3HBNA 4MFAA 3RAPR 2BTEA 1U9ZA 1F9EA 4JXXA 5J2JA 4KTQA 4ZT4A 3ZI0A 2YCLA 4FOTA 4J9LA 3HJTA 4PO9A 3RBAA 3WWEA 1Q17A 3TMAA 1KERA 3ZLVA 5EJFA 5LB4A 2Y1GA 4BN5A 3FPGA 3UGKA 1N57A 3FGOA 1X9GA 1NIPA 3TB6A 1K5DA 2GEFA 3M6LA 3HKDA 2WJVA 2Q2WA 2IF2A 3D6JA 3EDRA 1MEEA 2ZXUA 3RVSA 4YXFA 3C5VA 3K2BA 2VHVA 3H16A 4ZOEA 2BFBA 1E2KA 5IVHA 4CWAA 2ZAMA 2E37A 3ZHQA 4WERA 1YZ6A 3E5RA 1GM5A 5F76A 2VF4X 5T4EA 4EYIB 2UVPB 1UH5A 1SCDA 4LZWA 3JATB 1R0CA 2FN9A 3M6WA 3AL3A 4N8SA 4JGGA 3IX7A 3L5OA 4FYHA 4HH1A 4F5ZA 4CHTA 4LXQA 1PYGA 4C5AA 5EL0A 3UMYA 1J07A 4DLAA 4RZQA 1TGYA 2EXXA 4K9KA 5HDQA 4JEUA 2CCKA 4LS3A 3WGNA 4OEHA 2PXXA 4O4HA 4H7JA 4AKGA 4B9VA 4NJMB 4YRAA 5M04A 4HO1X 3H97A 4OGGA 3NPAA 3RYCA 1BDJA 4RSHA 1YR2A 2WD7A 3HCRA 2AUNA 2PTHA 5JHHB 3OF2A 1I8TA 2A35A 5EXEA 2W9CA 1S2DA 3WGIA 1URPA 4Q45A 3RVLA 2W0MA 2OHOA 1MB2A 4DL6A 3MB5A 1V2HE 1OU0A 2XKKA 1UBNA 2W54A 2HF7A 3SLRA 3ZI7A 3WISA 1E2DA 4POAA 3AY3A 3EB9A 3RH0A 1TJ5A 1UEJA 2QWXA 2YOHA 2JHGA 1BDHA 4K6MA 3FHLA 2CC2A 1GPLA 3GLFE 1FFEA 4KE7A 2BR3A 2ZSFA 3V7NA 1CZRA 4QULA 4CQLB 4OBEA 1N0WA 1Q1NA 2VAXA 5H4GA 1E7QA 3ZGVA 1AXGA 3AU6A 2AOWA 2IYYA 1XRRA 2NO7A 3VC1A 3ESDA 3ZWKA 4X3OA 5TARA 2PR7A 3VSEA 2JFHA 1V16B 3EXIB 5JFGA 4XQGA 3UJDA 3AJEA 2EGGA 3PXEA 3E1KA 1GL6A 2VRNA 1U45A 3UCEA 3U7FB 5KX5F 4LJLA 3WG9A 5IDQA 4TYPA 1KQGA 1SOWA 2KTQA 1PEYA 1O87A 2UZAA 2W9XA 1JR3A 4A03A 3FFXA 1PWYE 4M83A 1JQ3A 4KGVA 1D5WA 2JGEA 3PO5A 4B2IA 4X97A 3FCCA 5CNIA 3QVGB 3F73A 3EZ5A 4O0IA 3GROA 4MHTA 1NBMD 2KFZA 2XDAA 1V3VA 1KZ1A 2FJ0A 2WYIA 3IAS1 2VHEA 3LRPA 1H23A 3ANMA 3VKVA 2R8RA 1QZZA 1XEXA 2XZPA 1V1RB 5BORA 3BTUA 1N9KA 2G9NA 3M1IA 5E6UA 1DJOA 3GVPA 4UB5A 1QOPB 4INAA 5DOVA 4N3AA 1YS9A 4ZA2A 2MU2A 4IAOA 3O38A 4G09A 3HDHA 5DHPA 4OY3A 4KBYA 2PLAA 5LZ5A 2I7XA 1NK7A 4ZD6A 2Q9CA 4RWZA 4QNNA 3JZAA 2X1LA 4AKTA 5DULA 4AKHA 4A36A 1A2KC 5KZMB 2ZIWB 4IIHA 3ZWNA 1EWKA 2L17A 1U47A 3RUIA 3LDHA 4JX9A 2BZ1A 3TSCA 4H4DA 2HADA 4BO9A 2IXBA 3WGVA 3H1AA 1WEHA 1ZITA 4P84A 2CB9A 3EQZA 2F8MA 4CUZA 5L4SA 3IBYA 1QU2A 2VP6A 5JT1A 4C0QC 4AKIA 4CEIA 2H07A 4C2AA 3RABA 1K9VF 4GM1A 1YFKA 5T4HA 1WPQA 5J59A 1KH1A 3KELA 5AW9A 2I1VB 3O2JA 3RB0A 4EGSA 1KR2A 4RX1A 3HDTA 5GZ1A 3SQOA 2JFOA 1U49A 4I36A 1DFGA 3L0YA 1ZQIA 1WCWA 3ADBA 4K2AA 5J8YA 1ZQHA 2XY6A 3IVMA 1QRTA 4EYQA 1UMDA 1W5SA 3G2PA 3IO3A 4BLVA 2YHBA 4LDNA 3GILA 3NHPA 2CL5A 4O5AA 1A4UA 2HWWA 4UC0A 2WAMA 1EI9A 4KFRA 3SV4A 1D4OA 3N0WA 3W2HA 4FBMA 4PQYA 2AIRA 1XVAA 4P58A 3SBEA 1AGRA 2GWHA 2O19A 1ZQZA 4QWDA 4Q9DA 1O94D 2R7NA 3CBQA 7ICRA 1PFVA 3P94A 1XPUA 5D00A 2H9AA 4RVGA 3PRHA 1K8XB 1JE1A 4R6WA 1TA4A 1ZJWA 1LW6E 4BKRA 5DNVA 9ICAA 1OWNA 1J6UA 1XLWA 4OQYA 4ARCA 1M2KA 3DDUA 5IJZA 4NOMA 2UYCA 5JFTA 1FQOA 5BVGA 1C0EA 5M34A 3G5AA 2NT3A 3PLAE 1SK8A 2JZBB 5TS2A 3MBIA 3W9UA 3QF4B 3DE2X 2X8JB 3N8IA 4IBOA 1F0PA 2NVBA 4JUFA 3W8DA 5ICFA 2Q7XA 1BWQA 1P1RA 3UMCA 2I65A 3FLBA 5BNZA 2EKPA 4HX5A 4D41A 2BISA 3K16A 1Z4LA 2WWGA 5CYPA 4UJ5A 1MXFA 3FTDA 4F1WA 1NNUA 2X9VA 1HE5A 1QO0A 1O54A 4KSYA 2IYNA 4BQOA 1AKWA 1YOBA 3ERCA 5A7HA 2HBYA 1ORRA 4G5FA 3G49A 5BWMA 1LVGA 3TTUA 1Y1KE 4LTDA 4D5EA 2OLEA 4OQ4A 2WD8A 1Y8QB 5BQPA 2RC5A 5ALIA 1LBEA 1AS2A 2ISSD 4NRDA 2BRUA 2CFOA 2FQQA 2N3ZA 2QVXX 4MLCA 2X2FA 1R4ZA 3HW8A 2HQRA 4M86A 4BE9A 4RPJA 2C54A 5D7NA 4QAQA 1TIKA 1XRJA 5JJBA 4XAQA 2EZTA 3I76A 5I3ZA 2ZBQA 3NYIA 4EKYA 5CBPB 1Q11A 3LYUA 3ZJYA 