1LVHA

The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
220
Chain Sequence
MFKAVLFLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Caught in the act: the structure of phosphorylated beta-phosphoglucomutase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 75
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1lvhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1lvhA01
4BX2A 5AW1A 5T41A 3FPBA 2ZG6A 5ALNA 4Y3UA 2G06A 5AKIA 1RKQA 1EK1A 3E81A 3U7HB 2CFSA 2HSZA 1S8OA 1RPZA 4UMVA 5AM2A 4DCCA 3UMBA 5JJBA 5AKJA 5ALWA 3NIWA 3SF0A 3AR5A 1QQ5A 3SMVA 1SU4A 3DNPA 2YN4A 2D2VA 3AR7A 4UAUA 5AVQA 1CR6A 2AH5A 4KNWA 5ALZA 4DFDA 5AK6A 2ZBGA 1RMTA 3BA6A 4IG4A 4KX5A 3B9BA 3FPSA 5AW2A 3U7FB 3N8GA 3FZQA 2IOHA 4Y2YA 1Z4IA 2NO5A 3CNHA 4L6CA 1T5TA 2QLTA 3IJ5A 4EZEA 1F5SA 2R8XA 3ESQA 5AI9A 3OCZA 2YFYA 3L0YA 3EPRA 4XQ0A 1JUDA 5AVUA 4BKMA 4NFLA 2B8JA 5ALDA 1PW5A 2I34A 5AW0A 3EF0A 3U26A 1TJ5A 4NWIA 5AW4A 1WVIA 1ZRMA 4EEKA 3A1DA 1RQNA 1ZD3A 5AI0A 3HLTA 5ALGA 4RESA 3QGMA 1VJRA 1WPGA 2OM6A 3L8HA 2ZBFA 3MPOA 4YGYA 3OTQA 3SHQA 2WF8A 2QYHA 3EWIA 2MSNA 1Z5GA 2FI1A 4CF3A 5ALRA 2X4DA 4RETA 2IOFA 1J97A 3ZU6A 3IB6A 4GIBA 3L1VA 4XPZA 3F9RA 5AW9A 2P9JA 4Y2SA 1L7OA 4FYPA 4HGRA 4O8CA 1XPJA 3ZW7A 3U19A 5A3SA 1Q91A 4UU1A 2P69A 4YH1A 4Y2VA 3DDHA 4G9BA 3NRJA 4HAIA 2ZXEA 2G80A 3WK7A 3NASA 1RLTA 4EELA 2JARA 3R4CA 4UM7A 5AVTA 2C4NA 5AVVA 3S6JA 2RBKA 4OFZA 4XOUA 3L0CA 2YJ3A 2BY4A 4AP9A 2G07A 1SWVA 1Z4JA 2YMQA 1AQ6A 1RRCA 5A3QA 3PGLA 4ZEVA 4Y2UA 3QU4A 5ALOA 2FPXA 5AHXA 3QLEA 2NYVA 2ZOSA 3A1CA 1Z4OA 1RDFA 1L8OA 5AVWA 4Y2TA 5AW6A 4UM5A 3N28A 4UW9A 1QQ7A 5AIAA 1ZS9A 4EX6A 1QYIA 2W43A 2IA5A 1ZD4A 3OCYA 3ZX4A 2RARA 3L8EA 1ZD5A 4BX0A 2IYEA 1N9KA 2C8KA 3ZTWA 2OYCA 1RQLA 1Y8AA 3WKCA 4JB3A 3L5KA 1NF2A 2OBBA 5AVRA 3ZTYA 5AICA 2I6XA 5AI6A 5AKZA 2FEAA 5AKYA 4BYGA 2HDOA 5A3RA 3QU9A 4GXTA 3L8FA 1XVIA 1NNLA 2FPWA 1K1EA 1VJ5A 4KNVA 2ODAA 2FPSA 3VAYA 2BDUA 2R8ZA 3AR6A 4I9FA 2Q4TA 2ZBDA 2FUEA 2R8EA 3OCXA 3NAMA 3ONNA 2Q5EA 3AR9A 4MWOA 5ALQA 3ZUPA 4UASA 3ET4A 2B1QA 3WK6A 2I55A 3SLRA 2YJ4A 1CQZA 3UM9A 4E88A 3PCTA 4G63A 3U7GA 2NO4A 2VKQA 5ALIA 2FPRA 4YCMA 1O03A 4ZEXA 3QYPA 3A1EA 2O2XA 1T5SA 2YJ5A 3M1YA 5IS2A 1RKUA 5ALVA 5AI5A 5ALKA 4MUMA 4Y2JA 5AIBA 2G1AA 4QQFA 3I28A 4I9GA 2W11A 5ALXA 4F72A 5ALMA 4H1WA 2B8EA 1X42A 4F71A 2YMPA 3ED5A 4BNDA 3NUQA 5AM3A 2BDEA 3NANA 5AVYA 1L7PA 4NV0A 2GHTA 2JAOA 3N5KA 4XE5A 3UMCA 3QUQA 3WKEA 1Z4QA 4HGPA 2FUCA 1YDFA 4FE3A 2PKEA 5ALYA 2W4MA 3ZVMA 1MH9A 4BEVA 4CE6A 3MC1A 3KBBA 3GYGA 4L6AA 3ZWKA 3B9RA 3N07A 2MU1A 1IWOA 3AR2A 5AM4A 2HF2A 5AKGA 2JAWA 4HGNA 1Q92A 5AI4A 1L6RA 1KYTA 3L0BA 3OCUA 4C4RA 5FP0A 1ZD2P 5E0OA 3N1UA 3TLMA 5ALFA 5AM1A 1YMQA 1Z5UA 4CF5A 2P11A 3I76A 1Z88A 4DW8A 5AK5A 4C4SA 1QQ6A 2GMWA 4CF4A 5AVZA 1RKVA 3ESRA 2HI0A 3I1YA 3R09A 1TE2A 4B6JA 3U13A 4OCZA 1FEZA 4EENA 3CZ4A 2B82A 4L57A 3QU7A 5ALTA 5ALJA 1U2TA 2OA0A 1N8NA 2EAUA 3L8GA 3W5AA 5AM0A 2P27A 5AKXA 1YV9A 4EX7A 3QXGA 1YNSA 3KZXA 2G09A 3A3YA 4YIKA 3QUCA 2YJ6A 3AR4A 5AW7A 4FFDA 2CFTA 4OD0A 1RC8A 4NAVA 3OCWA 5ALUA 1LVHA 2FPUA 5AM5A 3E8MA 3J7TA 4ZEWA 3SD7A 1TJ4A 3E84A 4C4TA 1Z4LA 3QU2A 3EF1A 2RB5A 3SKXA 1O08A 3WK4A 1RLMA 2EATA 1L7NA 5AK4A 2HEGA 2FDRA 2GO7A 3FVVA 3WK5A 1U7PA 4BNDB 1Z4NA 5AW8A 3KOOA 2YBDA 1TJ3A 3KC2A 5AVSA 3WGUA 5AK3A 2R8YA 5IT0A 2PR7A 3WKDA 1L7MA 3W5DA 2HHLA 3R9KA 2WF9A 5ALPA 4HGQA 2G08A 3QNMA 3MN1A 1QH9A 3W5CA 2YMLA 5AKHA 3RFUA 4UU0A 3U7EB 4Y2QA 2AGVA 2MU2A 2IOFK 3WK9A 2WFAA 3I6BA 1SWWA 2B0CA 5AKKA 1U7OA 1VFPA 5ALLA 1YJ5A 3DV9A 3K1ZA 4KYTA 3ET5A 3OCVA 5ALEA 3UMGA 4UAVA 2I54A 2JAUA 4YIHA 2I7DA 3RF6A 2CN1A 1U02A 2AMYA 4J2TA 4AS2A 4PNHA 2PQ0A 2WF7A 3KD3A 5AI8A 3L1UA 4BX3A 2CFRA 4UATA 2YMMA 4KN8A 2GHQA 5IT4A 3L7YA 3ZVLA 2B30A 1U2SA 3QX7A 3ZI4A 4UMFA 2AUTA 4DWOA 4YCNA 2I33A 2WF6A 4HYTA 1RMQA 3WKBA 2C9MA 4UMEA 4JDPA 5AKLA 4Y2XA 3PGVA 3D6JA 2HOQA 3NALA 2EARA 3WKAA 3E58A 1Z4PX 5AVXA 3AR3A 4OHFA 2RAVA 3IRUA 1NRWA 3M9LA 3ZX5A 2HF7A 4UARA 5AKEA 1S2OA 2G0AA 1T9ZA 4QJBA 2HCFA 1J8DA 4Y2RA 3QUTA 3P96A 3WGVA 3DAOA 3BWVA 3AR8A 4UMDA 3QUBA 2GFHA 1L8LA 5ALHA 5AW3A 3B8EA 3SKYA 1YS9A 2WM8A 5ALSA 2C8LA 1TA0A 3HYCA 2WF5A 3PDWA 2YY6A 4BBJA 3OPXA 2DQSA 1EK2A 1XP5A 3KDPA 3ZVNA 5AESA 2C88A 2HO4A 1Z4KA 4IFTA 4AS3A 3FM9A 3ZWDA 3WK8A 1RMYA 2B1RA 1WZCA 1LTQA 2HX1A 4J03A 4YCLA 4NABA 1RLOA 1Z4MA 2O9JA 2Q4RA 2JGAA 1ZOLA 4HGOA 2ZBEA 1WR8A 1ZJJA 2WHEA 3W5BA 1ZRNA 3QU5A 4CNQA 4KX3A 4Y2PA 4BEWA 3FGOA 3MMZA 5AW5A
chains in the Genus database with same CATH superfamily
