1LVHA

The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
220
Chain Sequence
MFKAVLFLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Caught in the act: the structure of phosphorylated beta-phosphoglucomutase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 75
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1lvhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1lvhA01
1Z4MA 2I54A 4Y2UA 3PGLA 4H1WA 4C4TA 3VAYA 1ZD3A 4UARA 2JAOA 4UW9A 3WK5A 2OBBA 1U7OA 3BA6A 5ALNA 4ZEWA 1SWWA 1L7MA 1LTQA 4F71A 3FZQA 2YJ3A 3OTQA 3I28A 1L7NA 5AM1A 2B0CA 2FPXA 5ALUA 3UM9A 1Z4PX 2AGVA 3OPXA 2I33A 1YV9A 2W4MA 2HI0A 3WKBA 2CN1A 5AVVA 5IT4A 3MN1A 1ZOLA 3AR7A 3DAOA 1ZD4A 2ZXEA 2EARA 3L1UA 2C9MA 3QUCA 3QNMA 3SKXA 3AR6A 1Z4OA 3QX7A 4HGOA 2BDUA 1JUDA 5AK4A 1QH9A 3NASA 4HGPA 2MU2A 1NRWA 4AP9A 3L0BA 2D2VA 3J7TA 3EWIA 2IOFA 2HF2A 1Z4KA 3L8EA 2RBKA 3L1VA 4CNQA 5A3QA 2ZOSA 1Q91A 2ZBFA 2FPSA 3TLMA 1Z4JA 2HOQA 2CFSA 2NYVA 3NALA 3AR3A 4JDPA 4XQ0A 5ALPA 2I55A 4MUMA 2B82A 1ZD2P 4UM7A 1ZS9A 1YS9A 5AVYA 1RLTA 3WKAA 4G63A 3W5BA 1J8DA 5AVSA 3ZWKA 3EPRA 3PDWA 2MU1A 4F72A 1L8LA 3PCTA 2G07A 4J03A 3ZI4A 1VJ5A 5AK5A 3E81A 3WKEA 4HGRA 5AI0A 3FVVA 4RETA 1O03A 5AKEA 3ESRA 5AVRA 2W11A 2YBDA 5ALSA 1WVIA 3E58A 2FPUA 5AHXA 3I76A 5ALEA 3A3YA 5AM3A 4FE3A 1TA0A 4OD0A 5AI6A 3EF1A 4UU1A 4CF5A 1Z5GA 3A1CA 5AW9A 1ZD5A 3L7YA 4Y2VA 4CE6A 5AESA 3PGVA 3I1YA 4DFDA 4HAIA 1S8OA 3DDHA 1Z4IA 1X42A 1N9KA 2IYEA 2FUEA 5AI4A 3WK4A 1Z4QA 3OCWA 1J97A 3WK9A 2OYCA 2QYHA 4HGNA 1K1EA 5E0OA 4UMEA 1Z4NA 4KNVA 3MPOA 3A1DA 5ALRA 1RQNA 5AKLA 2YJ6A 2Q5EA 5AW4A 4HGQA 4C4RA 4Y3UA 4CF3A 2WF7A 4YCLA 3F9RA 4Y2XA 5A3SA 3WKCA 3SF0A 2R8EA 4GXTA 1WR8A 3L8FA 3N8GA 2HSZA 2RARA 4YGYA 2YN4A 3U19A 3HYCA 3WGVA 3B8EA 4KYTA 3OCVA 3K1ZA 2NO5A 4EZEA 1Z4LA 4IFTA 3P96A 5AW5A 2HHLA 4GIBA 1T9ZA 5AI5A 2YJ4A 3RF6A 1RLMA 3KD3A 3FGOA 5ALXA 3QUQA 4Y2TA 2CFTA 2AMYA 3ONNA 3CZ4A 4J2TA 1YJ5A 4ZEVA 1QYIA 3QGMA 3ZU6A 5AW3A 3UMGA 5AKJA 1RLOA 5AKIA 5AM0A 1YNSA 3OCYA 1RC8A 3FM9A 5A3RA 1KYTA 4UMVA 2X4DA 1TE2A 2GHQA 3QUTA 4IG4A 4L57A 1XPJA 4XOUA 1IWOA 2FPWA 3AR2A 1PW5A 1NF2A 2JARA 3U7GA 4BEVA 3WK7A 2MSNA 3SD7A 3WK6A 1YDFA 2W43A 4HYTA 2HDOA 2WF6A 2HF7A 5ALLA 4OFZA 4XPZA 1NNLA 3B9RA 4EX7A 5AICA 1RKUA 2PR7A 5AVTA 4O8CA 3QU4A 2HEGA 5AM4A 4FYPA 4NFLA 4QQFA 5AW7A 2C4NA 2IOFK 4ZEXA 1RPZA 5AKKA 2WF8A 2GHTA 3ET4A 3I6BA 4Y2YA 3U7EB 3HLTA 1U02A 3KZXA 4YIKA 3IJ5A 4FFDA 4NAVA 1LVHA 3ZW7A 2HX1A 1RKVA 4BKMA 2FDRA 3IB6A 2IA5A 2I7DA 5AVXA 3OCXA 2FI1A 1SWVA 3M9LA 5AW2A 3FPSA 1VFPA 3ESQA 2OA0A 5ALIA 4NWIA 2DQSA 3L8GA 3SHQA 5AVWA 3KBBA 5ALYA 5AM2A 1EK2A 3CNHA 5AKXA 1EK1A 4BNDA 2JAUA 3ZWDA 3WGUA 2B1RA 1Y8AA 5AVZA 3DV9A 3L5KA 2RB5A 3U7HB 2YMLA 1Z5UA 3SLRA 3M1YA 3N5KA 3ZVNA 2PKEA 3QYPA 1U2SA 4BX3A 4EELA 2G08A 2P69A 1QQ7A 3QU7A 2FUCA 1RMQA 3W5CA 3EF0A 2ZBGA 1RRCA 4EX6A 2P27A 4CF4A 3ZX4A 4UASA 3NIWA 2BY4A 3DNPA 5AKYA 3L0CA 5AI9A 2C88A 5ALTA 3S6JA 3MC1A 3E84A 3FPBA 3N28A 2CFRA 2FPRA 2IOHA 4RESA 4I9FA 2G09A 2HO4A 4BX2A 2WFAA 3NANA 2EAUA 1T5TA 3WKDA 1VJRA 3E8MA 2YMQA 4JB3A 1O08A 3UMBA 3ZUPA 4DCCA 5ALZA 1RDFA 1WPGA 5AI8A 5AVUA 3QU5A 1RKQA 2ODAA 5AK3A 3QLEA 4KX3A 1N8NA 3W5DA 1CQZA 4Y2SA 5ALGA 4YCMA 5AW6A 2NO4A 3AR8A 3ET5A 4EEKA 3QU9A 5AW1A 1ZRNA 3R9KA 2YFYA 5ALKA 1QQ6A 2R8ZA 1MH9A 3R09A 1T5SA 5ALFA 4KX5A 4UAUA 3UMCA 2R8XA 2I34A 3N1UA 2QLTA 5AIAA 3MMZA 4DW8A 1S2OA 1RMTA 2Q4TA 2YY6A 3SKYA 4XE5A 5ALOA 4NV0A 1ZRMA 5AKZA 4OHFA 4YIHA 4Y2JA 3N07A 1RMYA 4UMDA 2OM6A 3KOOA 5AKHA 2C8LA 5ALMA 1Q92A 4C4SA 2AH5A 4MWOA 4E88A 2JGAA 5ALWA 1TJ3A 3RFUA 2G1AA 2WF9A 4B6JA 1U7PA 2FEAA 4AS2A 4UMFA 4OCZA 2GO7A 3A1EA 3AR9A 3QUBA 2ZBEA 1F5SA 3SMVA 5AVQA 3ZX5A 4BEWA 3WK8A 5ALDA 2YMPA 1XVIA 2P9JA 2ZBDA 3KC2A 4BNDB 2EATA 5AK6A 5JJBA 3D6JA 3ZTYA 1SU4A 3NRJA 4YCNA 3ED5A 5IT0A 4Y2PA 3R4CA 2GMWA 4PNHA 4YH1A 5IS2A 1TJ4A 1RQLA 2Q4RA 4Y2RA 4DWOA 4UU0A 3ZVLA 2O2XA 1FEZA 5AIBA 2O9JA 2B8EA 3BWVA 3L8HA 3KDPA 3ZVMA 2B8JA 2YMMA 4G9BA 2BDEA 5FP0A 2RAVA 4I9GA 3IRUA 4KNWA 4UM5A 1L7OA 4L6CA 1YMQA 4AS3A 2P11A 1L8OA 3ZTWA 1XP5A 3L0YA 4NABA 4BX0A 3QU2A 1L7PA 2PQ0A 2JAWA 5T41A 2VKQA 2GFHA 5AKGA 2G80A 5ALQA 3QXGA 4Y2QA 2I6XA 3U26A 2WM8A 4L6AA 2AUTA 2YJ5A 1CR6A 4BBJA 3U13A 4KN8A 3OCZA 5AW8A 2HCFA 1AQ6A 3U7FB 4UAVA 2WF5A 3AR4A 4EENA 5AM5A 3OCUA 5ALHA 1ZJJA 4BYGA 3W5AA 2G0AA 2ZG6A 1U2TA 2WHEA 1L6RA 1TJ5A 1WZCA 2R8YA 3GYGA 1QQ5A 1Z88A 2B30A 4QJBA 5ALVA 5AW0A 4UATA 3AR5A 2C8KA 3NAMA 5ALJA 2G06A 2B1QA 3NUQA 3B9BA
chains in the Genus database with same CATH superfamily