3FWPA 3ND8A 1Z5GA 1UDWA 4ZICA 2CHUA 1UM9B 2DR0A 1NW3A 4JDPA 1PFUA 5COBA 4D3ZA 3DYIA 4JVLA 1GXSA 1LX7A 3IP5A 2DH6A 1NXPA 3O2SB 3GIWA 1KJYA 1ZQSA 2F43B 1JPVA 1YB5A 4B48A 1E2GA 3GAMA 5M7EA 1CUSA 1HDOA 5H2FU 4LRYA 4LEIA 4RZRA 3O2NA 2FLVA 3VUEA 2IJGX 4MGEA 3VKGA 1S3GA 2V74B 1IM2A 2P79A 3TOSA 5ESWA 4NCNA 2LGJA 3C5HA 2O2EA 2XADA 1VJ1A 4NNPA 1NRJB 2I4LA 2C2KA 1FLVA 3EK2A 1VI5A 1JB9A 5D4BA 1FSGA 3QSGA 1G60A 3ANLA 3E3LA 5KTKA 3EOBI 4E6PA 3PE3A 4RXTA 1JIJA 4DQRA 1XR3A 1JHYA 1JIXA 5KFSA 4XRGA 4RF5A 3UB2A 2H3ZA 3ZIDA 2ORVA 3CX4A 3ZXXA 4JEIA 3NI2A 3RBZA 3MWJA 1ZEJA 3OO0A 3WGJA 1K8RA 1JQAA 3TDNA 1RD4A 3QUSA 4BVHA 2R8KA 1DC8A 3QXXA 3VC2A 1KK2A 5J2HA 3QPBA 5KFGA 2J3QA 1ECFA 2J4CA 3TKAA 5ALYA 1Z6AA 1IHOA 3PLRA 2HRCA 3F8TA 1QG4A 4LE1A 2C00A 2ES6A 1OX6A 2BCVA 3ADDA 1SKRA 1H2FA 1J2EA 5L3RA 2WKSA 4CQJA 4KWTA 2GKGA 1UZAA 4X94A 3IVXA 1QLJA 1CXZA 3NFRA 2GZ1A 3HRIA 4AC9A 1NXWA 3KHRA 1FP4A 1OV6A 4O2BF 2OHHA 3OOJA 4RPIA 4DA9A 5B2ZA 3OJEA 3OTQA 5G0TA 1HT1E 5JBNA 1BS2A 3UJAA 2NRWA 1IWPB 3MMSA 3TG8A 5ES3A 1V71A 2EYUA 4I2BA 3TLEA 4UAGA 4OH1A 4MVJF 4PZDA 5KPJA 4Z53A 4LF6B 2JH9A 4WCFB 4X60A 4MVJD 4BNNA 3NBYC 5AKXA 4KFCA 4J9RA 2H1RA 4UATA 1FNBA 4K0RA 2Z95A 3QLJA 4QIHA 1NMEA 3JD2A 3VR5D 4LRXA 2FW7A 4KPGA 3CEAA 3VJKA 4XCVA 4ND8A 4PFQA 1WMBA 1T2FA 3HWWA 3MCZA 3T3GA 2XYVA 4KDCA 1YI8A 3DTVB 3IQIX 1XA0A 1JZTA 4MYRA 3QWBA 1ML4A 3KPVA 5C51B 4M0MA 1CJUC 2AD5A 4R54A 3EVFA 5HKKA 3SYKA 1E8NA 5IAJA 3RTVA 2PUAA 3WNCA 5L3SA 1JGTA 2AFIB 4ZEWA 1FFBA 3W6ZA 4ECQA 1XZMA 4UQPA 3HCOA 2MCFA 3QH4A 4P2HA 4TTVA 3ETEA 4B44A 2B6GA 4R7ZA 4KR2A 2QTMA 2FR0A 2FPGB 8MHTA 4KJXA 4REMA 2C5HA 3SYLA 3F6SA 4C01A 3U7HB 4L0MA 3GMDA 4WUVA 4LZJA 2DMRA 1QE3A 3X2FA 3N7SC 1XHLA 3LKZA 1AN9A 4F96A 2ZI7A 1Z1VA 4MVJE 1JDVA 4MB2A 4ZAZA 1GOTA 2E4VA 5BN4B 1DOAA 1K3FA 1P18A 4OIFA 3ZVKA 4ENQA 2ZJAA 1R37A 3CX3A 1T0HB 4D9MA 1P6QA 3AVYA 3ZBUA 2X4LA 4ZO9A 1H4SA 1J56A 1FDRA 2DSNA 4EB6B 1XTRA 4MPTA 1HQYE 2E5SA 5BN3B 2BPOA 3T1HB 3KKMA 4IWYA 1I2AA 2PT7A 3KYCB 2M2IA 2WT9A 1KKLA 1WMAA 2J67A 2FEPA 1XFDA 2WLTA 4P9NA 3F1LA 3H2BA 2Y66A 5C4GB 3OOEA 2G1AA 4DUPA 4XUCA 4LOHA 2O7VA 5EI5A 2F9LA 1GUYA 1CFZA 1PS8A 3D31A 2D0OB 3JU3A 2WWVD 1ZQWA 3RBVA 5BYBA 4C3VA 2IYAA 1QVWA 2DLCX 4M8SA 3TZCA 5CVTA 4LXHA 4YCMA 5KNLA 5MGBA 2P40A 4GX5A 1COKA 2DY0A 1DCFA 2MYNA 4YWJA 2EGUA 2XWSA 4C07A 3WNZA 4EEZA 3STVA 1QRUA 2WVJA 3QIAA 1HA3A 2C0CA 4FS1A 3UJ9A 4D97A 2CYAA 5KAMA 1R6XA 3ZCUA 3JV7A 3FIUA 1K4MA 4B87A 4BEJA 4Z6EA 5ESXA 1Y7TA 5HVNA 1ACJA 1KBZA 3V5NA 1SXQA 3MRTA 3PS9A 3BF7A 3A4VA 1CF2O 3HTXA 4JOBA 4MJ3A 3THXA 5CH5A 3EYWA 5JZMA 1UKZA 3Q5EA 2I2AA 1C7EA 1XAIA 1LDYA 1Y6RA 2AG5A 4BP8A 4CTKA 3OUTA 3A4TA 2RK6A 3QFCA 1DO0A 2A58A 4KLUA 1LXCA 1RWOA 3KEMA 1JSZA 3RF7A 3ZUPA 1OFUA 2XY4A 3UWOA 1R8XA 1NBMA 4L28A 3ZHXA 1UKAA 2LI6A 1Z5WA 4RFSB 4P7FA 4K9LA 1EK5A 2XRMA 3FJ1A 1F14A 4JIMA 4KDEA 1JQ5A 3WQSB 1YB1A 3KB6A 4NS4A 4PLPA 3E0QA 3ZD8A 1JHZA 1G3RA 4PGAA 1RQLA 1Z35A 3NALA 1MABA 4ZHSA 5E79U 1GY8A 3AKYA 1W19A 1RHMA 1W49A 1KVRA 1UBOS 4JENA 3ZEIA 4B73A 1P1CA 2WM9B 1KEWA 2LW7A 1KS2A 2NSDA 4U8GA 4YYEA 1R0RE 2I2BA 1WJGA 5F23A 3RDPA 1KSHA 2HCBA 1UZNA 4E3WA 1WA5A 3FPHA 2GT1A 2C7RA 5DMXA 8ABPA 3KXDA 2YC4C 4QTZA 4JP2A 3TXAA 4GKBA 5ADHA 4NPAA 1OTXA 1EVLA 1HLGA 1E2EA 3E05A 2ZUEA 1RTKA 5F3RA 4OQXA 5K4GA 3PR2B 3VR3D 2FW1A 1WRBA 1U6KA 2WE8A 1O6GA 3WHPA 4C0XA 2ZI5A 3DVAA 