2BTOA 4KPFC 2XITA 3DZCA 5BMVF 1KEJA 4FS8A 1RYFA 2PU5A 2V97A 4B75A 3HVJA 4H7EA 5AKIA 4RIFA 4TLAA 2WKSA 5CFNA 2YV4A 5GVSA 3EYAA 3PC7A 2EEZA 3C5CA 5E4FA 2NNLD 3LP5A 4AY6A 3KX2A 1MBZA 4RW0A 4PVCA 1MO4A 4Y6PA 4N9WA 3V00A 2WKWA 3NIWA 1II0A 3ED1A 5JIBA 2F9MA 1Z37A 2CRXA 3AVQA 4WOBA 2ZYWX 3ZHQA 1L1RA 2REXB 1EVLA 4N5NA 4QZGA 1JJIA 1KEEB 1A9XB 4FXOA 2V9PA 1IH8A 4HYQA 4JJAA 5AJYA 1CR6A 3M3PA 4FMDF 4UCWA 2WHQA 2VRCA 1YDHA 4CQLA 4L16A 1SN7A 1BW9A 3DHWC 1ZIOA 2R48A 3RSSA 3G0OA 4IIHA 3FAHA 4LQCA 4OJTA 4F3TA 2OV4A 1I9GA 4QUJA 4MQFB 3VR3D 3N70A 4YT5A 2JFHA 5K01A 2FZ4A 1N6LA 2JFFA 2JFGA 2I3DA 5GV7A 3WBBA 2DXIA 3L0DA 4KDRA 4DC0A 2I66A 2W6ID 4LF9B 4LJRA 2AJBA 2O5VA 2HA4A 1NZPA 2I2DA 2XAAA 2XWQA 3GNTA 4H16A 1PJAA 3M89A 3TRIA 5HSGA 4B9TA 4UB3A 1JB1A 3AFOA 4UD6A 5FWYB 5IAEA 1IG6A 1PV2A 4URHA 1HA3A 1T9AA 3LPNA 1VE9A 1PUZA 3BK1A 2X5OA 4O3SA 1F5SA 1PFYA 2R8XA 2CCKA 4GPIB 3U3RA 5BMVB 3PXGA 1XCGB 4FQ7A 2QMOA 3ZHXA 3JATB 1GYPA 1Q0HA 1YRLA 5KYYA 1DC3A 1NXWA 3WIEA 3KQVA 4LHSA 3CLUD 3F2CA 2C0PA 5DBHX 3U4AA 3L93A 2LR0A 4P35A 3IHQB 3N7PD 1S2DA 2Q07A 2VXCA 3CEAA 4YAWA 5EMLA 5FR2A 2PKQP 2COEA 4DUYB 1VG1A 1YRBA 5GPBA 2OPHA 3D4NA 5JECA 1GNQA 3TMKA 4MVCA 2RQ5A 1O6BA 2QB0B 1C4OA 1UC9A 3R3YA 2WTFA 3L6DA 2GVZC 2KJ8A 1KBZA 4NY1A 4Q9JA 1O95A 3ZN2A 4EBBA 3IE0A 1YAHA 5A4IS 2WJWA 3CF4G 5KTPA 4CV2A 1B3BA 3D2LA 1T3NA 3TFQA 1WXDA 3J81A 4FS2A 3CFYA 4YGXB 3L6RA 1N48A 3M5PA 5IMSA 5HF5A 2PO7A 1P7CA 4AMGA 4PYJA 3CNNA 3UNXA 4CCAA 1OFTA 4WBNA 2QB0A 2A5YB 2WE8A 1FXWA 2YQ5A 1V4VA 5CT5A 3RRGA 4YAIA 4OVKA 1L7AA 3C7DB 1N2EA 2GZMA 1QORA 3F6BX 1K06A 1GSAA 4LI3X 4DLYA 7ICJA 1QFMA 1QWOA 2ODQA 3FYUA 1NF9A 4OHMA 3UEOA 5LJIA 1BQ3A 4RSGA 5DZSA 3WFZA 1S97A 3IEVA 1ISFA 1KYQA 1IZ9A 2ZB2A 1BXZA 4FT2A 1VJGA 1QZXA 1RXEA 2CUZA 2O8NA 4OLBA 4RKQA 3JALB 4LV6A 4Y1GA 4CQMA 1TO1E 2EZUA 4JMPA 1D2MA 1U7UA 4GRIA 4GNKA 1DC4A 2QW1A 1QB8A 3QNUA 1HT0A 1ZXLA 2FSUA 3FYHA 1NQ5A 2BFDA 2WW8A 4CMIB 5ESDA 4EJMA 2X42A 3I9OA 1JAIA 2X7XA 4G0MA 4CRWB 4YH1A 1SXEA 4LI0A 1N75A 5G53C 3IBSA 3JWEA 3X0DA 3SCZA 3TPCA 4NG5A 4JA0A 4JXZA 2Y0PA 3T0GA 4EVQA 4XCXA 1FUKA 4MULA 4ZQGA 1RS0A 3PSAA 4NHEA 1IOWA 4R05A 5EZYB 5A4AA 3CR8A 1PT7A 1XK6A 2AJCA 2VRBA 2WILA 1QDUA 2GBFA 3OE7D 1PR6A 5EZQA 3D0OA 4MFCA 1LDNA 1E3DA 2I7VA 2QSZA 2Q3HA 4KYIB 3S6JA 1BROA 2RBKA 3LTEA 3QLVC 4YLGA 2GJ8A 3KJFA 4RF4A 4I2IA 2QU8A 4QHYA 3OOHA 4R2WA 5DV9A 1T35A 5IJWA 2HHCA 1Y4AE 1EVEA 4B48A 3HJHA 3EPIA 1KFDA 3ILXA 2HGSA 3AGPA 2XTNA 5DTQA 4ND3A 4UC0A 2I6SA 1FSZA 3C8MA 1XPRA 5HHIA 5LMNB 1Z22A 4M1SA 5DTMA 2HW8A 1XZKA 4NEHB 3ZV5A 1FJGB 1YL6A 2LP4Y 1NK8A 3ECCA 2DSTA 1LPBB 3BWDD 3HXPA 4QASA 2W2XA 4YAFA 3OM0A 3G2JA 3F74A 1ZS9A 3P9XA 4H15A 3ZDQA 3QV1A 1ADJA 1TVKA 2X2EA 1ZOSA 3ELDA 4KTVE 1ST3A 1E1NA 4DT1A 5LD2C 1WUHS 4D3FA 3SQIA 5IDYA 4WJ3B 2IW3A 2W4IA 3ESBA 3IAAA 2C42A 5CB4A 1ZO8A 2JFYA 1QQBA 3O2NA 4J3JA 1TAQA 4ZQHA 4EYSA 3JTMA 4U7FA 3KKNA 5JC8A 2F48A 1NNEA 4B84A 2PK3A 2AWOA 3FWPA 4LX0A 3ELYA 1GZ3A 2HA7A 1JX4A 3M3HA 3HG7A 2G9NA 1HDRA 5HJ7A 4WOKA 2B3DA 2PLWA 4ZAFA 1F20A 2QUHA 4EKYA 5U9CA 1JRPA 4FZLA 2IPOA 4L2IB 2I22A 4I3GA 2XGGA 5E3JA 3B1KA 5KSPA 3RGGA 5KC8A 1AGXA 1OA1A 3LE8A 5HFAA 3P2IA 2PGNA 4HQKA 3E2IA 1BPDA 1N56A 3KZVA 2DY1A 5ADWA 2OV6A 3FOZA 3EGDA 4IR9A 1QHHA 4MMZB 2WV9A 3L4PA 3F7TA 4FFVA 3OCXA 3GI1A 4XFKA 4ZVUA 3WOVA 2A0FA 4XD7D 3EBPA 4JR0A 5G4KA 1OJLA 1OVMA 3TMYA 2A5JA 3UK2A 4F3NA 1T8EA 5DHAA 4ZCMA 4LDNA 5EMJA 1JDSA 2IUEA 2RE8A 4UASA 2B34A 3S40A 4ZN6A 3WK6A 1U0BB 2I55A 3WSTA 2Y4NA 5B7NA 4DRXA 5A03A 4TM8A 1VLQA 2G67A 5H3LA 3UT0A 5FOSA 3KHRA 2C77A 2X0JA 2H0AA 2ZRCA 3PK0A 5DXJA 5LNK6 1GNTA 4KN6A 2FPRA 4AXXA 4E2FA 3J7AC 2F3SA 1QYVA 4H1TA 4OM8A 2BFDB 1MN8A 1E32A 5IS2A 4C7BA 1C8LA 2KFZA 1M5TA 1Y3HA 3ETRA 5AIBA 1EVJA 2GAFA 3FB4A 2YIVX 4ND2A 2QDKA 4R51A 1L5HA 4RDXA 2C3MA 2V45A 3BCUA 4X84A 3DQQA 2WV7A 3QMPA 4UUPA 2PWBA 5A3SA 1BXGA 2J6IA 1CLEA 4H4EA 2E4UA 3SWWA 4DQSA 4EG4A 4DQKA 1L5NA 3ED5A 2XQVA 3EPGA 2NPIA 2YB4A 4J9PA 3CX6A 1N7HA 3D1VA 3NANA 3VZDA 4J90A 1E9EA 4DOCA 3RI3A 1ORTA 4FXPA 3GZTB 3PNPA 1KJYA 2DOKA 4YO7A 4Z3KA 4OK3A 2QNIA 3THXB 1EDZA 1SY7A 3T7SA 3VHXA 1KVSA 3K20A 4YQEA 3U60B 1SL1A 1C3EA 3OPYB 1CFJA 3PW4A 1SCUB 5KFUA 2QD5A 3IO5A 1ZQHA 3FWKA 1B8UA 3HRKA 4WZAB 3RKSA 3KWFA 3AF6A 1E9CA 4Q1BA 4QPCA 3KQLA 3ZE1B 2DC1A 2BZ1A 2W2LA 1M1UA 2XEDA 4RVSA 1PZNA 3GBPA 5B1YA 3QYJA 1YR2A 5GONF 2A1TR 5CK5A 3FI9A 3QW4B 3RSCA 1XTPA 3DCNA 5CCXA 3NVDA 4S24A 4RTLA 2C9DA 4QC2A 3SBDA 4EI8A 2NG1A 3ELWA 5F35A 4ZU3A 4AP6A 5LN1A 1XRMA 3P8ZA 1L6RA 1PFVA 2QZZA 9ICTA 3SR6A 2I62A 3CLRD 5JAMA 1PK9A 2VF7A 4C4RA 2KQUA 2YHSA 4TTJA 5T14A 4Q9IA 3UQYS 1N5KA 3JSXA 3BXXA 4RJKA 2HOIA 1I4OA 1KJJA 3NH6A 3SFVA 5TIIA 4KLJA 4OK5A 1DIOB 2EANA 1BXRA 1G4AE 2EJVA 2J5RA 2Z3VA 3EQ9A 3TRFA 5DMXA 1ZU5A 2J45A 4R8UA 4J07A 2H1OA 1V8BA 2XUJA 4C07A 5KYKA 2F3NA 1C8VB 1D07A 1XZNA 3DF7A 4FYMA 2GZDA 3I5MA 3MQ4A 3OA2A 2AW3A 2O0LA 4PQGA 3X1KA 4CPDA 4KG7A 3UA4A 3ZV3A 3GF4A 4C2UA 1SA0A 1FEZA 2BFCB 4OGGA 1E3IA 1YQGA 2AEEA 2R6GA 2QTMA 4BQIA 4YRBA 2KBEA 2EGHA 2FA9A 3L05A 1OAKA 3LUDA 4JVSB 3HKCB 1ML4A 3JQEA 3TEFA 3E05A 4US2R 3THYA 1X7DA 4UTZA 5K0SA 3L8GA 3QG1A 4IM7A 4I5GA 5J8YA 1O5IA 3TOVA 4ZQEA 1YNSA 3E7WA 3H19A 4JD5A 5L1IA 5EWFA 2WNSA 4WEQA 1TM2A 1KEEA 4FT4A 1KOJA 2ISCA 2Z4RA 3C74A 4IQWA 3FDZA 1M54A 1PE0A 3PVZA 3B52X 4AJHA 3KWJA 2BTEA 1ZL0A 4NFHA 1VYHA 2GZ1A 5KSWB 2G70A 4R3WA 4ZOCA 1RXSA 1O2DA 2HN9A 4NAVA 4Q3AA 1IY1A 2ZRIA 1RYHA 2FK8A 3WRWA 1ZISA 1TJ4A 4HDMB 1CPYA 3INGA 3KL4A 1Y7TA 3DW3X 3AJAA 1M2EA 4H7KA 3ICEA 1C7FA 4RC9A 2MOKA 4QJ3A 1ETUA 2ZJ0A 1FVOA 1M1NA 4B9NA 1DEAA 1RVDA 1R0LA 2NTNA 1IZ8A 3PGKA 3T79A 4II2A 4IIJA 3ZUGA 3H1GA 2HNAA 3VA7A 2V3CC 