1GJRA 1IAQA 1IHUA 3DL0A 1SXQA 3MFQA 4MHOA 2KFNA 3KYCB 1LF5A 2PGAA 4S2EA 4EGJA 4L5AA 4CG2A 3DHVA 4O5OA 3IIIA 4GM1A 3WK5A 1TQ8A 1MOQA 1TRHA 2CE7A 3FFBA 4ER7A 1CDOA 5F5XA 4XYBA 2UUBB 4ALMA 5K4GA 2AZTA 4WBNB 3U3DA 4PG5A 4AUKA 3T3NA 2FHPA 2KNJA 4DPKA 4UB8U 1T2FA 1QVVA 2QTRA 5B2EA 3RUEA 5JXGA 2FWPA 4FO6A 3IGFA 1C3LA 3FZQA 1LWOA 1PIWA 2REXB 4PZDA 1JQEA 4YPVA 1I14A 3ROTA 1KIFA 3TDMA 1W0JA 2B92A 2H8KA 2QPLA 3HA3A 3IV9A 1IFXA 4AS3A 4BFZA 3IDSA 1NVVR 2PS0A 2VSQA 2CN1A 3KOMA 4O4LF 4QELA 3T7AA 5CDSA 1PLKA 4QYIB 3T7RA 4LOAA 2PNJA 4LI3X 1CQXA 2WKPA 4EMUA 3JRNA 2M0NA 3N2ZB 3ADOA 5JJIA 4JQSA 3BYZA 5K0NA 1EBBA 2VAWA 3ETJA 5IDQA 2GZ1A 3AR6A 3BRCA 3O8QB 3PB3A 4ND4A 1MQ8B 1JTEA 1QFYA 1QRAA 1S9DA 3MMNA 1Q3VA 2FLNA 1XZEA 4R8UA 4MGYR 3WL7A 2BDUA 4ACBA 3T1HB 3LRXA 8ABPA 3K70C 1MP0A 1NX9A 3E0FA 3ENNA 5B2FA 1GPYA 1G6OA 2Y0DA 1QU3A 3HRDD 3UAWA 1KSJA 1XZFA 2QMQA 3A9VA 2FHSA 4KXQA 5T6BA 2ZJ0A 1HOTA 3RG2A 1H2AS 3A6LA 2J48A 5JY6A 1UWCA 3F2CA 3TQRA 2JDID 2YYSA 4ECWA 1THMA 3P20A 2AI1A 1GADO 1ZK4A 3KKKA 2RHMA 3QY0A 4X8OA 1BQ3A 1KJ8A 3BMNA 4H18A 3TMYA 2F1OA 1CS4C 3O9ZA 2J4CA 2FZGA 3IBGA 1EXMA 1G8FA 2PV0A 2R68A 2JGKA 2XW6A 4NONA 3DG9A 1L9KA 2CFSA 2VL7A 5TARA 3T3FA 1K27A 3R0VA 4A8HA 4CQJA 4QWBA 3VC3A 5DIZA 4FILA 1ZCFA 1GRRA 5JSHA 1VHQA 3PXDA 1J0BA 1XZLA 3AO0B 4GQAA 3NYIA 5LJIA 1E9RA 4H0CA 4RMGA 2JEOA 2I7VA 1XMSA 3EPRA 5A6SB 2GCGA 2VYCA 3U56A 4R0VA 5BWNA 1NNUA 4KUGA 5IVDA 5KEIA 3LRTA 5HQ3A 1E1CA 1JG7A 1GQ2A 2UDPA 4P53A 1Y6ZA 2IYOA 3BWMA 4OHMA 4BC0A 3R23A 2J9ZB 1TADA 4A2QA 3OZFA 4HGRA 5GZ3A 3FVVA 2HCRA 2WB2A 1X6IA 1Q8KA 1N1GA 3WOHA 5CM8B 3TW8B 3DXXA 3OZEA 3ACDA 4PANA 4OI0A 2FPUA 4A3SA 1RZTA 1EQAA 3G59A 3WO0A 1T1EA 1EWQA 3S8MA 3BIXA 2GETA 3M6XA 4KTQA 1EIZA 1K8RA 2QP9X 4XCVA 4EF5A 3SDSA 9ICHA 3JYLA 3TL6A 2XRFA 4OHXA 1JL3A 3AF2A 1NI3A 3MRVA 1II8A 1CRQA 4LJ7A 3A1CA 4EUFA 5J2FA 1L6IA 2P4QA 3IBTA 3OAAA 1UBLS 3OO0A 2IYVA 4I4TA 4IMJB 4DMGA 3JPRA 3SQWA 4TZ0A 4NY8A 1UMBA 2B98A 2V6FA 3I30X 2Z4TA 1NUUA 4DRXB 3B1WA 4B1FA 4BP1A 1N9KA 3SQMA 3GOHA 3H6GA 1CTQA 1P5HA 4GKVA 2DFLA 3FWYA 4XWAA 4CIXA 3LKVA 2YIDA 4NICA 5JAIA 2BFCB 1YR7A 4BO3A 2WIGA 5LQCA 3EIFA 2OO7A 2Z6VA 1J5PA 5EXTA 4Z6KA 2IYXA 3ZLUA 2PT5A 4KFSA 3UK7A 3MSXA 4K6HA 3REOA 3ORSA 1AQLA 3UT5A 3L82B 4MVCA 3RIEA 4C2AA 9LDTA 3TJRA 1U9IC 3ZGOA 1Q50A 1COOA 1ZN9A 3CLUD 4CIBA 2ZT8A 4CHGA 2OV6A 4RSGA 1H3EA 4ODIA 2WJYA 5CAEB 3W2HA 1PZGA 5JSZB 1DBQA 1K92A 3W7BA 2Y9TA 1I7PA 1WD7A 4H1TA 1NK7A 4P32A 1SN7A 4ED9A 1QE3A 4GRIA 3E5MA 1P9WA 4V0NA 2W3RA 2QMOA 1KMQA 1QYXA 2WJHA 4L07A 2ZVDA 2ISPA 4M46A 4O5AA 4JP2A 2R2AA 1DEOA 1Q74A 2VOEA 3HFGA 3GQBA 2GOYA 3IEVA 2Y92A 4HF7A 3WGVA 3V97A 2KE5A 1DGSA 2RAUA 4LRXA 2NO5A 1QFZA 4QRHA 3GIMA 2WG2A 3HCOA 5DDIP 2A5FA 4LPSA 4DTCA 4QZGA 5DISB 3TNYA 3HJEA 1MAAA 1N5OX 2A0KA 4ENRA 2GN9A 2O7RA 4LVNA 2HQRA 4BYMA 1HE8B 5J2EA 1YI1A 3NWEA 3WIBA 2M98A 5L7YA 3BRQA 3QLJA 1Y6QA 4K03A 3ZOKA 1TM3E 2AMYA 3A2MA 3BXZA 3GJ7A 1COZA 1VG8A 4JFAA 4AP6A 3HEBA 4BPBA 3FCUB 4ECVA 3STWA 4C6HA 4PBSA 3RVRA 5CLFA 2WW8A 2E49A 1QCYA 3VZQA 3ST7A 3VYVA 2PKQO 5FHQA 3RR2A 7ICFA 4RJKA 2C42A 5J2JA 3EMKA 4BMZA 3A10A 4IIHA 5IDYA 1KYTA 1EFTA 2XCUA 3U44B 1OLUB 3RK1A 5GJWC 2N1RA 2VJOA 3KTFA 4BIMA 4DSFA 1XCOA 2Q7OE 2ZIVB 1SH7A 3F6EX 2JAXA 1YQ9A 4U2KA 3PZBA 2JR5A 3CP8A 3SZMA 3LBYA 1JAZA 4WZBB 1UZUA 3SD7A 1DFGA 3TNJA 2R6CA 5H83A 1OLXA 2NZVG 3K0AB 3ZWXA 5FFNA 4AD8A 4DCNA 4IFBA 1DNPA 2C5FA 1DT3A 1OWMA 4PZ0A 4QICA 5CDFA 5KFYA 3BZUA 5LD2C 1S4QA 4JXKA 3OESA 3O9VA 2FP4B 5CCBA 1F0KA 1F51E 2IQIA 4CGZA 5KFEA 3EMBA 4P4GA 5FO0A 2Y6UA 3K1JA 1NY5A 1Y4AE 1D6JA 3EQZA 4ZTUB 4WBXC 2VYNA 1VJCA 4Q4HB 5C8ZA 3KZNA 1XHLA 4NFLA 4WCDA 4YNBA 1T4MA 3ECAA 4PHAA 4TTRA 3SU8A 3U62A 2HEIA 3PO5A 5C5JA 3C3CA 2HLDD 4QYMA 2PZGA 2RH4A 4PC2A 2NIPA 4NAHA 3R9XA 2AOTB 2DJIA 2O1WA 2I4LA 3H83A 5FEUA 2FOIA 2Z6UA 2V4QA 5CB1A 3F7OA 3EVBA 5TMDA 5ARBA 1VLMA 2W6IA 4J7UA 9ATCA 2CB9A 4G86A 1C81A 5C1OA 1U7WA 2NSLA 3UENA 3RU3A 2IUUA 1V5IA 5LZ4A 1GNQA 4ZWNA 4DE5A 4PRLA 1QH1B 3TW6A 5FPQA 3MT8A 1LK0A 2J5RA 3EZ6A 1LNSA 1A7AA 4TQGA 4WOCA 1IQUA 3A4IA 1NT2A 3V2GA 5ISMA 4KO4S 2P6PA 4E5MA 1RWVA 4BQNA 5E6RA 1G18A 4A0SA 1MJGA 1GNSA 3O6VA 1L3VA 3Q98A 5ALYA 2LNDA 4X71A 5IDVA 3U80A 4BFTA 1DAGA 2P77A 5BOVA 3NVDA 3RVBA 4ZCRA 5BUQA 3PW4A 3ZWDA 1PS9A 3QVMA 4G1UC 1HT3A 3ETGA 3L0IB 1PYDA 4XR9A 3G3EA 5T6MA 2R6GA 4TLBA 1NXSA 1R0ZA 1RIIA 3B36A 2J08A 2H3HA 3CUVA 3GK3A 3NAGA 1KP2A 4FMCB 3VZRA 3SLRA 5BPFA 3Q9UA 4P2GA 3REGA 1Z07A 3UHPA 3EGDB 3ZVNA 5JBIA 3GDGA 1NW7A 1BE8A 4OHPA 3DYIA 3JZFA 3PXEA 4GOXA 5AQ1A 3WYDA 4GXNA 1R8QA 1HDYA 1KSGA 3B3QA 3C74A 4JWMA 3DDUA 4B46A 3IAS1 1RMQA 5JQGF 4EY3A 5K6AC 1O8BA 2AMFA 3EK2A 3G0CA 2CXPA 4IUYA 4QWWA 4M04A 4DR1B 3IQHX 4KVGA 1PX2A 3PF8A 4PF1A 1T8RA 4ZV4A 2XSZD 4U7CA 3U61B 4Z4IA 5T8KA 3CW8X 2XICA 4E2YA 4HV4A 2JI9A 3ILSA 3ZX4A 4LPKA 4C7JA 3B2QA 3PQ5A 4AULA 3EJ6A 4EI9A 4IJUA 4IIBA 4CM4B 2QUKA 2A88A 3CNEA 4OQFA 2PGLA 5CLHA 4DJDC 4TYWA 4DFKA 3ROEA 3QYFA 4NLKA 5L45A 1XS9D 1JHUA 2ZITA 1NQTA 5KTMA 3BSSA 3VU0A 5DB4A 1TX4B 4BEBA 2MR6A 3GZNB 4F5RA 5TISU 1QE0A 2PX0A 4FJ0A 2XMPA 3RAGA 4DDUA 3OA2A 4L3OA 2BR5A 3SHFA 4DGSA 4B87A 2GEBA 9GPBA 2NUAB 3LZ6A 4ZJZA 3FOZA 3QOWA 4Q16A 2GILA 4C78A 5KREA 2PLFA 3PFBA 4UD2A 1DWPA 1A5ZA 4NMLA 2R96A 3A2KA 1X39A 3CPJB 3G8BA 3NHPA 3PITA 1JQLB 2DWOA 3M34A 3HNRA 1QG6A 2WTBA 1RKQA 2C07A 4NCKA 4RXMA 2JLVA 4CM6A 3WYBA 2HVIA 4BRUA 4JCOA 4NOJA 3U3ZA 5C81A 1XVAA 4LNHA 2QTFA 5JANA 3A0UA 4GAEA 2E4YA 4YAUA 1Q14A 4AJOA 3VR5H 2J3MA 2GARA 4QDZA 4WN9B 5BVHA 1ITZA 2WOOA 2RBEA 4AZSA 2NO0A 3SC6A 3CF4A 4H6XA 4UNPA 3A32A 3TRDA 2Y0SC 3IKLA 1AUPA 4EIWA 3AESB 3GPIA 3RRGA 3I92A 1ZNYA 1L3BA 1N5IA 1Y1SA 3PQEA 