3G89A 3M4NA 1RJFA 4P7BA 2D2FA 1SXHA 4PL1A 2QPAA 1F6BA 1U9JA 2YH2A 1DT3A 1VG0B 3PGA1 2D0IA 1S3FA 3HGTA 3H11B 1N0HA 5IASA 5AVSA 1L1QA 3GRCA 2FFJA 3W6NA 4BNXA 4CLEA 3UMVA 4I8DA 3V7LA 4MQEB 3BWMA 1BSVA 4MTLA 3LPCA 4B3XA 1DEOA 1GZ6A 5E7MA 1L3IA 3O3OB 4AMYA 4RA6A 5EJIA 2WSIA 4NLGA 3ELYA 2CW5A 4IH4A 1OXUA 4CTOA 1K6IA 1XTBA 1R0SA 3DGFC 1O94A 4JH0A 3WGYA 4FFWA 4EHHA 5BXYA 1EFUA 2EGHA 3QX9A 4LXYA 5IH3A 2B8NA 1N1EA 4IFBA 4PF1A 4UUNA 3AY6A 3QFFA 2RARA 13PKA 3SQLA 1G291 3A36A 3RSOA 4KL8S 4NZMA 5CJ2A 3CGWA 4EI9A 3ZY6A 2PEYA 2HK8A 4PO1A 1XWLA 1R74A 3LC2O 2ZJZA 1MV8A 4UUOA 3NIGB 5F5LA 4CDGA 1L4GA 3U13A 4QTYA 3WO0A 1VHDA 3CC8A 5J0OA 1USWA 5EAIA 4MSUA 4TKMA 4BNDB 1LVUA 2ASDA 4Z3DA 2EZXA 3SE7A 3OCWA 2W6ZA 5L6LB 4YO7A 3HNPA 3PEEA 1I01A 5A02A 2LYHA 3CLUD 2QD2A 2IZZA 4W6ZA 2AH5A 1XTTA 3HJRA 4DLUA 5ALQA 2B4QA 1X0XA 4G41A 1VPLA 2OFXA 5HDBB 5TISU 1GO3F 3JQAA 5G1NA 4AG5A 1M8GA 5CUQA 2Z4SA 3G1UA 3PV0A 1SQ0A 2ATCA 2QMUA 4I5EA 3EGOA 1ZUWA 3C5WP 3ZCRA 3ETJA 5CHEA 5TMDA 3OEEA 5KFVA 4QM6A 1I4TD 5B66U 5L40A 1TKAA 2O8EB 2H3VA 3FYUB 4MYUA 2RGGA 4RELA 4QNLA 4PLVA 4UQGA 3JYHA 2ASVA 5LVAA 4ZOCA 4J9VA 3IXMA 2BEWB 5F7JA 1NU8A 3JQBA 4FCTA 5P21A 3D8SA 1D4ZA 2JC3A 1YCHA 4MPJA 1HNXB 1LVHA 1W2WB 1YBFA 4MVJH 1NBHA 1S2LA 3NS1A 1NSYA 1CZHA 4Q5IA 4EYOA 4R1TA 1LUAA 1P0FA 1N8KA 1D09A 4B32A 1GLNA 5KFWA 1E20A 4LXUA 5CCDA 3DLAA 2QL6A 3DOJA 1O5IA 2CFRA 3EZGA 1ESDA 2V4MA 5DW0A 5JDIC 1VRWA 4G1VA 2OGWA 2Q3BA 5BV8A 4S04A 1A9QA 3UKJA 4A10A 3QBDA 3DMHA 2QI9F 5IXSA 3BDIA 5D84A 4OJ5A 5K3BA 1Q19A 2DVMA 5EHIA 2B94A 1I7SB 4NBSA 4O2LA 4NESA 4KI0A 4BFVA 3IPAA 2F59A 3IP8A 3EC2A 3S70A 4UAVA 3TAUA 3VO1A 3TXXA 4E7OA 4C6RA 4MW1A 5FB3A 3PQDA 4ME6A 1ENOA 4X7BA 4BXOA 3QX7A 1ESMA 2V7VA 4YMMA 2Z6UA 2JAOA 1B41A 2WFMA 1PDWA 4O4LB 2P67A 1VLVA 3R7FA 2W2MA 1R4MA 2PBLA 3I72A 2F62A 1VMAA 3HKEA 2P66A 2AYYA 2ZB7A 1FS6A 4D82A 4RV9A 1J8QA 4L50A 1LPMA 4KR6A 3V42A 2H1WA 3THOA 1S9HA 2H6EA 5KEIA 4D1YA 4MJLA 3UT5A 2GHRA 5FWYA 3LUBA 3OE4A 2HHHB 3SDSA 3BTOA 4K28A 1RZUA 3DWGA 1US8B 4MRAA 4KU4A 2K7ZA 3E35A 1CUWA 2FX3A 1Z5ZA 1VLHA 1AM4D 4KQ1A 1IEWA 2JS7A 3SXJA 2J6IA 5LM3A 2G6BA 2WSSA 3BM5A 3D2AA 3P8ZA 1Z0UA 1ZXLA 5JQGA 4JI2B 2BTOA 4UUBA 2GH1A 2R6JA 3TJMA 1CUXA 1SL1A 3SNHA 2AW3A 1DE0A 3OOSA 3T9EA 2X8WA 1F8XA 4UB6U 1T2UA 3C0KA 2FWMX 4WNAB 4DBLC 3JQEA 1ZGZA 1J8YF 2X13A 2ODBA 1Z4OA 2PL5A 1PNVA 1Z0FA 3CVUA 3NRWA 4B3MB 2RHFA 2DUUA 2RDIA 3U3OA 4OH7A 3C48A 1KI7A 2VIXA 1TJNA 4Q16A 4N18A 3PPVA 3VR5A 1TXGA 1MOSA 3G6KA 2YIJA 1YASA 3USCS 4KTVE 3T7TA 3WMXA 2XNJA 2VA8A 3AM4A 4DOMA 3ZHUA 3V6LA 5AKEA 3B20A 5A4IS 2Z2YA 4JUIA 1IHXA 4XPZA 1U11A 3BE8A 3E22B 3M49A 3PHIA 1OD6A 3RF9A 1T2NA 4ZDJA 4MP3A 4BJ3A 2O3TA 1S2MA 1NBOA 4NZZA 1U0LA 4JQSA 4JWMA 3UMFA 3ZV7A 2EFYA 4DSAA 5EZYB 4U2CA 2CJXA 2CJFA 1B4FA 4MKRA 4HRAA 1ID8A 2FSVC 3EPLA 2OHFA 4PHAA 3H83A 1Z15A 3NGMA 2XQJA 4QM7A 5BMVA 2WM2A 4WKOA 1P5FA 4E31A 4RQBA 3S40A 4EGJA 5CA1A 4IILA 1MLDA 4MQ5A 1CWUA 2V6MA 3AOGA 2E55A 1XL0A 3AUXA 1I0IA 4S1PA 3UAOA 3I1IA 1U8FO 3MHPA 2DAPA 3SEFA 2O3QA 5JNLA 1CE8B 3OIGA 1RADA 6REQB 2XDWA 2MSKA 1N2CA 5D87A 2GESA 2CMGA 4L72A 4P0PB 5I9BA 2C2YA 4M38A 1T6BY 2Z2XA 2ST1A 3U7RA 4IMRA 1ZMRA 2ZSEA 3FZNA 3BSWA 1V4VA 5DM60 1Q0HA 4IOJA 2GOYA 1V38A 4LYDA 1IAQA 2E4UA 3OD1A 2RGAA 1SG0A 4KMRA 4HDRA 1X1AA 1G98A 3MN1A 4O0MA 4XM2A 2X9GA 1V43A 5H82A 2E1PA 3H0LB 1CV2A 2EW2A 4YMUA 