4NXZA 5KUTA 1QHEA 4EGAA 3WLIA 3QOWA 2Y0DA 2VNHA 2APJA 2HY7A 2R86A 3D7RA 4FTWA 4CTOA 4P08A 1ECBA 1R3UA 2BEWB 4N3BA 3KC2A 3ZDEA 1OU0A 1G8GA 3QUSA 4CLEA 2QN9A 3ZV6A 1PHPA 2R8YA 2FUG6 3R5JA 1N61A 8ICQA 2F77X 2VHYA 4QBFA 5ECWA 5GP1A 1L1FA 3SF8B 3WDSA 3WMRA 4BB5A 3F4BA 2HHLA 3L46A 1Z00B 2KLHA 2N0SA 3R9KA 1KS2A 3F4LA 5EKSA 4X7MA 1ESDA 4CRXA 3U6BA 4P3KA 2DGZA 4CM1A 4J1TC 2BIFA 1IXSB 2V3WA 3GFFA 1RRKA 4ZZIA 2XMSA 5DHQA 3LW8A 1GO2A 3VTAA 1ND5A 4D43A 2GF2A 1UKBA 1CQJB 2ZXIA 1KA9H 3IM1A 2W9AA 2YS6A 3PX6A 2FLNA 3AW8A 3A9SA 3QE4A 5KWIA 3WLHA 4C14A 3COPA 2ADOA 4OKIA 1RP7A 5H0IA 2E89A 3PRKE 4IWYA 1YR6A 3KHGA 4AUNA 4XEUA 4GLLA 1I3LA 3RABA 3V1KA 1IN7A 4E30A 4UAVA 3GFPA 1DPGA 2CVHA 2QM3A 2FRDA 1KQQA 1P1BA 2YVLA 2REOA 2ZBUA 4E2WA 3WMFA 5CIWA 3ICWA 2L42A 3D3WA 4DS3A 4QYSA 4RM3A 2VSOA 1DJNA 3HUFA 4LC0A 5FNZA 3OZXA 5H3HA 4FW9A 5KNDD 3GDOA 2I4NA 1E3LA 2YWDA 2ONYA 4L0QA 3PUXA 3A1SA 3A6JA 5LYJF 1SCAA 3CEPB 3H9UA 4CLRA 4IUCS 4MHOA 3ZDZB 1KZ4A 1PWYE 2FSGA 1L5UA 2Y1GA 3DZHA 2BRUC 1W4CA 3JD4A 4IHQA 4CW7A 5KTTA 4G4GA 5HKOA 1S77D 4MPRA 1U0NA 3T9AA 2GM5A 5HR7A 3JYQA 5KG0A 2BGMA 1TGYA 4MV5A 1LCIA 4LHZA 3CUEF 2VJOA 3R6LA 3W8NA 3L8DA 3PUWA 2NXCA 1FS5A 1GXSB 1J2TA 1I14A 1K2VN 2ZU6A 5CP2A 3QKSB 1WXGA 2I29A 4QARA 3OEHA 1FZQA 4A15A 3PZPA 2HMYB 3I2FA 1M76A 4OUKX 4EHLA 3HNRA 3ORRA 4E11A 1XTQA 2I6UA 2WJ6A 1COWA 3WRYA 5EXDA 5JI3E 5DNYB 1DCKA 3DXYA 1K86A 3H1BA 4D4KA 1K8YB 1Y6ZA 3C1OA 3I0ZA 1NRWA 3LOPA 1KI6B 1IEVA 2AD1A 4I8XA 1FB5A 5ICSA 3FTFA 3GCDA 5ENVA 1KY3A 4CQNA 4GOMD 1ZQEA 3GN2A 4YEDA 5B1HA 4BMZA 1WKCA 4KN7A 1UQTA 1LLDA 4PJ0U 1IK4A 1RP1A 2HCFA 2BP7B 1J09A 2CMKA 2HEIA 2IUYA 2V8BA 4KIJA 4LXHA 5TEVA 3WGQA 4ETWA 5LWHA 4WX2B 3EIQA 1FQWA 5BT8A 2W8KA 4OK6A 5FOXA 4DQQA 2JLXA 2NVWA 1X3SA 4WN9B 1VZ2A 2X9LA 4B3CA 1NK7A 2ZIWB 5DLYA 3W6ZA 1Y8QA 1C7JA 5IX8A 3VDXA 1MW9X 1B2LA 3KJNA 1H2EA 4ZGGA 9LDTA 3I32A 1A1VA 5GTIU 1V1JA 4B6FA 1ADBA 1UT5A 1QXSA 2H65A 3S2ZA 1WBBA 1SBTA 2YYZA 4B46A 4G56A 4O25A 1CEYA 2OYYA 1X9SA 3T5CA 4JKOA 1CQIA 3UB3A 3TZ6A 1N34B 5AQEA 3IILA 4INOA 2IDJA 2E5SA 1YBAA 4GLFA 3V97A 1GAXA 2P2NA 4P0QA 4RH3A 4DA8A 2NO6A 3IBCA 1KY5A 2A3RA 4EHNA 4YRGA 1XZGA 2HX1A 1KORA 1RD4A 3MT7A 4YP7A 1NJ5A 1N6OA 1VCHA 2FX3A 3DL0A 2YW9A 4A92A 1T0UA 4TLBA 1HX7A 1ZOLA 1BCSB 2X9VA 5K3EA 2AI1A 3IKMB 2OO5A 3JQAA 4DLKA 5ISMA 1ZJJA 4DL3A 2R84A 2RC6A 2PMEA 3EZ7A 2H3VA 3QU5A 2B1IA 4RH1A 1VE7A 1ZA1A 3TBKA 2J0QA 3RYHB 3ETLA 4IIUA 5JT1A 2ACVA 1OUMA 1TTQB 5CFOA 3W2GA 3OJFA 3OPVA 4R6XA 2BGKA 1CIPA 1J0BA 1HZZC 1VIVA 5ALNA 3H8SA 1A9PA 2V8OA 5DBCA 2VT2A 4U7JA 3NS7A 4OKSA 1JLLB 1GPYA 1E1DA 2F8MA 2OAEA 2EIHA 1TQ6A 1UKYA 4DYDA 1RZVA 4M22A 2NWQA 2AKAB 4M8IA 1U3FA 1GKYA 1ELOA 2HSZA 4M2YA 3A27A 4UMVA 4GHWA 3T3FA 2QTHA 5KL8B 5BNIA 4RF2A 4F85A 2CLFB 1JDPA 3PR2B 4H0CA 3SF0A 4EVSA 4MLPA 5EMNA 2OCAA 3E22A 5ITWA 2PWYA 1OYWA 1FA9A 1Z35A 1FCJA 1DEXA 4KVFA 4XIJA 4ZHQF 3DNMA 3FXAA 2VHXA 4MR7A 5EAIA 1AXGA 3OPYA 4AKTA 3QEAZ 3HXTA 4UAUA 1QR2A 3M6WA 4GZ3A 4KSBA 2X8WA 1GFWA 1L3UA 3GRCA 3UTCA 3BIXA 1CEZA 4AP5A 3IV6A 4YIHA 3U80A 3FMGA 5EYPB 1Q1ZA 2JJ1A 4MS3A 2GUGA 4PGGA 1DJPA 1PK1B 2ZPTX 3H16A 2H31A 4NENA 4WOCA 4GGOA 3E9MA 2OGWA 3Q7RA 4Q4HA 4RQ7A 3KHTA 4KZPA 4GL2A 1QLHA 4HADA 3TH5A 4C4XA 2HO5A 3H84A 4MKXA 3PEEA 2CJPA 3PXDA 2Q99A 3THOA 1SXJB 2OH2A 1ZEJA 3RR8A 1P1RA 4KH1A 1T24A 2UV8A 4LY3A 2IY9A 2H3IA 4C2BA 2RGAA 3C3KA 5CVVA 1P1IA 3TTXA 5E7MA 3D3JA 1P74A 2ZWIA 3KKMA 1W2WB 1OHHD 1Q0PA 1YCDA 1UOQA 2B83A 3FC4A 4ND1A 5T8KC 4BFYA 3KKZA 2RG1A 4QUGA 5JS1A 3G5UA 1J5PA 1O96A 4I1IA 1DAOA 1FMLA 1I24A 1ZBQA 4D57A 2O2GA 3HFJA 2FJPA 2GVDC 3FJOA 3MGBA 3UWMA 3TIVA 4BKMA 3S99A 3RARA 4FKMA 2VL7A 4E4TA 4QU8A 3CNEA 1V3TA 2AQHA 1LA2A 2QB1A 4NWIA 3AF4A 3H5IA 2PUVA 1P80A 2H5IA 5DN6A 2I1QA 4IIEA 5EIBD 4WJKB 4JKIA 4AECA 1DMRA 2DHEA 1JR3A 4WVLA 4B6EA 3L4BA 4EHHA 3V48A 4EHFA 1NZJA 3CUWA 3G7NA 3Q41A 4OM7A 4TWZA 3HLTA 1FS6A 2JBAB 2ZTLA 2GETA 1DZ3A 3DUWA 3QK7A 4LVSA 2DECA 1O94A 2FSVC 2QS9A 4G84A 5DK6A 2Y6VA 2P0YA 3PT9A 4C5CA 3GCGA 4ZAVA 1WHTB 1Z26A 2O2EA 2ZBFA 2UUBB 5LU9A 2OZVA 5BYJA 4ILEA 1E7QA 2I2XB 1KRHA 3H9BA 4GG1A 2VSXA 1NFRA 1CS4C 3C5HA 4OP2A 1E9RA 4XGIA 3RGWS 4DBVO 4JB0A 1Q77A 2CVOA 2PX5A 2V58A 4NPHA 2IOFA 5BV7A 2JB9A 3LZ6A 2J3JA 2QTBA 4FFWA 2POCA 1BKYA 2WD8A 3JZDA 4M9GA 1HUZA 1G8KA 3NO4A 3ORHA 3Q11A 4H7HA 4NICA 4GBED 3HJEA 4C3VA 4RK6A 4M9QA 2FSPA 1KS9A 4W8HA 5IXSA 1JIVA 4JHLA 2AHOB 1CNMA 1QK3A 3DOIA 4FYPA 4G5RA 1K6JA 1TQ4A 4MA5A 5J47A 2J5QA 2ZR9A 1P9NA 3LUGA 1QC5B 3A0HU 1G8JA 1XDSA 2ZTMA 3OIFA 3PR5B 3PQ8A 2AT1A 5BYAA 2GESA 3F98A 3P27A 4AYBF 2HJRA 1JSLA 2V5AA 3UJDA 1OFIA 5ITZB 4L08A 4KWHA 4MHVA 3MK31 2NU7B 2RI0A 3E3AA 3R3WA 5J3JA 3DP9A 2VJYA 4PNZA 4Q1AA 4GLBA 2HHVA 3UWDA 3BS5A 3NETA 4Q9KA 2ZM5A 3NDBB 3VSEA 1SD2A 1CBUA 2EWMA 2PCLA 3KU4A 4BUJA 3OQMA 2WG1A 5FWXA 5AOCA 5I5GA 5BPHA 3IMGA 4HATA 2OUIA 4K6HA 2HZ7A 2PZKA 1GNLA 2E82A 1UCVA 1FRQA 2PG3A 3EXG1 1JXLA 1ZMBA 3OHMA 2C4NA 4PAMA 4V0NA 1XL0A 4ZO6A 1RHKA 2G0NA 4UB6U 521PA 4CM3A 1BJTA 4QHSA 4XOUA 1DBVO 1YJQA 1JIJA 4AW9A 4HQRA 2FMUA 4DL7A 3PW0A 1R8YA 1REQB 3TSAA 3U2QA 4F04A 3IT0A 4DLAA 