1C7IA 3P32A 4J1SA 3KFXA 1TCCA 1BD3A 3KUUA 4JUCA 4ETIA 5L1KA 3IT1A 4FX2A 1TYBE 3UXNA 1YDHA 4NK4A 5U4XA 2BFBB 4RA9A 1SV0A 4KAJA 1XTIA 1RJ9A 2FSIA 2FR0A 3RIMA 9ICSA 2JGLA 1H5QA 5MN5A 3HA5A 1U0LA 4GYYA 2FFRA 3E6AA 2EDCA 4LRUA 3RFCA 2UYQA 3W1EA 2C2MA 1MW8X 1QHFA 2PSDA 3CRMA 4TQ9A 1V3TA 1YIAA 3TSCA 4B3GA 3NC4A 3GP3A 1DG3A 1E96A 2G9VA 1T36A 2H5EA 2WTAA 4PGGA 1O8CA 1NDHA 3DBRB 4U4AA 5J4YA 4UMDA 4TWRA 2QBYB 2WYIA 4D3YA 5I7SA 3KQTA 2JFNA 4KBYA 2HJHA 3DKVA 1DCFA 3PX4A 5J2DA 4RADA 5JWRA 2A1UA 3RFFA 4C43A 5IM4A 1BKDR 1NW4A 3GRAA 5JBQA 2I29A 2AN4A 3P0FA 3R4VA 1HE2A 4I1OA 4L4RA 4QX6A 5IJZA 3JD2A 5BPHA 4DLXA 1UDWA 2DT8A 3B3JA 4WY8A 1EK6A 1NHWA 1T1JA 3AMZA 1NF9A 4PYNA 3OPYI 1JAIA 5KTTA 1ZNXA 3AEKA 4JASB 4R1QA 2UYYA 4NBVA 3GLFE 4DLUA 1ZY2A 1VE1A 4KODA 2CVQA 2VSXA 1M34B 3OEYA 2OQ2A 1MIOB 1XMQB 2ZSFA 1L4KA 5C18A 1M6YA 4HSGA 4CUKA 1W76A 2V6GA 1DFIA 4EOGA 1X1QA 4FDUA 3TL2A 2Z1MA 5TQ0B 3WGLA 5DHAA 4DYHA 4QQNA 4OLJA 5DB7A 3SV3A 1PKEA 1IXZA 1R12A 1SJ9A 5IS2A 2ZZNA 4Y2RA 5KFTA 3OGUA 3KPJA 4J49A 4YJ2F 1NDUA 5KT3A 4UOQA 4GHWA 3R7AA 3M7IA 5BSFA 4PU0A 3DTVA 4HDSA 2Y71A 1NONA 2V65A 4LVCA 4TTQA 3BWVA 1BX1A 3R9WA 2XGPA 1X1RA 2O8EA 2WSMA 3KOXA 5BMOA 1W48A 3QQPA 4AO8A 4Q0MA 5CFPA 3M1LA 3NETA 1TK3A 5LIPA 1YC5A 3BXPA 3PQ7A 5JJLA 4TN5A 5CW2A 1D0VA 4DG9A 4KLCA 4RK7A 5F98A 1GPDG 1N25A 1T9GS 4KFUA 4PZUA 4C2TA 2HK8A 3V1LA 1TQ4A 3RGWS 4J0KA 4I8XA 2R18A 1PR9A 3ZKWB 4BJHB 2V5VA 2SKDA 2BBWA 1KIMA 4NDNE 5IASA 3BDPA 2FE1A 1N3IA 1OE0A 1PTJC 4MRMA 3NTVA 3D7LA 5FNVA 5K3FB 1PS8A 5SYNA 4AYBC 4DDWA 2JAWA 1P18A 3EA0A 1I0LA 4NG5A 4CWAA 4DMLA 5B7GA 3AFMA 2ASJA 1LJUA 3DC2A 5CEJA 5LKAA 3UKJA 2I6QA 4G8BA 3FUXA 3TQIA 1QLJA 1J8YF 1MKYA 4Y2QA 1HH4A 1GA4A 1Q3KA 1C8KA 4YFKA 2H3QA 3GO4A 4GH5A 5KFFA 4ZI5A 2WNSA 2BQRA 1SCQA 4PO8A 4G3XA 4RD4A 2B6GA 3UHOA 5CLJA 1QORA 1TT5A 2IU0A 5AW8A 3L4KA 3GI1A 4UAVA 2FU5C 1LQ2A 3DEIA 3P27A 3ZS9A 1E9VA 2YY7A 4XYEA 4GICA 4KK3A 2WWXA 1V7ZA 2AZ4A 3EMDA 1F6WA 5FLEX 1TZCA 5CG1A 3LQ2A 4HXGA 2OR3A 3DEZA 3EZ7A 3H11A 4MUIA 4RL4A 1B0ZA 5FO1A 5J1SB 1ULZA 2P67A 3A6GA 1AKVA 4KV7A 1S10A 3T9AA 4Y9SA 1PFVA 2R8YA 2V7UA 2YJGA 2OD2A 3GYGA 4ZMBA 5C8DA 2B30A 4TN1A 2C2DA 3B6EA 2JCVA 4BGUA 5I4KA 1A2OA 3LK6A 2UYOA 1ZOSA 2BCVA 1BCSA 1AO3A 2I3DA 9ICOA 3N6XA 3OX1A 2A92A 4FQ7A 4Z9BA 4P2HA 2H65A 4XCQA 3SYNA 3DWGA 2WA2A 3PX3A 4NHOA 4KR0A 1IIRA 1CLUA 2UUPA 2W2QA 4E5VA 3UJBA 3UAYA 3LJKA 4V0ME 2BYTA 2GN1A 2QX6A 3GJQA 4A36A 2OV2A 4RJ2A 1LSJA 5HIMA 2P1DA 4P38A 4O4HB 5E3JA 1D4FA 4KLQA 4QA9A 5CFRA 3KOWA 5C35A 1P1RA 2D2EA 5F9NA 3HYSA 4QWCA 1X8XA 2V74B 3GJSA 3N2LA 4DEYA 2RLTA 5D2CA 5G3YA 5BQ5A 4U7TB 3RBVA 4DB2A 1JEJA 1QBGA 2X1MA 3KB6A 4PSUA 5CMLA 4ZEWA 1CDZA 2FMXA 3NH9A 5HE8A 2JCXA 1SWWA 1CZNA 3EODA 3JQGB 4BZWA 2FPIB 2MYPA 3K70D 2A1TS 2IP1A 1GM5A 3KHGA 1JIUA 1J7KA 3TKAA 1W0JD 3K8QA 2JFXA 3UM9A 4UB1A 4O4JB 3REFA 5IT9A 5CLIA 1CG6A 1D04A 2ZBUA 2H7XA 2ZW9A 3TBKA 3ZV4A 4BGVA 1D8LA 2Q5CA 3L7BA 4Q3KA 1GRQA 1TUGA 1N9GA 9ICWA 1M54A 2PU5A 4YLYA 1UUFA 2WUFA 2CWDA 1G7SA 2BEKA 2IP4A 2ENUA 4OQDA 2EARA 4KQJA 4TYPA 3BF8A 3QUCA 4B7CA 4MWGA 3MFYA 5THXA 5CWRA 3NC1C 2CV2A 4GX1A 4HDKB 1U3UA 1GILA 4O3RA 1U8YA 2SKEA 2X7HA 2CJYA 3CMCO 3MIIA 3O8OA 4I2VA 4PSDA 5DULA 2FPIA 2DLDA 4A1OA 3V2UA 2YXNA 3WAJA 2FH5B 3HLYA 5EFZA 3SEZA 1EAMA 4H4EA 2OCYC 4YJ3B 1AHHA 1MHTA 3V7YA 3J81A 3V7LA 3LBAA 4MJXA 4Z5XA 5L6LB 4OVKA 3I9OA 1HRKA 1PR0A 3DDCA 3KE8A 4EP1A 3RJKA 2YYAA 4L50A 1UKVY 3EPJA 5JU6A 4MR9A 2YDYA 3MLAA 1FTSA 1L4LA 2RBKA 1QB8A 4E15A 3H9JA 3S5UA 1R00A 3CVOA 1OTHA 1OAOC 3EG5A 1N2CA 1N7GA 4Q9JA 1SD2A 5A9SB 3KSAC 2BR4A 4UFPA 1NNEA 4MAFA 4WX2B 5K51A 3CUKA 5IX8A 5JMTA 3NAZA 5D5QA 3RUDA 1QJ4A 2D3TA 2RI0A 2XF2A 2K87A 3GUUA 2X0DA 4MS4A 9ICUA 1PHPA 4YRCA 3FJOA 3MILA 3VYTB 1B2RA 3FLBA 4RV5A 4ENPA 3ZWKA 5DBIA 2AZXA 1YMUA 4OP3A 4YAGA 2OE2A 1C7QA 1M34A 1HYBA 2ZI3A 3NUGA 1Y1TA 2QRKA 4E07A 5KWJA 3BFVA 4CKEA 4HFNA 1G3RA 3T7TA 5GONF 1XCGB 4PSAA 5KU7A 1BE0A 3MR5A 5KNCH 3KNZA 1WKVA 4JOBA 4CI0B 2XBMA 2CXQA 2O23A 1TI7A 2ZP1A 1IOZA 1REQB 4LFAB 1TQ2A 3DBIA 4HXEB 3KE9A 4PHEA 4MMYB 1V5FA 5ALSA 3LUFA 3T99A 1PNQA 5IMBA 3GLSA 5JFGA 2PGOA 1K98A 5DLPA 5AOAA 5GONA 4DNPA 2I03A 2QRZA 4UUAA 3AJEA 3PJEA 3RUPA 4TLDA 5D3MB 5I9LA 2ASLA 1BMTA 5EIHA 3VBCA 3RJZA 1EM8A 1Y7TA 2G9RA 4LYAA 1E9DA 2CW5A 4CMKA 4EG0A 1IZ8A 4QXQA 1JG6A 3OFVA 5E1OA 1Y1LA 3I1YA 5CTJA 4YAKA 1U0SY 1I13A 4P4SA 4Y67A 4CLXA 4RTLA 3DDHA 1WB5A 4JOCA 1N6LA 4PX3A 2HVHA 1G55A 2EWMA 4O5EA 1FUEA 4LOJA 4UB2A 5B55A 5KFKA 1ZR4A 2FUEA 4EQ6B 3EN0A 3ZNOA 5B58T 1ML3A 3L7MA 4B8WA 4CCWA 1Z4QA 2O8CA 3E9YA 4LZNA 3KQVA 3Q8MA 5AOCA 4EYOA 1FDTA 3WGMA 4HGNA 1Q6YA 2E6UX 2W37A 5CVCA 4YXMA 3BGSA 4J1TA 4MV4A 3PQ3A 4UU8A 4WN9A 1N1MA 1U3GA 2XUKA 3AINA 3DMNA 4M36A 4R9RA 1T0BA 2J6SA 5A5VA 3IPLA 5D3KA 1U2GA 1YS1X 4RD1A 3GWZA 4X65B 4LDRA 3LE8A 3NEAA 5IIKA 1B26A 3AHCA 5ITVA 3GJTA 2R8OA 2X77A 2UZIR 3EGWA 4LYHA 4O3FA 4BIIA 4YCLA 4OX9Y 3WKCA 3NIBA 3H97A 4F4ZA 4ECYA 3JQBA 2G72A 1IY8A 1QR6A 2RARA 4TT3D 4YGYA 2G71A 3NBQA 3ZZUA 3B8EA 1ECLA 1NYTA 1DK3A 4MVJI 4U2EA 4BKUA 2XDQA 4YRSA 5C8YF 5JNRA 1LUAA 3RB4A 4MS1A 1WF6A 5AW5A 