3LDFA 3FAKA 1UADA 2GBLA 4Q9HA 3WGOA 1SK9A 1YIAA 1FUYB 2C99A 4BLUA 1U8AA 4YT4A 4HWTA 1S3IA 1WOYA 3BK7A 1KRWA 3LGXA 4YQFA 2Z8XA 3CCFA 1MO6A 3CF4G 1T8EA 7ICVA 2AI2A 2PN1A 2GK6A 1GPYA 3BXFA 4Q3EA 5LQKA 4QSHA 1Y82A 4LWQA 1RJ9B 1W44A 3KSUA 2A8YA 5JG7A 1DC3A 3UICA 2XY5A 1YMVA 2YV3A 3W78A 4BTVA 3LOUA 3C6QA 3TPZA 3GCGA 3OT1B 4TS3A 4ZIRA 4Q4LA 1SVKA 4HNVA 4EENA 3CG4A 1UFKA 3GG2A 3N87A 2J46A 1G3MA 2H1VA 3DEYX 4QTTB 1N9GB 1Z07A 2C7GA 2F67A 2ES4A 1UJBA 2PT5A 5ALKA 3X43A 4KVAA 5KAFU 1ZHOA 2C3MA 4GC5A 3HM9A 5ALOA 3BQ0A 4Q4AB 4NYIQ 5HTKA 2JFFA 5E9WA 1SKQA 1IZ8A 2ONJA 2F4NA 5EJ7A 3H17A 2HSDA 3TB4A 2AC7A 4IRUB 1T4MA 2QYTA 2ICAA 2GN8A 1E7YA 1ZM7A 1EUDA 4CUJA 1BVHA 4P4LA 5CM8B 3NHJA 2VAWA 3L6UA 4NU0A 2VNSA 1TQ8A 1SCBA 2O8FB 1QYRA 5T8KA 3C3BA 5CA0F 2HWXA 4B34A 3JQ9C 4QTUB 3HR7A 1Z22A 4HLDA 1DL5A 3PC8C 3E9DA 1GDDA 2BSXA 3IA2A 2QSUA 2V6FA 3KKPA 2XT9A 2FPPA 4LGVA 3PUJA 3V1UA 2OV3A 5JCJD 3V33A 1P60A 1Q7CA 2UZ4A 4WA7A 1SHLA 1N6RA 4L08A 1JQEA 2ZYUX 1K0UA 5AVYA 4BP9A 3S7TA 2X0FA 3OHSX 3VR4D 3LVFO 5JRDS 3FPBA 1R15A 3AUYA 1ORDA 4GW3A 3ONWA 5CCXA 3PCXA 2PGAA 3TLGB 3SFTA 3MWKA 1FYFA 4XSHA 4JJFA 1NW4A 1WE2A 2A5JA 5FADA 1MA7A 2IHYA 3JVVA 1JSLA 1EDEA 4FYXA 1Z3IX 2QVGA 4GXNA 3KVOA 3EXHB 5JR3A 4B3BA 1QC5B 3DSRA 4JI8B 1NZDA 1Z4JA 5IF3A 3DE6X 2OSBA 1NJSA 1Z2OX 3PRKE 4NV1A 3TQFA 3DBHA 3QKSB 2JEFA 1FDUA 1RAHA 1IN1A 3AI7A 3R7SA 4YAEA 4DDUA 1JQDA 2QMOA 3THSA 2RHHA 4AZ0B 1DGQA 3KAPA 2J7PD 4KWIA 3LGAA 1Q22A 1AKVA 3JAKA 4KXUA 4IOKA 4E32A 3WSVA 5DDMA 3LGSA 2KZ3A 1K5PA 2C7VA 4KO4S 1GG8A 3HSSA 2JPDA 2FMQA 1LTQA 3VR3A 5AD1A 3L93A 4KV9A 4XH9B 2CVFA 1RIFA 4YLYA 3UC9A 3NC0C 2FF5A 2DSTA 1XTUA 1I4OA 3TW8B 4GP9A 2HBJA 3I9V1 1BC5A 4IXDA 1Z7EA 2BF4A 2YCBA 2P9EA 1Z0SA 2FWJA 3ED5A 3W3AA 1T9CA 2BEUB 1XYVA 4L57A 3OAAD 3IUQA 3EW7A 3KP1A 3L8FA 2KHVA 2BCSA 1JKXA 3P7MA 3IJEB 4HAYA 3OCCA 1MQ3A 3OTGA 2JEIA 2ZRAA 5IC5A 4EB8A 3LI2A 1U2QA 4KX3A 3ISTA 2P75A 1NASA 4PCVA 3QEMA 1SVOA 3EZ9A 4K6FA 2WYUA 4WQMA 2O14A 1E94E 1SG6A 4AQDA 5FWAA 2Z8YM 3FW1A 4YCBA 3H2GA 1Q7GA 1IXZA 2BCEA 5EWJB 1PJ2A 4UHKA 2JFNA 2OV2A 3ETGA 4MARA 1HNWB 1EJ6A 3SU8A 1JIQA 4R2HA 1PD0A 3K6RA 4FOOA 1S2IA 3IHQB 4S0ZA 3A0UA 3U61B 2O8DB 4HWPA 3EVTA 3QLUA 3A6PC 3KTAA 2XMDA 4TKVA 4G65A 3ZHOA 2FZEA 4KLQA 3BQ9A 1KETA 3KR1A 1GZ7A 4D9EA 1J8VA 3NP7A 1SPBS 2VYNA 8ICQA 1C4KA 3JQQA 4LHYA 4UPEA 1Y5IA 3MERA 2D2IA 1Q0UA 2NV2B 1ISFA 1VG1A 1T8SA 1CUZA 4CM9A 2YN4A 5YASA 5AMXA 1D2NA 1S2NA 5J2UA 1KS9A 5K8VA 5AW8A 2KD1A 4UM9D 2P9FA 3QVJA 1PVDA 3SQWA 1VBFA 4B79A 3OZCA 4KQHA 3QPWA 1AGNA 3K3PA 4TLAA 5JQWA 3NBXX 5G5GA 4NULA 1XLTC 2VAMA 1QG6A 3CR3C 4IGAA 4FEEA 9ICBA 1SD2A 3PXAA 3IMEA 4OHZA 3IYLW 3LC0A 3EXEA 3WK6A 3JPRA 1ACLA 4LA4A 4EUNA 4C88A 4QQRA 3NWEA 4ZOLA 4B3SB 2JFQA 5KWVA 1M7GA 3QV2A 4ZHQA 1Z12A 2QNBA 2E21A 3RRYA 3D3WA 5G0SA 3GEIA 1P7CA 3R8CA 1JEYA 5TT0A 2BGKA 2PGNA 1AS3A 4JWTA 2XBLA 2A0YA 1BJKA 2GA9A 3DCIA 1EUZA 3SI8A 2X0JA 4HAWA 1RI1A 2IS6A 4HVAA 1EGAA 3CMCO 1IUPA 3H65A 2OZPA 2P5UA 3M6ZA 1CZKA 3NKLA 4MKXA 4MMXB 1H8HD 1LPOA 3N5KA 2F8LA 4R81A 4TV8A 4YCJA 1JJBA 2PRYA 5DXAA 5DTJA 1IATA 3PQ5A 2XWBF 3P26A 3CPJB 2Z09A 4RTNA 2JLYA 3ZQJA 4B81A 1Z8FA 4BFZA 1IPEA 3PQ6A 1YA4A 4G0ZA 3QA9A 3GW8A 3PC4A 4MVJG 5JY1A 3U26A 2FHSA 3CX7A 5HZKA 2VPXA 2WHPB 4B31A 1ZD4A 5A06A 3V1KA 5AFSA 2FSGA 1DV2A 1IIRA 4EY4A 2PMCA 2A2ZA 5HUHA 1A9XA 3UQZA 3HN2A 4B76A 4Z6DA 1GG9A 