3V8NA 1LKYB 2IS2A 4LRUA 2I7XA 3GDFA 2ZWPA 4TS1A 1YRYE 3DDSA 3K0CC 5DYWA 1JG7A 3ENQA 1EFHA 1SPBS 3A3NA 3FYDA 1R4MA 4BP8A 4QGFA 1NRJB 5K0GA 2HT1A 3GWGA 2Z1MA 5EHGA 4KUHA 5TPWA 1TOAA 2FPXA 4O4JA 4BNLA 1K3FA 1W76A 3N8DA 1U5CA 4L7VA 4IOMA 5J5VA 1M1YB 2ZAYA 5A6SA 1R0YA 4DV4B 3GEDA 2QZSA 4PGYA 4FCTA 1E6EA 1MG5A 3W8FA 3RVQA 4ZAGA 5EC8A 5BOMA 3K5IA 1ESMA 3RS5A 1PJTA 3IP5A 1ZQAA 3FZEA 4YS6A 4F7DA 5KTMA 3MVEA 1K27A 3QV2A 1YT5A 5I9IA 3K9QO 1NG9A 4AJJA 1EX1A 1ZK1A 3KP1A 1ZICA 4AJ2A 1K98A 4QOIA 1KO1A 1KEZA 3P9ZA 5B7QA 4US9A 2AW5A 3PSTA 1QH1A 3CRMA 3MTDA 2BZSA 1AUOA 1FZTA 3LCCA 4K9KA 1BDJA 1JR6A 1M2NA 3R41A 3ZQ6A 2E4XA 5H1YA 1KSHA 2BFOA 1JLKA 4DR7B 1X87A 2J8ZA 3I6MA 3GFGA 4ISBA 1E9VA 5CVEA 5J43A 2VJ5A 1MPXA 1TK2A 3GXBA 3WGGA 3C28A 3AR6A 1A7UA 4P4OA 3V7LA 4RCZA 4GQBA 4M37A 2Q4TA 4S1OA 1PV4A 4MB0A 2FDXA 2E4ZA 4O2AF 3WYCA 5AUOB 621PA 4I9HA 4K4HA 4D7AA 1NBMA 2CLDX 4JNCA 4Y9UA 2JHPA 3NYQA 1B8VA 4N5DA 1IXRC 3BZCA 1P9RA 4JROA 3HDQA 3NOQA 2JVIA 4BLQA 4UTPA 2JJYA 3H0LB 4MFFA 1U8AA 1ZD9A 4HZGA 3TKYA 2LGJA 4EB6A 3CRVA 4YROA 3LMKA 5BSMA 2FXVA 5HHHA 2XD9A 3OJLA 4C4YA 3HCPA 4BY9E 4QPJC 2XUAA 1EXDA 4OREX 2G6BA 2ZYRA 3DE6X 1PS9A 1UAGA 1ZQFA 5GY7A 2LZ0A 1GUFA 1N6IA 3PPYA 3SQLA 4AQDA 4PC7A 1AKVA 1Z13A 1T5SA 3AV0B 4Q4DA 5KEIA 1I2BA 1U3DA 3T4EA 4QM6A 2FEXA 5P8WA 3ZLTA 4NBNA 3I9FA 3HFGA 2AGQA 2CMDA 5FNVA 1J8FA 4OAOA 4TXHA 5IH3A 4EM6A 3PCRB 3QVWA 2O8EA 3NYIA 5FPYA 4UFNA 4PEVA 2CLOB 2H1LA 5JCOA 4F71A 3TSZA 1XDUA 3ISJA 4URZR 1UPCA 1KKXA 1W4BA 2WDPA 3HN2A 3MRVA 3O47A 5A05A 5KOYA 2AFHE 1P6QA 4NV0A 1XWFA 2UZ1A 4XA8A 5DGTA 5I5EA 4MUKA 5E6UB 5REQA 3V42A 3EFHA 4HLUC 4OHWA 1EE9A 4DQUA 1R64A 4QDUA 1N9GB 2C2GA 4BPBA 2XWSA 2RGBA 1J7KA 5B5EU 4MR9B 5LMZA 2JGDB 1XCPA 2FH5B 4FE3A 4YTEA 4AWAA 4Z6KA 4AJ9A 3IDFA 3LQKA 2R9VA 3O38A 4O4LF 1E6UA 4UHCA 2HWXA 1V2HE 5EJ8A 1V4BA 721PA 4CE6A 2C2HA 2PFKA 3MC1A 3L8CA 3ZHSA 1EBFA 4Q3KA 2P2ZA 2C1EA 3CMMA 3H2YA 4J75A 4Q66C 2AJQA 4XIIA 3V46A 5MFPA 3LO5A 4R1QA 4YRZA 3DOHA 3LOQA 1RJEA 1AB5A 4L8FA 5F9NA 1KL9A 4U0JA 5DBBA 4PZ9A 5AJVB 2IYVA 2UZ0A 3X43A 4YC7A 5TMPA 4L5CA 5CLIA 2K8AA 1THZA 1U9JA 5E0OA 1XVUA 2GUWA 4C1NA 4TZKA 2A0WA 3C85A 4RY9A 1ST2A 3L92A 1K7SN 2IYNA 3D1JA 1JT2A 3CBGA 3CR7A 3ZK7A 1ILEA 3PE3A 4KR6A 2IL1A 2F00A 3CS3A 2W98A 5NLLA 3IP7A 3BGSA 4UVHA 1ZCAA 3HCRA 1QF7A 1KQNA 5L6MB 1U31A 2QP9X 2RDMA 4QLBA 5THKA 2ONJA 3PI6A 3RBDA 4B6JA 3IG8A 2OGSA 2QUAA 2CXUA 4QBKA 2AZMA 2P4EA 1T3GA 2P1ZA 2XOEA 3LT2A 2C5EA 4OL0A 4NBUA 4TTSA 4ERNA 1Z83A 4D82A 1CP3A 1ZHFA 1DLJA 2WM2A 3NJRA 3GMSA 3JZFA 4NBWA 1E4YA 2AMVA 3HU1A 1U2TA 3R3VA 4X8OA 3VJLA 2Q3MA 4O33A 1XEAA 4PF1A 1FP7A 1UBFA 4E5UA 3N2GA 1K6MA 4W9MC 2C7GA 3ZTTA 4LDJA 1AHPA 2XE4A 5JD6A 3EX7C 1RTTA 3WFIA 3L1KA 3URMA 3T1HB 3HY6A 1IBLB 1DUSA 2RAPA 3DEFA 1HYHA 2ZIVB 3CUSA 4I1UA 2OBLA 1O9HA 3RBAA 3AW9A 1QSSA 2ROQA 1Z74A 5ELMA 1RFGE 4LTDA 1NLMA 4LBWA 1GZ7A 1RLIA 1MHPA 1POXA 1VRVA 1E1YA 3HB1A 4RQNA 3E8MA 2EH9A 5LQNA 1ZPDA 3PCXA 2XO7A 5EE3A 2F8KA 1OXXK 2I76A 2GR9A 3ANMA 1ZSVA 2GPJA 4M8NE 4PO9A 4XPIA 3X1ZA 3TNFA 4Q5IA 5KSYA 1GYQA 1O08A 3WK4A 3HJCA 5CFZA 1PEKE 1QAMA 3DE0X 1BN7A 3J81k 4DSLA 1OFUA 4DVGA 1XMQB 1HQDA 3EB9A 4DDWA 4JLVA 4K9RA 3K09C 3PJRA 3IAUA 1BG6A 2X0KA 3GEHA 4P33A 1MLDA 1J2MA 2OZLA 5AW8A 5K8JB 1Y1LA 5JXJA 4INJA 1IY2A 4LZZA 4AYBC 3VPGA 3BMNA 3IUBA 2PAFA 2X0EA 3B0XA 4EG5A 1NUHA 2JJMA 1E61A 3DBOB 3JQQA 2WFZA 3UW1A 1CNEA 1MF7A 1QPBA 3LX5A 4C7MA 3T1VA 3MIIA 4HGQA 2JI9A 2NRZA 4LOLA 3ZWOA 4BVBA 4MVJH 1TFUA 2CMFA 5TQ0A 1KI8A 1OFUX 3ORSA 3QNMA 3GCZA 4V0ME 3WOHA 2C7RA 4EJFA 1C0IA 2A5DA 4JL5A 5JQGB 1SJ9A 3IR5A 2P3OA 4E7OA 2AGVA 5KNDH 4XWAA 4W99A 3FGPA 5B36A 1H5QA 3WLAA 4PSAA 3OX3A 3DA8A 3GLGB 4OF4A 1G20A 3AOGA 1HYEA 5I45A 4KJXA 5CDFA 1MB3A 5HR5A 1W19A 1MQ3A 1YJ5A 2B99A 2IYLD 5HE9A 2I2AA 5ALEA 3UMGA 1RQXA 4UU8A 2FPIB 2PX8A 5EIBC 2G8NA 2W6QA 2JAUA 4JXJA 3UMFA 2YV2A 2WSLA 3HW8A 2WDZA 1U02A 2AMYA 2PEZA 3NWBA 2PSJA 2KZZA 3RJEA 3QRWA 5AI8A 1B14A 2FKAA 3NHMA 2WINI 2CFRA 5LZ9A 2GKGA 4ED2A 1JPVA 2OWOA 2XKBA 3AVWA 3IT2A 4DA9A 5F2OA 2VHUA 2YZGA 2KTQA 4Q8EA 1IAVA 2HD4A 2Q5LA 3VR6A 3ZVLA 1UJ2A 5H7XA 4G23A 4RL6A 3E53A 1RPNA 4I4IA 1IV8A 2QARB 5KFEA 4GVXA 2JIMA 4NH4A 2HMSA 1JT9A 3SR4A 2W9BA 1AGYA 4MVJD 1L4UA 1FPMA 2BGWA 3HCAA 4Q12A 5FWYA 3HRDD 3G8YA 2QZPA 3L4EA 2JA1A 5B12A 1XFAA 2ZRHA 2QLBA 3USES 3JSAA 2ZAIA 3PDIA 3BWXA 1F12A 5P21A 5FR1A 1NDHA 2W0SA 3HB5X 1ZSYA 2PKWA 4GEKA 4LA4A 4LECA 1AO0A 2B35A 2Y27A 1Z4PX 4DFMA 1PTKA 4C78A 3QVGA 5KDOA 1HYGA 1UBMS 1D04A 4KUGA 1Z33A 1HFWA 2HLPA 1ZVKA 2KX7A 3DLHA 4KLZA 1U1DA 4WE3A 3A2KA 5I9BA 1M10A 1R0BA 4H1UA 2BCGY 4U5QA 5EUQB 1J8MF 2NPOA 1EA7A 3OMXA 5CVTA 1SQ6A 5HMLA 5KT2A 1JJBA 1T9ZA 2LTAA 2FR1A 3CRZA 5HCNA 1HOTA 1SUBA 2VAVA 3CSSA 2GS9A 4REMA 4OJMX 5IBPA 4TS4A 1QRRA 4YRIA 2W9MA 4R9NA 3OA0A 3EPKA 3AR8A 2J4FA 3QUBA 2AS0A 1OB2A 1EX7A 2XWPA 1NN5A 1VSQA 3MOGA 4IHJF 3U44B 2B4QA 2ECPA 3WLFA 1TVMA 1QVVA 1V1RA 3KVNA 4HD8A 5FCDA 4HUTA 1WDLA 3JQRA 5ALSA 2AN9A 4Z2YA 1V43A 2PGLA 1SZCA 4B31A 2G4LA 3E61A 3AKDA 1JXQA 4L8YA 1N2OA 5B64A 2KSOA 4HX9A 1W1WA 5PNTA 5KO2A 1JKJB 1XP5A 1OGJA 2FAXA 