2HU5A 1NWCA 2FRXA 3RRXA 4DLSA 4MHSA 2F43B 2M1ZA 1M2WA 3C5WP 4MV0A 4RVFA 2DWCA 1D4AA 4ZVLA 3RFXA 3GZNA 1JZSA 1W6RA 4C4AA 1QNFA 1OI3A 4D74A 1WEKA 2YW9A 3ONNA 1K89A 3A8TA 4UM8B 4NDZA 1V38A 3ROKA 5AJVB 1HFEL 3B1KA 3TIIA 1A50B 4CR8A 4TMFA 3TOXA 4ENUA 2YOHA 1DEHA 2FYTA 1T0IA 3QGMA 1P7VA 1ZCJA 2ZSJA 3PC8C 1QPZA 3PG5A 2JW5A 3P9XA 2PQMA 1TRKA 2OC9A 4JLJA 4LDPA 1CNMA 2WZDA 1SL2A 3ABQB 1SQ5A 4G4SO 5EUMA 2JZBA 1ZQSA 4K9DA 4P4NA 1RC8A 4G1BA 4DAOA 4FMCF 4C3UA 5EHQA 1FO4A 1VZ2A 3GOQA 3ROXA 3K0BA 5CYOA 3U17A 1EUDA 2C5BA 3K9QO 4A8TA 3QUTA 2ZULA 5DI3B 2GAFA 8LDHA 4DWWA 3RPEA 4D97A 9ICBA 1R8XA 2CVFA 2R97A 2OBMA 2V4RA 1RYNA 2BM8A 4R5MA 4P92A 3VMFA 4AF6A 4D4IA 4EMBA 1JEYB 2PBLA 4WLEA 1P6QA 2JIZD 4AJNA 1GZ7A 2I7CA 1KDRA 3AEXA 1AIPA 3ELBA 3GCZA 4DV2B 1R0LA 3D6TB 3MYYA 1W9HA 3I04A 3JVEA 1OLOA 3I53A 4PCUA 3JTMA 1O6ZA 1T3GA 3GUZA 5EXPA 2FKAA 1CIJA 3OF5A 3QXHA 1G8YA 3FZNA 2FFQA 2B34A 3GN1A 3NQ41 4JLAA 4OGGA 3E2MA 1AKRA 2VK8A 3MERA 3OMLA 1HQKA 4JK1A 2QLLA 5AICA 9ICNA 2AF4C 1MABB 3H2ZA 3KEFA 1C7RA 3DOIA 2E0IA 4J16A 4PGXA 4LGCA 4MVJD 4O29A 4ZYZA 5BUCA 3UJ9A 5A03A 3GZTB 1C9DB 2HFJA 2GHIA 2J87A 3L49A 4MQBA 3RVLA 3CZMA 5CA0F 2RKOA 1RFLA 2VDQB 8ICEA 2FE9A 4HATA 4PE5B 1UBMS 1DWOA 1AXRA 1RWBA 1X70A 2IOFK 1NU6A 2HHTA 2Z1NA 4I99A 5FJIA 1S2GA 4UHFA 3CWCA 2GTHA 5FBWB 1LLCA 3C1OA 3IRVA 2JZOA 3B3AA 4EW3A 1CZLA 1LJ8A 2QMZA 4A16A 1PBTA 4LHWA 5B3JA 1KF0A 1NR7A 4D02A 1CF4A 1DAHA 3U4GA 4PXYA 5JTUA 1H93A 2RKBA 2IV2X 3TJZA 4M83A 5JUMA 1Y7IA 4DCTA 3B2NA 1W0CA 3EJWA 4MW5A 4D9IA 5JPCA 2AOTA 1GGJA 3LWBA 4RPJA 1CUEA 1DOHA 2FAXA 2QI9C 1R9MA 2Q5OA 1JE1A 7ICTA 2FMUA 2WJZB 3SQLA 1S7GA 3CVYA 1T7PA 3PNVA 2OHIA 4YC7A 5TLSA 1NWHA 1KYVA 1O9GA 1Q20A 5D6NA 2JV3A 2EG9A 3FMPB 3V1MA 1GZ4A 1K8ZB 3SHWA 5AW2A 1LD3A 1NHGA 4IR7A 4HO1X 1NLYA 2FWJA 2VQ6A 1EFVB 1FXWA 1HE5A 2GJSA 3L8GA 2KPOA 2ZVPX 2QTGA 3N2KB 4IDOA 5KFJA 5F3RA 3THRA 3WLLA 4QVGA 1XU4A 1NP3A 3IILA 2CEAA 1JSCA 3LDAA 2JEFA 1SB8A 4FZVA 1E7RA 1LPOA 4DJFC 1FU8A 1QIIA 2KHZA 1WUJS 3U7RA 3AEUB 5A5GA 3AJAA 1DHRA 3FDFA 1X6JA 1J21A 1PBNA 1HUOA 3K0AA 1A8PA 2Z2XA 3QPVA 5T57A 3RUCA 3U9SA 4BO4A 3AQEA 4AN0A 2FQWA 4O4IB 1QM5A 2FZWA 1U2SA 4ZU1X 2G88A 4RX1A 1IAVA 2FFAA 4O4LB 2WV9A 4I5GA 2QDKA 3ZJ5A 3AFOA 1BDBA 5J2CA 1RJFA 5F77A 3UBTA 1QSLA 5EN4A 2X0EA 1HT1E 4TTPA 1KC1A 1USKA 4LDNA 3EAQA 4WIAA 4E6PA 1NR5A 1K5HA 3L1KA 2J0UA 3NS7A 4JV1A 4KOAA 2P27A 2XB2A 4KB5A 4G26A 5ICGA 1XDUA 3IOMA 4P3YA 3UJ6A 4H60A 1V9CA 4B6SA 1YKSA 4PZOA 5JYEA 3I61A 3T4PA 3CE6A 3FLEA 4D25A 5KFVA 1U0JA 5C1PA 2R8JA 4IRKA 1UADA 1EINA 3LTEA 1RBYA 5CB0A 5JWOA 4B45A 4KPEC 4BO1A 1B7GO 2RHBA 1ZIOA 3NNNA 3R3WA 2E4AA 1MENA 2EZUA 4BX9C 4DQIA 1G3UA 5FOWA 1XMJA 1HSZA 5IUJC 4L5CA 5C7OO 1X94A 3DW1X 2YHUA 2DCMA 4D96A 4KQGA 4ZIRB 3TIGA 4YV7A 5D86A 4Y18A 2D74A 4R1PA 4F92B 2DGZA 2C5AA 3TPZA 1YZ7A 4RQ8A 1XZHA 4K6FA 1Z13A 4YWHA 4MWTA 4P86A 3K9CA 3E7WA 3EXG2 4PHHA 3KHHA 1L7QA 1N0VC 2HDNB 2V4MA 2FJPA 1JHDA 2Y1DA 3E8MA 2XADA 3R40A 2IYSA 2ZTCA 3FPKA 4JELA 4KXWA 4Z0PA 5JJ5A 4M38A 1YU9A 2GXSA 3FR8A 3I9V6 4YPFA 1RDFA 5JVDB 5FWXB 2PXIA 1K7EB 2Q1UA 3ZGZA 2QRLA 3AM4A 3GBSA 3SZRA 5D49A 3DE6X 3N58A 1SFRA 1VKRA 1OWLA 2ZVJA 3ASUA 4YRGA 1DOAA 1JA0A 3L46A 1YRBA 3W2IA 2O7NA 3MCVA 5CAEA 1SKQA 3FYTA 1TAGA 1NI4B 1U2PA 1CQZA 1KY5A 3HY4A 4FK8A 4R9NA 3W5IA 5CURA 2DJ5A 3CZQA 2BPFA 4JJZA 3T41A 5EMMA 2CLHB 5B58C 2D2XA 4R83A 4G0WA 1ZRNA 3CJRA 2UVWA 3PU6A 4YAOA 1G7TA 2JIOA 1JDTA 1I2AA 3HBJA 3IMKA 2PL1A 1VIMA 1DGJA 1AQNA 5KWVA 1NJWA 4JWNA 3H5RA 1S5PA 4PEVA 4AJPA 3M3PA 3GWGA 1RLUA 4ZGGA 1CBUA 3M1IA 4FD2A 1MJFA 3EZGA 1U3TA 1GPMA 3ULKA 2C2HA 2ODEA 2QT0A 1T2UA 5DBAA 4WFQA 2O0JA 3BQ0A 1U28A 4JT2A 1IDOA 3IBSA 1D7OA 1PAUA 1XHFA 1ADFA 1XOIA 3AVTA 1Y3DE 5DXAA 4Z3KA 2JHAA 7ICQA 4BFXA 4HNRA 1ZVVA 4N82A 3NH6A 1KI6A 4NJMA 1AMUA 3THWA 1EBUA 5ITZB 4GSLA 2GX6A 1UBSB 4BNLA 2ODWA 3T7SA 2GNPA 2X19A 1FFSA 2Y77A 4V39A 3SJAA 4RXUA 2X9NA 1W581 2CYCA 3RS0A 4B80A 1B22A 2PWZA 1HORA 2JBAB 2IE0A 1I36A 4D5GA 4FWTA 3I72A 3KXLA 4PIMA 2FMQA 4R05A 1ZQBA 2HA5A 4PPFA 4N7JA 3TTTA 1C9MA 4EHJA 3KQHA 4AY6A 1PFWA 1L1FA 3HZHA 1EDBA 1M8GA 3BT7A 5GM1A 3NYQA 3DFZA 5BYJA 4CODB 4LTNA 3V7WA 1EA7A 5KJ1A 4A8PA 4DHWA 1Q11A 3EARA 2ZJ7A 1VCOA 4O4IF 1CYDA 3TKLA 5IJ0B 2BTQA 1WMAA 2R6AA 4MPTA 4XQGA 5HFAA 3QE0A 4LFBB 1XLVA 1CB7A 1XC9A 5KFMA 1NKBA 4R16A 2Q5HA 3ILVA 4HX5A 4OXYA 6NULA 1A9PA 2KVSA 1GAJA 2O9JA 3L8HA 3BJMA 3O4FA 3QEOA 5EGNA 1BA2A 4QTYA 2E5SA 3HFJA 4D46A 4YRMA 1SELA 4YR0A 1XRLA 3LP6A 4I1PA 1F3OA 2VDKB 1A9SA 1C1XA 3BIOA 4FINA 3RSCA 2R3SA 4DLRA 3PKIA 4FFVA 1CYEA 5EQFA 3SFVA 3EX7C 1V85A 3EQ7A 4MIOA 5DTIA 4ZQFA 1E2QA 5BT9A 4C14A 3GV7B 4LVSA 3BMCB 3ZTWA 2ZBQA 1R0XA 5ITSA 1OQAA 1UMBB 3EULA 4DA9A 1GEGA 5HXAA 4YJFB 3OHAA 2DHRA 3H2SA 2VUIB 2I4IA 4C7XA 5KNDA 2GN6A 1FTQA 2X9LA 4KVAA 4FHZA 1UA1A 4NNOA 4RJLA 3C8MA 4X3PA 1P4JA 2XUPA 5AXAA 4O3SA 2IU6A 2FR1A 4GGPA 3AHHA 2PTGA 3RFVA 4F86A 5BP7A 2JRCA 4QYIA 5JS1A 2H1HA 1TK9A 3EAFA 3OQMA 4J9SA 1K7CA 3UMRA 3DCIA 2LW7A 3JALB 3PVXA 2HMTA 1SVSA 1PV1A 1UT5A 2GZSA 4OQ4A 3W3AA 4EPTA 1U2RA 3BCSA 3M4NA 5CLQA 3H0KA 4JUFA 1EZ1A 3PSIA 4LY9A 