1JMVA 3RSSA 3S1SA 2QAGA 1ZVQA 4KXLA 1NKBA 3EG5A 3I64A 1L4KA 1J2JA 3GP5A 4EKEA 1XXHB 4G2NA 2IYRA 1YC5A 2VR1A 1JDBC 3GCZA 3I3OA 1WBBA 5EQDA 1PVOA 1UEIA 3PI6A 1H3NA 3MTIA 4NLLA 2HSGA 3CISA 1KIAA 4FHEA 3TF5A 3RLFA 3JZDA 4A8EA 5ALRA 3W4IA 3CNBA 4J7XA 4PSDA 3FZYA 3OHMA 1P1IA 1WU8A 5AKZA 2PSSA 4HX2A 1PR3A 1V37A 5F7OA 3ZWBA 1XRSB 3TBHA 2FW9A 4QIWF 4JV5B 1LQTA 1PVQA 5JRZA 3K6JA 1HWYA 4NV0A 1WOMA 3AWDA 1TF2A 3FRIA 8ICMA 1I5RA 1CNFA 4V1CB 4DPMA 5HM8A 4HEHA 3LPAA 1KMHB 1F2UA 4V3CA 1P3DA 2GX6A 1MORA 3OCYA 2G9VA 3MMNA 3M2TA 1NRWA 3GJSA 4X1IA 3K05A 4KXVA 1SHJA 1U1GA 4GU5A 2YV5A 2BH9A 4E1AA 2QARB 2NPFA 4FN5A 4MI9A 5T5QA 5F35A 3V2HA 1Z25A 1C4OA 1S2OA 8ICGA 4DLRA 1G6KA 2O52A 2WKQA 4PYKA 2GAJA 3MGBA 3UPQA 1F60A 4PEVA 1XS9D 3JVUA 2WW8A 2WJZB 1XJ5A 2JZNA 3JPYA 4PNZA 5EUMA 1XMQB 4KGDA 4FYMA 4H35A 1FTGA 5KJFA 4YFYA 1WLYA 4K1XA 3H5AA 1I7NA 4PZEA 3LYHA 3PK0A 3JD0A 3WIVA 1NXXA 5F9HA 3OKPA 4E5NA 2DZDA 1EGVB 4WOBA 2ACVA 2MA1A 5ARBA 1WHSA 4IHKA 9ICEA 4H6WA 2EAMA 4AAYA 2LKYA 3H1BA 2QY6A 2IBTA 2C3PA 3S29A 4R1QA 1M1XB 1JR6A 3J81k 3E9QA 3L0DA 2JFGA 3SR6A 3VOBA 3VOSA 1AGYA 4F5WA 3IXQA 4GKAA 3IVAA 4IQFA 3T5PA 1G64A 1K7YA 3BIJA 4NFHA 1P2TA 3OIDA 3K96A 4Q4HA 3VR4H 1O4WA 5KNBA 1YVRA 2KV2A 1Y42X 3GARA 1TLFA 3F2VA 5KHOC 1T7PA 1XF9A 5DYWA 4X20A 1RWNA 3MCVA 4K6CA 1L4HA 1V9PA 2PRJA 3PB3A 3NBZC 3D6TB 5J9FA 1HRKA 3PA8A 1S1CA 1P2VA 3KJHA 3N39C 4TM7A 1IE3A 3TUIC 2WJ4A 4US9A 2X4IA 3A1TA 1IXYA 4WLOA 4CG2A 3R77A 4Z54A 5J0UA 1ENYA 2EIXA 3LS2A 3WKDA 5HMMA 9ICLA 1SKYE 3CLRC 1K7SN 1FDVA 4D7AA 1S97A 4RD4A 3VPHA 3HZZA 2JG3A 1DRWA 1R6VA 3NAGA 3KSRA 2ZSBA 121PA 1YRAA 4ZEXA 5CJ7A 2PVPA 5CU7A 1ULAA 2L18A 1G8FA 1GRNA 5KJ6A 2QG4A 1QHEA 1JU3A 3FUVA 4D9CA 2F6RA 3UW1A 3UYLA 3QXSA 2D3WA 2OM2A 1MTZA 5DI9A 5DGCA 4GQBA 2ZBFA 2YVUA 2Z4RA 3SYTA 3TD6A 1WW2A 3VDQA 1BMDA 3KQQA 5HXAA 2RHRA 1PT5A 1EDOA 2H5IA 1I3LA 4D0SA 8ICUA 3DFKA 3EPHA 4XE5A 3H3FA 3G0OA 4MHVA 3JQGB 3L9WA 4OQEA 4URWR 1QO9A 4QKQA 5A71A 1RAEA 1M1YA 4KGXA 1T24A 4RQ3A 3WA7A 1N8TA 3DXZA 4R41A 4C14A 5LYJB 3V55A 5IUJC 2G5HB 3C3KA 2G71A 1QS0B 3NWJA 5HS6A 1NYLA 4OKSA 4DF4A 4TGLA 1BPDA 2EFDB 2YWDA 4PAWA 1EK0A 4ZYWA 1N56A 4KNWA 4DSZA 2PX8A 4MQFA 5AW4A 3L7BA 1W4RA 5CEFA 5DHQA 4Q6WA 3KQVA 1TQ2A 1X7YB 3UXOA 1DBQA 3G8BA 4HNAA 4OJMX 5FBLB 3EIUA 3PDIB 1PS0A 3B7WA 3K9QO 4J4BA 1TTHA 3Q8LA 1FU8A 4EFMA 3CLSD 3ZU4A 1I13A 3ANXA 5DWQA 3GFRA 4TTJA 1J90A 4QEZA 4CMHA 1OAOA 3KJEA 3EIWA 1VG8A 3SAHA 3WZ2A 1SKAA 4UD2A 2C58A 3OHPA 1J5XA 4BIMA 4C8MA 3LDGA 3D59A 5L4NA 3VPCA 4M6WA 1KI1A 2UZ0A 2Z8YA 2J7PA 3NLLA 1BE1A 2VO1A 2V65A 4NXZA 1YL5A 2F17A 3HY4A 1V9CA 5DX0A 1OBFO 3P1JA 4CE6A 2DWPA 1Y9AA 4OBWA 1L7BA 2ZWMA 2IUEA 3OQHA 4TXNA 1ICIA 1PE0A 1ZIPA 2W2VA 1I9CA 1WVMA 3QHPA 3BL6A 4IF4A 7ICPA 1JG2A 3RR2A 4TLLB 2FGJA 2ODQA 2OC4A 1XZHA 2OKCA 1MENA 4LHXA 1P5HA 1D8YA 4YMIA 4JLBA 3E4CA 4AZTA 5F9NA 2FOXA 4YRLA 5A1TA 1CIJA 3OJWA 3OAAA 3KDPA 5LQMA 4PHCA 3RG8A 5AW1A 4ZQCB 4P34A 3ZNNA 4LKOA 1P2BA 3GJ4A 4EYHB 1QHHB 1UK9A 3ZX5A 4H7EA 2NUPB 4PCAA 1S8NA 1IZ9A 1N0IA 4TVOA 4DYHA 3VGPA 4M9HA 3ZDRA 2A1IA 3HXKA 1W93A 2HGSA 4PO8A 1QFXA 3HB5X 2Y4NA 2AL7A 1E99A 4F38A 3RS8A 1MH1A 1H1TA 4TUYF 4EL0A 3RB3A 4D4IA 3ORQA 5HIIA 1T3TA 1OAAA 3KZVA 2GEBA 2IV3A 2ZJ5A 4GQAA 1SWWA 4OREX 3H9CA 4HPXB 1NUUA 4XKJA 1E6LA 2BQUA 2J08A 4TMKA 2HEIA 2IW1A 5FL3A 3T7CA 1A96A 2Q2OA 3AR8A 3UOAB 1Y8ZA 4M7WA 2FP4A 1ONNA 