2VC2B 5DIZA 2B6HA 2GN4A 2J9FB 1U2GC 4IGKA 1Z47A 2XTAA 4LSGA 4II3A 1U2EA 3AVOA 3IODA 4RANA 1QDLB 3JQ6A 4OFWA 1Z73A 2QTGA 2B1RA 3BERA 1TUBB 4G07A 4OJ5A 2H48A 3OE5A 2QX7A 5G5GA 4P4GA 3RFXA 2W22A 5KL1B 7ICNA 3PDJA 3GNSA 1FRNA 2JW5A 2FV8A 3PRJA 2QI9F 1SZDA 1W0KD 5SICE 4CEIA 3ND8A 4TL6A 1NULA 3NHBA 1TXGA 3HPQA 5I7AA 3RTAA 5KOIA 1CUZA 2HUNA 5DO9A 5HRUA 5FJJA 2B5WA 5CFLA 2JIZD 3LL7A 4C2AA 1OWOA 4K4IA 4H7PA 4M1EA 3AILA 4K7JA 3I5XA 1Q15A 4H35A 1VKOA 1EK1A 4BIMA 3M6IA 4ZV4A 2WAOA 1GVHA 4QXRA 3FRJA 4RJ2A 5LMUB 3U7HB 5A04A 1RPZA 2Q27A 1Z5VA 2CZGA 3KR0A 1CCWA 2DERA 4GPZA 2W58A 1RRMA 4W63A 4EG8A 1U9LA 2OYSA 1F6DA 2BZ0A 1LSOA 1CJMA 2Y68A 3E27A 2C82A 3CH5A 3EHEA 3GUCA 3KB8A 3W3AH 4CM4A 3H87A 3OZEA 2WZBA 4QHTA 3G82C 3R7NA 1TZCA 4LBYA 3C23A 2DPJA 2DT5A 2R751 2RGDA 3IP3A 5DGCA 5JU6A 1QU3A 4QXAA 3W79A 1ZONA 2IEZA 4NMXB 1U0JA 2J30A 1A5SB 4WVFA 3LQQA 1Q3VA 4K05A 5ALZA 4D8YA 3MCTA 4B6QA 4MHSA 3TB6A 3IX7A 4TV9B 2PX0A 1G5IA 1H2WA 1NZDA 2CYBA 4PZAA 5JCZA 3IESA 2NM0A 3F9CA 3ZDFA 2QLMA 1EJBA 1JHVA 2QG6A 1I6KA 4MUNA 2W00A 1F51E 3AIOA 4HLQB 4U4AA 1X1CA 3SXPA 4RK7A 7ICRA 4YV1A 2VWGA 3IIIA 5DULA 3U7FB 4DLPA 3EOAI 4FVTA 4XRHA 2HIAA 4WKPA 3SNKA 2QGNA 2EDAA 3OIYA 4JX9A 1DO8A 5U4QA 1S1CA 2C2EA 1VKNA 1TU0A 1CRQA 2A7QA 4GI3A 4HFNA 1XAJA 4L4XA 4MEBA 5TX7A 4RKWA 1TCVA 1N92A 1SGGA 1R9NA 1JJFA 1P6XA 4P5EA 4FE4A 4GAEA 1G3RA 3FHLA 3I5UA 5CA1B 3CRXA 3DR5A 1FDOA 1S3GA 2PGXA 1GL9B 3EPRA 2NUTB 3Q4GA 2WU0A 4BUCA 2FEKA 1ZGCA 3HEAA 5AVUA 3F90A 3TWOA 2XIQA 2NXJA 2FMIA 5ALDA 2QX8A 3FIUA 1HDCA 4Q03A 4B82A 4X1YA 1WL8A 4IQVA 1N1DA 3RFTA 2HJ9A 5BR4A 5FYDA 4UFPA 4GD3Q 2GH1A 1PJRA 9ICHA 3QVOA 3K71B 1E59A 4RFVA 4DANA 4EDHA 5HTOA 3KUKA 2W2MA 2ZQYA 2XLCA 2ZQ5A 1RI1A 3CT6A 2CBZA 3WSWA 3N2YA 1WU8A 2I3AA 2QSUA 4JR2A 1VJRA 2C4KA 3JPOA 2ZT7A 4NEGA 5A6SB 3REFA 4KVGA 3L8HA 3V1LA 4EKDA 3MPOA 4H59A 2QRVA 2YXEA 4YDSA 5JR3A 3U5ZB 2IXEA 4QZ9A 3B1JA 3VNAA 3JRNA 2GLTA 1N2BA 5B6JA 3MGHA 2HQBA 2Y1KA 4PHEA 3QXHA 4TTRA 4JUZA 4R2IA 3GLGE 2JD1A 4D9NA 3AYZB 3ZCTA 2JZNA 3VR6H 3BKWA 3LRPA 4ID9A 1C7QA 3UENA 4F46A 5KYXA 3LXXA 2IHYA 4UHEA 3RH6A 3LKVA 4O3PA 1H05A 4MUAA 4TZTA 4YUWA 5ES4B 1FDVA 1ZWKA 4P83A 1E0SA 5G1NA 4NYJQ 1GFIA 1E2PA 3CONA 3IP6A 2IXBA 5B4VA 2XNDA 2ZUVA 3MW8A 3V4OA 2HIMA 3JVVA 2UVDA 3BH6A 2ZJYA 5CFQA 1ZINA 2HBKA 4QRIA 5E6SA 4XWTA 1TCUA 5C51B 4IWXA 1QP7A 4P0PB 1DK3A 2ZXEA 2D1SA 4MS4B 2I91A 3AF0A 1PGOA 4O2RA 3N2LA 2JC3A 4UTOA 2YWBA 1SKAA 1TAHA 3K2QA 1XF1A 4XWOA 4ENRA 3NJ4A 5LD2B 3PJEA 1K4KA 3CF2A 2PMBA 4BZPA 3DXZA 5KNDA 1EP3B 1JDUA 4GBMA 4GI7A 4O3RA 4PHTA 1L3IA 4PHPA 4ZAYA 3AP2A 1ZNZA 4CV1A 4DDKA 1NW6A 4IHJA 4IQTA 4RSRA 4B2LA 1Z7YA 3ZNQA 1HH4A 3IAFA 5CEFA 2WI8A 1AZLA 3T9BA 3W6PA 1OWLA 1NXOA 1G6HA 1WMAA 2P3LA 4U00A 2ZLBA 2XKAA 2XR1A 4C8NA 2J3EA 1SGWA 2R66A 3EFEA 3OT1A 3SEZA 2FFHA 2XXJA 3WHPA 2AKEA 1CRLA 3EZFA 3FNIA 3HEMA 1YR7A 4RHFA 1EGHA 2JBWA 3IBTA 1C9YA 1PL6A 2D1YA 3AM5A 3IVCA 4DWVA 2O8DB 4IIJF 1LJLA 1MJGM 1K97A 1W29A 1BJRE 4M6WB 1T2AA 4X93A 4KDEA 5JTTA 4AL4A 3UHAA 1RDFA 1LBQA 1WW3A 1WCIA 2QJRA 3E7PA 2Z9DA 3G1WA 3QSGA 2EFGA 4LYAA 4U2DA 3B7PA 4I6JA 5EIEA 3FPHA 2KNJA 4RSMA 4ARZA 4R98A 1N32B 2Z56A 4FD2A 3ZZMA 3AL2A 4DOAA 3QTLA 2L18A 2K87A 5EXSA 5U1PA 1HFKA 3U0BA 4PGXA 3VGJA 1UP7A 3ZBPA 3ZTWA 1NVMB 2QE7D 1HEUA 3I9LA 2XMGA 3QWBA 2WHXA 2RDJA 2WU8A 1X86B 1EH5A 2IZ1A 3KU1A 1YONA 3P2MA 3TI9A 1W4LA 3ZTYA 2FPKA 5BWCA 1R6DA 2C2ZA 2FE1A 1MMFB 2H9AA 2Q2VA 4X63A 3D6MA 3OHSX 5A3RA 1HDGO 3UA3A 3O1LA 5CX1A 5ITVA 4GI1A 4D8TA 1C3XA 2WWRA 3L5OA 5EKTA 1GGMA 2FHSA 3WV4A 2R47A 2FPWA 4GOOD 3FYSA 4KNVA 4UTVA 4RTRA 1GQQA 1UM8A 4Z6CA 2VEDA 1FUUA 4KWTA 3UG6A 1USKA 2PAAA 3FF1A 4A03A 2H7XA 2ZBDA 2GNOA 3Q7SA 1ZJWA 5B2EA 3C2MA 4BWYA 3MXOA 3Q8RB 1Z8DA 3L0ZA 3PE4A 2XZPA 5IASA 4F11A 1DJQA 1CZKA 3B7GA 3CXRA 3TLKA 5EL0A 2A9OA 4JQYA 4AO6A 3KFVA 1N1GA 1TLTA 2CEAA 3AFHA 3JASB 3Q8XB 3QXXA 3WI7A 1HEKA 4D0LB 1Y4DE 1DAKA 5K3AA 4E88A 3Q5EA 3GEIA 4HDKA 1SXJC 1JL3A 1Q1AA 2VP3A 1TM7E 3R7LA 2TMYA 4WRRA 4X00A 2ZT5A 2YJTD 2A94A 2XUZA 1L9XA 4G41A 2OK7A 4CLXA 1KO7A 1QYXA 3VPHA 5ICGA 5ALKA 5F33A 1E4VA 2YL2A 1M83A 3AJ8A 4ZO4A 3RQIA 2EKBA 3H9QA 4OHUA 2ZE6A 4NDZA 3RTDA 3T7DA 3ICQB 2W2VA 1LBTA 4I2BA 1FRFS 3AB3A 4NX2A 1XAIA 2VSNA 4B4VA 1LW6E 3V4VB 1B6SA 1HT2E 4WY5A 2DHDA 4ZGWA 3H2KA 2XZLA 4YMSA 3AI7A 5KCZA 1K7FB 4E21A 2P2LA 3ZJYA 4BNDA 4ZHQB 5BVHA 5B2ZA 1I3KA 2JS7A 1DHRA 4YACA 1U6IA 5FLEX 1TKAA 2O3JA 2JIBA 2GHTA 1Y8QB 1XC7A 2P9ZA 2JAOA 2SHKA 2WAYA 2ZR7A 2GM3A 3C6MA 4WH0A 1J2YA 3G02A 1YL7A 1ADFA 2HGZA 3KSBC 2IV7A 2GN2A 3NMUF 1RQ2A 4H3HB 4DDUA 4RK0A 2VTDA 2Z9CA 2PKEA 1I0ZA 3MFYA 4YVFA 2ZIWA 2HVHA 1T9KA 2WKRA 2D1RA 2PFQA 3CX8A 1KYVA 1RRCA 2C4UA 3S0JA 2XT9A 1NKSA 1TRHA 1ZL2A 2W71A 3PG5A 5BSGA 3L43A 3AUUA 4OUDA 4C7ZA 3N07A 2CDRA 4ZT7A 4G0OA 1DRKA 3TZCA 3P2JA 4BNUA 1KDPA 1XSLA 5AKGA 2AC7A 3UXPA 3FUCA 1U3CA 4BJ1A 1D8LA 1CNFA 4S35A 4LG1A 3RSGA 2ZW9A 4YMLA 3NWEA 2CCGA 1XALA 5DTJA 3OJWA 4BB0A 3FGNA 3ORFA 1E20A 4UBNA 2R60A 1GTVA 1KVUA 3FCSB 2X9NA 4JT9A 4GX5A 5B7PA 4HDKB 2VQFB 3G17A 2OVBA 3E2PA 2VJCA 1SPXA 2FN8A 3PGJA 2SICE 4YQWA 4M8KA 2F2TA 4FI3C 4RU1A 