1KJYA 1B8OA 1SL1A 1ULUA 2XWSA 3M6VA 1JHZA 1KIAA 3G6VA 1K2VN 3AETA 4OUKX 3CYMA 1LC3A 4RLSA 4AYXA 1DMSA 4DJTA 1QSYA 4WBNA 2JKYA 2BI8A 4FKBA 4OMUA 1NN0A 1S2LA 4O3PA 3W5AA 3O4RA 1NBWB 2IODA 3X44A 3HJBA 3WGOA 2XNJA 3UMSA 1Z5ZA 2GLTA 1EFKA 2NNLD 2OENG 3F5SA 1H6AA 3G82C 3NJ4A 5FCDA 5AW0A 4GDMA 3TLXA 1Q1QA 1L5FA 1A9YA 2WWGA 1PK1B 3JPOA 4RD3A 4W1SA 1IONA 2OSVA 1U2QA 2NV2B 3L9WA 5E6SA 5LZ7A 2ZXIA 3ILHA 4J4TA 4KLIA 4JI6B 4CR7A 4UPEA 4R66A 2C20A 3QFSA 4EH1A 2XXBA 3H9GA 5GGYA 2JI7A 2LCFA 4K9OA 1ODFA 2D5CA 2GS9A 3WL5A 4KN4A 2IXTA 2IXEA 4RA6B 3FX2A 3Q8SB 2O2DA 1V11B 1JG4A 4KE6A 1ULBA 2BEWA 3VAYA 4AN4A 2QAGA 1I33A 4X61A 4MIYA 4PFQA 3LZCA 1W2GA 3KT6A 2CLMB 3VI4B 5DGXA 5KFXA 5IU6A 5F2OA 2YV3A 3LOUA 3GCWA 3RK4A 4E3ZA 5C46F 5E1BA 1XTUA 1TZKA 4KLZA 2YASA 3NBMA 3ZC3A 1O87A 1CETA 2JFFA 3G8CA 5I9NA 1L7MA 2XX3A 3SBEA 2YIMA 1V16B 4QJ5A 3UHFA 5F5NA 4G1EB 1BNOA 2PKQP 3JVVA 1MAVA 2PJZA 3MJFA 1PO7A 1IVSA 1YB7A 2DPHA 4FHCA 4B7AA 3OPXA 3MD0A 4DJEC 4EFMA 2IU3A 2H1SA 1ZQUA 2P7IA 4WWHA 2XDYA 3PDHA 3KB2A 4ZQBA 4RQ2A 3R3HA 3C85A 1DEKA 1J8VA 3F2DA 2P35A 1BHJA 4AICA 3GT4A 3RIHA 3OF2A 3P9CA 3WOVA 2G77B 1KQ3A 4L02A 4ON9A 2QUJA 4X44A 2ALZA 2FMKA 4ONEA 3BH7A 5LOVF 1I3LA 3MAJA 4C7KA 3PVCA 1FTNA 2G4LA 3GP5A 1XNRB 1AH2A 5EWMB 4GI3A 3UTCA 4EBFA 3HK2A 5AO9A 4YDQA 4BLVA 4BNJA 1DBVO 4AP9A 1Z28A 1UA0A 3L0BA 4MSUA 3SENA 3G7UA 4J0DA 1DRGA 3UWOA 3FUVA 1P2UA 1GPJA 1LBEA 3IXMA 3O03A 4K5QA 3VSEA 2IEDA 4NS1A 3ZWBA 1MF7A 4EMSA 5C8YB 3SJ7A 3JAWB 3LBFA 3DM5A 1T94A 1J20A 4UBLA 3VHQA 3M4ZA 3TI9A 1PNRA 3IO3A 1ZMRA 4W5NA 4B5KA 3TLMA 1U0GA 2WB1F 2GEUA 3F1LA 4WK2B 1KAEA 1EFHA 3M5CA 3PNQA 1AQUA 2JFQA 4PLVA 2GPBA 4BC1A 4WBNF 3NALA 3OZTA 1W9MA 5KOIA 5KTPA 1U1FA 4P08A 5ALPA 1W88B 1X77A 3G88A 2C7OA 1GUDA 3ABSB 3G6WA 1RKBA 5TVGA 3SPXA 1X2IA 1D03A 2Y1XA 4PHGA 5H16A 2AV6A 3JPYA 2IX3A 2Z43A 4O1MA 4ZYWA 1TAHA 1E2IA 2PANA 4Y2GA 5IANA 3U4QB 3GJXC 8ICIA 3C2KA 3CQ9A 1XK6A 2VXBA 3NYWA 3OETA 4KI0A 4TKVB 4V3BA 1V1RA 2JGDB 5KMGB 2QTAA 4BMXA 1M6VA 4AI6A 2IV7A 3KB1A 4ZOAA 1KZGB 3ONEA 3OT5A 3I9JA 1KL7A 1LZLA 1MW9X 1QVAA 2B3DA 4IDFA 4J0CA 5K3DA 3FYHA 1K3TA 2Y9MB 1QE5A 2LDXA 1H2BA 3E0QA 4BZQA 1V95A 4DQRA 4GFJA 2O50A 1BPBA 4C07A 3L1HA 3BZBA 3DBHA 1ESNA 1G20B 3HVIA 3EWAA 2Q5QA 4YDRA 3WYGA 1U9ZA 1HKUA 1OUQA 4A27A 1NLUA 1UC5B 3HN2A 3QIAA 3L77A 1MO4A 1ZFNA 3PWSA 1FTWA 1QG4A 3R6LA 1G59A 1GO3F 1SXPA 1JDJA 5AR1A 2C3YA 4DSUA 1ZJZA 5CB4B 3GV5B 3BDIA 2HQBA 4H3SA 5F5LA 3GGDA 2GI4A 2JGMA 5A5EA 5BR8B 3KYDA 2OOSA 5JASA 2NW6A 1ICIA 1AB5A 1FB5A 1UMCB 2ISSD 1Y6GA 4B85A 5BMVA 4E11A 1KK1A 2P40A 3LWLA 4F85A 1GEEA 3KV3O 3NEYA 4DS3A 1SCAA 1CQWA 2WYOA 3QBEA 4YMNA 1A04A 4CFSA 3WK9A 1NUSA 1KTIA 3ZH2A 3JAMA 2BTOA 2XAAA 5J2AA 3K70B 1G7RA 2I6UA 5CDYA 5L40A 4C8LA 1WIWA 3EFEA 1P2FA 4KNVA 1TT7A 4MVYA 5DPMA 3W1WA 4D9NA 2YIJA 3D6UA 5ALRA 2RHCA 3V8VA 4HMQA 3UG7A 1WSBA 1CUFA 2P3SA 2W4QA 5EZYA 4FWBA 4KYUA 3O73A 5KSZA 1UJ4A 2ZROA 2AXTU 1MC4A 1XMPA 3SBDA 1Y3CE 2R6HA 1NA5A 5TS3A 3FTFA 1NK8A 3CIFA 4N5HX 1X2BA 1X2EA 1R18A 1ZD9A 2EFGA 4K46A 5DK4A 1JEEA 1K5GA 3VPGA 4E03A 3I5UA 1TPYA 4O33A 2QX8A 5C8YA 2PMCA 2HSZA 1EP3B 4ICAA 1IATA 2GZDA 3HLKA 5HBGA 2IKQA 4A8JB 1U5BA 4MAAA 2X0FA 3OCVA 4GOJA 2E6KA 2JGJA 1NK0A 3PX7A 3RSSA 4K3UA 3P96A 3PUWA 4BE9A 1V9PA 3LX4A 4CKBA 5LXTB 3KJXA 2SNIE 5K1ZA 2X14A 3HB4X 4LC0A 4U2DA 3HVUA 1M5RA 4LZLA 1OJ7A 4TYMA 3QE9Y 1NVBA 2HSGA 2ZRMA 3PGJA 4FPXA 1NASA 1C41A 1U98A 3GFTA 4R2WA 4TS3A 2V7QD 1Z0FA 2R7MA 1KBOA 3ZGXA 1M2OB 4JQYA 3V8MA 4XWOA 1EVZA 1YZTA 3KDAA 2JLZA 1T8SA 3E48A 2WQZA 7ICMA 2BCEA 2X58A 5AW3A 5T64A 4BTVA 1XTJA 4ZVTA 5K0GA 5PNTA 3BB3A 2AGPA 4Z6DA 1YNSA 1T5DX 1LI7A 5K0ZA 4LWQA 3C8ZA 4F6LA 1GY8A 2JGIA 4X63A 2R85A 4YCSA 1VSQA 3I01M 3R7SA 4MYRA 2VAMA 4IR1A 4M47A 2DKOA 2PX2A 4FEGA 4ZVPA 4LXUA 1NN5A 4AJJA 1I2DA 2JGDA 3VHXB 2QTBA 2P65A 3B1ZA 3EC2A 2I9KA 4BEVA 3M9NB 3WK7A 1XTVA 4F8JA 1FP4A 4EJ0A 3AFGA 2HA6A 4MEAA 2ZSEA 1B8PA 1JR4A 2DKXA 4GW3A 1IJKA 4L75A 4W8OA 3TTVA 1YDEA 2BEWB 4GMFA 4GVPA 5DLQC 1PJRA 2Z9DA 4FYYA 1V7CA 2X5XA 3IHTA 2OO5C 5ALLA 4B43A 4WUVA 1CE8B 4PL1A 4ASUA 3RLIA 3K6SA 2JVKA 3G49A 4A0GA 3AVYA 4M0KA 1WHTA 1WQ3A 1U3WA 1XB2A 4O63O 4BAUA 4DLTA 3KALA 2ES4A 2HRDA 3CN9A 4R1SA 3T61A 4MMXB 3JVIA 2AQ0A 1RPJA 4OATA 3X1XA 4YP3A 3DZHA 3O92A 1PK7A 5KHOC 4PYIA 4OQXA 5DSZA 5K01A 1BJTA 3JQEA 4EUSA 2AX4A 2CC2A 3RSZA 4Z49A 4CYMA 3S81A 4ECZA 4N65A 3FUUA 1C8BA 1VPVA 3F96A 5EP2A 7AT1A 3HLTA 1IYZA 1QDEA 2ARKA 3JTEA 4WV3A 5IBRA 3JQPA 3SJBA 4R9VA 4ETMA 2WILA 5IYZF 2ZEJA 3MG9A 1E2UA 3EFHA 5FI0B 1OLSA 4F3RA 3HMKA 5H80A 4BKMA 3ILYA 1E1DA 2GEJA 3K94A 4CQLA 2F7SA 3QUAA 3FE2A 5I6DA 1NW9B 3SJZA 2A86A 2WAQC 1GWNA 2ACKA 3FPSA 5D3ZA 3OPYA 4D57A 4EBBA 4JNCA 5D84A 1A1SA 1FCJA 3FCSB 2AKYA 4A0FA 1L8XA 2G1UA 4I36A 2X8LA 4F2GA 5KOHA 4EKNB 4G5HA 4KQCA 1PWYE 4IUCS 3I2HA 4ACOA 2GD2A 3SXPA 1E2MA 2WM9B 1WW2A 3Q10A 3SX2A 1P75A 5AVZA 3FNEA 2Z2ZA 4FGLA 1FZQA 1LDGA 3UBMA 3ZDZB 4QJIA 1E3SA 4QIWC 2BM0A 3PLRA 4X7PA 4L15A 3UC5A 2A0WA 3IAEA 1ODKA 4GYWA 4PGMA 3E7FA 2XT9A 3B3FA 1XAHA 3OY7A 1NVGA 2CLFB 4LY3A 5EKTA 1GL9B 2VYND 5F7OA 2Q5JA 4GUAA 4JBWA 4GP9A 4QXOA 