2YXNA 4MEBA 2UYQA 1NLFA 9ICTA 4MF2A 4EG0A 2YQ4A 4IEEA 8ICIA 1RQGA 3EVNA 4TV9F 5FBQB 1IY1A 1ZH2A 3T1TA 1QMGA 3L4PA 2PJRA 3QKWA 1W6RA 4PTYA 1JILA 1FY2A 1SC3A 1PR2A 2YQZA 1RRKA 3TRFA 1YQ9A 4YAOA 3CVJA 4Y2PA 1DHRA 1LZKA 1AQJA 4DE5A 4UE3S 2QUIA 1MTOA 4QYMA 3PW4A 4UHDA 1Z2PX 1BE8A 5CTAA 4TMZA 3GFOA 3V1YA 4GXIA 1SH7A 2DKZA 2I1QA 5PGMA 4IQGA 4MR7A 1RYMA 2W7TA 3ENZA 2B1RA 1E6KA 1FS5A 4LYGA 1I1NA 4HRYA 4WY5A 2EARA 3A4LA 4RO0A 1HR0B 4TXMA 1JVNA 1Q3VA 1YC2A 4F5OA 3EH1A 5BPCA 5DHUA 3PHHA 3D6UA 3S1AB 2FZ4A 2VT3A 3ZD7A 1NR5A 4KXXA 2D7DA 1S8OA 3AFIA 4HG2A 2QSYA 3FCEA 1CBUA 1N5IA 5I47A 4Z51A 1BJRE 2ZJFA 1SU7A 2LXNA 3CP8A 1XLUA 4RFLA 5G1PA 4EIWA 2H51A 4UQLA 4NABA 5DJ5A 3OESA 1H8HA 3KD2A 3Q7EA 2PUJA 2VTKA 1FNCA 4BFCA 3TQOA 4JLOA 3JTEA 4ZI5A 3GUZA 2G06A 1DVRA 4EYGA 3WHKA 3TQQA 4KTTE 2VCHA 7ICJA 3EBPA 3JAWA 2F1OA 3EJWA 3BFVA 1GG2A 2ZBDA 1DO8A 3CPEA 4FCWA 3V8VA 1CS0A 4HMOA 2FWAA 1IOWA 1ZYUA 3LX4A 1HLDA 1NLZA 3RRGA 1RM4A 3AKCA 4DL3A 1OZFA 1V0JA 1MAWA 4IQVA 2RHLA 3TW4A 3JYNA 2ONYA 3JWEA 1QB8A 3FWZA 2RGRA 1UKBA 3WICA 4DV6B 4PAGA 1QNLA 3ALRA 3ZU6A 3G8CA 2VJNA 2AZ4A 4X95A 1W5AA 2H3HA 3C8DA 1VLMA 1N2OA 3ZKWB 3CINA 1EKXA 4DNOA 4FDUA 3MMXA 3T7IA 1YZQA 1O1YA 1NF2A 3KWFA 2X3YA 2UZ3A 8ICLA 3A1FA 2DC1A 4HUQA 2P0AA 2NYVA 2ONCA 3QJYA 5L3QA 4DF8A 1MXHA 3E9MA 6AT1A 2EKDA 3R3JA 3MOGA 2IUUA 1L9KA 2QTWB 4I4IA 4YALA 1TLTA 3EUWA 1L5VA 5AW2A 2V6GA 1ACMA 2J85A 3F5MA 1TJ4A 2JH8A 4RYLA 3VBCA 2OD7A 2OB1A 2A9PA 3T7JA 2P6OA 3KR0A 4XQ8A 3RS3A 3RFFA 3JPTA 2W70A 3M5CA 4M0UA 3GDOA 1UC4B 1XELA 3QZUA 4JHXA 3AR4A 3DG9A 2I4NA 1WMSA 3N0TA 1GUAA 3IT1A 2A67A 1JG7A 4WJKB 3IV7A 5C32A 4EHFA 2CL7X 3D5EA 3M5PA 1FRZA 3RJMA 3QWHA 4PANA 4FIZA 1PT8A 2WVGA 1QZXA 3KUDA 1P1FA 4UOZA 1MRZA 5JJ5A 3OE1A 4MVJM 5CDTA 3K70B 1GGEA 3GLFA 2A9JA 1JDPA 1QIEA 1H4TA 2CNDA 2YXPX 5DYNA 4DTIA 1A77A 4D44A 3CRNA 3R7NA 1M34E 4BCDA 1I4EB 1KBOA 3OJCA 3ORYA 3W8FA 5HE8A 2GJ9A 2VDWA 3DUFB 2R87A 4LECA 3PHBE 4EPVA 4AF8A 1E5LA 2VNHA 2G72A 1LKZA 5ILGA 4UMDA 4MUYA 5EJEA 4A6EA 3D8UA 2WDZA 4LJ4A 1U1CA 3WO1A 5KMGB 1CDDA 1JXOA 5ALSA 1YE5A 3CXRA 3L0ZA 4OJYA 4FWBA 4WESB 2YZNA 4Z7NB 3CKMA 3BOSA 4OLBA 2E48A 1KPGA 3X1ZA 3FNGA 3M9WA 3OQJA 4JJ7A 3F2BA 3JD1A 5IP5A 4HT3B 1Y3FE 4HNHA 1YS1X 3IVGA 1T6ZA 1LRLA 3V7KA 2V8OA 4YONB 4WN9B 1ZOOA 3AGPA 1APBA 5EWMB 3YASA 1TM4E 1G55A 1SVWA 5GM1A 1KL7A 2XA1A 5KYKA 1UPAA 4MWZA 5BYJA 2R96A 1RACA 2EHJA 5KS2A 3CRRA 4BVAA 1ESZA 4ED8A 5DP2A 4JQZA 4OUDA 2EZYA 1SWVA 2RHJA 4LYFA 3I1FA 5KFEA 3HLYA 3A58B 5CVCA 1M54A 3S2GA 3N4MB 4IH9A 4HH3C 1A4IA 2FXVA 1LTHR 1CS4C 2QL5A 4ADSG 4A5SA 1YV9A 4Z0HO 1DGJA 2ZPTX 4YT5A 1ZQDA 3DGEC 3OT4A 2I6SA 1VL0A 5A4JA 3LC1O 1PKEA 4P83A 2JEJA 1IBLB 3GRFA 3L82B 4JQOA 1IXRC 4I2FA 5K3FA 3IKLA 2EF1A 3DL7A 4YGYA 3KKAC 4YB8A 3ZHSA 4MP8A 4DMLA 1JKIA 3CONA 3F96A 3W2FA 2W3SA 3NCHA 1XCMA 3AF0A 5K4LA 2G07A 3EVDA 1B6TA 4O5OA 3UJNA 3IE1A 2YKGA 3SXUB 4DQQA 4Y3UA 5EIEA 4W9NC 5KX5A 2PY6A 3MT0A 5TEWA 3KT3A 2EJTA 1Q50A 4PICA 4M8IA 3R3UA 3IQZA 3OP1A 5K7SA 3UC5A 3T54A 4CKCB 2WTUA 2XCAA 5EP1A 4G1BA 1U3WA 3MF4A 3W9BA 2ORIA 5A3VA 3CF4A 2HO5A 3LQYA 2A4KA 2XR1A 3A31A 1GKUB 1RWVA 5DCUA 1XNHA 3MK31 3IUYA 4DV0B 1U8YA 1R6AA 3SIWA 5IIKA 1F7UA 4RD1A 1MO2A 1NE2A 4HWOA 4ZU6X 4KAXA 3WFZA 3O93A 1FVXA 4O02B 5A4MS 5F98A 2KX7A 1UM8A 1ZL0A 1UBMS 2ZIAA 1KPIA 3NJRA 1UKCA 4JFRA 5JSKA 4QZGA 7ICTA 3ZWMA 4WZAE 4MCJA 3U44A 