3REGA 1QP0A 3ML1A 4G5FA 4BFWA 1AKEA 4ETNA 1K9VF 1PUJA 1OHHA 3NUGA 3LWMA 1XTVA 1E2EA 1XLTA 2PGIA 4ZFNA 4J1QA 2EF1A 4CKEB 3E4CA 5CHEA 5J8YC 1V6AA 2E6UX 5CHYA 1HM5A 1QF9A 3TO5A 3QELB 1IXKA 1ZKMA 1UF9A 1IPFA 3TXXA 4IDPA 3PVXA 4GF5A 4HX5A 2IWHA 3ZU2A 5JDIC 4S05A 3CR3C 1UBTS 4EW1A 3E7FA 1K66A 2DLDA 1NPTO 2EAUA 1EINA 2QN8A 3OY2A 2C5FA 1KOFA 4ID3A 4JELA 3HA2A 3LLMA 4HC4A 4V1CB 3E48A 2F59A 3CVVA 4K8OA 3ZDCA 2DR3A 5HKBA 3DCIA 3FFAA 1MNAA 1P5ZB 1G5TA 5CIQA 4AZ0A 3TAQA 1TA9A 4QOGA 1U7DA 4ZOEA 4RH0A 4BQSA 3LBIA 4C20A 1E7SA 1WUYA 4LZGA 3O2JA 2HJWA 1YE3A 5IAOA 4FD3A 2HCRA 2FCRA 1KOGA 1CDZA 4OB7A 5H68A 5SZHB 4CIDA 1PQYA 3QKRA 2MSDB 4X7RA 5HE8A 5K20A 3J7TA 4MAAA 3DJFA 1Q16A 3U4DA 1GQYA 4R2MA 4TQAA 3WO0A 4FC6A 5CB1A 3EXAA 1GG8A 5IUNC 5AHOA 4EF6A 1G291 2PVPA 3L40A 4PE5B 1CULC 3VPAA 1ZK4A 2P75A 2OGZA 4CU2A 1NXPA 2QYTA 2B4TO 4HDOB 4LNHA 3SF8A 4ZI2A 2F17A 2FKNA 4OQFA 3V7JA 1XJ5A 2BL4A 3AK4A 5IJAA 4ZK2A 1IC6A 1QX4A 4ZJPA 4IH1A 4AZVA 2GLUA 5SY4A 4FYHA 2E37A 3JAWB 5BP7A 1V3UA 3LXRA 5C5JA 1P31A 3DT6A 2YYSA 2FWPA 5KYXB 1ZR4A 1M0EA 2XI9A 1YB4A 1NTRA 2VG8A 3FUWA 4HEJA 4OHCA 1W5FA 1T8SA 3SHVA 2G1PA 1TZBA 2Q4BA 3TTSA 5JAOA 3D31A 2AC2A 4BYMA 5B3LA 4TGLA 4Y2QA 1U9CA 4U2GA 3P2YA 1K6XA 2J67A 5EWEA 3M9OB 3FWZA 4OGFA 2ZPUA 2BMVA 3OUTA 1P44A 3CLUC 3FN4A 4U2BA 5ERXA 4XWKA 5JROA 1YVRA 2PKRA 4G0UA 4CFZA 5JD5A 1ZNQO 1S8AA 3EZXA 3FTCA 2RIRA 1UMBA 1NIPA 1QG0A 1J8VA 2A33A 2LE0A 4P7GA 4PZPA 1ZKDA 4M99A 4H08A 4R8SA 3X1JA 4EHKA 4MKFA 3U62A 4N5LA 2YN2A 4MLCA 2ZJZA 1Y7PA 2NGRA 1UZAA 4UOEA 3NBAA 2WTBA 3LHFA 2IPMA 3L1UA 3M83A 3VSBA 1WCYA 2DVMA 2ZROA 2D62A 2IHJA 3CRRA 3E8XA 4NYMQ 1V5EA 3ANLA 3EAFA 2BQRA 1R66A 3NTLA 4G1CA 3H2ZA 1US8A 4KN8A 4N0EA 3O4JA 1CJUC 1G4UR 3DT9A 3U39A 5BYKA 5JLJA 1QPZA 3NWPA 2YVKA 4K86A 3TOCA 3VOBA 5LNK1 2P90A 1S76D 3ZW9A 4CL3A 3AVTA 1TEHA 3K9HA 1X8LA 1HR0B 1AURA 2D8CA 1JTEA 1N4DA 4ZCSA 4RTOA 5KCMA 3E9QA 1AV7A 1JQDA 1KZYC 2KHQA 4JP2A 3RVDA 4YAGA 1N6PA 4S0XA 1KKMA 1O9GA 4F9EA 1TJNA 1PVVA 1LDEA 1OSNA 1QJCA 4X85A 4E5MA 1TGVA 1OH8A 4G9GA 1NIJA 1Y6RA 4B1FA 3HU3A 5DRTA 4G4IA 3VU8A 4HNVA 1M8JA 3T1YB 4UE3S 2BHRA 1Q46A 2QHXA 2LBPA 5GGXA 1KETA 1JSCA 1YJAA 3GD5A 4J7XA 5IKEA 2O59A 1YQWA 1XZHA 3D7MA 2PO5A 2CVFA 5T3UA 5I9NA 3BMCA 3RUIA 3CT4A 3RH5A 1SULA 4PCAA 1ZQWA 1UINA 1NU6A 4YJDA 2P1DA 2CD7A 3TRJA 1GNSA 4MZDA 2PU7A 3KYCB 4OXRA 3SOPA 4J6EA 1O97D 3DE1X 5JNSA 3X1DA 1T9BA 4TV8A 2KYRA 5JDCA 3PDHA 2GWSA 2OB1A 4WBNB 2D2FA 2Z5VA 4R2LA 4F45A 3P20A 2AQ0A 3QBTA 3SDSA 1THTA 4LZDA 2XA9A 4H3VA 4BRWA 1Y5LA 3BCSA 4X1KA 4D9IA 3DAOA 3IALA 4L8GA 4ND5A 4YJ2B 4D9BA 1UJ4A 3UGTA 1EEXB 5EHXA 1PNTA 1A2BA 1HIWA 1G2QA 1D9XA 3F3KA 4PTZA 5AW3A 1DP4A 3WO1A 3SQWA 3NVYA 4Z4CA 5J5CA 3STUA 3R0XA 1PV1A 3IQHX 1A8QA 3SBOA 3TSCA 2JZCA 3BPSA 2VT6A 3EVCA 3E9EA 2GI4A 1A4IA 3QKSA 5AR1A 2FE4A 3MMXA 8ICMA 1ZG3A 4UE2A 2VJ4A 2CHFA 2C2YA 4DA6A 2PLFA 4KPYA 5L6LB 1XZEA 5H9WA 3H2HA 3RS8A 4IDBA 5TDHA 5JXIA 2H3FA 1QGAA 4QJ4A 2PYDA 2XUFA 3CUKA 1HSZA 2ZVQX 6Q21A 1NKCA 4YLYA 3B9JA 3IRVA 4ZMSA 4XUCA 3OJXA 1JHAA 1ULHA 4WHMA 4MRMA 1JTVA 4OXYA 2VAWA 2YVQA 4ZARA 5DBIA 5T5QA 4DM4A 4J03A 3QVTA 2EFDB 3S5UA 3RRJA 2IP2A 1XTRA 1RG6A 3USCS 4F4HA 4LJ8A 2HBJA 1VPTA 1YHYA 2JGAA 4PSUA 1SXDA 1FX0A 4KLGA 5DBEX 2XYVA 3PFCA 2J9RA 1MA3A 3FBGA 4GMDA 5HUHA 1YJBA 3ZWYA 4DJFC 5JD4A 3AG6A 1RHJA 4BO7A 1P2GA 1UMKA 1ZVMA 2ZS9A 2VH2A 2B7BA 3SKVA 1Q20A 4G01B 5L40A 3B1VA 2A3NA 3OX1A 3T1TA 1C14A 4BB6A 4XLTA 3EXHA 1R8JA 5T41A 3SQMA 2E4YA 3MBOA 4FNMA 3PFWO 4DHWA 4FJ2A 1XDGA 4YWJA 5FTNA 4MX8A 4EY3A 1T34A 2CL6X 1NXQA 2XSZA 2P62A 2PXIA 1M8KA 4PHGA 5CRIA 3V2GA 4AIIA 2PNFA 5HM8A 2PUAA 5EE1A 3AINA 4DSFA 5FXMA 2I4TA 3ZLBA 4NLNA 2FEMA 2O6LA 3Q9NA 4JK1A 3EQ8A 4BE7B 3ADDA 2BMFA 2QE6A 2OWEA 2J48A 3A06A 5CEHA 1L6IA 3DO8A 1OLSA 3CPHA 4J2HA 2VQEB 4TSFD 5FPPA 3EISA 1XS9D 3GLKA 1XRJA 2E6KA 2Y9UA 3IULA 3LFUA 4L51A 4P81A 4BFXA 3IVGA 3JW8A 3SHTA 1Y3CE 4QNRA 1NLUA 3M6ZA 1DC5A 3MM4A 5JD3A 1T5HX 1YR1A 2AN1A 1TMYA 5GWXA 1J25A 1CVLA 1TZJA 4Z7JA 2UZ1B 2XRMA 4CKWB 1MX5A 2SBTA 3PPVA 5DM4A 2H2IA 1S0MA 1X7XA 1OAOA 1E18A 2QVCA 3KTFA 3Q2OA 4LE2A 5B58T 3IOYA 1TB4A 3R1IA 1OTYA 4J2OA 4XM0A 4HN9A 3BJMA 4Y2GA 1PK8A 1LF5A 3RRFA 1Q50A 2CLCX 1W9MA 4RKEA 3M3DA 1J5XA 1TMGE 3INNA 3HNPA 3B9BA 3OPNA 5BSHA 3FNHA 2VPZA 4HTFA 2UYCA 1FRVA 3P9PA 1FYXA 5HIAA 2Q9BA 4LW8A 4KLQA 3Q7EA 4KI7A 4ED0A 1TK8A 1I2DA 2FW0A 2WFMA 3I39X 4DQVA 2Q6IA 4ECRA 2NYRA 2NRXA 2HJSA 2PA3A 4M4SA 2M32A 1A2KC 4PTYA 4RZ3A 3AM1A 4GYJA 3NAGA 4P3XA 3L0YA 1GTJ1 7ICSA 4QZBA 2Y92A 4Z9BA 1W7AA 3AQ4A 4PS0A 3W78A 2R18A 2BGRA 3DTYA 2QRJA 4FJ1A 3SAJA 1OC4A 2Z04A 5A4DA 2IYOA 1G55A 1PT8A 4F5ZA 5AW0A 1G5FA 1SURA 2I99A 3RB8A 2YDXA 1MAUA 4PG8A 4F4JA 3MJFA 4FMCF 3E2MA 2HCBA 4LKOA 4C0SA 1DO2A 1QFJA 4GR5A 5JYDA 1S5PA 4ZVSA 1OBCA 4IMPA 2VZ8A 1FF9A 1WXWA 4NZYA 2XGJA 4Y1RB 5FL7D 6PFKA 5FULA 4TL8A 1KSGA 3NVZA 3QTBA 6NULA 2ZS7A 4NZPA 3QOXA 4DC9A 3PGA1 2ZS8A 1IJKA 1NBAA 1W4ZA 2FRDC 2NTEA 4TV8F 4KZKA 2JMGA 3SLGA 1G3UA 4QUHA 1W6RA 2NT4A 3EQ2A 5KINB 5HMMA 4D98A 5JCXA 7ICPA 4DJTA 3EXIA 3IHLA 4N3NA 3CTMA 3T3IA 2W6NA 3HRIA 3FVQA 4K1LA 3PXEA 