1ONNA 4NLBA 2KFZA 4X93A 3Q7IA 3NOXA 4E5KA 5HE9A 2G4VA 5BOLA 5HUJA 3D3NA 2HWWA 4UPDA 2ZT7A 4X84A 1I0IA 2EW2A 3FYUA 1CUGA 2EQBA 3UV3A 4NL9A 4EF4A 3RYCB 5F9MA 3RUAA 3O8LA 4R68A 4TXNA 5I48A 1UPAA 3EW9A 5E3IA 3H5AA 2BY4A 5EERA 3KPVA 4UEJA 1ECBA 3AIIA 1OZAA 3L0ZA 4GLJA 2XOXA 5JSQA 4EY7A 5A4KA 5HJ7A 3L8MA 3U4CA 5MGBA 4R98A 3TZBA 5IWAB 3MC1A 2WKWA 4B8ZA 4F7DA 1U8UA 1X1AA 3MCAA 4WLUA 4H6WA 3EXEB 5K0JA 1JU4A 3BTSA 4WESB 4CG1A 3B85A 2ZPAA 1Z18A 4XIJA 4RU1A 2WWHA 3I73A 4IJWA 5E1DA 8ICTA 4BY9E 3FY4A 3UT0A 2AG6A 1XO1A 2J85A 1BE1A 4E2WA 4Q01A 5F9LA 4I9HA 3VC2A 2IPOA 5I45A 9ICGA 1PR2A 4B44A 3HB1A 2QARA 3H18A 4DL7A 2J6CA 1O08A 5D3QA 1OH5A 1H42A 4A03A 2C2WA 2H1IA 5BWCA 3LUPA 4JSYA 5CXUA 5ITZA 4ZRDA 4Q34A 3E2EA 3PQDA 4M1SA 4NY1A 3RQIA 1WF3A 1G0NA 2CNWA 3RR8A 1EVYA 3C3WA 2FUNB 3OPNA 1G5TA 2ZXFA 4KFRA 5HS6A 2VHZA 3KHTA 2XGJA 1EB9A 2WTNA 4G5GA 5AK3A 1NVWQ 4QPJC 2ZJYA 4XVCA 1QO0A 4AY5A 4BNZA 4CMAA 5ALGA 1Z0AA 3KR0A 4HUTA 3FMIA 1XKLA 4RY8A 1S7CA 4N0DA 2ECQA 4XVHA 5AW1A 4BMOB 1QC5A 2J0QA 1OX6A 3BCHA 3JQ6A 3HYTA 4O1HA 4KW7A 1YA8A 5BNIA 1CJTC 1PT7A 3HI4A 3MWDA 3AF0A 4K6OA 3WB1A 3FHTA 2VHCA 3F0TA 2GN0A 3COPA 2AQ4A 3R09A 2HFKA 1TQ6A 3PFHA 1KRWA 1UPHA 2N0SA 1S1CA 5DM1A 5TGZA 1SC6A 1UM9B 2FWMX 3BJIC 3U49A 5JFOA 3GDFA 2G6BA 3NPAA 1N78A 1JBKA 1TMGE 3ZJUA 2Z2IA 5CDGA 2E4WA 3ALRA 4OP2A 1JDSA 2A2ZA 2IZ0A 2HHUA 2A0FA 1GG9A 3CU5A 3I5AA 4HWSA 4U3JB 4YLEA 4IOMA 1IQ0A 2YHBA 1NTRA 3AL0C 3KL2A 3AKEA 1WDKA 4C8OA 1Q95A 4OQQA 3A6EA 4KQ9A 1G4HA 1GZUA 1LFDB 1FDSA 2QVCA 2ZS9A 5TIIA 1J24A 1WW8A 5G1NA 4B3HA 3QV2A 5GV8A 4JNKA 4U6QA 4XARA 2P7HA 1DBIA 2X23A 2NG1A 4H2DA 5BN4B 4RF4A 7ICHA 4HOYA 4MWOA 2QM0A 3UYLA 2GLEA 2P2GA 2JH9A 1GARA 2XRMA 3FWZA 4MW6A 3ROZA 3VNRA 3TQ1A 4B32A 5HZGA 1NN1A 5L53A 3PGXA 3ODPA 3CTPA 3JASB 4QU9A 2VJNA 1FJHA 5KUTA 4ZMRA 2IYWA 1I4DD 4U2BA 4JAVC 1BXKA 4IF4A 4B4VA 5L7WA 4ZK2A 3KYJB 5L51A 6AT1A 5CT6A 1E9FA 1WLYA 2OGSA 3PC8A 5THKA 1Y9AA 1WZUA 2AYZA 4PHCA 4YGXB 2VA2A 1PZHA 2K7ZA 3DVRX 3JQ8B 1UAGA 3T3OA 3ENKA 4UB4A 1MFZA 3CZAA 1E4VA 5T4FA 1PQYA 2J46A 3QVGA 4PO9A 1RJWA 1R0SA 3A4NA 3I6MA 3VU9B 1U7TA 1N5XA 5EFOA 3GCGA 3HU5A 3NGLA 1E1QA 4QFBA 4ZT5A 3JAKA 2C03A 1GQQA 2X5OA 3LXXA 4JI3B 2B5OA 3YASA 5L4NA 1PP4A 1Q0TA 5F51A 5IFLA 5AMXA 1QCCA 2B8EA 3V4LA 5IULC 1DAIA 5A1TA 1AGXA 3Q87B 4JITA 4B0PA 5ICSA 3P8ZA 2V5UA 1X7HA 1PGPA 1XSEA 3IRUA 2NU8B 5JO0A 4E31A 1SHTX 3WGQA 2OWDA 5I9IA 4IF6A 1MO2A 4L78A 4HD8A 1VL6A 2L2QA 1UOEA 3P4XA 4L9RA 1O4WA 2AK3A 3HHEA 4P54A 3CO0S 1YVUA 2GOLA 1XQXA 4Q8FA 1HEYA 3W9SA 5C34B 2A1JA 3JWPA 1Q12A 3QKSA 1NM5C 2H4YA 3MBYA 3UFXB 5GJBA 3PDCA 1WTCA 3ZD9A 2OTCA 3HUUA 1C2YA 5FR1A 3Q8WA 3RRFA 3KTQA 1IHYA 2UVQA 4RH0A 5C7LO 4J9LA 2WYUA 2GEDA 1L5YA 4QU0A 5KKCA 4R8MA 3HXQA 4KFCA 5HGJA 4ZHQF 4IWYA 1ZM9A 1GGEA 1M1YA 3TZQA 1DKNA 4CF6A 3VRHA 3GAFA 2MSCB 5B3JC 3U26A 1QO0D 2C61A 2FDCA 1EX6A 3CUEF 1JFFA 2KZ3A 4YRJA 4WVLA 3NVZA 1CR6A 5EWLA 4DQQA 4S12A 2RK4A 2DUWA 2PGXA 4IDHA 1ZICA 2WTEA 4HR7A 1SOMA 5DRYA 1MD9A 4QJ4A 5FQOA 3UKOA 4UQOA 5FBHA 3LSYA 2BHNA 1F1BA 1GPBA 1VLQA 2GBLC 3EIOA 5AM5A 4NZOA 1KJIA 5TQVA 3EPLA 4PPGA 3S3TA 1RAGA 3T35A 4H1VA 4FW8A 1A9QA 3FMFA 4JD5A 4GR5A 3MUOA 3IX7A 2CWWA 3TSYA 3E27A 3MR3A 2VRNA 2C9YA 4LNAA 1I10A 4M7WA 5E8RA 4ZARA 3TIXB 5DMHA 2D06A 2K5UA 2GWRA 4HB2A 3MWFA 1QHGA 4JP3A 5ARDA 3PUYA 3IL2A 4B2IA 1Y5IA 3CF4G 3L4JA 2GF9A 3TLYA 1A1VA 5G0SA 2LKCA 1QHEA 1WX1A 1BQ4A 2F9LA 3TTXA 1R5BA 3WHIA 2OO5A 3R5HA 2RH8A 3A1VA 4HNAA 4FBMA 1G21A 4QFMA 1SM4A 1QZZA 1UXIA 2OBXA 5FAXA 3PPVA 2CUKA 1K86A 1A0OA 3GJ3A 4UBNA 1QTMA 1CWUA 3BB1A 1WWKA 3N97B 1E5XA 4I8DA 2WP0A 1BGXT 1Y9ZA 3IEXA 1CR2A 3UMJA 4CLDA 5J2UB 5KVCA 1AVTA 4O4IA 4NNPA 1XSPA 4QU8A 1OYOA 4EECA 3LPCA 2QRHA 4FDLA 3IVRA 4UB3A 4XSHA 4LWOA 1WXEA 1ZSNA 4FFBA 2PSEA 4DXHA 4JYZA 3AEUA 3VC7A 5JEEA 4C4XA 1N2SA 2OC4A 4GPZA 3VYSB 5KFLA 1LTQA 1P31A 4F71A 5BR4A 4B3CA 2QU7A 1LBSA 3DP7A 3EZNA 3FWPA 1V9SA 1Z4PX 2PGIA 4WLVA 1KI8A 4H1UA 1YV9A 4W9RA 5CD9A 1GXSA 1HQYE 3PGKA 4XCXA 4YYZA 2C00A 3CZPA 3MLBA 1QCDA 4L72A 4YHHB 3I9KA 3U9TA 3IXQA 5LYJB 2QUZA 1UC8A 4BVFA 4MYSA 4HMOA 3B5IA 1TMOA 1UKCA 5EUQB 4Q9DA 5HHIA 4L5BA 1PR4A 5EZ5A 4FKZA 4IDBA 3FHJA 3P9PA 5G0TA 2DTXA 5J0SA 2XCLA 1YCDA 2VF4X 4MVXA 3MCTA 4BFYA 5HKKA 3NXSA 4BASA 2VHJA 4BQEA 2R6R1 3KO8A 1ZUHA 4BAZA 1IRXA 1LX6A 2HY7A 2IE8A 4PM4A 2W3SA 1Z62A 4IYJA 4LF6B 2FVXA 1UFKA 2IOFA 1X7YA 2WVHA 4JMPA 4UFOA 2G8NA 4TSRA 3CR7A 1TLTA 2X8WA 1CQIA 2HCBA 9ICVA 5JG7A 4O59O 2KIVA 2AD1A 5BYBA 1C8VB 2RGXA 3CWZA 2OM2A 4PRYA 4UREA 5SZHB 2YH2A 2OCLA 3I23A 3N7RC 1QONA 3IR6A 3ADBA 1QV7A 4UHBA 5DBGA 1Y80A 3A6FA 2QUHA 4CN9A 1MG5A 4X6YA 4RQ0A 4L7QA 1N5WA 4BVAA 5I47A 4W5QA 1LSUA 3ZE8A 2QR3A 3BB4A 4YCJA 1ZS9A 2R8IA 1AHIA 3LOQA 1TYEB 3PTLA 3MMPA 4DQSA 4Q3NA 3MJDA 4C0JA 5AVSA 4ND1A 2O5EA 2HBKA 1FS5A 4UCWA 1FNDA 4I50A 4UOEA 1PQUA 2FA9A 2A5DA 2QGZA 1VIVA 3P2MA 4CQMA 3H13A 3INTA 3PLNA 4MNTA 2Q8NA 4GR9A 4QATA 2XNCA 5TDHA 3FOCA 3G9UA 3UH1A 3FJ1A 4B7ZA 1Y82A 3TRIA 3SGLA 5HVNA 4EZ9A 2PH7A 1ZQKA 3A7DA 4P4SB 2GM5A 3BHIA 4GMKA 3R75A 3TTSA 1Y5MA 3V8QA 5AKEA 4OM8A 4PINA 2ZCJA 8ICAA 4H4DA 4KLAA 