4UTOA 1J9GA 2IELA 3KHSA 5J0PA 4ZDKA 4DL9A 1CIVA 2A9VA 3DNPA 3AK4A 4JN6B 5JAHA 1LC0A 3E8XA 3LA8A 5JS8A 4G86A 2FVXA 2YIVX 2C04A 1U94A 2ORED 4V0OA 5F1KA 1SA0B 2OO3A 1B42A 1NNSA 2ENUA 2G1UA 3GLGE 1T36B 2FEAA 5G2OA 1FFHA 5D7BA 3Q7TA 1U80A 3M70A 4U6QA 2IYPA 5CG2A 4EGQA 2Y67A 1UQRA 2FG7C 3D4OA 5KJ1A 5IJ9B 8ICHA 2XJ4A 1V8ZA 2D1FA 4GDMA 3BA1A 3AEYA 4GD3Q 1RLJA 3R0XA 2GOLA 5KTPA 3VSDA 1LK5A 4A8TA 2ZVQX 1NLMA 3HYSA 5KQMA 2IP4A 1Y1LA 1TK9A 5JSZA 1Z0IA 5DV9A 1JXEA 2R68A 2AR0A 4Y1RA 1T4CA 1X7WA 4QEDA 1UAAA 1VDMA 2YC2C 3OQPA 2PEZA 4QREA 3A14A 1RLUA 2OXRA 1YI0A 8ICSA 3U4GA 3N7TA 3EZ7A 2AXEA 4EGFA 3DMYA 5E4YA 4LFCB 3FVRA 3U4CA 2FWNA 2X9NA 4X1YB 3IRVA 4BFUA 4BNHA 5JVDB 3OQNA 4EUEA 2AQKA 4QYSA 2FSIA 2HOQA 2IS1A 3G9UA 3QPUA 4YRIA 5GTHU 1I7LA 4W6QA 3DAPA 3Q5GA 3O1JC 2H3FA 1D0SA 2AUMA 3QVMA 4C4XA 1RFGE 1CR2A 4FM9A 2G1JA 4Y30A 2GEVA 1MX3A 3GUYA 4PRLA 2B4TO 4R16A 2JJ1D 5JNRA 5DBFA 2PQ6A 5HF6A 3A11A 3TD2A 2R8ZA 1ZQPA 3S44A 4RZ3A 2BFFB 4TWRA 2GM3A 1L5LA 1I6WA 4QU0A 5LLSA 1JJIA 3FH0A 4X64B 2PRKA 1JV2B 2BYTA 1TQ6A 4UBLA 1NU6A 1GAXA 2RAFA 5IBQA 1SXDA 3JSXA 4C5CA 3I5UA 1N5WA 1RSZA 4P5PA 3FMPB 1ZQVA 3UHJA 4AU1A 5CK4A 3H87A 1USGA 4O3MA 3K0CC 3EW9A 1M1NB 1FFDA 1BMQA 2Y1EA 5EKTA 1O9HA 4A0SA 3AIIA 4FYYA 1DXSA 2YWHA 3U3MA 1A50B 5KUTA 1H94A 3R2JA 2V7UA 2B6HA 1N92A 3UTCA 4EZ6A 1QWOA 3A32A 2YB1A 4YJ2B 1WZNA 2W8BB 4H08A 3CO5A 3FOCA 2IU3A 4DNFA 1TA0A 4Q4CA 3AEQA 4A2PA 2DT5A 5C5DA 3K0FB 4AMGA 2DQ4A 1WXHA 1UF9A 2OXTA 4PNPA 4MV8A 1VHLA 2Y1FA 4YV0A 2C88A 4EA9A 5GIPE 3RRBA 4F5YA 4G1UC 3I2HA 3SFVA 4ZTBA 1P0QA 1N2JA 2YYAA 3Q0TA 4UASA 3LLSA 1D2HA 1G20E 1BROA 2BF7A 5I01A 2JXJA 2Y9TA 1SXJE 4PN7A 3VQTA 4MWBA 1E98A 2DWOA 2VAPA 3CRQA 3KETA 3BXXA 3KUXA 2YXLA 4MUBA 1KOLA 1U5BA 2VZ8A 2R5NA 5HQ3A 1H6CA 2A4MA 5K3DA 3KALA 1I3MA 3REQB 2AOVA 2BSAA 5JXWA 4GZLA 2HHLA 4MWSA 4I4TB 3DWFA 4ARIA 4CMBA 4DQIA 2JH3A 4ZJZA 4QUEA 4NI5A 3JYLA 4R1NA 3FR8A 1KL9A 4ANFA 1V96A 2IBMA 4H16A 3WGKA 1RQNA 1ZQEA 3N59A 3GGGA 1YJCA 5HIAA 1X38A 5JUWA 3NGDA 2XGGA 5AHRA 3UHFA 1QCZA 1IFXA 3PNYA 2I76A 1YDMA 4NWIA 3JARA 3Q41A 3UO8B 3FMGA 5GTIU 4D3FA 3NVVA 4S2UA 4LXIA 3FVVA 4DSNA 1KF0A 1Z3EB 3C74A 2HY7A 3TOCA 5WRFA 2IP2A 8ICAA 5EE1A 3RIGA 1HT0A 1IM5A 2UV8A 1ML3A 2BKUA 3D7SA 3D3KA 2H0QA 3HC7A 1CT9A 1F2TB 3NIDB 3BTVA 4R5HA 2O59A 4R40A 2JLCA 3IUMA 1LX6A 1RPNA 4DDKA 1ZBDA 5EINA 2W7PA 4BIIA 2CMHA 1YB4A 4MWGA 5FEUA 3HX0A 1KAEA 2QXTA 5CFZA 2JVJA 4EZBA 1NPTO 4NYIR 5A5EA 1UMBB 3S68A 4NBKA 4CDRA 1X7HA 4YJDA 3Q2KA 2XCSB 4PPYA 1DIRA 3P9IA 2I34A 2NZWA 1L5FA 5CG1A 1CRPA 4EF5A 5HE9A 3JPSA 3CJQA 2X42A 4RLHA 2QUHA 5AHKA 3ID6C 2PLRA 1PIWA 1SD1A 1N7JA 3DEAA 4O2BA 1KO1A 4L7QA 4Q00A 2HJGA 4G5YA 2JAQA 2SCUA 2EW1A 4CTNA 3O8BA 3KB1A 1U48A 3BWXA 4C7MA 4NZ9A 3THRA 4D9HA 2E4WA 1N5RA 3VSAA 3CW2A 4MVJA 2VJMB 4K4GA 4NYJR 5BW5A 4RHYA 2AMLA 2D5AA 3T41A 3TL3A 1P8AA 5ERXA 1XALA 2D8MA 1KDRA 4NJ8A 3HVRA 2G40A 4WCFC 2BL4A 5IZCC 2GTIA 1BOOA 2WUWE 3EHEA 2I9KA 1ZRHA 1D2MA 4D42A 3IUNA 1U28C 5KYYB 1M2EA 4DR3B 3VVMA 3U4DA 3RHTA 3GH1A 5TPWA 4Z1MD 4BVKA 4BC1A 1MPXA 1C4XA 1WL8A 1P73A 1FFXB 4WBNB 3DOCA 3U3XA 4ZGBA 1AOXA 2IEIA 3WRWA 2NSHA 1MB0A 2OV8A 1Y4ZA 1R6DA 3G5MA 5ALPA 1IULA 1IDOA 4QGAA 4PXSA 2CF6A 2BN4A 1KRPA 2CNNA 1S9FA 1MMFB 2OKGA 4PLWA 3RFXA 3MWLA 1HGXA 1EIWA 3MZ0A 4MV4A 1Z0DA 4JI4B 2GPJA 2P2DA 2AJQA 3EISA 3FOBA 1BIFA 4Z4EA 2D7CA 4ALIA 1XVVA 4KWEA 