2PFGA 4O3NA 1Q12A 4NZZA 2NUAB 2X7HA 3F9RA 2W2PA 3RD5A 2EFCB 5BVGB 4MVJP 2D0DA 3VSDA 5ETJA 1G2OA 3U1BA 2P9JA 3FTNA 4LJYA 4P53A 5EIOA 5DCLA 3IBGA 5IM5A 1UBJS 10MHA 2JJ1D 1TQ2A 1ZGBA 5IKOA 1MORA 4MRRA 3E9NA 4S1NA 5JS2A 1CDEA 5FBWB 2IPNA 5I8WA 1JIIA 2VDLB 1T9DA 2P69A 4RZIA 4B0OA 1NASA 1FU8A 1MJHA 3RYIA 3UCEA 4F56A 1PQWA 1WPRA 2C5HA 1M34A 4LDPA 3QJGA 2BE9A 4D4MA 2WZDA 3EARA 3NNDA 3THWB 1HORA 3BXGA 3WK7A 1KZGB 1C81A 4OGWA 2QTCA 2JDIA 4FFBB 4A8JA 3EE6A 3MMSA 4TL7A 1BEZA 1JDBC 3O94A 1QGYA 1QHFA 3SJBA 2ZRPA 3HY4A 3QH4A 4N54A 4XGNA 7ICLA 2W3RA 1PNVA 1S02A 1ZUD1 5J2BA 2A5LA 4A0QA 2QVLA 2Q21A 3ZXSA 3N97B 2HDHA 2BY4A 1EVKA 4I6GA 3LFTA 3MUOA 3G2MA 2QMQA 2E5WA 5A3QA 1K5HA 1FW8A 3ICOA 2CNBA 1JG2A 1YWGO 1AF4A 2D4AA 3KB2A 1T94A 3NOXA 2ZR8A 4KAJA 1H3NA 3I4FA 3RWMB 1KVRA 4N03A 1GITA 3DE2X 3FYUB 4Y2UA 2W37A 3KOMA 3L3BA 1R8QA 3C15C 1JH8A 2BBOA 3QQ5A 4NTZA 3ZNPA 2IBSA 3FMPB 3M6AA 5LP6C 2AG8A 1XRLA 5T3YA 2ZR0A 4OB8A 1YACA 1KJZA 2WJHA 1TT5B 4DKXA 2X58A 1CUAA 2RONA 4DL6A 1JHYA 1OA0A 4LHWA 4MYUA 4YDRA 5A5FA 4E5KA 5ER6A 1JV2B 3M1IA 4P3NA 2QNRA 3FCEA 1HDIA 1LZLA 3NHZA 5A02A 1SQSA 4M46A 1P73A 2LIVA 3FIJA 3LBFA 4ZMBA 1AD2A 3OFVA 1G21B 5B1EA 4CM8B 2DCUA 3KZMA 3OQ6A 1XSPA 5JDCC 1NF2A 3M9NB 5KWSA 1E2DA 2ID7A 1E2HA 3M6VA 3CRQA 5IVDA 1KI1A 1MA7A 2FEAA 4K40A 3FBTA 3ZWAA 1C4WA 1P9OA 4HHEA 1FP4B 1PRYA 5IDXA 2GBPA 2R6R1 1QJ4A 3L8FA 4OQQA 5A0LA 1L3TA 2RGCA 3JAKA 4TMXA 4M9LA 2EV9A 1DEOA 2AB0A 4MS1B 4D2IA 3ZDBA 3WFJA 4DFJA 3MJTA 4OJQA 3IPYA 1FFYA 1YS4A 3E2EA 2BGNA 3WNZA 5T4BA 1BHJA 4LJ7A 1B4DA 5FPHA 1KYWA 4BO1A 1CF2O 3CZCA 1KO4A 4M89A 1ZM9A 3OZUA 2NU7A 1H6CA 2BCQA 1E8MA 1I1OA 4MQEB 2VDQB 2NX2A 3K0SA 1X1AA 4NNOA 3ET4A 4EFLA 4HTAA 3D0QA 4W7HA 5HQ3A 4BQNA 1YRHA 4AVYA 4L0CA 3EZ5A 1TK3A 3IPCA 3PWSA 4HAXA 4PCVA 4PNPA 4LY6A 4NLGA 1NVAA 1L8QA 1GFSA 2ODTX 3HS3A 1Z18A 4NBKA 4Q4JA 4TRRA 2OCEA 5CA0A 1EP9A 3TEMA 5LIRA 4Q1CA 4L28A 4ZOQI 4BVAA 4UOQA 3L7JA 6AT1A 3A1EA 1H2AS 2WUEA 3D8TA 2C61A 4AU1A 3F6SA 1V96A 3B12A 2G1AA 1PL7A 3WL5A 3UAVA 1A9ZA 3GJ0A 4IQ4A 4I9GA 1G8MA 2Z43A 4Q4JB 5CA0B 1F0YA 2Q8QA 1NC1A 2ZIFA 3INYA 2OBYA 4R1NA 1OAOC 4RPXA 4B7UA 5JXWA 3V8MA 2CW5A 3V55A 3RM3A 1COWD 1DX4A 2GA9A 1ULSA 1DKQA 3BXFA 2W6OA 3D5QA 3HWSA 2ZTEA 4M76B 4U9UA 2GYYA 5FQOA 4GPBA 4TYNA 3FHCB 1XZPA 3VJRA 4ARCA 2B25A 2R62A 2C2OA 3D2BA 2VK4A 1VM6A 4Y0VA 3SM9A 3E9DA 4HDAA 2CB0A 4IVRA 5TNXA 1UUFA 4KMOA 4MYCA 1ZOOA 3RBVA 3KZCA 2P5TB 3NI2A 4FGJA 4BFUA 1UAAA 4J3NA 1SRRA 1BDMA 4JHXA 3IEMA 2ZRMA 1S96A 1V16B 1SVUA 2GKSA 3CJRA 1KR2A 4FBTA 2BPOA 3JAKB 3LDGA 1IM4A 4JL8A 4N3AA 3ES9A 4R8VA 4TUYA 1MCZA 3GYGA 1UWVA 4R63A 4W5HA 5JLAA 2BHSA 3N8KA 4XYBA 1G98A 2IP4A 4D25A 1TYAE 4LUCA 3PW7A 8GPBA 2NIPA 1AOXA 2RCYA 4Z7OB 1WETA 4Z8YA 3RFVA 5LMCA 2R2GA 1YFJA 1T8RA 5FLXA 4AI6A 3CB4A 4Z0HO 1WY5A 3BJRA 1E98A 2YHUA 3G2LA 3Q15C 3DV0B 3V8RA 3CGWA 2DT8A 4CMEA 5E7IA 1HTBA 1C5KA 4Q3NA 3J81j 4LWQA 4UPEA 4RNOA 1BYUA 3IUNA 3M5CA 3G8DA 3I2GA 2HYIC 3IOCA 2KLBA 2BKVA 2DBZA 2KHZA 3GEBA 4PICA 4F2WA 2PJRA 1BE1A 3D8SA 1ZK3A 1JEEA 3C5WP 3JD0A 5D6OA 4ND8B 1Z5ZA 2B8TA 3RS2A 3T3PB 3Q3EA 1QHGA 1TE2A 4FIDA 1RYNA 1CR0A 2VHEA 3ZXXA 1Y5NA 4O5OA 1DDIA 1M1YA 1DQRA 1LF0A 3ST7A 3JQAD 2V6GA 4QBGB 4FFSA 4EBEA 2XUPA 2D2EA 3GAMA 3C4JA 3JQ8A 3R6TA 4KPUB 5HTKA 2HT6A 2DLCX 3GFRA 4W1SA 4TYMA 1L5VA 3B13B 4FDMA 1U7HA 4ZI3A 4GLOA 5K5EA 3LRTA 1E3TA 4LV5B 3WIDA 5K0ZA 1RBZA 1Y4ZA 2HRBA 4IQ0A 3ANYB 3DUFA 2IA6A 3AR4A 5AW7A 2QN2A 3JQGA 4BAZA 4EMUA 4TQUS 1FVHA 4ECYA 3KR2A 3A1VA 3NRZA 1TM5E 3CCFA 3I23A 5JEDA 4J1SA 4RZ2A 1N2IA 1PEDA 1W1UA 4TUPA 7ICQA 3MZ0A 3UXHA 1HDEA 1V16A 3E8SA 3P9YA 2J6HA 3NNSA 1HURA 4FEEA 4L7QA 5DLEA 3SPXA 4D5EA 4JI3B 2C2MA 4C4TA 1Z4LA 4LHXA 3UBTA 3OEED 1D6JA 1KFJB 4EI7A 4YX9A 3EF1A 4DV1B 4F8JA 3EIEA 4TLEA 1FJHA 3KE9A 1RJFA 1C20A 4G09A 4OJLA 4UZSA 1NW9B 3MGIA 5JQGF 2BH9A 1M2FA 2Q2NA 5K4AA 5G5HA 2IYUA 3AC0A 4BFLA 1N57A 3I61A 5IAAA 3HT3A 2AVNA 5CYFA 2RHLA 4FYYA 5D00A 1LD3A 1TKRA 1FNCA 2ECOA 3CNLA 3G2OA 4R54A 4MI6A 5TC4A 4BN0A 1PCXA 1Y1PA 1RYDA 1BE8A 1ZRHA 5EVJA 1A5BB 2YZNA 4YCDA 5H3CA 1ZM4A 4MEAA 1CC1S 3TRKA 4B09A 5JRJA 1KQGA 4UQGA 4HXFB 3OO0A 5ALPA 4MWDA 4Q24A 3AZOA 4XB6B 3PUJA 5BMOA 1MTZA 1K89A 1UJNA 2FEOA 3PC8A 2XB4A 4YP6A 4EJSC 4CDRA 2XAUA 2PT9A 2VUTA 4QOJA 1QTIA 2QQ5A 3SY8A 1EESA 1B3RA 3HWX1 4YR9A 2O8FB 4UBLA 1NJGA 2VTEA 4C05A 3DMPA 3RJTA 4YPFA 3ZVKA 2F3RA 3EGIA 1OI4A 2HSWA 4ECWA 2FW7A 4M9CA 2V6IA 4HDCA 3VXKA 3WGJA 1F8UA 1RPTA 3EMKA 3RJGA 3GMDA 5ALLA 4GECA 1FXUA 4LCJA 3Q9LA 1ESNA 3SYNA 3SLKA 8ICNA 1RPAA 2IMWP 1T4DA 1NE7A 1L8AA 5DHTA 5LQSA 4PH5A 3TKLA 2BI7A 2I7DA 5FORA 1WPXA 3B82A 3G0DA 1S5LU 4EYEA 1XZJA 1Y33E 1E4OA 1Q5PA 3JVUA 2IUUA 2BGGA 4LSMA 3ZIAD 3EZ6A 3HFSA 1VKJA 5IAJA 2XE7A 5H81A 4Z49A 3MF4A 5C7IO 2GHQA 4B5LA 3V6KA 3MCVA 1C3VA 4J4HA 1E4EA 5COQA 3MTQA 4NBLA 4PIPA 3UPDA 3JWGA 2P66A 1WRBA 1QOZA 3FFXA 2XCIA 4HNQA 3NVMB 3V1MA 4BL5A 2MHCA 3HYSA 4KDFA 4ENSA 4RZUA 3N9IA 2LM4A 2I33A 4OQZA 4JBHA 4X6UA 3TW6A 4A1OA 2FZVA 1U3GA 2RK3A 5EPEA 3OU6A 4DIKA 3SSOA 3HBLA 1HTTA 1ORRA 2QRZA 5JUMA 4YV0A 1PHRA 3NTRA 1P1JA 3Q72A 4V39A 2XY5A 3UO8B 1PAUA 