4EYKA 1MX3A 1V6AA 1LLFA 4E5PA 1OAKA 3H1BA 2A1TR 5IARA 5BRJA 5AHXA 1SKRA 2Y1WA 2O4CA 3WNDA 4J90A 4NLZA 1UDBA 2FTKE 4TYNA 2CF6A 1BHO1 1DWUA 1N5MA 3EF1A 3S1LA 2QZ4A 1JQKA 2D62A 5GONB 3W4IA 1EGHA 2FLWA 1FX0B 2VZ9A 1E3DA 3TGLA 3IDWA 3K09A 2EX0A 3IIJA 5J3JA 1T6ZA 2RC5A 1RM4A 4TVSA 5J29A 4TTIA 4M0EA 4G24A 2OVBA 3CY6A 4I1RA 3S1AA 3IVCA 4L8YA 1T13A 1IOLA 5G1PA 5FF9A 5BNZA 1WCXA 4R8VA 4S1NA 8ICSA 3ANNA 1LPMA 3FDZB 3RD5A 4DEXA 1C8LA 1NULA 1U9JA 1Z0KA 3LW7A 4EA7A 1JJ7A 3CKLA 5CXQA 1QKIA 3QUSA 3L4SO 1P1KA 4R8SA 4YP6A 1DZIA 3H9BA 3N2YA 4DNQA 1QB7A 2H2GA 3EQ8A 3KLOA 3HCBA 3VDRA 1HDZA 4H7EA 3R5FA 1W7AA 2RGRA 5KTYA 5E8JA 3FNGA 1WL8A 3MPOA 1ZJ6A 3Q85A 4DNXA 5LQJA 2EFYA 1GRCA 4UEOA 3VV2A 2BGTA 4RTKA 1KO4A 5FTWA 1TVAA 4W4TA 1OV6A 4IDDA 3PS9A 3PFGA 4MGZR 5G40A 4Q9NA 1TIPA 4JC0A 2FFJA 4KPYA 4BMDA 4CF3A 5HM6A 1DO0A 1TLLA 1QIFA 2PSFA 4FCVA 8ICOA 4GXTA 2QVBA 1JDUA 1K6EA 1E69A 3CH6A 3DFFA 1QZXA 3M4XA 2PX4A 4YRAA 3WLNA 2QB0B 3HYCA 2AFHE 2IYYA 2QI9F 5EINA 3OTWA 5JAPA 5FBKA 3KSBC 1JFRA 2AEJA 2V9PA 5FI5A 5G2OA 3T5KA 4KDFA 2FR8A 4GIBA 1T35A 3SF8A 5C80A 2FKNA 2V03A 3G8DA 4M9CA 5HKAA 2WZBA 4E5YA 4YCBA 2IHKA 3JD3A 4JLVA 4XSGA 3BBLA 5BSUA 1MTZA 9ICQA 3CF2A 4FNMA 4NU0A 4TV9F 1NDQA 4R2MA 4PJ0U 4ED3A 4DV7B 4G5XA 3ISTA 4RDHA 2Y4NA 1BWSA 3DT9A 1AS3A 1KY3A 4H16A 3CZ4A 4UZSA 5FWYA 3IKMB 3KHKA 1VMIA 2BMJA 1I2CA 4MVJH 5CIYA 4WJ3B 2CUNA 3CH4B 1VJGA 1AKTA 3FCYA 2YS7A 1D07A 1JXAA 4MGEA 2PZFA 2NPOA 3G8YA 2NRVA 3I05A 4ZQIA 4OM7A 3LDFA 2P6NA 3R7DA 1YR6A 2QJOA 3HJFA 1QBKC 2C59A 1YB1A 1XL0A 3EUWA 3GRCA 4UDNA 1RADA 3A6PC 5CNMA 3K8ZA 2VNKA 4QRIA 1S2NA 4O2BF 3D3JA 4R6WA 2LYHA 2TECE 5BWMA 3ETLA 1OOEA 5EE3A 1VI6A 1U1IA 2F90A 4Z8YA 1KEJA 3PW7A 4CQNA 1QX4A 2JARA 3HDHA 1LRKA 4F9GA 5F73A 4OHYA 3DL2A 1YS4A 2FSFA 1AKEA 1IN4A 1W46A 1F2VA 1QQTA 2W54A 2E37A 2V8BA 1N3YA 3P2IA 4KRXA 5DE3A 5HDQA 2REBA 4RKWA 4DVJA 5KO2A 3QPWA 1E5QA 1ODSA 4ZT2A 2FPOA 1FFBA 1MOZA 3PNCA 4OFZA 2HRBA 3T3MB 2ZM5A 4DR5B 1K1SA 1M1YE 5EJ5A 1T1IA 1MBZA 3HGQA 5FNZA 1RKUA 1FFEA 4KLRA 1JLKA 4K9RA 1K06A 4O8CA 2ZZMA 1X7DA 1YH3A 1SKUA 1CULC 4E1VA 3I8XA 2JDIA 2Z2KA 4ECUA 2C9CA 4Y0NA 4CM9D 4ZDKA 1MEEA 2D6FA 1DKMA 1E9SA 2OAGA 4IRDA 2Q6OA 4MDYA 4ZEXA 1BKYA 2EFDB 4DJJA 1NBOA 1ZUNB 2O06A 1E5LA 2GHTA 1S0MA 2R84A 3NAQA 1WYGA 3S99A 3V1YA 5KSYA 5AUOB 5JCPA 3W5HA 2F1IA 2CDCA 3I0MA 1Z74A 3MQFA 4TKLA 3FNFA 4RAOA 1JR3D 2W9XA 3OEHD 2RK6A 3RS4A 3WQHA 1SK9A 1VMKA 2GN8A 1VLJA 2GBLA 1Z39A 4F2WA 1IBKB 3KLPX 3Q40A 3KKAC 1M2JA 2AOUA 2JJ1D 3IB6A 2IA5A 1MR3F 3U13A 1V6CA 2GWSA 3DOHA 3RW9A 1GSOA 1P2SA 1QANA 3RC8A 1B3BA 1F0NA 4MGHA 1BXGB 3U4DA 3MT7A 3ESQA 2UUAB 4HRVA 3TCXB 3WWPA 3T15A 1ZQDA 5FWYB 2AWNA 2JAHA 3PTZA 1J0AA 4Z4GA 4FFMA 3CCFA 1YUNA 5FTJA 3WRXC 2QM7A 4MRMB 2PXCA 1N0IA 1M8KA 5ED0A 5DYGA 3C6YA 5A05A 1N2CE 2CHQA 2D1RA 3T5AA 1EEXB 2ISQA 3OZCA 1G98A 1MN8A 3BMOB 2C3PA 4U63A 1KZ9A 4CHTA 4DLYA 3D43A 2JHFA 4EB6A 3EZLA 3MBOA 1CIPA 1P2VA 2WJPA 1DHTA 4G01B 4TTVA 2D4HA 4PY2A 1V8PA 3WRYA 2Q28A 3PUVA 4RM3A 1E4YA 4JLWA 5C4GB 2H7VA 3ZEIA 5L3QA 3H0MB 3AH8A 3I2KA 1L5GB 5L3VA 1EGMB 1R16A 1T0PA 1T6BY 4O4HA 5EZQA 5EJ6A 4RS3A 2FUCA 3CH5A 1HMYA 2G04A 3CUTA 4GZ5A 1D2AA 2HYIC 1RM5A 1JLMA 2ZM6B 3E8SA 2E85A 1UBGA 2P3QA 5KG5A 4JA0A 4XZ3A 2WD7A 4Z8XA 1RXYA 1IXYA 2CJWB 5FR2A 1Q57A 5BV0A 4JV2A 1TZBA 2UZ1A 1JU3A 1XLTA 1PVRA 1FYDA 1VPLA 1EE2A 4FYMA 3BAFA 1MGOA 4BLQA 4OJPA 1P5RA 3L41A 4IWNA 3QVGB 4M22A 4PC6A 4KGDA 1KEZA 1ZQNA 3H11B 3O4HA 5EYPA 5KVSA 5CT4A 2ZRDA 4ISCA 4L8LA 5DBFA 2P62A 2X9QA 3AEKB 4YBZA 3T34A 2PUAA 3ACBA 3B7GA 1PUIA 4M9UA 4LJXA 3X1KA 3SHTA 3DT8A 3KT0A 1YUMA 5TV2A 1KO8A 2C2RA 4PAOA 3L93A 1MT3A 4HH0A 1KI4A 2FWAA 1TT5B 1OXKB 4BECA 2PUEA 1GNVA 3ESBA 2B21A 5JPDA 2AFIE 4X92A 1ZZEA 2JG3A 3KR2A 2WSSD 1O97D 4MYUA 3ZBQA 4GMGA 5KG3A 4OI1A 1SUEA 3TDNA 2VA3A 1QS0B 3HKBA 4M0UA 3S40A 2C1XA 4DCCA 2VZLA 3HV2A 3QA9A 2FWBA 5FA6A 3WZLA 1RLIA 1KFCB 2NNWB 4XX0B 4C6TA 3TKYA 3LRPA 3O8CA 4XKJA 3ETDA 1HYEA 1LY1A 4OA8A 5EJ8A 2W2LA 5K8VA 4BN4A 4MW2A 4RANA 3WAKA 5BSGA 3SLKA 1VMDA 5IINA 2WWRA 3A3OA 3M8KA 4H7DA 3QW2A 4JVMA 4MPDA 5BN3A 4KQEA 3PJRA 3DBLB 3NC0C 3S2GA 3WRWA 2CMFA 1H4TA 4B7XA 1VDZA 1CEXA 3IJEB 1J25A 4G37A 4JU9A 1IBCA 4HAZA 3AVPA 4CQMB 1JWBB 1E32A 2DFPA 2EX4A 2PMBA 3BM5A 3SS9X 2NU7B 4YUZA 1UM9A 2WAMA 4BJ5A 5FPKA 1Z63A 1MH9A 3ANMA 3H7AA 2V3VA 3OBIA 3DVLA 5F1KA 2OORA 4NI5A 3WIUA 1YS7A 2ISCA 1ESCA 4EG5A 4EY5A 3LS2A 4KMOB 1H3FA 2PVSA 3KKLA 3ZV5A 2JLRA 3GLQA 4WT7A 3BH6A 4AZ0B 2HN9A 2FW6A 4EY6A 1F0YA 1EHCA 3MFHA 2IEYA 4URXR 3ZWNA 1CFJA 2NSJA 1KZ7B 2ZWOA 3HMQA 4H7FA 4CL3A 4CKCB 3G9ZA 1YZHA 1GDHA 4RF3A 5K45A 4UBBA 1N6PA 2FZLA 3PFCA 4INOA 4IVQA 4X6LA 2PUDA 3STXA 1SOWA 5AKHA 2PYIA 4S24A 2J6HA 2JFWA 2OKCA 3TZHA 2WOJA 3SYRA 4C8KA 3B51X 5CJPA 6GPBA 4G8JA 4W9NA 1U8FO 1U7PA 3SM9A 1J00A 5FKJA 2J9FB 1NVDA 1IXKA 2DWUA 2WV7A 1B0AA 1UPXA 1VRVA 2DKFA 1I6LA 1ECFA 3B20A 4MX8A 4JLMA 5CHYA 3DH0A 3UWDA 2UXCB 4GOND 4MPRA 1K0UA 1RAEA 3AX6A 4Y1RA 3ZX5A 3WK8A 1JIXA 1ZMTA 4LJLA 4FXOA 2WZCA 1T36B 4NCAA 1ZXXA 2OYRA 1LKYA 2FPPA 4HH4A 4RJTA 5HCUA 2EAOA 2YWRA 4X66B 1LBQA 1LTKA 4YCNA 4FYXA 2PS1A 