1NAHA 5T7BA 2X23A 1RCTE 5KNDH 4H0NA 2O2YA 5FO1A 1G6Q1 4PO3X 1UJ4A 2OCIA 3DMDA 1Z4PX 2ZI4A 3LWBA 2FUCA 3KJGA 3KT0A 3SX2A 2JLAA 5FWXB 4IMIB 3G88A 2P5YA 1FMTA 3QENA 1MJHA 2B2XA 2OXOA 4OHBA 5EHGA 3CEHA 4OP1A 1IUNA 3OPYA 4DEYA 1AHHA 4UHEA 2QRGA 2VA3A 4MYHA 4LDJA 4Z4CA 1PZGA 3DHEA 1P39A 1G6HA 4PTLA 1EM8B 5D49A 2AZTA 1GZHB 2GM5A 3V7JA 3TIGA 1E66A 2C1XA 2P30A 5C8YB 3WMRA 3MUNA 4Q3KA 2OTCA 2YZGA 3LPDA 1QPZA 1AQ6A 3A1WA 2FEOA 1JMSA 4NU8X 5EPUA 5BRNA 1JUDA 1KK0A 2P27A 4FKBA 3T5MA 1GA4A 2OCBA 4P3OA 1C7JA 2Z5LA 2UVUA 2BTQB 3NC1C 1K1QA 1P17A 2OAGA 3BQTA 3NNNA 2QPOA 4YJ3B 3HDYA 3IOEA 2ODEA 2VDNB 1II8A 2DFLA 3DUWA 3QGMA 1E89A 4BQNA 3SKYA 4N12A 4Y1GA 2WTMA 4HMQA 2HTFA 3ASYA 4IQ0A 1ZQUA 2P9BA 5KBYA 2HJSA 4IUCS 2H7CA 4BKMA 4G36A 5LQCA 4B3JA 3TE6A 3VRHA 1OZGA 1FSSA 2AKAB 4HVCA 1NK8A 2V4UA 4RGBA 3ASZA 4FXPA 3MSXA 1Y5RA 1G8SA 4I3FA 4RPXA 2QZ9A 1GZSA 4MS4B 4DREA 1JQKA 3HKCA 4L78A 3L77A 1JEQA 3ESQA 1OW5A 3WADA 3RJZA 4OYHA 3GIIA 4U7GA 3GVCA 5EKXA 1C0KA 3DHWC 2FOIA 2K4PA 4DV1B 5BPFA 4YBZA 4QBTA 4MRVA 1MVNA 4F71A 4KMOB 3NHKA 2ODGA 2QQ5A 3VTAA 3IP1A 1G2QA 3OZDA 1RXEA 4ZCSA 3ABOB 3FI0A 5CJPA 2ZR8A 2XECA 2XNSA 3Q8KA 2FFAA 1KDTA 3JQ8B 1C7IA 1QYIA 2OBFA 5ULLA 5DWVA 5IIIA 4YJHA 3KYDB 1K66A 1RXWA 4HXYA 4ALMA 3IIIA 1AK9A 2QW8A 3Q6IA 4XR9A 2R1ZA 1SAYA 4DNXA 2RBKA 3B1KA 2NRXA 4QZVA 5CIYA 5EYPA 2G0NA 3ZC3A 1CJTC 5CHYA 3TFWA 2A0KA 2VQDA 2QTLA 2R97A 2IXGA 1Z63A 4HQ0A 2O5VA 5C1PA 4DCCA 4JI6B 1P7YA 3FSGD 1NN1A 2BFEA 1IEQA 2HXGA 2JGRA 2HN9A 1N63A 3LK7A 4LC9A 1EK2A 4F4HA 2C1ZA 1BX3A 3FA2A 5D3QA 5AKJA 3CZAA 5BOSA 5JANA 2VUIB 2GYUA 1Z3CA 4PZLA 5BV2P 1BFDA 5I5EA 2AE1A 1B00A 3OJOA 1VMEA 3R5HA 3QHQA 1U2DA 3AB3A 1QOQB 2PS0A 3N6VA 3TJRA 1TAMA 4Z4HA 4I2NA 1V1JA 1OBOA 3SZRA 2F77X 1G2PA 5J0RA 4PHPA 4F4ZA 4ZVKA 1ZKDA 4DLSA 3HBMA 5I7EA 1KYYA 1RKBA 2VP9A 2C4TA 3KPWA 3Q1LA 3CNEA 4EW2A 3EVBA 1Q77A 2JIBA 4GHWA 1LSJA 4P4NA 4UHCA 3I6MA 4A1OA 4R0MA 2O0HA 3V8NA 5JD4A 1CZOA 2VSQA 4KRFA 1C9MA 4IG4A 1PG2A 3FN4A 4OKIA 1EX7A 1T5TA 1FW8A 3MWDB 4ALLA 1ZD8A 4KIUA 4CMAA 2PZAA 1FMLA 3RAXA 3SKVA 5KFRA 4GRAA 1GILA 1X40A 4ESEA 5CVUA 1N5XA 1GARA 2PZLA 1X80A 4CN9A 2NQ8A 4RM3A 4ND2A 3K6KA 4C9BA 2UDPA 1DT5A 5A0LA 3ZJ5A 4WFJA 3WA6A 1OE0A 2I6XA 4J9UE 4OAPA 3GEHA 1ZNWA 2JJ1A 1JEOA 2VP5A 4A0QA 1YJBA 3OPNA 3NVZA 1UC8A 5DISB 2ECQA 1WQ3A 5KG0A 6NULA 5F33A 1W0JD 4AS1A 3MGHA 4D57A 3KUCA 5KU1A 1CRZA 1XWWA 2SKCA 3ZWOA 4LZLA 3N75A 4EMUA 1CNMA 2A0FA 3WLEA 3S2YA 2RKBA 4ZQFA 3RYIB 1ORIA 1K2VN 4ZKDA 2E6UX 2WU1A 3LSTA 2F48A 1W1IA 4QWCA 5ESRA 1E4OA 2UAGA 1M7HA 1VSTA 4PXYA 1BRTA 1U7UA 2XUKA 2ZBRA 4G0WA 1B16A 2LTAA 3VA7A 2BFCA 3PX6A 4A73A 4WD3A 1J70A 4NFLA 4FYKA 4RTOA 4ZC1A 1IB0A 3H84A 3C8HA 5ADVA 2XWQA 1L1EA 1ZOIA 3D02A 3SIXA 3RW9A 1M6YA 3P2JA 5FBRB 3JWHA 4D02A 1HI9A 3OJLA 3TH5A 5DPMA 4B7CA 5E6RB 2R48A 9GPBA 1SKWA 2IY7A 3QXGA 1EFTA 1AN0A 2FFHA 2WHRA 1YD7A 4E12A 1EVIA 3JVEA 3HH8A 4PZAA 6GPBA 3TZKA 2W2PA 2H06A 4FFVA 2IH5A 4Y2HA 4DLPA 3LX8A 4FGUA 2D1QA 2GILA 1ADBA 2EL9A 3B0YA 2X2EA 1LV8A 2KSOA 2YZMA 2YMQA 2B4YA 1XPRA 3SZUA 2X41A 3SAJA 5ITZA 1EVYA 3FYUC 2DLDA 4OA8A 3TX2A 4BUJA 3V6KA 2YWXA 2R751 5ADWA 3QEOA 5L4LA 1XO0A 2NVUB 1BN6A 2F44A 2MTBA 4P2GA 2TSYB 1A9RA 1OI2A 2C9MA 3ZG6A 4C1NA 4CF7A 5TB5A 3K53A 3KWMA 2ZAGA 4Z2YA 4F4UA 4FT4A 1WQ1R 2X4DA 1Z26A 3OM8A 3PENA 5DLDA 4TPKA 3NT5A 2V8BA 2A1AA 3FBGA 4CV2A 4L3OA 4IYJA 3B89A