2DUJA 1NP6A 2CY0A 1ZGAA 1L3SA 1C9MA 3A6HA 3FSJX 3KZOA 5I6DA 1LPSA 2NU6A 1PK1A 2QDXA 1FTWA 3O92A 2VP6A 1PEYA 1FP1D 1KKLA 3FTQA 1NATA 3H3JA 4FBMA 4M1TA 3WQHA 4C0WA 1RR6A 4QYWA 1T5LA 3PX0A 1KPHA 1LFAA 1Z29A 3PZRA 5GJBA 4XA5A 2KZMA 3DFIA 5HQJA 1JAHA 2ILVA 5DT9A 4BNXA 4RACA 3C45A 4E15A 3TZQA 4DF3A 4ZCRA 1F7UA 1M6VB 3O8OB 2WEKA 3NM5A 2JL1A 3CPEA 1NKEA 5KT7A 1UWKA 4J9MA 1L2TA 2CXPA 3LUCA 1KDVA 3F73A 4Y0NA 4BS9A 2I0FA 4OQMA 2JI6A 2B3TA 5IAGA 4R68A 1WV1A 1I4WA 1T0PA 1NWHA 4XQCA 3I62A 5BURA 1SH7A 1BPZA 1BCRB 1MO2A 2C22A 4A5SA 1IN5A 4IUYA 5DTRA 2K8CB 2CFCA 2XTJA 3CZQA 2Y66A 3DWGA 4ME6A 3AU6A 1T2FA 1VCMA 2WWTA 1CRWG 3I9NA 2JEZA 3PWZA 3Q8PB 1JJAA 1P8JA 4YA6A 3UJ3X 3W9SA 5CGQB 1YS6A 3OFSA 5KYGA 2BCRA 1A96A 2WU4A 4QGHA 4XH9B 2DQSA 4Z0PA 3FW1A 1ILWA 1EK2A 1ORHA 5JAZA 3KZ1E 1OVGA 4IFTA 2C0QA 2Q1XA 1E63A 3ZWWA 4FR0A 2F1IA 4WIAA 5FLKA 5KWJA 1PJ8A 1A5ZA 1XN1A 1WCV1 1GM5A 2KFNA 2KHVA 1EDEA 1XMJA 1E2GA 1VHJA 1XVAA 2YXDA 3B53X 3GT4A 1NYLA 2VP0A 4WZAE 1GR1A 2O2YA 1A9TA 3JVIA 3ZLVA 2Z6UA 1Z25A 3C6ZA 4M60A 5T4EA 3W4KA 3AM3A 1VCNA 5ENDA 1JE1A 2FQ1A 2JASA 3UYLA 5E3HA 4U1RA 1CSEE 3STXA 4QICA 4TQ9A 5KDDA 2R00A 1L4HA 4KBFA 2WHEA 4PO3X 1ZRNA 2OHFA 2ZZKA 3AHJA 4J29A 3BTVA 4NSNA 3DW1X 2CHEA 4KXVA 3BZWA 3FYCA 5KMGB 1N0WA 1SBIA 2HK9A 5BNWA 1WX1A 2MYUA 3LPCA 4JT8A 5AW1A 4OQNA 4RAQA 3RSLA 3WGYA 3FPBA 5CVJA 4OQEA 2F44A 5FFNA 4DLRA 1G5RA 5DYNA 4RA6A 4AUKA 4Y1RA 2PZJA 1Z36A 3E81A 3OD5A 3UJNA 3LKZA 1S8OA 1VSVA 3TQ1A 3IC5A 3MD0A 1R37A 1XAHA 3FE2A 4G5HA 4Z4HA 3O8RA 3RRZA 3QOYA 3UN1A 3Q6IA 4HEHA 1CI4A 1Z5WA 3V4PB 5JAHA 1QOQB 5LQKA 3FSEA 2PLNA 2HQRA 5EOVA 3SS7X 4GC5A 4IH9A 1OH7A 2O50A 3TM4A 1ZHOA 4R7TA 3RVMA 1BDIA 1PR0A 1QS0A 4XKJA 3AR7A 5K0TA 1OE0A 4D4LA 1D4OA 3VYTB 1WAMA 4BWVA 4O3QA 4ND8A 4X1OA 1S8FA 2G8LA 2J7PD 2XDYA 5CVDA 4R8UB 4KIUA 1U9IC 1W48A 3LT5A 1SFRA 5F1OA 1R5JA 5K8VA 2XY7A 4F5OA 1BC5A 3WWCA 2I8LA 4MGHA 4HPWA 1YKGA 2BEVB 1ZQVA 1QFYA 1X1TA 2YUIA 1NC3A 4KX5A 3UQ2A 1KAQA 3F78A 3X1WA 5C7LO 4PL1A 2H52A 3GV5B 1U8TA 5HQ3B 1R0XA 1E1QD 4WKNA 2LD4A 3LCJA 3OU2A 3P9RA 4PYQA 3BB3A 3FKQA 5EFZA 5EXPA 3MR5A 2IYFA 3L7MA 4EJSA 3ZC3A 4I55B 4DL5A 3GEEA 4RK1A 3IJ5A 2EHDA 5BSRA 4NCXA 3ZWPA 2BJHA 4J7CA 2OE2A 5AI9A 1AQUA 3DPIA 3GT7A 4ZQCB 2EZ9A 1MRNA 2GO1A 5DYTA 4QM7A 4F0JA 1NNI1 4Q7JB 4Q44A 4L27A 4O2BB 1GQSA 3D54D 3GLHA 4WMLA 2BFWA 4Z3OA 2VK2A 3EF0A 3Q5GA 3S27A 4HVCA 4KFCA 5AW4A 3OECA 1QO9A 1ULBA 2PGJA 3N7SC 2ODBA 2VNSA 3N05A 1O96B 3QVUA 5DVZA 4ER0A 1U3WA 4OV6B 2WG0A 4YCMA 5D6NA 3T94A 2WQZA 4F6RA 2UVPB 4DGQA 1L9KA 1JPJA 5TPZA 5J0TA 1JWBB 4OBBA 2QMHA 3C1YA 1M73E 2A59A 3CM0A 2PMCA 4X8LA 1MEOA 4PZZA 5AHWA 4BLOA 2WZCA 4WCDA 1WPGA 3A70A 4EGFA 1YRQA 4LK2A 2XADA 3FCYA 5DYGA 1E1CA 4J0QA 2JFWA 4PIMA 2WF8A 4AAYA 4GC9A 4B74A 4H9GA 4F86A 1BSVA 3ZCQA 4FSHA 3WYAA 1G5HA 3OJUA 5E6RB 4I55F 3PSIA 2GTPA 3LT4A 4RCYA 4Q19A 2Q0ZX 1FFGA 4J3FA 1PVRA 3TQOA 4F4FA 3UC5A 5IZCA 1XQ1A 2GZHA 5KG3A 3R5FA 4JC0A 2AUNA 3UJ8A 3WBKA 4BBAA 3ZD9A 2H1IA 4I1RA 5I4IA 3RVSA 5EQTA 2XCAA 5JMTA 5J4YA 3TQCA 5DTEA 4XAQA 1B0AA 4JX8A 1E3SA 3W7AA 3MBYA 2IHNA 5DQGA 3DB1A 4ND7A 4ND4A 3RJHA 4CGZA 1R10A 4FN5A 3U4CA 2JCGA 3O8DA 5ELLA 4Y2VA 2HHJA 3GJ6A 4LOHA 4YY3B 3HV2A 2O48X 1LSJA 4UJ5A 4HDRA 4EW6A 2O20A 1C3OB 3LVBA 4PZNA 2G40A 2PVSA 3A1FA 1OZFA 4BZXA 4FB5A 5K45A 1Z07A 1PR5A 3PIDA 4WXEA 2K4IA 5KQRA 4HDMA 4M8SA 5KT6A 2OV3A 3MSCA 4KLHA 1TMOA 5D1NA 2PJUA 1U0RA 2AJDA 5FHRA 2OWDA 2XB8A 4C3OB 4BVGA 4AUEA 4L9WA 3WLPA 3L04A 1G9SA 1YB6A 3EG9B 2H07A 1WLSA 1WSDA 2D5AA 3BN3A 3CA8A 3OLCX 1TAGA 5JVDB 1RRVA 4B3XA 4EWLA 2BEWA 3OFKA 1PG5A 4JV5B 3TI0A 2AN3A 2UUPA 4A2WA 1OCEA 5DNUA 3WWPA 1DHTA 1PQUA 4H2DA 3ZV7A 4XWWA 2PUCA 1AU9A 4DCSA 5C37A 3QHQA 2XDAA 4KO4S 5EQDA 2QRHA 4EY5A 3QJYA 5CPBA 4O4IA 3RC3A 1TF5A 3MBIA 1JFTA 4EA7A 4WXPA 3BH0A 3L7OA 1RWWA 5ESWA 4JV1A 1T8WA 5EWJB 3ILHA 3RIMA 3VCBA 5JG7A 3PHHA 2J0VA 4XUEA 3ZDAA 1LNSA 4IDGA 4QPNA 3OCYA 5E0KB 5AYVA 1T91A 1OI7A 3JD2A 1Y8ZA 3C1ZA 1U2DA 1XV5A 4WJLA 2EDCA 4PZOA 1CJTC 1E58A 3LWNA 3CW2A 2JGNA 1WZUA 3BSYA 3KVOA 2OYCA 1IBMB 5F1KA 1UBSB 1ZQUA 1X15A 2HZBA 3EFOA 1EVZA 3KCQA 4Q4LA 1QIFA 4W6QA 4TV9A 4R71A 2QRNA 3G0CA 3R0IA 4D8UA 5MGNA 4CM9D 4V03A 3DE7X 3ZJ5A 2C5LA 3PFBA 1KYYA 4NJ8A 1R5NA 3LNCA 1HLDA 4MKZA 2I6QA 4IMJB 4EFNA 3OKCA 2K5UA 4X1IB 1E0KA 4XYMA 2CJFA 4G5XA 1XQ6A 1PLLA 2AXPA 1US8B 2XNDD 3WISA 4E7PA 4DMRA 3W9UA 1NNLA 1K4YA 5JYBA 1VJ5A 2C95A 5DGBA 1NMQA 3G5TA 3NHAA 2GWRA 5G0UA 4KL8S 2AU0A 2O8BA 1PX2A 5DDIP 3PBKA 3U6KA 1EFCA 1CUGA 2REQA 2E85A 3HN6A 4JJIA 4CR7A 3VYVA 1PUXA 4X1IA 3NT5A 1KI3A 4UOZA 4BBZA 1ZY2A 1HK7A 3DEYX 2WT4A 2FN9A 4WBXC 2YWGA 4GH5A 3F5QA 3TQSA 1BHQ1 3GCWA 2ZM6B 2ZTDA 3HX0A 1ZOIA 3I1IA 4OSEA 3B5IA 4WTOA 5MN4A 1YB2A 5E7QA 1ZR2A 3VSAA 1SAYA 3FDJA 1WKBA 1KYXA 1W49A 3B6KA 3EBOA 3IOMA 3PCTA 2AG5A 2Q9CA 4XASA 4ZVQA 5AWFC 2WJJA 4QJ5A 1ODKA 2J3MA 4TYWA 4CT0A 2AYXA 1Q3UA 2I03A 1PF7E 3NORA 1GEGA 2YINC 3I8XA 7AT1A 4DXDA 1DQSA 1XEXB 2GBLA 3B9QA 4F2GA 1RKUA 2WK1A 7GPBA 1PT6A 1ZQQA 2ZSFA 3PMNA 3ZHBA 2X1LA 2XTZA 2VA8A 3TLCA 4BB9A 1GUBA 4DSOA 1KPIA 3FWHA 3DD1A 2GYVA 2ZIGA 5ECGC 5ALMA 1P0FA