3QBDA 2P9CA 5LA6B 5I7OA 5JHHB 4IRCA 1KI9A 2CDRA 2R7KA 1JEQA 2PT7A 4O4JF 5I4CA 3K9LA 4N41A 2MMGA 2XY5A 2BFBA 4KXUA 2QG6A 4MA4A 1TEVA 3HYRA 4GYJA 3E0XA 1OA0A 1XEFA 4I8IA 4OHCA 5J43A 3ZVMA 1CVIA 1TTQB 3B48A 4IHKA 4Q4AA 2VHYA 5BW8A 4B9SA 3TFQA 3T94A 2JASA 3GFFA 5C32A 4NH4A 4OKIA 1II9A 1QGYA 1USGA 1SZHA 1TM5E 4OHWA 2YB1A 2XOKD 4LXXA 4B6EA 3GLFA 1BW9B 3Q3GE 2JCYA 2Z9BA 2VPYA 2ZIFA 1JXLA 4YRLA 5A0TA 3EC1A 4ZEMA 2OKGA 1Z3IX 3PK0A 1G6HA 2J3HA 1HGXA 4QOIA 1ISHA 2XCTB 4J16C 2YWHA 4C6TB 4YA6A 2ZS7A 3OWXA 1E79A 1EIWA 1CUKA 4HNAB 1LPNA 3BBPA 4XH9B 1Q1GA 1S3GA 2GYUA 2XECA 3K3PA 5TJHA 3VVLA 3KJGA 4HPJB 3VHRA 3ZGNA 3Q8PB 3AVWA 3SDZA 3S8YA 4O6VA 2JHCA 4I55F 4IQ4A 1TAMA 1DK2A 2WBLC 5AXCA 3U0VA 3MK31 5L9XA 1FC0A 1KO7A 1J06A 1FQKA 2XODA 1OBOA 4UTVA 1DKRA 4UM9B 2I4TA 1YT5A 2QSUA 5SY9A 1Y89A 5FLYA 2NT4A 4JYBA 4TYQA 5AJUA 3H87A 4XFJA 1ABFA 4AS2A 3WWOA 2AWOA 4BKOA 2OXTA 2HJGA 4G56A 1IDN1 2O0LA 2VF5X 3DO5A 1WZIA 4NU8X 4QECA 5A4MS 1GVHA 1EAYA 4FHDA 2XXAA 4EENA 4QXPA 3GDOA 2OXFA 2ZKLA 1VP9A 4R31A 4CEIA 4R2HA 4CMIA 1A4XA 4IIXA 1IU9A 2AQ8A 3EGXB 1RYHA 2D54A 3PFWO 3VH3A 2Z5LA 3ZW8A 4PZYA 2BGNA 4N5NA 5EL0A 4BYGA 2G0AA 1JFFB 1FLVA 4RCVA 2PI5A 1HEUA 1T9BA 1BPZA 1DDGA 1GGNA 1VHWA 3EA5A 4I6EA 3ZWPA 2R79A 1X19A 5TE9A 3ZHTA 3UOWA 3ODGA 4G8DA 4MFCA 1CF2O 1JILA 1Z73A 5GGXA 4RCYA 1BXRA 1YHYA 1WZ2A 2ETXA 3OCJA 1RXCA 3IERA 1T5LA 3H05A 3UFXA 1JMYA 1GT91 3THXA 2V4ZA 2I2CA 1C3VA 5J0RA 2GNAA 2FWIA 4LDZA 4YJ2A 1WSAA 5EHGA 3C3YA 3EQ9A 3OX2A 1DINA 3R7BA 1JMSA 2A33A 3CSUA 3LDGA 3SXUA 3O83A 2WZQA 4HXFB 5LDHA 5ICMA 2II6A 1FW6A 1PGOA 1E63A 2BFFA 2O1SA 3PUZA 1M8JA 1YZNA 4RGYA 1SKBA 1IZYA 1ZD1A 4GU5A 4H77A 1YE3A 1OXVA 3LP5A 1SD5A 1WVMA 4KCGA 3U4IA 4MIEA 5EPOA 3UJPA 1G8MA 3UWKA 2ZWPA 2Q6IA 3UB3A 2X22A 2V58A 3AV3A 1E6WA 2Q0HA 4TKUB 1EM6A 2QG4A 3CUWA 3TW0A 1BMDA 2COKA 2DXIA 5GVSA 3HDGA 2CEKA 16PKA 2E1FA 3KRTA 5F2NA 1JJBA 4CNBA 1D5WA 2HI0A 4QZ8A 4IH4A 1QJCA 4XGIA 4QGHA 5AVVA 3BTOA 1P3JA 2F4VB 3D8SA 3OLZA 2I2FA 3U37A 3FHOA 3IPRA 1V5EA 4QEDA 2ZIWA 2ZTLA 1NQWA 3DE2X 1PFKA 1PZFA 2C9MA 1VHTA 5LP6C 4IQTA 5EXDA 3FOBA 3RSQA 2PRZA 2R8PA 3SKXA 4DSAA 4M1OA 1WBBA 3LT4A 2FR8C 1T6YA 1KSFX 3CRQA 2ORED 3PGMA 4QYSA 5TF0A 2L82A 3H4IA 3ZHOA 4NESA 4B6PA 3LTNC 3U4MA 2O20A 3BS5B 2IH2A 1MUUA 1TC1A 2DSNA 4G2TA 1KAMA 1LSOA 3BIFA 5DTQA 4A8JC 3C2MA 1QO9A 4GRDA 3RU7A 2HLDA 4LMBA 2KK0A 1JYSA 3J7AC 1T8WA 2Z3ZA 3T95A 5E9JA 4XVUA 1J0CA 1H6DA 1JROA 1AKYA 1DX9A 1SUWA 4FBLA 4QBIA 3A3PA 2XZOA 2I66A 5MN4A 1JBQA 3QV1A 4WY5A 2X1LA 4CMEA 4BAGA 2FW9A 3D31A 3QFHA 3PA8A 3GFBA 2C2KA 4NF2A 4DV0B 4U2FA 2VRCD 2FQQA 5FBVB 1AE1A 1JB9A 3LHKA 4IDPA 4J0JA 5E95A 2IPNA 3ERCA 4IQVA 2Y05A 1G4AE 1HDRA 2C9ZA 5CHGA 2MSDB 4OTZA 1ZD2P 2XY6A 2B5WA 4RAQA 4LGYA 5H3HA 2QTWB 5JCOA 3G5LA 3IMEA 3L04A 3I3OA 5EMLA 1HQCA 1YOBA 3T5HA 4YMMA 4KITB 4H4CA 4L4XA 4E12A 4E94A 4BRZA 2CXYA 3OM9A 1P0FA 4Q12A 4TTSA 4ECRA 2OH2A 1L4GA 2CPRA 1W6UA 3AI2A 5J0OA 1Q3TA 1GLGA 1ZQQA 1J8FA 1WABA 4YT8A 4DQPA 1WUDA 2GZRA 5J1TB 3KTOA 4BVKA 5IUNC 3IE1A 1OYYA 3P9KA 2WAAA 5BV8A 1AXEA 3BXHA 5ILGA 2GDZA 2Q0ZX 3ZWMA 8ICWA 5EJ7A 4WOBA 4RNMA 1V4NA 2W11A 3EPIA 4AZWA 1YCGA 4M0LA 2CSXA 2BPOA 3VX4A 4Q7QA 4H9GA 4A7PA 4ZCMA 1IL0A 4IMRA 3QTLA 3IP8A 1FDVA 2H8GA 2XUHA 4RQ3A 2ZUBA 3T8YA 1KXZA 2IYFA 4ZDJA 4RTMA 4D1YA 2J9RA 1CD5A 4YFYA 3TW8A 1R9JA 3PDIB 4J29A 3L7IA 5DJ5A 2ATVA 4CE6A 3IIKA 2HK6A 3ZK7A 4EDFA 3IS3A 4E70A 5AUQA 1NNSA 2AL7A 1K08A 4HAIA 2FPGB 5K05A 3LT2A 1C4WA 5BPCA 1WCIB 2XMZA 3EVEA 4HLQB 4ITVA 5NULA 4CGYA 4CT5A 4YCAA 5BYKA 1X42A 2DFDA 2NO7A 5DN6D 2NACA 5K3OA 2ATLA 2ILTA 4QPNA 4W8GA 3EXFA 1XCMA 5F78A 8ICLA 4U7HA 1XMVA 2JLUA 5J4KA 2VDPB 3ZXUB 1U8AA 5MFZA 1CDEA 4K4HA 1M6VB 1SXJC 1IUNA 3ER6A 3PKZA 3R77A 1G2QA 5EY5B 2VP4A 3P19A 1ZQ9A 4KUHA 3ZY6A 3ML1A 1KZHA 3IE0A 1Z4NA 1LBIA 2Q2VA 2NXJA 1JW9B 3RSLA 4C80A 3E7PA 4UE2A 4NU6A 5B1YA 2OSBA 1T8PA 2JA2A 3M9XA 1PK8A 3MS7A 3VSBA 4N3BA 3U7QB 3ILXA 3F2BA 1CB0A 3WL6A 2WF7A 4ALIA 3F9RA 1G0OA 3RANA 3ISVA 4X6XA 2C78A 3SIWA 1WR8A 5EOVA 2GJAA 5KC8A 1ND5A 2F8MA 5BSHA 2IUSA 1T3NA 3P5BA 5JIBA 3WGTA 4I2DA 2ZJ8A 1LV8A 1HIWA 1KK2A 2BBTA 4MCIA 5KFIA 1K6XA 5IN5A 4LQDA 5DGTA 3UJCA 4HB4A 4LISA 1Z4LA 5G5HA 3NBFA 2DKZA 1MG0A 2UVUA 4ELTA 1KFJB 2WC1A 5EWGA 4GLOA 4GMXA 4RIEA 4UQGA 5IK2D 2WPDD 1IHPA 4LI0A 5JT1A 1GPWB 3RYFB 3KD3A 4BVLA 1OV4A 2QL9A 2QP4A 4HNHA 1HXHA 4JH0A 4R8UB 4GVXA 5EHIA 4DIBA 5LOVB 4B40A 3NO4A 4UBOA 2F3TA 1J2NA 1XAGA 3O2QB 3ROMA 3S7TA 1CJBA 4YRTA 3GIKA 1G21E 2EL7A 1VHDA 1DAKA 1PVPA 1DQRA 4BUGA 2HF9A 4IWXA 3WYNA 1EE9A 3MGIA 3RIYA 4MITA 1WKCA 1DZ3A 4UUNA 2Y0PA 4PYLA 4URUR 4ARZB 1SCDA 1SKWA 1UBHS 3NJRA 4DOMA 1YQEA 5FAKA 1Z7WA 3LKBA 4CTNA 3DD1A 2VUSA 4B3IA 1M3SA 1CEZA 2J30A 3EVGA 1ZUWA 1WXFA 1O96B 1YR1A 4GM4A 1Q1ZA 5IW8A 1IG0A 1W8IA 4AB1A 3IPCA 1T3HA 4DQVA 2IIPA 3BFXA 4WECA 2A14A 1ZI8A 1K8YB 4JLOA 3NVYA 2WUEA 2IY7A 3IURA 4KO1S 4BDTA 1N32B 3BQNB 4KPUA 3MGBA 1GTL1 2GVNA 1X14A 1NBME 4QUGA 5CFZA 5JXIA 2I91A 5ANRB 4DOAA 2JHDA 1BN6A 3CLSD 4IMPA 3LYAA 4Q21A 4HYTA 3QMMA 5GIPE 2V3WA 1Q7TA 2C9BA 4XPZA 1GAEO 1TYAE 5JD5A 3E7DA 5ILOA 2QE7A 3BHNA 4QPCA